4YQ8A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
248
structure length
240
Chain Sequence
b'SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 240
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq8A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq8A01
4CNDA 2EGVA 3KY7A 1K3RA 4XBOA 4YQ1A 3DCMX 4YQ6A 4YPZA 4YPXA 4YVHA 5FAIA 3NK7A 4CNFA 3GYQA 4YQ2A 4YQSA 2I6DA 1UAMA 4YQ8A 1Z85A 1GZ0A 4H3YA 4X3MA 1O6DA 4YQ7A 4IG6A 4YQAA 4YQKA 3N4JA 3ONPA 4PZKA 4YVKA 4YQ3A 3N4KA 4YQ9A 1VHYA 4YVIA 4YVGA 3AIAA 5D9FA 1J85A 4YQOA 1IPAA 1NS5A 4YQ0A 4YQBA 3BBDA 2O3AA 4E8BA 3L8UA 4YQNA 4YQRA 3OINA 3O7BA 3AXZA 4YQ4A 1ZJRA 1V6ZA 1OY5A 4YQPA 5GM8A 4JALA 3BBHA 1UAKA 2HA8A 1TO0A 3IC6A 4RG1A 1X7PA 3KNUA 3NK6A 1VH0A 2Z0YA 4YPYA 3QUVA 4MCCA 2QWVA 4J3CA 3BBEA 2CX8A 2QMMA 4YQCA 3OIIA 1VHKA 4FAKA 4H3ZA 3AI9X 4YQJA 3IEFA 4JAKA 2V3KA 1NXZA 2YY8A 1P9PA 3ILKA 4YPWA 4CNGA 4YQQA 4L69A 4MCBA 5GMBA 4YVJA 4MCDA 4X3LA 1UALA 5GMCA 4YQTA 3OIJA 2EGWA 4CNEA 3KW2A 4YQGA 4KGNA 1V2XA 4YQIA 4YQLA 1MXIA 2V3JA 1UAJA 4YQ5A 4KDZA 4YQDA 3E5YA 3KTYA 1X7OA 5CO4A
chains in the Genus database with same CATH superfamily
4CNDA 2EGVA 3KY7A 1K3RA 4XBOA 4YQ1A 3DCMX 4JWJA 4YQ6A 4YPZA 4YPXA 4YVHA 1TROA 5FAIA 3NK7A 1WRPR 4CNFA 3GYQA 4YQ2A 4YQSA 2I6DA 1UAMA 4YQ8A 1Z85A 1GZ0A 4H3YA 3KORA 3SSXN 4X3MA 1O6DA 2OZ9R 4YQ7A 4IG6A 4YQAA 4YQKA 3N4JA 3ONPA 4PZKA 4YVKA 4YQ3A 3N4KA 4YQ9A 1VHYA 2XDIA 4YVIA 4YVGA 3AIAA 5D9FA 1JHGA 1J85A 4YQOA 1IPAA 1NS5A 4YQ0A 4YQBA 3BBDA 2O3AA 4E8BA 3L8UA 4YQNA 4YQRA 3OINA 3O7BA 3AXZA 4YQ4A 1ZJRA 1V6ZA 1OY5A 4YQPA 5GM8A 4JALA 1TRRA 3BBHA 1WRTR 1UAKA 3SSWN 2HA8A 1TO0A 3IC6A 4RG1A 1X7PA 3KNUA 3NK6A 1VH0A 2Z0YA 4YPYA 3QUVA 1RCSA 4MCCA 3WRPA 2QWVA 3FRWA 1CO0A 4J3CA 3BBEA 4JWHA 2CX8A 2QMMA 4YQCA 3OIIA 4JWGA 1VHKA 1MI7R 4FAKA 4H3ZA 3G1CA 3AI9X 4YQJA 3IEFA 4JAKA 2V3KA 1NXZA 2YY8A 1P9PA 3ILKA 4YPWA 1WRSR 4CNGA 4YQQA 4L69A 4MCBA 5GMBA 4YVJA 4MCDA 4X3LA 1ZT9A 1UALA 5GMCA 4FMWA 4YQTA 3OIJA 2EGWA 4CNEA 3KW2A 4YQGA 4KGNA 1V2XA 4YQIA 4YQLA 1MXIA 2V3JA 1UAJA 4JWFA 4YQ5A 4KDZA 4YQDA 3E5YA 3KTYA 1X7OA 5CO4A
chains in the Genus database with same CATH topology
4CNDA 2EGVA 3KY7A 1K3RA 4XBOA 4YQ1A 3DCMX 4JWJA 4YQ6A 4YPZA 4YPXA 4YVHA 5FAIA 3NK7A 4CNFA 3GYQA 4YQ2A 4YQSA 2I6DA 1UAMA 4YQ8A 1Z85A 1GZ0A 4H3YA 4X3MA 1O6DA 4YQ7A 4IG6A 4YQAA 4YQKA 3N4JA 3ONPA 4PZKA 4YVKA 4YQ3A 3N4KA 4YQ9A 1VHYA 4YVIA 4YVGA 3AIAA 5D9FA 1J85A 4YQOA 1IPAA 1NS5A 4YQ0A 4YQBA 3BBDA 2O3AA 4E8BA 3L8UA 4YQNA 4YQRA 3OINA 3O7BA 3AXZA 4YQ4A 1ZJRA 1V6ZA 1OY5A 4YQPA 5GM8A 4JALA 3BBHA 1UAKA 2HA8A 1TO0A 3IC6A 4RG1A 1X7PA 3KNUA 3NK6A 1VH0A 2Z0YA 4YPYA 3QUVA 4MCCA 2QWVA 4JWHA 4J3CA 3BBEA 2CX8A 2QMMA 4YQCA 3OIIA 4JWGA 1VHKA 4FAKA 4H3ZA 3AI9X 4YQJA 3IEFA 4JAKA 2V3KA 1NXZA 2YY8A 1P9PA 3ILKA 4YPWA 4CNGA 4YQQA 4L69A 4MCBA 5GMBA 4YVJA 4MCDA 4X3LA 1UALA 5GMCA 4FMWA 4YQTA 3OIJA 2EGWA 4CNEA 3KW2A 4YQGA 4KGNA 1V2XA 4YQIA 4YQLA 1MXIA 2V3JA 1UAJA 4JWFA 4YQ5A 4KDZA 4YQDA 3E5YA 3KTYA 1X7OA 5CO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CND A;  2EGV A;  3KY7 A;  1K3R A;  4XBO A;  4YQ1 A;  3DCM X;  4YQ6 A;  4YPZ A;  4YPX A;  4YVH A;  5FAI A;  3NK7 A;  4CNF A;  3GYQ A;  4YQ2 A;  4YQS A;  2I6D A;  1UAM A;  4YQ8 A;  1Z85 A;  1GZ0 A;  4H3Y A;  4X3M A;  1O6D A;  4YQ7 A;  4IG6 A;  4YQA A;  4YQK A;  3N4J A;  3ONP A;  4PZK A;  4YVK A;  4YQ3 A;  3N4K A;  4YQ9 A;  1VHY A;  4YVI A;  4YVG A;  3AIA A;  5D9F A;  1J85 A;  4YQO A;  1IPA A;  1NS5 A;  4YQ0 A;  4YQB A;  3BBD A;  2O3A A;  4E8B A;  3L8U A;  4YQN A;  4YQR A;  3OIN A;  3O7B A;  3AXZ A;  4YQ4 A;  1ZJR A;  1V6Z A;  1OY5 A;  4YQP A;  5GM8 A;  4JAL A;  3BBH A;  1UAK A;  2HA8 A;  1TO0 A;  3IC6 A;  4RG1 A;  1X7P A;  3KNU A;  3NK6 A;  1VH0 A;  2Z0Y A;  4YPY A;  3QUV A;  4MCC A;  2QWV A;  4J3C A;  3BBE A;  2CX8 A;  2QMM A;  4YQC A;  3OII A;  1VHK A;  4FAK A;  4H3Z A;  3AI9 X;  4YQJ A;  3IEF A;  4JAK A;  2V3K A;  1NXZ A;  2YY8 A;  1P9P A;  3ILK A;  4YPW A;  4CNG A;  4YQQ A;  4L69 A;  4MCB A;  5GMB A;  4YVJ A;  4MCD A;  4X3L A;  1UAL A;  5GMC A;  4YQT A;  3OIJ A;  2EGW A;  4CNE A;  3KW2 A;  4YQG A;  4KGN A;  1V2X A;  4YQI A;  4YQL A;  1MXI A;  2V3J A;  1UAJ A;  4YQ5 A;  4KDZ A;  4YQD A;  3E5Y A;  3KTY A;  1X7O A;  5CO4 A; 
#chains in the Genus database with same CATH topology
 4CND A;  2EGV A;  3KY7 A;  1K3R A;  4XBO A;  4YQ1 A;  3DCM X;  4JWJ A;  4YQ6 A;  4YPZ A;  4YPX A;  4YVH A;  1TRO A;  5FAI A;  3NK7 A;  1WRP R;  4CNF A;  3GYQ A;  4YQ2 A;  4YQS A;  2I6D A;  1UAM A;  4YQ8 A;  1Z85 A;  1GZ0 A;  4H3Y A;  3KOR A;  3SSX N;  4X3M A;  1O6D A;  2OZ9 R;  4YQ7 A;  4IG6 A;  4YQA A;  4YQK A;  3N4J A;  3ONP A;  4PZK A;  4YVK A;  4YQ3 A;  3N4K A;  4YQ9 A;  1VHY A;  2XDI A;  4YVI A;  4YVG A;  3AIA A;  5D9F A;  1JHG A;  1J85 A;  4YQO A;  1IPA A;  1NS5 A;  4YQ0 A;  4YQB A;  3BBD A;  2O3A A;  4E8B A;  3L8U A;  4YQN A;  4YQR A;  3OIN A;  3O7B A;  3AXZ A;  4YQ4 A;  1ZJR A;  1V6Z A;  1OY5 A;  4YQP A;  5GM8 A;  4JAL A;  1TRR A;  3BBH A;  1WRT R;  1UAK A;  3SSW N;  2HA8 A;  1TO0 A;  3IC6 A;  4RG1 A;  1X7P A;  3KNU A;  3NK6 A;  1VH0 A;  2Z0Y A;  4YPY A;  3QUV A;  1RCS A;  4MCC A;  3WRP A;  2QWV A;  3FRW A;  1CO0 A;  4J3C A;  3BBE A;  4JWH A;  2CX8 A;  2QMM A;  4YQC A;  3OII A;  4JWG A;  1VHK A;  1MI7 R;  4FAK A;  4H3Z A;  3G1C A;  3AI9 X;  4YQJ A;  3IEF A;  4JAK A;  2V3K A;  1NXZ A;  2YY8 A;  1P9P A;  3ILK A;  4YPW A;  1WRS R;  4CNG A;  4YQQ A;  4L69 A;  4MCB A;  5GMB A;  4YVJ A;  4MCD A;  4X3L A;  1ZT9 A;  1UAL A;  5GMC A;  4FMW A;  4YQT A;  3OIJ A;  2EGW A;  4CNE A;  3KW2 A;  4YQG A;  4KGN A;  1V2X A;  4YQI A;  4YQL A;  1MXI A;  2V3J A;  1UAJ A;  4JWF A;  4YQ5 A;  4KDZ A;  4YQD A;  3E5Y A;  3KTY A;  1X7O A;  5CO4 A; 
#chains in the Genus database with same CATH homology
 4CND A;  2EGV A;  3KY7 A;  1K3R A;  4XBO A;  4YQ1 A;  3DCM X;  4JWJ A;  4YQ6 A;  4YPZ A;  4YPX A;  4YVH A;  5FAI A;  3NK7 A;  4CNF A;  3GYQ A;  4YQ2 A;  4YQS A;  2I6D A;  1UAM A;  4YQ8 A;  1Z85 A;  1GZ0 A;  4H3Y A;  4X3M A;  1O6D A;  4YQ7 A;  4IG6 A;  4YQA A;  4YQK A;  3N4J A;  3ONP A;  4PZK A;  4YVK A;  4YQ3 A;  3N4K A;  4YQ9 A;  1VHY A;  4YVI A;  4YVG A;  3AIA A;  5D9F A;  1J85 A;  4YQO A;  1IPA A;  1NS5 A;  4YQ0 A;  4YQB A;  3BBD A;  2O3A A;  4E8B A;  3L8U A;  4YQN A;  4YQR A;  3OIN A;  3O7B A;  3AXZ A;  4YQ4 A;  1ZJR A;  1V6Z A;  1OY5 A;  4YQP A;  5GM8 A;  4JAL A;  3BBH A;  1UAK A;  2HA8 A;  1TO0 A;  3IC6 A;  4RG1 A;  1X7P A;  3KNU A;  3NK6 A;  1VH0 A;  2Z0Y A;  4YPY A;  3QUV A;  4MCC A;  2QWV A;  4JWH A;  4J3C A;  3BBE A;  2CX8 A;  2QMM A;  4YQC A;  3OII A;  4JWG A;  1VHK A;  4FAK A;  4H3Z A;  3AI9 X;  4YQJ A;  3IEF A;  4JAK A;  2V3K A;  1NXZ A;  2YY8 A;  1P9P A;  3ILK A;  4YPW A;  4CNG A;  4YQQ A;  4L69 A;  4MCB A;  5GMB A;  4YVJ A;  4MCD A;  4X3L A;  1UAL A;  5GMC A;  4FMW A;  4YQT A;  3OIJ A;  2EGW A;  4CNE A;  3KW2 A;  4YQG A;  4KGN A;  1V2X A;  4YQI A;  4YQL A;  1MXI A;  2V3J A;  1UAJ A;  4JWF A;  4YQ5 A;  4KDZ A;  4YQD A;  3E5Y A;  3KTY A;  1X7O A;  5CO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...