4YQ2A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
248
structure length
236
Chain Sequence
b'RGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 67
structure length 236
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq2A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq2A01
5CO4A 4KDZA 4CNGA 1UALA 3AI9X 4YQRA 4YQ0A 4H3ZA 1K3RA 3E5YA 1IPAA 1O6DA 4JALA 3AXZA 2V3JA 4YPYA 4YQ6A 4YQOA 4X3LA 2HA8A 4L69A 4YQKA 5GMBA 1TO0A 4YPZA 4IG6A 1V2XA 3IEFA 4YQ9A 4YQ4A 3NK7A 2QMMA 4YQGA 1NXZA 4YQDA 3N4JA 3NK6A 4YQBA 4FAKA 3AIAA 2EGWA 4YVIA 4YQ8A 4YVGA 4H3YA 5D9FA 1Z85A 3N4KA 3OIJA 2V3KA 4YQIA 4MCCA 1J85A 1NS5A 3BBHA 4YQ3A 1P9PA 1MXIA 4X3MA 4MCDA 4YQ2A 4RG1A 1X7OA 4YQAA 3BBEA 2QWVA 2EGVA 1OY5A 4YQTA 4YQQA 3OIIA 4YVKA 3KTYA 1VHYA 4YQ1A 1GZ0A 3QUVA 2Z0YA 3IC6A 3KW2A 5GMCA 4YQCA 4YQLA 3BBDA 4J3CA 4E8BA 3OINA 4YQNA 4YVHA 4YQ5A 3KY7A 2YY8A 3GYQA 3ONPA 4YQ7A 4YPWA 4MCBA 4PZKA 5FAIA 2O3AA 1UAMA 5GM8A 4CNEA 2CX8A 1VH0A 3O7BA 1V6ZA 1X7PA 3KNUA 4CNDA 4KGNA 4YQPA 4CNFA 1VHKA 1ZJRA 1UAJA 1UAKA 3L8UA 4YQSA 4JAKA 4YPXA 4YQJA 3DCMX 2I6DA 4XBOA 3ILKA 4YVJA
chains in the Genus database with same CATH superfamily
5CO4A 4KDZA 4CNGA 1UALA 3AI9X 4YQRA 4YQ0A 4H3ZA 1K3RA 3E5YA 1IPAA 1O6DA 4JALA 3AXZA 2V3JA 4YPYA 4YQ6A 4YQOA 4X3LA 1ZT9A 2HA8A 4L69A 4YQKA 1JHGA 5GMBA 1TO0A 4YPZA 1WRSR 4IG6A 1V2XA 3WRPA 3IEFA 2XDIA 4YQ9A 4YQ4A 3NK7A 3FRWA 2QMMA 4YQGA 1NXZA 4YQDA 3SSXN 3N4JA 3NK6A 4YQBA 4FAKA 3AIAA 2EGWA 4YVIA 1TRRA 4YQ8A 4YVGA 4H3YA 5D9FA 1Z85A 3N4KA 3OIJA 2V3KA 4YQIA 4MCCA 1J85A 1NS5A 3BBHA 4YQ3A 1WRTR 1P9PA 1MXIA 4X3MA 4MCDA 1WRPR 4YQ2A 4RG1A 4YQAA 1X7OA 3BBEA 2QWVA 2EGVA 1MI7R 1OY5A 4YQTA 4YQQA 3OIIA 4YVKA 3KTYA 1VHYA 4YQ1A 1GZ0A 3QUVA 4JWFA 2Z0YA 3IC6A 3KW2A 5GMCA 4YQCA 4YQLA 3BBDA 4J3CA 4E8BA 3OINA 4YQNA 1RCSA 4YVHA 4YQ5A 3KY7A 2YY8A 3GYQA 3ONPA 4YQ7A 4YPWA 4MCBA 4PZKA 5FAIA 2O3AA 1UAMA 4FMWA 5GM8A 2CX8A 4CNEA 1VH0A 3O7BA 4JWGA 1V6ZA 1TROA 1X7PA 3KNUA 3SSWN 4JWHA 4CNDA 4KGNA 4YQPA 4JWJA 4CNFA 3KORA 1VHKA 1ZJRA 1UAJA 3G1CA 1UAKA 3L8UA 4YQSA 4JAKA 2OZ9R 4YPXA 4YQJA 1CO0A 3DCMX 2I6DA 4XBOA 3ILKA 4YVJA
chains in the Genus database with same CATH topology
5CO4A 4KDZA 4CNGA 1UALA 3AI9X 4YQRA 4YQ0A 4H3ZA 1K3RA 3E5YA 1IPAA 1O6DA 4JALA 3AXZA 2V3JA 4YPYA 4YQ6A 4YQOA 4X3LA 2HA8A 4L69A 4YQKA 5GMBA 1TO0A 4YPZA 4IG6A 1V2XA 3IEFA 4YQ9A 4YQ4A 3NK7A 2QMMA 4YQGA 1NXZA 4YQDA 3N4JA 3NK6A 4YQBA 4FAKA 3AIAA 2EGWA 4YVIA 4YQ8A 4YVGA 4H3YA 5D9FA 1Z85A 3N4KA 3OIJA 2V3KA 4YQIA 4MCCA 1J85A 1NS5A 3BBHA 4YQ3A 1P9PA 1MXIA 4X3MA 4MCDA 4YQ2A 4RG1A 1X7OA 4YQAA 3BBEA 2QWVA 2EGVA 1OY5A 4YQTA 4YQQA 3OIIA 4YVKA 3KTYA 1VHYA 4YQ1A 1GZ0A 3QUVA 4JWFA 2Z0YA 3IC6A 3KW2A 5GMCA 4YQCA 4YQLA 3BBDA 4J3CA 4E8BA 3OINA 4YQNA 4YVHA 4YQ5A 3KY7A 2YY8A 3GYQA 3ONPA 4YQ7A 4YPWA 4MCBA 4PZKA 5FAIA 2O3AA 1UAMA 4FMWA 5GM8A 2CX8A 4CNEA 1VH0A 3O7BA 4JWGA 1V6ZA 1X7PA 3KNUA 4JWHA 4CNDA 4KGNA 4YQPA 4JWJA 4CNFA 1VHKA 1ZJRA 1UAJA 1UAKA 3L8UA 4YQSA 4JAKA 4YPXA 4YQJA 3DCMX 2I6DA 4XBOA 3ILKA 4YVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CO4 A;  4KDZ A;  4CNG A;  1UAL A;  3AI9 X;  4YQR A;  4YQ0 A;  4H3Z A;  1K3R A;  3E5Y A;  1IPA A;  1O6D A;  4JAL A;  3AXZ A;  2V3J A;  4YPY A;  4YQ6 A;  4YQO A;  4X3L A;  2HA8 A;  4L69 A;  4YQK A;  5GMB A;  1TO0 A;  4YPZ A;  4IG6 A;  1V2X A;  3IEF A;  4YQ9 A;  4YQ4 A;  3NK7 A;  2QMM A;  4YQG A;  1NXZ A;  4YQD A;  3N4J A;  3NK6 A;  4YQB A;  4FAK A;  3AIA A;  2EGW A;  4YVI A;  4YQ8 A;  4YVG A;  4H3Y A;  5D9F A;  1Z85 A;  3N4K A;  3OIJ A;  2V3K A;  4YQI A;  4MCC A;  1J85 A;  1NS5 A;  3BBH A;  4YQ3 A;  1P9P A;  1MXI A;  4X3M A;  4MCD A;  4YQ2 A;  4RG1 A;  1X7O A;  4YQA A;  3BBE A;  2QWV A;  2EGV A;  1OY5 A;  4YQT A;  4YQQ A;  3OII A;  4YVK A;  3KTY A;  1VHY A;  4YQ1 A;  1GZ0 A;  3QUV A;  2Z0Y A;  3IC6 A;  3KW2 A;  5GMC A;  4YQC A;  4YQL A;  3BBD A;  4J3C A;  4E8B A;  3OIN A;  4YQN A;  4YVH A;  4YQ5 A;  3KY7 A;  2YY8 A;  3GYQ A;  3ONP A;  4YQ7 A;  4YPW A;  4MCB A;  4PZK A;  5FAI A;  2O3A A;  1UAM A;  5GM8 A;  4CNE A;  2CX8 A;  1VH0 A;  3O7B A;  1V6Z A;  1X7P A;  3KNU A;  4CND A;  4KGN A;  4YQP A;  4CNF A;  1VHK A;  1ZJR A;  1UAJ A;  1UAK A;  3L8U A;  4YQS A;  4JAK A;  4YPX A;  4YQJ A;  3DCM X;  2I6D A;  4XBO A;  3ILK A;  4YVJ A; 
#chains in the Genus database with same CATH topology
 5CO4 A;  4KDZ A;  4CNG A;  1UAL A;  3AI9 X;  4YQR A;  4YQ0 A;  4H3Z A;  1K3R A;  3E5Y A;  1IPA A;  1O6D A;  4JAL A;  3AXZ A;  2V3J A;  4YPY A;  4YQ6 A;  4YQO A;  4X3L A;  1ZT9 A;  2HA8 A;  4L69 A;  4YQK A;  1JHG A;  5GMB A;  1TO0 A;  4YPZ A;  1WRS R;  4IG6 A;  1V2X A;  3WRP A;  3IEF A;  2XDI A;  4YQ9 A;  4YQ4 A;  3NK7 A;  3FRW A;  2QMM A;  4YQG A;  1NXZ A;  4YQD A;  3SSX N;  3N4J A;  3NK6 A;  4YQB A;  4FAK A;  3AIA A;  2EGW A;  4YVI A;  1TRR A;  4YQ8 A;  4YVG A;  4H3Y A;  5D9F A;  1Z85 A;  3N4K A;  3OIJ A;  2V3K A;  4YQI A;  4MCC A;  1J85 A;  1NS5 A;  3BBH A;  4YQ3 A;  1WRT R;  1P9P A;  1MXI A;  4X3M A;  4MCD A;  1WRP R;  4YQ2 A;  4RG1 A;  4YQA A;  1X7O A;  3BBE A;  2QWV A;  2EGV A;  1MI7 R;  1OY5 A;  4YQT A;  4YQQ A;  3OII A;  4YVK A;  3KTY A;  1VHY A;  4YQ1 A;  1GZ0 A;  3QUV A;  4JWF A;  2Z0Y A;  3IC6 A;  3KW2 A;  5GMC A;  4YQC A;  4YQL A;  3BBD A;  4J3C A;  4E8B A;  3OIN A;  4YQN A;  1RCS A;  4YVH A;  4YQ5 A;  3KY7 A;  2YY8 A;  3GYQ A;  3ONP A;  4YQ7 A;  4YPW A;  4MCB A;  4PZK A;  5FAI A;  2O3A A;  1UAM A;  4FMW A;  5GM8 A;  2CX8 A;  4CNE A;  1VH0 A;  3O7B A;  4JWG A;  1V6Z A;  1TRO A;  1X7P A;  3KNU A;  3SSW N;  4JWH A;  4CND A;  4KGN A;  4YQP A;  4JWJ A;  4CNF A;  3KOR A;  1VHK A;  1ZJR A;  1UAJ A;  3G1C A;  1UAK A;  3L8U A;  4YQS A;  4JAK A;  2OZ9 R;  4YPX A;  4YQJ A;  1CO0 A;  3DCM X;  2I6D A;  4XBO A;  3ILK A;  4YVJ A; 
#chains in the Genus database with same CATH homology
 5CO4 A;  4KDZ A;  4CNG A;  1UAL A;  3AI9 X;  4YQR A;  4YQ0 A;  4H3Z A;  1K3R A;  3E5Y A;  1IPA A;  1O6D A;  4JAL A;  3AXZ A;  2V3J A;  4YPY A;  4YQ6 A;  4YQO A;  4X3L A;  2HA8 A;  4L69 A;  4YQK A;  5GMB A;  1TO0 A;  4YPZ A;  4IG6 A;  1V2X A;  3IEF A;  4YQ9 A;  4YQ4 A;  3NK7 A;  2QMM A;  4YQG A;  1NXZ A;  4YQD A;  3N4J A;  3NK6 A;  4YQB A;  4FAK A;  3AIA A;  2EGW A;  4YVI A;  4YQ8 A;  4YVG A;  4H3Y A;  5D9F A;  1Z85 A;  3N4K A;  3OIJ A;  2V3K A;  4YQI A;  4MCC A;  1J85 A;  1NS5 A;  3BBH A;  4YQ3 A;  1P9P A;  1MXI A;  4X3M A;  4MCD A;  4YQ2 A;  4RG1 A;  1X7O A;  4YQA A;  3BBE A;  2QWV A;  2EGV A;  1OY5 A;  4YQT A;  4YQQ A;  3OII A;  4YVK A;  3KTY A;  1VHY A;  4YQ1 A;  1GZ0 A;  3QUV A;  4JWF A;  2Z0Y A;  3IC6 A;  3KW2 A;  5GMC A;  4YQC A;  4YQL A;  3BBD A;  4J3C A;  4E8B A;  3OIN A;  4YQN A;  4YVH A;  4YQ5 A;  3KY7 A;  2YY8 A;  3GYQ A;  3ONP A;  4YQ7 A;  4YPW A;  4MCB A;  4PZK A;  5FAI A;  2O3A A;  1UAM A;  4FMW A;  5GM8 A;  2CX8 A;  4CNE A;  1VH0 A;  3O7B A;  4JWG A;  1V6Z A;  1X7P A;  3KNU A;  4JWH A;  4CND A;  4KGN A;  4YQP A;  4JWJ A;  4CNF A;  1VHK A;  1ZJR A;  1UAJ A;  1UAK A;  3L8U A;  4YQS A;  4JAK A;  4YPX A;  4YQJ A;  3DCM X;  2I6D A;  4XBO A;  3ILK A;  4YVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...