4YQ8A

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
248
structure length
240
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 240
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4yq8A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4yq8A01
4YQPA 1UAMA 5FAIA 1K3RA 5GMBA 4CNFA 4YVHA 2HA8A 4YQIA 2QMMA 4H3ZA 3O7BA 4YQKA 4YQ5A 4RG1A 3OIIA 1UAKA 1V2XA 4E8BA 4YQOA 1P9PA 1VHYA 1O6DA 4YQNA 4YQ3A 4YQRA 4YVJA 2CX8A 2EGVA 1IPAA 4MCCA 1VH0A 1UAJA 2Z0YA 4YQSA 4YVGA 1NXZA 3BBEA 4YQCA 4J3CA 3AXZA 4YVKA 3KNUA 1OY5A 2V3KA 4YQ8A 3KTYA 4YQJA 2YY8A 1X7OA 1Z85A 4JAKA 5CO4A 1ZJRA 4YQQA 4YQ6A 1NS5A 4X3LA 4YQ4A 4YQ0A 3BBDA 4IG6A 4KGNA 4KDZA 3DCMX 3N4KA 3GYQA 4FAKA 4YQLA 4YQBA 2O3AA 5GM8A 4YQ9A 3AI9X 4YQGA 3QUVA 1X7PA 2EGWA 1UALA 4YQ2A 4YQ7A 3E5YA 3IEFA 4YPZA 4H3YA 4MCBA 5D9FA 4YVIA 5GMCA 4YQAA 1GZ0A 3KY7A 1V6ZA 3ILKA 3ONPA 4CNEA 4YQDA 3NK6A 4XBOA 3L8UA 3N4JA 4MCDA 3AIAA 1VHKA 4CNDA 4YQTA 1MXIA 4YPXA 3BBHA 1J85A 3IC6A 3KW2A 2QWVA 4JALA 2I6DA 4YPWA 4X3MA 4YPYA 1TO0A 4L69A 4PZKA 3NK7A 2V3JA 4CNGA 3OIJA 4YQ1A 3OINA
chains in the Genus database with same CATH superfamily
4YQPA 1UAMA 5FAIA 1K3RA 5GMBA 4CNFA 4YVHA 2HA8A 4YQIA 2QMMA 4H3ZA 3O7BA 4YQKA 4YQ5A 4RG1A 3OIIA 1UAKA 3G1CA 1V2XA 4E8BA 4YQOA 1P9PA 1VHYA 1O6DA 4YQNA 4YQ3A 4YQRA 4YVJA 2CX8A 2EGVA 1IPAA 4MCCA 1VH0A 1UAJA 2Z0YA 4YQSA 4YVGA 1NXZA 3BBEA 4YQCA 4J3CA 3AXZA 4YVKA 2OZ9R 3SSXN 3KNUA 1OY5A 1JHGA 1CO0A 4YQ8A 2V3KA 3KTYA 4JWFA 4YQJA 2YY8A 1MI7R 1X7OA 1Z85A 4JAKA 5CO4A 1ZJRA 4YQQA 4YQ6A 1NS5A 4X3LA 4YQ4A 4JWJA 4YQ0A 4JWGA 3BBDA 4IG6A 4KGNA 1RCSA 4FMWA 4KDZA 1TRRA 3DCMX 3N4KA 3GYQA 4FAKA 4YQLA 4YQBA 2O3AA 5GM8A 4YQ9A 3AI9X 4YQGA 3QUVA 1X7PA 2EGWA 1UALA 4YQ2A 3KORA 4YQ7A 1WRPR 3E5YA 3IEFA 4YPZA 4H3YA 4MCBA 5D9FA 3WRPA 4YVIA 5GMCA 4YQAA 1GZ0A 3KY7A 1V6ZA 3ILKA 3ONPA 4CNEA 4YQDA 1ZT9A 3NK6A 4XBOA 3L8UA 3N4JA 4JWHA 4MCDA 3SSWN 1WRSR 1VHKA 3AIAA 4CNDA 4YQTA 1MXIA 4YPXA 3BBHA 1J85A 3IC6A 3KW2A 1TROA 2QWVA 4JALA 2I6DA 4YPWA 4X3MA 1WRTR 3FRWA 4YPYA 1TO0A 4L69A 4PZKA 3NK7A 2V3JA 2XDIA 4CNGA 3OIJA 4YQ1A 3OINA
chains in the Genus database with same CATH topology
4YQPA 1UAMA 5FAIA 1K3RA 5GMBA 4CNFA 4YVHA 2HA8A 4YQIA 2QMMA 4H3ZA 3O7BA 4YQKA 4YQ5A 4RG1A 3OIIA 1UAKA 1V2XA 4E8BA 4YQOA 1P9PA 1VHYA 1O6DA 4YQNA 4YQ3A 4YQRA 4YVJA 2CX8A 2EGVA 1IPAA 4MCCA 1VH0A 1UAJA 2Z0YA 4YQSA 4YVGA 1NXZA 3BBEA 4YQCA 4J3CA 3AXZA 4YVKA 3KNUA 1OY5A 2V3KA 4YQ8A 3KTYA 4JWFA 4YQJA 2YY8A 1X7OA 1Z85A 4JAKA 5CO4A 1ZJRA 4YQQA 4YQ6A 1NS5A 4X3LA 4YQ4A 4JWJA 4YQ0A 4JWGA 3BBDA 4IG6A 4KGNA 4FMWA 4KDZA 3DCMX 3N4KA 3GYQA 4FAKA 4YQLA 4YQBA 2O3AA 5GM8A 4YQ9A 3AI9X 4YQGA 3QUVA 1X7PA 2EGWA 1UALA 4YQ2A 4YQ7A 3E5YA 3IEFA 4YPZA 4H3YA 4MCBA 5D9FA 4YVIA 5GMCA 4YQAA 1GZ0A 3KY7A 1V6ZA 3ILKA 3ONPA 4CNEA 4YQDA 3NK6A 4XBOA 3L8UA 3N4JA 4JWHA 4MCDA 3AIAA 1VHKA 4CNDA 4YQTA 1MXIA 4YPXA 3BBHA 1J85A 3IC6A 3KW2A 2QWVA 4JALA 2I6DA 4YPWA 4X3MA 4YPYA 1TO0A 4L69A 4PZKA 3NK7A 2V3JA 4CNGA 3OIJA 4YQ1A 3OINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQP A;  1UAM A;  5FAI A;  1K3R A;  5GMB A;  4CNF A;  4YVH A;  2HA8 A;  4YQI A;  2QMM A;  4H3Z A;  3O7B A;  4YQK A;  4YQ5 A;  4RG1 A;  3OII A;  1UAK A;  1V2X A;  4E8B A;  4YQO A;  1P9P A;  1VHY A;  1O6D A;  4YQN A;  4YQ3 A;  4YQR A;  4YVJ A;  2CX8 A;  2EGV A;  1IPA A;  4MCC A;  1VH0 A;  1UAJ A;  2Z0Y A;  4YQS A;  4YVG A;  1NXZ A;  3BBE A;  4YQC A;  4J3C A;  3AXZ A;  4YVK A;  3KNU A;  1OY5 A;  2V3K A;  4YQ8 A;  3KTY A;  4YQJ A;  2YY8 A;  1X7O A;  1Z85 A;  4JAK A;  5CO4 A;  1ZJR A;  4YQQ A;  4YQ6 A;  1NS5 A;  4X3L A;  4YQ4 A;  4YQ0 A;  3BBD A;  4IG6 A;  4KGN A;  4KDZ A;  3DCM X;  3N4K A;  3GYQ A;  4FAK A;  4YQL A;  4YQB A;  2O3A A;  5GM8 A;  4YQ9 A;  3AI9 X;  4YQG A;  3QUV A;  1X7P A;  2EGW A;  1UAL A;  4YQ2 A;  4YQ7 A;  3E5Y A;  3IEF A;  4YPZ A;  4H3Y A;  4MCB A;  5D9F A;  4YVI A;  5GMC A;  4YQA A;  1GZ0 A;  3KY7 A;  1V6Z A;  3ILK A;  3ONP A;  4CNE A;  4YQD A;  3NK6 A;  4XBO A;  3L8U A;  3N4J A;  4MCD A;  3AIA A;  1VHK A;  4CND A;  4YQT A;  1MXI A;  4YPX A;  3BBH A;  1J85 A;  3IC6 A;  3KW2 A;  2QWV A;  4JAL A;  2I6D A;  4YPW A;  4X3M A;  4YPY A;  1TO0 A;  4L69 A;  4PZK A;  3NK7 A;  2V3J A;  4CNG A;  3OIJ A;  4YQ1 A;  3OIN A; 
#chains in the Genus database with same CATH topology
 4YQP A;  1UAM A;  5FAI A;  1K3R A;  5GMB A;  4CNF A;  4YVH A;  2HA8 A;  4YQI A;  2QMM A;  4H3Z A;  3O7B A;  4YQK A;  4YQ5 A;  4RG1 A;  3OII A;  1UAK A;  3G1C A;  1V2X A;  4E8B A;  4YQO A;  1P9P A;  1VHY A;  1O6D A;  4YQN A;  4YQ3 A;  4YQR A;  4YVJ A;  2CX8 A;  2EGV A;  1IPA A;  4MCC A;  1VH0 A;  1UAJ A;  2Z0Y A;  4YQS A;  4YVG A;  1NXZ A;  3BBE A;  4YQC A;  4J3C A;  3AXZ A;  4YVK A;  2OZ9 R;  3SSX N;  3KNU A;  1OY5 A;  1JHG A;  1CO0 A;  4YQ8 A;  2V3K A;  3KTY A;  4JWF A;  4YQJ A;  2YY8 A;  1MI7 R;  1X7O A;  1Z85 A;  4JAK A;  5CO4 A;  1ZJR A;  4YQQ A;  4YQ6 A;  1NS5 A;  4X3L A;  4YQ4 A;  4JWJ A;  4YQ0 A;  4JWG A;  3BBD A;  4IG6 A;  4KGN A;  1RCS A;  4FMW A;  4KDZ A;  1TRR A;  3DCM X;  3N4K A;  3GYQ A;  4FAK A;  4YQL A;  4YQB A;  2O3A A;  5GM8 A;  4YQ9 A;  3AI9 X;  4YQG A;  3QUV A;  1X7P A;  2EGW A;  1UAL A;  4YQ2 A;  3KOR A;  4YQ7 A;  1WRP R;  3E5Y A;  3IEF A;  4YPZ A;  4H3Y A;  4MCB A;  5D9F A;  3WRP A;  4YVI A;  5GMC A;  4YQA A;  1GZ0 A;  3KY7 A;  1V6Z A;  3ILK A;  3ONP A;  4CNE A;  4YQD A;  1ZT9 A;  3NK6 A;  4XBO A;  3L8U A;  3N4J A;  4JWH A;  4MCD A;  3SSW N;  1WRS R;  1VHK A;  3AIA A;  4CND A;  4YQT A;  1MXI A;  4YPX A;  3BBH A;  1J85 A;  3IC6 A;  3KW2 A;  1TRO A;  2QWV A;  4JAL A;  2I6D A;  4YPW A;  4X3M A;  1WRT R;  3FRW A;  4YPY A;  1TO0 A;  4L69 A;  4PZK A;  3NK7 A;  2V3J A;  2XDI A;  4CNG A;  3OIJ A;  4YQ1 A;  3OIN A; 
#chains in the Genus database with same CATH homology
 4YQP A;  1UAM A;  5FAI A;  1K3R A;  5GMB A;  4CNF A;  4YVH A;  2HA8 A;  4YQI A;  2QMM A;  4H3Z A;  3O7B A;  4YQK A;  4YQ5 A;  4RG1 A;  3OII A;  1UAK A;  1V2X A;  4E8B A;  4YQO A;  1P9P A;  1VHY A;  1O6D A;  4YQN A;  4YQ3 A;  4YQR A;  4YVJ A;  2CX8 A;  2EGV A;  1IPA A;  4MCC A;  1VH0 A;  1UAJ A;  2Z0Y A;  4YQS A;  4YVG A;  1NXZ A;  3BBE A;  4YQC A;  4J3C A;  3AXZ A;  4YVK A;  3KNU A;  1OY5 A;  2V3K A;  4YQ8 A;  3KTY A;  4JWF A;  4YQJ A;  2YY8 A;  1X7O A;  1Z85 A;  4JAK A;  5CO4 A;  1ZJR A;  4YQQ A;  4YQ6 A;  1NS5 A;  4X3L A;  4YQ4 A;  4JWJ A;  4YQ0 A;  4JWG A;  3BBD A;  4IG6 A;  4KGN A;  4FMW A;  4KDZ A;  3DCM X;  3N4K A;  3GYQ A;  4FAK A;  4YQL A;  4YQB A;  2O3A A;  5GM8 A;  4YQ9 A;  3AI9 X;  4YQG A;  3QUV A;  1X7P A;  2EGW A;  1UAL A;  4YQ2 A;  4YQ7 A;  3E5Y A;  3IEF A;  4YPZ A;  4H3Y A;  4MCB A;  5D9F A;  4YVI A;  5GMC A;  4YQA A;  1GZ0 A;  3KY7 A;  1V6Z A;  3ILK A;  3ONP A;  4CNE A;  4YQD A;  3NK6 A;  4XBO A;  3L8U A;  3N4J A;  4JWH A;  4MCD A;  3AIA A;  1VHK A;  4CND A;  4YQT A;  1MXI A;  4YPX A;  3BBH A;  1J85 A;  3IC6 A;  3KW2 A;  2QWV A;  4JAL A;  2I6D A;  4YPW A;  4X3M A;  4YPY A;  1TO0 A;  4L69 A;  4PZK A;  3NK7 A;  2V3J A;  4CNG A;  3OIJ A;  4YQ1 A;  3OIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...