4YQ7A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
249
structure length
238
Chain Sequence
b'GSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 73
structure length 238
sequence length 249
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq7A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq7A01
5GMBA 4YQ5A 4KGNA 1VHKA 3BBHA 3N4JA 4CNDA 2V3JA 4CNGA 1X7OA 4YQ8A 2O3AA 4YQ1A 1UAMA 2YY8A 4YQAA 1GZ0A 1OY5A 1X7PA 2Z0YA 3L8UA 1VHYA 4MCBA 4PZKA 3IEFA 4YQ9A 1ZJRA 1UAJA 3NK7A 4YQQA 4YQBA 3OINA 4L69A 3DCMX 1P9PA 4YPXA 4YPZA 4H3YA 3QUVA 2V3KA 4YQPA 4YQ7A 5GM8A 4YQIA 2QWVA 4YQCA 4YQ3A 4YVHA 3BBDA 3IC6A 4YPWA 4MCDA 4J3CA 4YQOA 1V6ZA 3E5YA 4CNEA 4YQRA 3AIAA 1IPAA 4YQJA 5D9FA 1VH0A 4YQ2A 3OIIA 3O7BA 1Z85A 3N4KA 1K3RA 4YQTA 5FAIA 3AI9X 1MXIA 3ILKA 5CO4A 3GYQA 4X3LA 4YVKA 3AXZA 4YVJA 4YVGA 2EGWA 3NK6A 4YPYA 4H3ZA 3ONPA 4YQNA 4X3MA 4YQGA 4MCCA 4YQ6A 4YQKA 2I6DA 4CNFA 4E8BA 1NXZA 3KY7A 3OIJA 4XBOA 1V2XA 4JALA 3BBEA 4JAKA 1TO0A 2HA8A 1J85A 1O6DA 4IG6A 1UALA 2QMMA 3KTYA 4YQ4A 4YQLA 4YQSA 1UAKA 4YQ0A 1NS5A 2EGVA 3KW2A 4FAKA 4YVIA 4YQDA 3KNUA 4KDZA 5GMCA 2CX8A 4RG1A
chains in the Genus database with same CATH superfamily
5GMBA 4YQ5A 4KGNA 1VHKA 3BBHA 3N4JA 4CNDA 2V3JA 4CNGA 1WRPR 3WRPA 1X7OA 4YQ8A 2O3AA 4YQ1A 1UAMA 2YY8A 4YQAA 1GZ0A 1OY5A 1X7PA 2Z0YA 3G1CA 3L8UA 1VHYA 4MCBA 4PZKA 3IEFA 4YQ9A 1ZJRA 1UAJA 3NK7A 1MI7R 4YQQA 4YQBA 3OINA 4L69A 3SSWN 3DCMX 1P9PA 4YPXA 4YPZA 4H3YA 3QUVA 2XDIA 4YQPA 2V3KA 4YQ7A 5GM8A 4YQIA 1WRTR 2QWVA 4YQCA 4YQ3A 4YVHA 3BBDA 3IC6A 4YPWA 4MCDA 4J3CA 4YQOA 1V6ZA 3E5YA 4CNEA 4YQRA 3AIAA 1IPAA 4YQJA 5D9FA 1VH0A 4YQ2A 3OIIA 3O7BA 1Z85A 3N4KA 1K3RA 4YQTA 5FAIA 3AI9X 1MXIA 3ILKA 5CO4A 4FMWA 3GYQA 3SSXN 4X3LA 4YVKA 3AXZA 4YVJA 4YVGA 2EGWA 3NK6A 4YPYA 4H3ZA 3ONPA 4YQNA 4X3MA 4JWHA 4YQGA 4MCCA 4YQ6A 4YQKA 2I6DA 1TROA 4CNFA 4E8BA 4JWGA 1RCSA 1NXZA 3KY7A 3OIJA 4XBOA 4JWJA 1V2XA 4JALA 1WRSR 3BBEA 4JAKA 1TO0A 2HA8A 1J85A 4JWFA 1O6DA 1JHGA 4IG6A 1UALA 2QMMA 3FRWA 1CO0A 3KTYA 4YQ4A 4YQLA 3KORA 4YQSA 1UAKA 4YQ0A 1NS5A 2EGVA 3KW2A 4FAKA 1TRRA 4YVIA 4YQDA 3KNUA 4KDZA 2OZ9R 1ZT9A 5GMCA 2CX8A 4RG1A
chains in the Genus database with same CATH topology
5GMBA 4YQ5A 4KGNA 1VHKA 3BBHA 3N4JA 4CNDA 2V3JA 4CNGA 1X7OA 4YQ8A 2O3AA 4YQ1A 1UAMA 2YY8A 4YQAA 1GZ0A 1OY5A 1X7PA 2Z0YA 3L8UA 1VHYA 4MCBA 4PZKA 3IEFA 4YQ9A 1ZJRA 1UAJA 3NK7A 4YQQA 4YQBA 3OINA 4L69A 3DCMX 1P9PA 4YPXA 4YPZA 4H3YA 3QUVA 2V3KA 4YQPA 4YQ7A 5GM8A 4YQIA 2QWVA 4YQCA 4YQ3A 4YVHA 3BBDA 3IC6A 4YPWA 4MCDA 4J3CA 4YQOA 1V6ZA 3E5YA 4CNEA 4YQRA 3AIAA 1IPAA 4YQJA 5D9FA 1VH0A 4YQ2A 3OIIA 3O7BA 1Z85A 3N4KA 1K3RA 4YQTA 5FAIA 3AI9X 1MXIA 3ILKA 5CO4A 4FMWA 3GYQA 4X3LA 4YVKA 3AXZA 4YVJA 4YVGA 2EGWA 3NK6A 4YPYA 4H3ZA 3ONPA 4YQNA 4X3MA 4JWHA 4YQGA 4MCCA 4YQ6A 4YQKA 2I6DA 4CNFA 4E8BA 4JWGA 1NXZA 3KY7A 3OIJA 4XBOA 4JWJA 1V2XA 4JALA 3BBEA 4JAKA 1TO0A 2HA8A 1J85A 4JWFA 1O6DA 4IG6A 1UALA 2QMMA 3KTYA 4YQ4A 4YQLA 4YQSA 1UAKA 4YQ0A 1NS5A 2EGVA 3KW2A 4FAKA 4YVIA 4YQDA 3KNUA 4KDZA 5GMCA 2CX8A 4RG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMB A;  4YQ5 A;  4KGN A;  1VHK A;  3BBH A;  3N4J A;  4CND A;  2V3J A;  4CNG A;  1X7O A;  4YQ8 A;  2O3A A;  4YQ1 A;  1UAM A;  2YY8 A;  4YQA A;  1GZ0 A;  1OY5 A;  1X7P A;  2Z0Y A;  3L8U A;  1VHY A;  4MCB A;  4PZK A;  3IEF A;  4YQ9 A;  1ZJR A;  1UAJ A;  3NK7 A;  4YQQ A;  4YQB A;  3OIN A;  4L69 A;  3DCM X;  1P9P A;  4YPX A;  4YPZ A;  4H3Y A;  3QUV A;  2V3K A;  4YQP A;  4YQ7 A;  5GM8 A;  4YQI A;  2QWV A;  4YQC A;  4YQ3 A;  4YVH A;  3BBD A;  3IC6 A;  4YPW A;  4MCD A;  4J3C A;  4YQO A;  1V6Z A;  3E5Y A;  4CNE A;  4YQR A;  3AIA A;  1IPA A;  4YQJ A;  5D9F A;  1VH0 A;  4YQ2 A;  3OII A;  3O7B A;  1Z85 A;  3N4K A;  1K3R A;  4YQT A;  5FAI A;  3AI9 X;  1MXI A;  3ILK A;  5CO4 A;  3GYQ A;  4X3L A;  4YVK A;  3AXZ A;  4YVJ A;  4YVG A;  2EGW A;  3NK6 A;  4YPY A;  4H3Z A;  3ONP A;  4YQN A;  4X3M A;  4YQG A;  4MCC A;  4YQ6 A;  4YQK A;  2I6D A;  4CNF A;  4E8B A;  1NXZ A;  3KY7 A;  3OIJ A;  4XBO A;  1V2X A;  4JAL A;  3BBE A;  4JAK A;  1TO0 A;  2HA8 A;  1J85 A;  1O6D A;  4IG6 A;  1UAL A;  2QMM A;  3KTY A;  4YQ4 A;  4YQL A;  4YQS A;  1UAK A;  4YQ0 A;  1NS5 A;  2EGV A;  3KW2 A;  4FAK A;  4YVI A;  4YQD A;  3KNU A;  4KDZ A;  5GMC A;  2CX8 A;  4RG1 A; 
#chains in the Genus database with same CATH topology
 5GMB A;  4YQ5 A;  4KGN A;  1VHK A;  3BBH A;  3N4J A;  4CND A;  2V3J A;  4CNG A;  1WRP R;  3WRP A;  1X7O A;  4YQ8 A;  2O3A A;  4YQ1 A;  1UAM A;  2YY8 A;  4YQA A;  1GZ0 A;  1OY5 A;  1X7P A;  2Z0Y A;  3G1C A;  3L8U A;  1VHY A;  4MCB A;  4PZK A;  3IEF A;  4YQ9 A;  1ZJR A;  1UAJ A;  3NK7 A;  1MI7 R;  4YQQ A;  4YQB A;  3OIN A;  4L69 A;  3SSW N;  3DCM X;  1P9P A;  4YPX A;  4YPZ A;  4H3Y A;  3QUV A;  2XDI A;  4YQP A;  2V3K A;  4YQ7 A;  5GM8 A;  4YQI A;  1WRT R;  2QWV A;  4YQC A;  4YQ3 A;  4YVH A;  3BBD A;  3IC6 A;  4YPW A;  4MCD A;  4J3C A;  4YQO A;  1V6Z A;  3E5Y A;  4CNE A;  4YQR A;  3AIA A;  1IPA A;  4YQJ A;  5D9F A;  1VH0 A;  4YQ2 A;  3OII A;  3O7B A;  1Z85 A;  3N4K A;  1K3R A;  4YQT A;  5FAI A;  3AI9 X;  1MXI A;  3ILK A;  5CO4 A;  4FMW A;  3GYQ A;  3SSX N;  4X3L A;  4YVK A;  3AXZ A;  4YVJ A;  4YVG A;  2EGW A;  3NK6 A;  4YPY A;  4H3Z A;  3ONP A;  4YQN A;  4X3M A;  4JWH A;  4YQG A;  4MCC A;  4YQ6 A;  4YQK A;  2I6D A;  1TRO A;  4CNF A;  4E8B A;  4JWG A;  1RCS A;  1NXZ A;  3KY7 A;  3OIJ A;  4XBO A;  4JWJ A;  1V2X A;  4JAL A;  1WRS R;  3BBE A;  4JAK A;  1TO0 A;  2HA8 A;  1J85 A;  4JWF A;  1O6D A;  1JHG A;  4IG6 A;  1UAL A;  2QMM A;  3FRW A;  1CO0 A;  3KTY A;  4YQ4 A;  4YQL A;  3KOR A;  4YQS A;  1UAK A;  4YQ0 A;  1NS5 A;  2EGV A;  3KW2 A;  4FAK A;  1TRR A;  4YVI A;  4YQD A;  3KNU A;  4KDZ A;  2OZ9 R;  1ZT9 A;  5GMC A;  2CX8 A;  4RG1 A; 
#chains in the Genus database with same CATH homology
 5GMB A;  4YQ5 A;  4KGN A;  1VHK A;  3BBH A;  3N4J A;  4CND A;  2V3J A;  4CNG A;  1X7O A;  4YQ8 A;  2O3A A;  4YQ1 A;  1UAM A;  2YY8 A;  4YQA A;  1GZ0 A;  1OY5 A;  1X7P A;  2Z0Y A;  3L8U A;  1VHY A;  4MCB A;  4PZK A;  3IEF A;  4YQ9 A;  1ZJR A;  1UAJ A;  3NK7 A;  4YQQ A;  4YQB A;  3OIN A;  4L69 A;  3DCM X;  1P9P A;  4YPX A;  4YPZ A;  4H3Y A;  3QUV A;  2V3K A;  4YQP A;  4YQ7 A;  5GM8 A;  4YQI A;  2QWV A;  4YQC A;  4YQ3 A;  4YVH A;  3BBD A;  3IC6 A;  4YPW A;  4MCD A;  4J3C A;  4YQO A;  1V6Z A;  3E5Y A;  4CNE A;  4YQR A;  3AIA A;  1IPA A;  4YQJ A;  5D9F A;  1VH0 A;  4YQ2 A;  3OII A;  3O7B A;  1Z85 A;  3N4K A;  1K3R A;  4YQT A;  5FAI A;  3AI9 X;  1MXI A;  3ILK A;  5CO4 A;  4FMW A;  3GYQ A;  4X3L A;  4YVK A;  3AXZ A;  4YVJ A;  4YVG A;  2EGW A;  3NK6 A;  4YPY A;  4H3Z A;  3ONP A;  4YQN A;  4X3M A;  4JWH A;  4YQG A;  4MCC A;  4YQ6 A;  4YQK A;  2I6D A;  4CNF A;  4E8B A;  4JWG A;  1NXZ A;  3KY7 A;  3OIJ A;  4XBO A;  4JWJ A;  1V2X A;  4JAL A;  3BBE A;  4JAK A;  1TO0 A;  2HA8 A;  1J85 A;  4JWF A;  1O6D A;  4IG6 A;  1UAL A;  2QMM A;  3KTY A;  4YQ4 A;  4YQL A;  4YQS A;  1UAK A;  4YQ0 A;  1NS5 A;  2EGV A;  3KW2 A;  4FAK A;  4YVI A;  4YQD A;  3KNU A;  4KDZ A;  5GMC A;  2CX8 A;  4RG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...