4YQ2A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
248
structure length
236
Chain Sequence
RGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 67
structure length 236
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq2A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq2A01
4YQ8A 4L69A 3BBEA 1J85A 1Z85A 1UALA 4YQRA 4J3CA 3AXZA 3QUVA 4YVHA 4YVKA 5GMBA 4E8BA 4YQTA 4YQGA 1VHYA 1UAJA 5CO4A 4YQ6A 4YQBA 4YQCA 1VHKA 5GMCA 4FAKA 4PZKA 1P9PA 4X3LA 3GYQA 4JAKA 4YQDA 4KDZA 3AIAA 3OINA 5GM8A 4YQ5A 1VH0A 4YQQA 2EGVA 1UAMA 1X7OA 4YVJA 2EGWA 4YQNA 4CNDA 4YQSA 4YQIA 1NS5A 2HA8A 3OIIA 5FAIA 4XBOA 4YQ2A 3KTYA 1V2XA 4YQOA 2CX8A 4YQ0A 4CNFA 3KNUA 4YPZA 3NK7A 3ONPA 4CNGA 4MCCA 3IC6A 5D9FA 1ZJRA 1OY5A 3BBHA 1IPAA 4RG1A 4MCDA 3IEFA 1NXZA 2O3AA 2V3JA 2V3KA 3KW2A 3BBDA 1X7PA 2QWVA 4YPXA 4YQ7A 1MXIA 3E5YA 4JALA 4MCBA 1V6ZA 4YQAA 3DCMX 4CNEA 1GZ0A 1TO0A 3ILKA 4H3YA 4YQLA 4YQPA 4YQ4A 3AI9X 4YQKA 4YQ3A 4IG6A 4YPYA 4YQJA 1O6DA 3L8UA 4H3ZA 2YY8A 4X3MA 3KY7A 3N4KA 2Z0YA 4YQ9A 4YVIA 3O7BA 4YPWA 4YVGA 4YQ1A 1UAKA 2QMMA 1K3RA 2I6DA 4KGNA 3OIJA 3N4JA 3NK6A
chains in the Genus database with same CATH superfamily
4YQ8A 4FMWA 4L69A 3BBEA 1TRRA 1MI7R 1J85A 1Z85A 1UALA 4YQRA 4J3CA 3AXZA 3QUVA 4YVHA 4YVKA 5GMBA 4E8BA 4YQTA 4YQGA 1VHYA 1UAJA 1TROA 5CO4A 4YQ6A 4YQBA 4YQCA 1VHKA 5GMCA 4FAKA 4PZKA 1P9PA 4X3LA 3GYQA 4JAKA 3WRPA 4YQDA 4JWGA 2OZ9R 3AIAA 4JWJA 4KDZA 5GM8A 3OINA 4YQ5A 1RCSA 1VH0A 3FRWA 4YQQA 1JHGA 2EGVA 1UAMA 1X7OA 4YVJA 1ZT9A 4YQNA 2EGWA 4CNDA 3SSWN 4YQSA 4YQIA 3KORA 1NS5A 2HA8A 3OIIA 5FAIA 4XBOA 4YQ2A 3KTYA 1V2XA 4YQOA 2CX8A 4YQ0A 4CNFA 3KNUA 4YPZA 3NK7A 3ONPA 4CNGA 4MCCA 3IC6A 5D9FA 1WRTR 1ZJRA 1OY5A 3BBHA 1WRSR 1IPAA 4RG1A 2XDIA 3SSXN 4MCDA 3IEFA 1NXZA 2O3AA 2V3JA 4JWHA 2V3KA 3KW2A 3BBDA 1X7PA 2QWVA 4YPXA 4YQ7A 1MXIA 3E5YA 4JALA 4MCBA 4JWFA 1V6ZA 4YQAA 3DCMX 4CNEA 1GZ0A 1TO0A 3ILKA 4H3YA 4YQLA 4YQPA 4YQ4A 3AI9X 4YQKA 4YQ3A 4IG6A 4YPYA 4YQJA 1O6DA 3L8UA 4H3ZA 2YY8A 4X3MA 3KY7A 3N4KA 2Z0YA 4YQ9A 4YVIA 3O7BA 4YPWA 4YVGA 4YQ1A 1UAKA 2QMMA 1CO0A 1K3RA 1WRPR 2I6DA 4KGNA 3G1CA 3OIJA 3N4JA 3NK6A
chains in the Genus database with same CATH topology
4YQ8A 4FMWA 4L69A 3BBEA 1J85A 1Z85A 1UALA 4YQRA 4J3CA 3AXZA 3QUVA 4YVHA 4YVKA 5GMBA 4E8BA 4YQTA 4YQGA 1VHYA 1UAJA 5CO4A 4YQ6A 4YQBA 4YQCA 1VHKA 5GMCA 4FAKA 4PZKA 1P9PA 4X3LA 3GYQA 4JAKA 4YQDA 4JWGA 4JWJA 3AIAA 4KDZA 5GM8A 3OINA 4YQ5A 1VH0A 4YQQA 2EGVA 1UAMA 1X7OA 4YVJA 2EGWA 4YQNA 4CNDA 4YQSA 4YQIA 1NS5A 2HA8A 3OIIA 5FAIA 4XBOA 4YQ2A 3KTYA 1V2XA 4YQOA 2CX8A 4YQ0A 4CNFA 3KNUA 4YPZA 3NK7A 3ONPA 4CNGA 4MCCA 3IC6A 5D9FA 1ZJRA 1OY5A 3BBHA 1IPAA 4RG1A 4MCDA 3IEFA 1NXZA 2O3AA 2V3JA 4JWHA 2V3KA 3KW2A 3BBDA 1X7PA 2QWVA 4YPXA 4YQ7A 1MXIA 3E5YA 4JALA 4MCBA 4JWFA 1V6ZA 4YQAA 3DCMX 4CNEA 1GZ0A 1TO0A 3ILKA 4H3YA 4YQLA 4YQPA 4YQ4A 3AI9X 4YQKA 4YQ3A 4IG6A 4YPYA 4YQJA 1O6DA 3L8UA 4H3ZA 2YY8A 4X3MA 3KY7A 3N4KA 2Z0YA 4YQ9A 4YVIA 3O7BA 4YPWA 4YVGA 4YQ1A 1UAKA 2QMMA 1K3RA 2I6DA 4KGNA 3OIJA 3N4JA 3NK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQ8 A;  4L69 A;  3BBE A;  1J85 A;  1Z85 A;  1UAL A;  4YQR A;  4J3C A;  3AXZ A;  3QUV A;  4YVH A;  4YVK A;  5GMB A;  4E8B A;  4YQT A;  4YQG A;  1VHY A;  1UAJ A;  5CO4 A;  4YQ6 A;  4YQB A;  4YQC A;  1VHK A;  5GMC A;  4FAK A;  4PZK A;  1P9P A;  4X3L A;  3GYQ A;  4JAK A;  4YQD A;  4KDZ A;  3AIA A;  3OIN A;  5GM8 A;  4YQ5 A;  1VH0 A;  4YQQ A;  2EGV A;  1UAM A;  1X7O A;  4YVJ A;  2EGW A;  4YQN A;  4CND A;  4YQS A;  4YQI A;  1NS5 A;  2HA8 A;  3OII A;  5FAI A;  4XBO A;  4YQ2 A;  3KTY A;  1V2X A;  4YQO A;  2CX8 A;  4YQ0 A;  4CNF A;  3KNU A;  4YPZ A;  3NK7 A;  3ONP A;  4CNG A;  4MCC A;  3IC6 A;  5D9F A;  1ZJR A;  1OY5 A;  3BBH A;  1IPA A;  4RG1 A;  4MCD A;  3IEF A;  1NXZ A;  2O3A A;  2V3J A;  2V3K A;  3KW2 A;  3BBD A;  1X7P A;  2QWV A;  4YPX A;  4YQ7 A;  1MXI A;  3E5Y A;  4JAL A;  4MCB A;  1V6Z A;  4YQA A;  3DCM X;  4CNE A;  1GZ0 A;  1TO0 A;  3ILK A;  4H3Y A;  4YQL A;  4YQP A;  4YQ4 A;  3AI9 X;  4YQK A;  4YQ3 A;  4IG6 A;  4YPY A;  4YQJ A;  1O6D A;  3L8U A;  4H3Z A;  2YY8 A;  4X3M A;  3KY7 A;  3N4K A;  2Z0Y A;  4YQ9 A;  4YVI A;  3O7B A;  4YPW A;  4YVG A;  4YQ1 A;  1UAK A;  2QMM A;  1K3R A;  2I6D A;  4KGN A;  3OIJ A;  3N4J A;  3NK6 A; 
#chains in the Genus database with same CATH topology
 4YQ8 A;  4FMW A;  4L69 A;  3BBE A;  1TRR A;  1MI7 R;  1J85 A;  1Z85 A;  1UAL A;  4YQR A;  4J3C A;  3AXZ A;  3QUV A;  4YVH A;  4YVK A;  5GMB A;  4E8B A;  4YQT A;  4YQG A;  1VHY A;  1UAJ A;  1TRO A;  5CO4 A;  4YQ6 A;  4YQB A;  4YQC A;  1VHK A;  5GMC A;  4FAK A;  4PZK A;  1P9P A;  4X3L A;  3GYQ A;  4JAK A;  3WRP A;  4YQD A;  4JWG A;  2OZ9 R;  3AIA A;  4JWJ A;  4KDZ A;  5GM8 A;  3OIN A;  4YQ5 A;  1RCS A;  1VH0 A;  3FRW A;  4YQQ A;  1JHG A;  2EGV A;  1UAM A;  1X7O A;  4YVJ A;  1ZT9 A;  4YQN A;  2EGW A;  4CND A;  3SSW N;  4YQS A;  4YQI A;  3KOR A;  1NS5 A;  2HA8 A;  3OII A;  5FAI A;  4XBO A;  4YQ2 A;  3KTY A;  1V2X A;  4YQO A;  2CX8 A;  4YQ0 A;  4CNF A;  3KNU A;  4YPZ A;  3NK7 A;  3ONP A;  4CNG A;  4MCC A;  3IC6 A;  5D9F A;  1WRT R;  1ZJR A;  1OY5 A;  3BBH A;  1WRS R;  1IPA A;  4RG1 A;  2XDI A;  3SSX N;  4MCD A;  3IEF A;  1NXZ A;  2O3A A;  2V3J A;  4JWH A;  2V3K A;  3KW2 A;  3BBD A;  1X7P A;  2QWV A;  4YPX A;  4YQ7 A;  1MXI A;  3E5Y A;  4JAL A;  4MCB A;  4JWF A;  1V6Z A;  4YQA A;  3DCM X;  4CNE A;  1GZ0 A;  1TO0 A;  3ILK A;  4H3Y A;  4YQL A;  4YQP A;  4YQ4 A;  3AI9 X;  4YQK A;  4YQ3 A;  4IG6 A;  4YPY A;  4YQJ A;  1O6D A;  3L8U A;  4H3Z A;  2YY8 A;  4X3M A;  3KY7 A;  3N4K A;  2Z0Y A;  4YQ9 A;  4YVI A;  3O7B A;  4YPW A;  4YVG A;  4YQ1 A;  1UAK A;  2QMM A;  1CO0 A;  1K3R A;  1WRP R;  2I6D A;  4KGN A;  3G1C A;  3OIJ A;  3N4J A;  3NK6 A; 
#chains in the Genus database with same CATH homology
 4YQ8 A;  4FMW A;  4L69 A;  3BBE A;  1J85 A;  1Z85 A;  1UAL A;  4YQR A;  4J3C A;  3AXZ A;  3QUV A;  4YVH A;  4YVK A;  5GMB A;  4E8B A;  4YQT A;  4YQG A;  1VHY A;  1UAJ A;  5CO4 A;  4YQ6 A;  4YQB A;  4YQC A;  1VHK A;  5GMC A;  4FAK A;  4PZK A;  1P9P A;  4X3L A;  3GYQ A;  4JAK A;  4YQD A;  4JWG A;  4JWJ A;  3AIA A;  4KDZ A;  5GM8 A;  3OIN A;  4YQ5 A;  1VH0 A;  4YQQ A;  2EGV A;  1UAM A;  1X7O A;  4YVJ A;  2EGW A;  4YQN A;  4CND A;  4YQS A;  4YQI A;  1NS5 A;  2HA8 A;  3OII A;  5FAI A;  4XBO A;  4YQ2 A;  3KTY A;  1V2X A;  4YQO A;  2CX8 A;  4YQ0 A;  4CNF A;  3KNU A;  4YPZ A;  3NK7 A;  3ONP A;  4CNG A;  4MCC A;  3IC6 A;  5D9F A;  1ZJR A;  1OY5 A;  3BBH A;  1IPA A;  4RG1 A;  4MCD A;  3IEF A;  1NXZ A;  2O3A A;  2V3J A;  4JWH A;  2V3K A;  3KW2 A;  3BBD A;  1X7P A;  2QWV A;  4YPX A;  4YQ7 A;  1MXI A;  3E5Y A;  4JAL A;  4MCB A;  4JWF A;  1V6Z A;  4YQA A;  3DCM X;  4CNE A;  1GZ0 A;  1TO0 A;  3ILK A;  4H3Y A;  4YQL A;  4YQP A;  4YQ4 A;  3AI9 X;  4YQK A;  4YQ3 A;  4IG6 A;  4YPY A;  4YQJ A;  1O6D A;  3L8U A;  4H3Z A;  2YY8 A;  4X3M A;  3KY7 A;  3N4K A;  2Z0Y A;  4YQ9 A;  4YVI A;  3O7B A;  4YPW A;  4YVG A;  4YQ1 A;  1UAK A;  2QMM A;  1K3R A;  2I6D A;  4KGN A;  3OIJ A;  3N4J A;  3NK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...