4YQYA

Crystal structure of a putative dehydrogenase from sulfitobacter sp. (cog1028) (target efi-513936) in its apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
251
Chain Sequence
b'LGTENLYFQSMDLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEGSSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPKIRVNSLCPGMIDTDFHNRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Dehydrogenase
publication title Crystal Structure of a putative Dehydrogenase from Sulfitobacter sp. (COG1028, TARGET EFI-513936) in its APO form
rcsb
source organism Sulfitobacter sp. nas-14.1
molecule tags Oxidoreductase
total genus 87
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yqyA00
2DTXA 3NRCA 1A7KA 5T8KC 4JP2A 1QLHA 4E6PA 1NVGA 1Y1PA 3MOGA 5A05A 1V35A 4WK6A 3WSWA 3VKVA 3HN2A 3LC2O 4W9NC 5ITWA 3KB6A 3ZN2A 6LDHA 5AXDA 1BTOA 4WE3A 4WKGA 3KM0A 5B4TA 3EMKA 2BRUA 2BH9A 3DZKA 3HWRA 4GL4A 4E21A 4CR8A 1RM5A 5A02A 3WGQA 3ZWMA 2GUGA 2RIRA 1A4UA 1JVBA 3U5TA 3UUWA 4DMLA 4J2HA 5ENVA 3NX4A 4UUNA 4HADA 5IXYA 1U8XX 3JQ6A 4OJNA 3WWZA 3H9GA 3HN7A 3QP9A 4YAEA 4ALMA 3F1LA 3GGOA 4FFOA 1ONOA 4H7PA 4L74A 4MVJH 3WR5A 1EVYA 4EYEA 4S3MA 2Q2VA 3H7AA 3HFGA 1IZ0A 2EW2A 5T57A 4FB5A 1ZK0A 4NH4A 4EEZA 4B3JA 2CMDA 3M2TA 2D0IA 4Q3DA 3DR3A 4MVJI 3AK4A 1SB9A 2PH5A 3OQBA 1ZW1A 4M49A 3CTMA 1YE3A 4MVJP 1X7DA 4PZDA 4DIBA 1X13A 5C7LO 3WQQA 1OOEA 1Z6ZA 1EVIA 2BI8A 4GVLA 4XIYA 2O3SA 5C37A 1HDGO 4KQXA 1NWCA 4TQGA 3KVOA 3G1UA 2DAPA 1KOLA 3DDNA 1IPFA 2H6EA 3CMCO 3QVTA 3DTTA 3HQ4O 1VL6A 2AQIA 2P2SA 2EGGA 3D5QA 3QWBA 3HFSA 1KC1A 2PLAA 3WGYA 4C7JA 1YOVB 3AOEA 3H9QA 5JO9A 4TROA 3SVTA 3INRA 4YJGA 3L6EA 4E5NA 1P0CA 3AWDA 1SB8A 4IQ0A 4PLYA 3PLNA 1O6ZA 4LVCA 2PWZA 4BOYA 4UVGA 3H9UA 1C1XA 5ES3A 2X22A 3VPFA 1SCUA 3AI2A 2X9NA 2WM3A 2E4AA 2X5OA 4PLPA 3FNGA 4JCOA 3MWEB 4YWJA 2VHXA 2DQ4A 2NQTA 4BO1A 3HDYA 5A3JA 5FF9A 3RBXA 2PKQO 3Q1LA 3KYCA 2VN8A 2EW8A 3LC7O 5G0WA 4KP7A 1HEUA 4L9RA 3S8MA 1MP0A 5JAIA 1DIHA 4D79A 2G76A 4IQGA 4HNHA 1U4SA 1NBOA 1LLDA 1NR1A 2GZ2A 3ULKA 1J5PA 3W4KA 1VKNA 2OOSA 3DEYX 3BTOA 3C85A 2BFOA 3DB2A 1ULUA 1A9YA 3JQCA 3DHYA 4OH1A 2LDXA 3V5NA 4DIOA 5JBIA 1I10A 2NTNA 3WGTA 4II2A 3ZZNA 4DLBA 1GD1O 2HMTA 4CV1A 3OEYA 4ALIA 2YY7A 3BMQA 4CMAA 4K6FA 4CUZA 1LDEA 1FXSA 3GZNB 1G1AA 1P77A 4CLOB 1TT7A 2Q4BA 1PIWA 5GY7A 4N54A 3TZ6A 4CODB 4RVHA 2VT2A 1ZFNA 3RBZA 1ZBQA 4RJTA 4BO7A 3NJ8A 4BO5A 4UREA 3GC6A 1B0AA 4GX5A 1SOWA 3WTBA 4I1IA 4GWKA 2GGSA 1P1JA 3I23A 3OA2A 3DAPA 1HDZA 3JQFA 2VWQA 5THQA 5CEJA 5I7SA 3JD4A 3ON5A 1I0ZA 4OMUA 4TWRA 2JCVA 1X1EA 2AE1A 3DFUA 4ZRMA 1KS9A 3I1JA 1ZK2A 3NDJA 2RHRA 3PWZA 5T5QA 3H2SA 1WP4A 4BKRA 3O9ZA 2FPPA 4KOAA 1KVRA 1XDWA 3PEFA 4E30A 2G17A 1ZUD1 1DJNA 4AJ4A 1W4ZA 2VCYA 2GN9A 3Q2KA 4LK3A 1KEVA 2VWPA 3ETDA 4RDIA 3OIDA 3RFVA 3MTGA 3GAZA 1Y7TA 1K3TA 4E31A 1XG5A 3H5RA 1HLDA 4Y9DA 3PHGA 5JDCC 2WD7B 3PRJA 1ZXBA 4I5FA 3TFOA 2IYPA 2PD4A 3V2GA 2ZQYA 5L95A 3WYEA 4E3ZA 2AQ8A 2E82A 4NJOA 3FD8A 4XGKA 1FMCA 2V6GA 3IQDB 1T1RA 4G5HA 1B2LA 1N9GB 1R4MB 2SCUA 4IS2A 3GEMA 1ENPA 4NI5A 3CH6A 3W6ZA 4BNFA 2UAGA 1P0FA 1N92A 3HG7A 4OXNA 5HBRA 1QYVA 4DUPA 1U9JA 4O1MA 1KERA 3K6JA 4NK5A 1BXZA 4GX2A 5FI3A 2ZTVA 4BNVA 2B5WA 4PLHA 4BNLA 3C8MA 2CF5A 2Q1UA 2DKNA 3JQ7B 3NT4A 2IXAA 2HMUA 3L9XA 2C29D 3DBHA 3GRPA 5DOZA 4ND5A 1HE5A 1CETA 3GNQA 1V0JA 4JNKA 3DMYA 3I4CA 2NVWA 1YRLA 3GOHA 3E5RA 1OAAA 4KMSA 3ROMA 5G4LA 3VTZA 1YWGO 1HTBA 1WXDA 4FDAA 1UZLA 2HJSA 2A92A 4YDRA 1LSOA 5JFOA 1ZSYA 4XCVA 4TZKA 2VYNA 2EGHA 3DZFA 3K9QO 3PQEA 3IKVA 4CQLB 4WASA 4E2WA 1B8VA 2GASA 4OAQA 1LBEA 4Z0TA 3F5SA 4JN6B 1BRMA 3MCVA 2I6TA 1T1SA 1KBZA 4A0SA 3TZHA 3W8DA 1SMKA 1HT0A 4CM8A 2YQ5A 3QHAA 4BMSA 1YKFA 1ZK4A 1J0XO 3KHUA 4LRTB 1OZAA 1DO8A 3W8FA 4ZQBA 3ANLA 4W6ZA 2AEFA 1LC3A 1ID1A 2WYWA 2FPIA 4BVAA 1SZJG 1NM5A 3WJAA 4BGIA 3GH3A 4Q3CA 1V9LA 2VNAA 1TA4A 1DRUA 2ZTMA 2GZ3A 1DOHA 3VC7A 4PLVA 4QFDA 4HP8A 3PGXA 1VI2A 1ZO8A 1RYEA 2C82A 4XQ9A 4ZD6A 4JROA 4P8RA 4JBIA 1WZIA 3WXBA 4ND1A 3BTVA 3I9NA 4A2CA 2B37A 1MA0A 4GVXA 3EK2A 1DFGA 4XDYA 4OYRA 1I2BA 1IL0A 1AXEA 5TIIA 4IIVA 1QLJA 3F47A 2WD7A 2CVZA 3DC2A 3OIFA 2VHYA 1EBFA 4W4TA 3JV7A 4IDFA 3DONA 2ZATA 4UUPA 2ET6A 4YRDA 2I66A 3DBRB 1P1KA 3H9EO 4H16A 3WNQA 2J3IA 2AW5A 4W7IA 1RM0A 3ETEA 1NVTA 3AU9A 4RV9A 4YAJA 2FR1A 2OBNA 1R4MA 4KTVE 4CR6A 3KZVA 1I32A 1Q2XA 4ALJA 5JPIA 3K8ZA 1JAYA 4RORA 4D0SA 5T6BA 1ZEMA 3WFIA 3F1KA 5TNXA 5MGBA 2HK9A 3WGZA 2HKIA 5JYDA 4GPD1 5CP8A 3I3OA 3D64A 4UVEA 4XD2A 1IOLA 4IBOA 2GD1O 3SC6A 3UCFA 1CIVA 4B7XA 4ZN6A 3TL2A 5DCUA 2P5UA 1DIBA 2CUKA 3S1LA 4YRBA 1VLLA 4FD3A 3SX2A 4B7UA 4BQPA 1RWBA 2HJRA 1ORRA 2E48A 2HMVA 2ZIZA 4AG3A 2I76A 1PGJA 2QG4A 4E5YA 2I99A 1YB5A 4DBVO 1U28A 2D1YA 2Y1EA 6ADHA 4ZQEA 1F8FA 2PGLA 2AEJA 3KUXA 1R15A 1QYXA 3KYDB 3UOGA 2FY8A 4A5OA 3OICA 4U0JA 1F0YA 4M54A 4EJ6A 2JFGA 4CQLA 3G1TA 1H9AA 3K96A 5L45A 3MJEA 1ZJYA 5C7IO 2I65A 4UVHA 2OP0A 4K26A 2YHUA 4WLOA 3D4NA 3CIFA 4JGBA 4YAKA 1ULSA 3ZNPA 1PGOA 3IS3A 2DT5A 1XCBA 4JP3A 5ICMA 4YQYA 3RIHA 4ESOA 3PZBA 3VOSA 3QWFA 4NNJA 3VDRA 1ISMA 4XDZA 4E4YA 4E13A 1JW9B 1ENYA 1Z45A 5EMHA 3JYNA 1E0DA 3VAZA 5LCXA 3GEGA 4RPGA 2YFHA 3AM4A 1KEUA 3IDSA 1PJ2A 2VHVA 3GR6A 4DVJA 1JTVA 4YJFB 5KJ6A 1E5QA 5CFZA 5AVOA 1BGVA 3S55A 4ZGWA 4DLAA 5KWEA 3WYBA 4EBFA 4GWGA 1DC5A 1NHWA 1R4NB 2Y66A 3DZBA 3VZQA 1GADO 3D0OA 4OQZA 3UAGA 2YHIA 1P1IA 1UR5A 1X7GA 2DM6A 2Q2WA 2RH8A 5L7YA 2RH4A 1YJQA 3DQPA 2W2LA 1NYTA 3ZWAA 2Q1SA 4RZIA 1CERA 4XQEA 4CUJA 1MC5A 2HO5A 2FR0A 4MOWA 1E5LA 1PGNA 1PWZA 3NYWA 4MIYA 3VPXA 1NX6A 1G0NA 4PLGA 3GFGA 5A5EA 4MO2A 1XHLA 2GLXA 3D3EA 1D8AA 2EP5A 3QIVA 3IJPA 4WPGA 4CMCA 3QWHA 3WMWA 1HSZA 1ZIDA 2VZ8A 5G4KA 5J23A 2VHWA 1BWSA 3ANNA 2BLLA 4BUCA 4YRAA 4N7RA 2BD0A 1I3KA 3AW9A 4LMRA 4IDCA 4XYMA 5IAAA 1F06A 3KLPX 2OBYA 3D3WA 3MZ0A 2NADA 3NT2A 4BNGA 3LSYA 4EI2A 2DBZA 1DAPA 3FNHA 1A9ZA 1UDBA 3PXXA 2WD8A 1JQBA 1EFKA 3EHEA 1Q0QA 2Y1OA 1LEHA 3GMSA 4HFRA 4J1NA 2DBVO 1LSUA 3WG9A 1H6CA 2GZ1A 2I3AA 4MKZA 5IDYA 2EERA 3E5MA 3HDJA 3JQEA 1A72A 4LRSB 1MFZA 2WE8A 1PS9A 1EVZA 2D4AA 4PCVA 5EESA 3UKOA 4UUOA 5THKA 4M1QA 1BDBA 1P44A 4CM4B 1GZ3A 1GYQA 3S2EA 4CLDA 1ARZA 2FP4A 3EYWA 1QRRA 4FFLA 4BO9A 3COSA 5G0TA 2VRCD 3WMXA 4IJWA 2PD3A 9LDTA 4K6CA 5DBFA 1PZHA 2JHFA 1AUPA 1JAXA 3AJRA 4MP6A 4J1TA 4BNYA 5L4SA 4IXWA 5IZCA 3KTDA 1LSJA 1GEGA 2IEBA 5BSEA 5CDUA 1C1DA 4UEOA 1HDXA 3ZW8A 1GZ6A 4LSWA 3JQ9A 2VWGA 2EEZA 2XXBA 1LDGA 2YYYA 1PWXA 3KOUA 4R69A 3H4VA 4GX1A 3U0BA 4OXKA 4RVDA 3PP8A 1LNQA 1BXGA 3OP4A 3RD5A 4XQGA 3LVFO 2PTGA 4HY3A 3RKRA 4GMGA 2XF8A 1WDKA 4BIIA 3SXPA 1YJ8A 1PJ3A 2Z1MA 1QP8A 3H3JA 2ZB4A 2WTBA 1H94A 3C7AA 3RJ5A 4N5LA 1PZEA 1U3UA 4Y98A 5TQVA 1U4OA 1N5DA 3RQSA 3OQ6A 3GNTA 4D0RA 4KUGA 2BFAA 3AUUA 4YJFA 2Y1DA 5LDGA 3T7EA 3ZU3A 4IGFA 1B14A 4LGVA 3KEQA 2O50A 5EL0A 4BKUA 2AMFA 1I3LA 2R2GA 1EE9A 1O9BA 2R00C 1LA2A 4RPLA 5U4QA 3PLRA 5JCJD 2ZB3A 2VYVA 3BZUA 5ENDA 3VH4A 3NTOA 3TOXA 3I9OA 3PVZA 1T25A 3R1IA 3NDRA 4FJ2A 1V3TA 3I9JA 4KWIA 4BO6A 2NV6A 4R3WA 5IDQA 3D4PA 3FNEA 1T26A 3KBOA 1ZKMA 5ILOA 4R41A 3DOOA 3P19A 4IDEA 3RSHA 3TNLA 3INTA 2EKLA 3U49A 4L4SA 2LDBA 5HA5A 5CPFA 5L53A 5LDHA 5B1YA 4CM5A 1NAHA 1FDWA 2R00A 1E1NA 1E3LA 2QX7A 5IDXA 1LTHR 4CM6A 1ADBA 2W98A 2P91A 1KC3A 3KRTA 4MVJG 4QXMA 1WPQA 5EIOA 3MJVA 3RCBA 3F6YA 4LVUA 4MKXA 3FWZA 1GQQA 3R3SA 1I2CA 1OC2A 4J49A 4I5GA 2W4QA 1BHSA 4CV0A 1C1XB 3C3XA 4WOKA 2JCXA 1Z73A 1PJTA 4R3NA 2X6TA 4QO8A 2UYYA 3I5MA 1SEVA 1ZEJA 3NUGA 3KYCB 3GY0A 1DC3A 3IMFA 3L0DA 4ZU3A 1W73A 1Y9AA 2P9EA 5I9MA 4NFYA 1F8GA 4CMJA 4UAGA 4X54A 3JD3A 2IEDA 5A1TA 4OQYA 4PG6A 5KJ1A 3DZJA 5F5LA 4XGNA 4CV3A 3ORFA 1P1RA 4FFRA 4URFA 1ONPA 1ZK3A 5DULA 3UICA 3ONFA 1MB4A 3BMQB 4JIGA 4CLEA 4BO0A 4C4OA 2C5EA 1XYGA 1WLYA 1RJWA 5IF3A 1GEEA 4TRNA 5JMPA 3NEPX 1HYGA 4IJKA 1R66A 1DBVO 4LW8A 2AG8A 1DEHA 3RFTA 1K6XA 4BV8A 3OETA 1BW9B 3WGGA 3M6IA 4RQUA 4FPXA 1UP7A 4I8XA 5CPBA 1NPTO 3QSGA 3ASUA 1TT5A 5TGDA 3D1LA 4BL5A 5AOVA 1RPNA 1B26A 1EMDA 5C5IA 1HE4A 3U09A 3HNPA 2E37A 1J6UA 3JQBA 3PYMA 2X9VA 4DYDA 1NTOA 1YGYA 2Q50A 4Y6SA 1E7YA 4B4UA 1GV1A 2ZCUA 3B1FA 4IM7A 4GLOA 2PKRA 5F1KA 2A9FA 4RDHA 2NVUA 4YT4A 4D7AA 5DBGA 3GDFA 3AOEC 2VUUA 4CQMA 3FSRA 2UVDA 1P1FA 1AN9A 3RUDA 4B79A 2V6BA 4LSMA 1V8BA 5BNFA 2Y0CA 4I08A 3FWNA 2OZPA 3K2EA 4N5MA 5TT0A 1EEHA 2HRZA 4RCVA 2YZ7A 2VNSA 5EERA 4NBRA 3NJ4A 5JYEA 4AJJA 5IJZA 2X0IA 3JQDA 2VZ9A 4BB5A 4CLRA 2AXQA 1KVSA 5L40A 4R51A 4R68A 1HDCA 4CMKA 4U5QA 1HSOA 2DU8A 1U3TA 2WSBA 2X8LA 1NASA 3ADOA 4YB8A 4AJLA 2B5VA 2P9CA 1C14A 2EJVA 1Z75A 2Q1TA 2ZB8A 5KVVA 1YBMA 1BVRA 2B36A 1U2GA 1GFSA 3ZW9A 4YVFA 4ZQGA 5TS3A 1PR3A 2O3TA 1PJLA 4FIZA 3ST7A 1HRDA 2VTDA 5B4VA 3GHHA 1E7SA 2GERA 4FFPA 1PGQA 3ROQA 3DBHB 3RJ9A 3C1OA 4XKJA 2XXJA 5I9LA 3JD1A 3LZ6A 3TWOA 2GF2A 3F5QA 3GFBA 1VKOA 1VJTA 3TOZA 3E9QA 1G6KA 1GU7A 4EUHA 1I30A 3WFJA 1TLTA 4CMIA 3H9JA 4NR0A 4IDBA 4IY1A 2X7HA 3DBLA 5ITVA 5JY1A 3DZIA 4PVDA 2PZKA 3JQFC 1FDSA 4RLHA 2PD6A 2VRBA 3JQGB 1EFLA 1YBVA 4E0BA 2FPGA 4JQCA 2CNBA 5BNTA 3BA1A 4N5NA 3WGIA 2PFGA 4TKMA 5JMWA 3I4FA 1E3IA 2C0CA 3PTZA 4R1NA 4J7UA 1JVSA 1DPGA 5L9AA 2O3QA 3KSDO 1T2EA 3OH8A 3ICPA 1NFFA 4MIEA 4CM8B 1BW9A 1P9LA 3AUSA 4CM7A 1H2BA 2NU6A 1XELA 3OM9A 2C2YA 2YJZA 5G2OA 5G0SA 3RAJA 2P68A 4XR4A 4NK4A 1ONNA 4PLWA 4BNIA 1NFRA 2A94A 3PYXA 2J5QA 3CSDA 4BO4A 4PVCA 2NU7A 1LDBA 3QA9A 1P74A 2DTEA 4J90A 3GLQA 2PK3A 1FK8A 3C7CB 4F3YA 1XU7A 4NDNE 1ZVMA 3RBVA 3RC1A 1KEPA 3L6DA 3GA0A 1HYHA 4WEQA 2AG5A 3JYOA 1SO8A 3P2OA 3SJUA 5I8ZA 3TFQA 1E77A 1XIVA 5TJHA 4ZHSA 3RUCA 3FPCA 4Z3DA 4CMEA 3TQHA 2IZ1A 4WNCA 4TSKA 3T7CA 3FRJA 4XIJA 1HDRA 3UFXA 2CDCA 2J8ZA 3BMNA 2CZCA 5BSGA 1MC4A 4GSKA 1IPEA 4OSOA 4JXKA 5DOVA 4NJMA 1K6JA 4JJIA 4E32A 4M87A 1AHHA 4AJNA 3IP1A 3PQFA 4IZHA 4LN1A 3WB9A 5LC1A 3ANMA 1L7EA 4RZHA 4IDGA 1DDOA 1UXJA 3F46A 4FN4A 1DJQA 4YEDA 4P22A 3P2YA 2GCGA 4NZ9A 1H6BA 2UDPA 1NAIA 2Q4EA 1DAOA 1NNUA 4ZRNA 4CMBA 4EEXA 1X15A 4OIMA 1LJ8A 3JQAD 5L7WA 2DC1A 4A03A 3L07A 3BHIA 3H8VA 2BI7A 5FWNA 2GN6A 4Q3EA 4L8VA 1VRWA 3DZHA 4J0EA 4EJMA 4IMRA 2WWRA 5DBIA 5DNAA 1UH5A 1R12A 3Q9NA 2J5KA 4B3HA 4ITUA 2UUPA 5JC8A 3VPGA 1UDCA 1SBYA 4IS3A 4FQ8A 2P4QA 4XGIA 3A1NA 4WEOA 4Z0HO 1U5CA 1EQUA 1UAGA 2V6MA 4QTZA 3ZHYA 4RF5A 1YQDA 2PGJA 4MVJE 3ITKA 3ZGYA 1YQGA 4FJ1A 2DUUA 2YQ4A 2PZLA 5TF4A 1EUCA 3ZNOA 3JQGA 1PQWA 3Q3CA 2HK8A 4G65A 4PZEA 2AEMA 1Y9EA 5T67A 3RU7A 3V2HA 1SEPA 2X5KO 3CXRA 3JYLA 3U62A 1M66A 2GN8A 5U9CA 2QRJA 1HF3A 3FHLA 5T64A 4D46A 3BYZA 5A03A 3JYQA 2PA3A 1JN0A 1GYPA 3PWKA 4J6FA 3IKTA 2X23A 4NBUA 3DMTA 4XB2A 4B8WA 5CDSA 4HUJA 3EY4A 2WYUA 3FPLA 1YH3A 3PHIA 4QEDA 3VPSA 2DVMA 3H5AA 4GLLA 5GZ1A 3FCOA 2NNLD 1EQ2A 2B35A 2D8AA 4R5HA 4FC7A 5HWSA 2CDAA 5AXBA 3PFWO 4XJSA 5A9TA 1FDVA 1DIRA 2W2KA 2ZJ0A 4O0LA 4BNTA 4OM8A 4XYEA 2FN7A 3GPIA 3N58A 1EUDA 4O6VA 5DT9A 4WLFA 4R1SA 1IB6A 4DQUA 2YHIB 3B6ZA 4M8SA 3NAQA 4J0FA 1GR0A 4ALNA 1P33A 5HS4A 1PTJA 2DTDA 2DUWA 2O2YA 4FOSA 4L4XA 4OKNA 1NPYA 3W4JA 1AE1A 1PJQA 3L4BA 1B3RA 2HRBA 1ISGA 2B83A 2H63A 3WX0A 1Y6JA 4C7KA 4CM9D 4RVSA 1M2WA 1QR6A 4IJVA 1OBFO 1WW8A 4CM1A 3SEFA 2JD1A 2PGDA 1PU2A 2QZZA 1I8TA 1ADCA 3HE3A 4PGFA 3Q9UA 3ZCXA 2QQ5A 4EITA 3L4SO 1M6WA 3M1LA 3ZU2A 3JYPA 1E1LA 4JLWA 3KSUA 3JTMA 2C7VA 5DCYA 1MXHA 4Z0PA 1FF9A 5G4KB 3L9WA 1K0UA 2X9GA 3ZU4A 4B4WA 1GUFA 1N1GA 1DHRA 5HTOA 3JQ8A 3EC7A 2HQ1A 3ZV6A 1ISJA 2CSUA 4K9DA 1K5HA 4J7CA 4DRYA 4E5MA 3AY3A 3AUTA 3D3WB 4YA6A 2YV3A 3GMDA 3UXYA 1KY4A 1GQ2A 4TKLA 1L1FA 1DLJA 2O48X 2F1KA 4FS3A 2AHRA 1XQ1A 2Q3EA 2JD2A 1LQTA 2Q99A 4MKRA 1KVQA 1XWFA 3RUEA 4BGEA 4Z9XA 1U1IA 4ID9A 1KVTA 3QRWA 3MEQA 1WNTA 4TZTA 2EP7A 2J6IA 3K5PA 1LI4A 2JCYA 4A26A 4DA9A 4AJIA 3O8QA 4WLEA 5BQFA 2JFFA 1E3WA 3VZSA 1W6UA 2VT3A 3C24A 3RVDA 4AJ2A 1TVEA 3A9WA 3MOIA 4J91A 1E7WA 2GNAA 2ILTA 4GSLA 3D7LA 4INAA 4RLSA 4XQCA 3GVIA 5CDTA 7MDHA 5KKCA 1A27A 3ROKA 3RUAA 1DFHA 5KOIA 4R5MA 4YJDA 2O2SA 2C2XA 4HX5A 4EUFA 4B3IA 1C1DB 3ZWOA 1U5AA 3QY9A 3RKUA 4I5EA 2EKQA 3ZWPA 1H93A 1X1TA 3OSUA 3K31A 1UJMA 2Q1WA 4OOFA 1E7RA 1Y5MA 2DPHA 1BXGB 2QYTA 4WJZA 3I9MA 1P1HA 1Z7EA 4FJ0A 5KVCA 1I2ZA 2D2IA 3G79A 1NQTA 2VOJA 4GKBA 1YDEA 4IJUA 1P45A 3FNFA 3GQVA 4J1QA 4DQXA 2I5PO 3E1KA 4Y67A 4AJKA 2CVOA 1HL3A 4M89A 3H6KA 1VM6A 2X0JA 2WEKA 1HXHA 4NPCA 4PG4A 4K28A 2FZEA 3DHEA 3WS7A 4FR5A 3WIDA 4U7WA 4OOEA 2Y1CA 1PJCA 1E6UA 2HSDA 3ZWVA 1XGKA 2NU8A 3R3JA 3C7DB 1IE3A 3L6OO 3LU1A 1K2WA 2I3GA 3G17A 3GUCA 2FWMX 5IFLA 1I24A 4UEKA 2R6JA 3I9LA 2ZQZA 3U4HA 3A4VA 1DRVA 1O5IA 2VUTA 3ONDA 4EJ0A 1D4FA 2ZTUA 3E48A 4ZQHA 5B37A 3PPIA 3VVCA 1YB4A 3AM5A 3SC4A 1Q7GA 1H5QA 2EXXA 5DP2A 4BKOA 2X58A 4CL8A 3DL2A 3RUFA 1JA9A 4BNZA 4MJLA 3ZHBA 1N7HA 1CDOA 1A7AA 4G2NA 4S1VA 4ROSA 1E7QA 3WYCA 1ZNQO 4BKQA 4IXTA 5F1PA 3VH2A 4JJGA 3TRIA 4WLUA 3ICCA 3DOJA 4AL4A 3JCZA 4YJHA 1EK5A 5DP1A 4KUHA 5A9SA 4MVJD 3KV3O 4A7PA 1PS8A 4YXFA 1VJ1A 2RBEA 5KVQA 5I7FA 5IZCC 1ZXLA 3WNVA 8ADHA 5MDHA 5KJEA 2B0JA 3JQ9C 3ZH2A 2FR8A 2OL4A 1KIFA 5JW6A 1MXFA 1RYDA 3ZWYA 4TRRA 3U3XA 3A14A 4XB1A 1SNYA 3ETGA 4GBJA 2J3KA 2D3TA 2O7QA 4NIMA 2NSDA 3BAZA 3CMMA 5KJFA 1V6AA 1Y8QA 2YDXA 2D59A 3GRKA 4QSMA 2ZCVA 1AHIA 3F4BA 1D3AA 1YBAA 1ZSVA 1IYZA 2BGLA 4BNXA 4D3SA 1ADGA 4XRGA 1HLPA 1DLIA 3KO8A 1FDTA 3AM3A 4QO7A 4DTIA 1NQAO 1E1MA 2O23A 3QVXA 2J5RA 3UH1A 1CQIA 4E5PA 4F6CA 2JKVA 5A4DA 2BHLA 2JJYA 3PHJA 4YCAA 1O0SA 3RUHA 1KEWA 3RWBA 4XWYA 4DGSA 1TT5B 1X14A 3PGJA 4HV4A 3BIOA 3Q11A 5JDIC 1Q7CA 3QVOA 1L7DA 4YYZA 5C3MA 3GGPA 3LQFA 3P7MA 4L76A 1FJHA 5G0VA 5AYVA 3S2IA 4ND4A 3SJ7A 1TEHA 4QFCA 1J49A 1CYDA 1VC2A 1WWKA 1K6IA 5F3RA 3WBBA 4YAGA 4ZQFA 2HK7A 2OMEA 3B20A 2NVUB 3DTYA 4B4OA 4CMHA 5GZ3A 1JDJA 3BXXA 4CQMB 5FEUA 3TSCA 3DWFA 4HFNA 4ZVVA 1NQ5A 3CINA 3PI7A 3FBGA 4R1TA 2VRCA 1YDWA 5CEEA 2IXBA 4DWVA 3PJDA 2Q45A 4CMGA 5JDIA 2FSVA 3AFNA 4NBWA 2HMWA 4E33A 5JY6A 4KDFA 3DOCA 4YAIA 1BVUA 5KJCA 1U8FO 1HE3A 3GUYA 3QE3A 4CLRB 3BMCA 1PZGA 3GDOA 1OC4A 3E82A 1B7GO 2GO1A 3TPCA 1IY8A 1NVMB 3K30A 1HZZA 3CEAA 2J3JA 4D44A 2QW8A 1ENOA 3EW7A 3W6UA 4E5KA 1PQUA 3AFMA 2GYYA 1VPDA 1FDUA 1C0KA 3G3EA 3O38A 3OJ0A 3GF4A 4KZPA 1DSSG 4J4HA 1LQUA 1O94A 3U9LA 1XU9A 4WLVA 5COBA 4Q39A 4GAEA 1A71A 4KWHA 5JCJA 3CPSA 4YBZA 3TZKA 1HZJA 1QKIA 3SLGA 1BMDA 3GN2A 2X5JO 1UAYA 3ABIA 5F1OA 2C07A 2O3RA 4BNMA 4BNHA 2W90A 2HCTA 4PLFA 3Q6IA 2E6UX 2QRKA 2RCYA 4QX6A 5AXAA 2OXIA 4FOOA 4HFMA 1CEQA 1UXKA 1K89A 1UDAA 2AA3A 3AUAA 3V2UA 5K6AA 3E18A 3E9NA 3B1KA 4OL9A 4CMIB 5K9ZA 5I8WA 4B7CA 4DLLA 3HB5X 3GZ4A 4DPMA 4NG5A 1H6AA 2Q49A 4NFSA 3DBLB 3KSZO 1Y5RA 4PRLA 2AQHA 1W0CA 3VH3A 3JD2A 5A5FA 4BO8A 1LRKA 1TXGA 1DB3A 2E49A 4PRKA 5H82A 5B12A 3IJRA 3JQBC 2FZWA 1WZEA 3WGHA 5BSFA 1MUUA 1LDNA 2HAEA 3HADA 4KUEA 1VJ0A 4PN3A 5B4UA 4BNWA 1PZFA 2WYVA 3HDQA 1PSDA 4Z3KA 2NU9A 2OORA 3ZNQA 1CJCA 1U2DA 4QT0A 1F14A 4KDEA 3QWAA 3LC1O 4BKPA 1SPXA 4NHEA 3KYBA 5COAA 5U1PA 1ZZEA 1N8KA 5BT9A 3RC9A 1ZSNA 3PJEA 5JXWA 3GK3A 4PG5A 1QMGA 5HRUA 3WBFA 2CDBA 4B8ZA 3UN1A 4ONEA 4XEHA 4PLTA 3QW2A 3BTSA 1YONA 1QV6A 3D5TA 4IMPA 3WDSA 3PFFA 3TF5A 1E1KA 2CVQA 4BGVA 1LC0A 2Y0EA 4CM3A 4EZBA 4I9HA 4WCFA 3W8EA 4QUKA 3BMNB 3ZNNA 2X1HA 1SC6A 1E3SA 4Q9NA 4RPKA 5IN5A 1MFPA 1T24A 2I67A 4NJMB 4MINA 4ALLA 4YTEA 2FRDA 1CRWG 1OMOA 4YPOA 2WMDA 4ND3A 5T8KA 1BDMA 3T4EA 3MTJA 5COQA 3BTUA 1F12A 1Q0HA 2CD9A 4JX8A 3MWDB 5EINA 4W9NA 1Q7BA 3V1TC 3ADPA 2JFHA 1DFIA 3OIGA 3WQSB 4WGGA 3WLFA 1ZH8A 3HSKA 2IDZA 2BGKA 2VWHA 2Y93A 2ZKLA 3BMOA 3U4DA 5JCXA 2YFQA 2HUNA 1EUZA 4DPKA 1HKUA 4RL6A 1PGPA 1GV0A 4YACA 5TRTA 1QSGA 2C7GA 3GVPA 3M1AA 4LCEA 4DREA 4E2ZA 5JAZA 4RPJA 3H65A 4HFJA 3AOGA 3QVWA 4CJXA 4CLXA 2O4UX 2QRLA 4U6QA 2O4CA 4Z9YA 4J2OA 3GHYA 1QXSA 1ISFA 1YVEI 2Z95A 4L0QA 4EUEA 2Y68A 3PIIA 2IRWA 4DMMA 4BV9A 1UP6A 1MX3A 5JS6A 4E12A 4Q3NA 4M86A 4WNIA 3WSVA 4XJTA 2GRAA 3GAFA 2GN4A 5DCWA 4IPTA 3RASA 5CDGA 1R6DA 1ZK1A 4Q3BA 4CUKA 3ZWCA 1S7CA 5I9NA 3NV9A 2UUOA 3R0IA 3OQ1A 4OO3A 3EZLA 5A3VA 1X0XA 1YS4A 2O3JA 2Y05A 3O4RA 2IZZA 3ZWXA 2ZYAA 4IGEA 3GPDG 2JD0A 2F00A 3IUPA 4Z9FA 5GMOA 3HB4X 1UZMA 1B8UA 1GY8A 3UGKA 1CWUA 2DPGA 4FFNA 4TMFA 3WQRA 4E2YA 1UXHA 3EDMA 2JHGA 1N7GA 4CMEC 2XOXA 4AJEA 1U3WA 2WE7A 3JQAB 2DLDA 4PFJA 4LMPA 5FI5A 4N18A 1C3VA 2TMDA 2PKQP 4KQWA 3M2PA 2EIHA 3EUWA 3LT4A 1EBUA 4YT5A 4RF2A 1XLTA 3CE6A 3FF4A 1QG6A 3OMLA 4DPLA 1N2SA 2Q46A 1YB1A 1RM4A 4L75A 4UEJA 4NBVA 3UCEA 3CZRA 2H1SA 3MJ4A 1IUKA 1PJ4A 4RF4A 4WUVA 4A10A 1GCOA 1ZMTA 3HUDA 4IZIA 2W2KB 3WTCA 4XA8A 1LUAA 3ENKA 3BHMA 3LT2A 5L4LA 5EQDA 2OO5A 3WWYA 1EE2A 3ITDA 3H2ZA 4IINA 4U0KA 1H2HA 2NUAA 4PLZA 1UP4A 5TX7A 1AGNA 5JE8A 4Y8VA 3DFZA 2ZJ1A 2ZB7A 2ZYDA 3ZU5A 1VE9A 4OKIA 1YO6A 4BS9A 3E8XA 1O89A 1XQ6A 2X86A 3C1AA 4BO3A 1DHTA 2V7PA 1I36A 2VHZA 2BKAA 1JKJA 4BNNA 3KEOA 1YQXA 5JLAA 5JAQA 3PJFA 1OFGA 1GDHA 5G0UA 3HHPA 3FN4A 2FHSA 4WLNA 4GI2A 1KETA 3BHJA 3NGXA 2VYND 3VH1A 2DFVA 1T2CA 3N74A 3PJGA 3JD0A 2D5CA 3VZRA 1Y81A 3I83A 3JQ8B 3O26A 1R0LA 1I01A 2POQX 4RGBA 1E7MA 4AJOA 3GNSA 3VPHA 4O63O 4RVFA 3EVTA 1YOVA 4NMHA 1EK6A 1MV8A 2EHDA 2EKPA 3S2FA 3UCXA 3UHAA 1XEAA 2DFDA 3PK0A 1NP3A 2H9IA 3C1TA 4DC0A 5DF1A 4P38A 1I3NA 4NQZA 3H3FA 3ZI0A 3Q0EA 1GUZA 2EF1A 1YL7A 5HM8A 4O5OA 1E92A 3O8QB 3Q2IA 5JDCA 1GAEO 1B15A 1E3WB 2JAHA 3AY6A 4PG7A 3PHLA 4D43A 3O03A 3RFXA 3DMTC 4MVJF 1GL3A 1MGOA 3I6IA 4YT2A 5A04A 3ZV4A 5H83A 3LLVA 4FGSA 2NLOA 5A9RA 1E6WA 4DQVA 1AXGA 3IAHA 1TB4A 2NM0A 2GPTA 4UULA 2Y99A 3K73O 3RU9A 3GVXA 2VOEA 1GYRA 2QZ9A 3A28A 4ALKA 4BGUA 3OBBA 4J7XA 3DO5A 3HJAA 4LISA 4XYBA 3GG9A 3ZHXA 3IL2A 2YV1A 1T4BA 1E3EA 5FYDA 4HNGA 3IUSA 2YV2A 4BNUA 3ROPA 5BSHA 1C0PA 3JQAA 1HETA 4RQTA 3STHA 4Y6RA 2Z1NA 9LDBA 5IXSA 3ZV5A 4P4LA 4RF3A 5FFFA 5AQ1A 3KLMX 2QYSA 1PS0A 4R54A 4F45A 1XA0A 2NTJA 3L4BC 2VZ0A 3I9KA 3QJ5A 4YR9A 1NFQA 3GZNA 3ZDFA 3QQPA 4CLOA 4EGFA 4WOJA 2GDZA 2XPCA 4R01A 4H3VA 1M67A 4Z6KA 1UXGA 2V65A 3QV1A 3CUKA 2OP1A 5C7OO 1OI7A 2GSDA 4XRRA 4BMNA 1EDOA 1VSUA 2QHXA 3VVBA 3VKUA 1ADFA 3LYLA 4FC6A 5KCZA 1JKIA 5AXCA 2WDZA 3INGA 2YDYA 1ZMOA 1LLUA 3EZYA 5TSDA 1X7HA 2BGMA 4J4BA 1VL0A 4Y6PA 3TDKA 1RM3A 4GGOA 3I6QA 4XR9A 2QIOA 4L73A 1CQJA 1I3MA 1WAMA 2C54A 3JSAA 4BNKA 3HDHA 3NTRA 1Q1NA 3FR8A 1EDZA 1Y8RB 3OHSX 2H5LA 1GZ4A 4FFMA 4GQAA 4UVIA 3WIEA 3IOYA 2BELA 1YL5A 5ICSA 1HDOA 3IIEA 4JK3A 4R1UA 5CG2A 4B4VA 5L4NA 4AFNA 4J43A 3GDGA 1PR9A 1DC4A 1LLQA 2EWMA 4XYGA 1LDYA 5KNLA 1Z7BA 4HWKA 1JWAB 3KETA 2Y1FA 1W8DA 2NACA 1XKQA 4IIUA 4TRJA 2Q2QA 1B3BA 2WJPA 3V1UA 7ADHA 3LT0A 4MPDA 3E9MA 4ILKA 5IZ4A 1D7OA 1ENZA 4I9NA 3TZQA 5BNIA 4YJHB 1QORA 3CZMA 4OGWA 3UVEA 1N9GA 3ZWNA 1NPDA 4ND2A 3X2EA 3TN7A 2V6FA 2VUSA 5A9SB 3GVCA 3D4OA 4NBTA 3CKYA 3OEWA 5CDYA 1PL8A 1VL8A 2HMSA 3NTQA 3AU8A 4AICA 4UVDA 1WMAA 4ZA2A 2BFPA 4ZICA 1BG6A 1IZ9A 4XZ3A 4H15A 1LRJA 4IDDA 3KXDA 1M75A 3JQ7A 1WMBA 1P3DA 1PJSA 1BXKA 3FTPA 4CM9A 2PH3A 2EV9A 2NWQA 3NKLA 5JC1A 3MJSA 1IULA 1E3JA 4DIFA 2Z5LA 1G0OA 4NU6A 2BF7A 1Y8QB 3VHRA 4Q3AA 2ZYGA 3WGOA 1DC6A 1QYDA 2Y67A 3VDQA 2B4TO 3PZRA 5TC4A 1LSSA 1R16A 4DL9A 5ADHA 3X2FA 1I33A 4CLHA 4HKTA 4J1SA 1Z82A 1LX6A 2IE0A 2IZ0A 5CHEA 3VZPA 4P4GA 3TL3A 3U4CA 2B4QA 2W2LD 1B16A 3DZGA 3N7UA 2VQ3A 4BNJA 4F46A 3E6AA 2OHXA 3WICA 1R0KA 1SAYA 3F4LA 2NVBA 2B69A 2ZK7A 4PIVA 4D45A 1MG0A 4D41A 4BQRA 1GPDG 4U8GA 1O8CA 4DC1A 4EW6A 2FOIA 1GUYA 3ZWWA 2D5AA 1NXQA 3ONEA 1VSVA 3LT1A 4TVOA 5EPOA 3LDHA 5TT1A 1T4DA 4R9RA 3RROA 1GCUA 3DAGA 3GN1A 5L7TA 2X4GA 1N1EA 1MLDA 3PDJA 2I9PA 4II3A 2O7SA 4RVGA 4XX0A 2RHCA 4BB6A 4I9UA 1EZ4A 1JWBB 5JO0A 4J9VA 3ASVA 2A4KA 4ZJUA 3ENNA 1ISHA 2IODA 5DN9A 3HZZA 1PL7A 1PQPA 1JKFA 2PV7A 3PHHA 2BMAA 1Y8RA 2RAFA 2W8ZA 3ZHZA 5I7VA 5KIAA 2BFMA 1EVJA 3EGOA 3G0OA 3F9IA 3PYLA 1WDMA 5I7EA 2NTVA 1D1SA 1YL6A 3DXFA 1XSEA 3W4IA 1DIGA 1HDYA 4BHTA 3BMCB 1C0LA 2P5YA 4CL3A 4O59O 1QV7A 1UUFA 4GH5A 2PY6A 3DHNA 4BMVA 4D3FA 4HXYA 3LF1A 8LDHA 1GQYA 2G1UA 2PNFA 3UW3A 3E03A 3U4IA 1HE2A 4L4RA 4MP8A 1PEDA 3DBRA 3NT5A 4FW8A 2B4RO 4W82A 3UF0A 3OECA 3I52A 4J16A 4FBGA 2OUIA 1P31A 4W7HA 5IG2A 5JNLA 1O95A 3DAFA 3FTNA 2UV8A 5DDIP 1QYWA 4JJFA 4MVJM 4J4TA 2Y0DA 4GKVA 4GMFA 5IN4A 5F5NA 1NWHA 3A06A 3AI3A 5CG1A 2PZMA 3LK7A 1B8PA 3VTFA 2EG9A 4TVBA 4I5DA 2G5CA 2AQKA 5HS6A 1LXCA 5IDWA 2VTEA 5EN4A 1XR3A 1T2AA 2IYOA 1DXYA 3QWIA 3GT0A 3WOHA 2ZTLA 1LLCA 4RVUA 4WCDA 1ML3A 3PWSA 3QVSA 1LU9A 2CY0A 4MDHA 4YT8A 2PZJA 5KVSA 1R37A 1Z74A 3EAGA 4NU5A 1A4IA 2X0NA 3OJEA 4OSPA 2VYVD 4EDFA 4QQRA 3S2GA 3WJ7A 1ISIA 3IC5A 4YQZA 1PJBA 3MJCA 1PX0A 3KYDA 4FCCA 4BO2A 1LDMA 2C59A 3QLJA 4AJ1A 1LRLA 3NGLA 3SLKA 1TI7A 1NR7A 1PL6A 1ZCJA 1GTMA 4GGPA 4U6SA 5TJ9A 1E6EA 4PG8A 4CV2A 1U3VA 2OFPA 4OXYA 4R9SA 4DBZA 1T2FA 2FMUA 4DXHA 4MVJA 2TMGA 3OJOA 4P4NA 1IHXA 4M55A 4AJPA 2CF6A 4A73A 2OGUA 4JBHA 1MG5A 4AVYA 1U7HA 3W1VA 1H9BA 2YUTA 3OF2A 1C0IA 4MP3A 3K2BA 3PDUA 5ILGA 4IQ8A 3TZCA 4WCFB 4KTTE 2G0TA 2C20A 2NQ8A 3G49A 3FBTA 4WECA 4D42A 3ZV3A 1KYQA 4PZCA 3GGGA 1D1TA 3H5NA 4GX0A 5KTKA 5TLSA 1HWYA 1H6DA 4R4JA 4FGWA 1F17A 5ER9A 3EVNA 1R4NA 2P4HX 4HBGA 2CFCA 5K0ZA 2XAAA 3V8BA 1JLLA 4OHUA 2HLPA 1S6YA 3BMOB 5JAMA 2FSSA 3RC2A 5GZ6A 2EJWA 4AJHA 3IP3A 3WLEA 4PLCA 4CR7A 5CEFA 2AE2A 3OJLA 2Y1GA 1QYCA 2JL1A 3L77A 4IUYA 5K6AC 2GR9A 3V1YA 1BSVA 2O3UA 2P9GA 1WDLA 4QECA 4UUMA 1SOVA 4JBGA 1HYEA 3OFSA 4NFHA 3R6DA 3LLSA 1DIAA 3NDIA 1V3VA 2G82A 5KKAA 4W99A 3SBOA 3T4XA 1I5RA 1JU9A 3F3SA 2C5AA 1UZNA 4FSHA 1A5ZA 4R16A 3PIDA 1J4AA 1IHYA 2YW9A 5CAEA 4YJGB 3RUIA 4F6LA 1CF2O 1U7TA 5L3ZA 1R0SA 4LCJA 5EQFA 4XYLA 3MJTA 4K1LA 3AY7A 2DBQA 1RKXA 1H0KA 1Q0LA 3PQDA 1UXIA 3RC7A 4D3DA 1M76A 3GVHA 3GEDA 5A06A 5F21A 2HU2A 1KY5A 2HDHA 2PR2A 3OJFA 3RI3A 1M6HA 4RPHA 1YXMA 4TRMA 5ER6A 5BR7A 2JAPA 4IDAA 4J9UE 3LF2A 5EJ2A 1V3UA 2DBRA 4MIOA 1X0VA 3ZWBA 4DYVA 4CM4A 4CQMD 4G81A 2A35A 5JSFA 3B70A 3B1JA 4A27A 4E2XA 3DBVO 1GPJA 1ZJZA 4WCFC 1KVUA 1NHGA 3OA0A 5DZSA 3P5SA 4CPDA 4J3FA 1NQOA 3FI9A 2X0RA 1DRWA 5H81A 5L51A 3K92A 4RO0A 3AI1A 3TJRA 3FR7A 3GG2A 1T2DA 1WVGA 2J3HA
chains in the Genus database with same CATH superfamily
1L5HA 4ZHQA 3W3AA 5H9VA 1A7KA 5T8KC 1QLHA 4KGZA 5SZJA 1ZISA 3U7GA 2I4TA 1QTIA 4QULA 3BRWD 4OLJA 5ITWA 4PQYA 3KB6A 3CNOA 4YRQA 5FA8A 2P9FA 3V8RA 5JS7A 1GSAA 3AJDA 3I5XA 5HMLA 1AKNA 1J00A 1SBIA 3FYDA 1Y1KE 2PX8A 3DZKA 4GL4A 4U2KA 2BW0A 4E21A 3CUEF 1RM5A 2XLCA 4JH0A 3FNBA 3VO9A 1MB9A 3K9NA 5DGTA 2DF8A 3I9FA 3ZWMA 1RYNA 2ZUWA 1OLSB 4WXRA 2KM1A 4X6YA 4RJKA 6GPBA 1SULA 5I51A 1Y9ZA 2ZJFA 4UUNA 1O97D 4HADA 2YOFA 4JI2B 3EDOA 3S2UA 2QVCA 2JFQA 4B80A 4BVKA 4MEBA 2ODWA 5NULA 2JKYA 1OB2A 1V7QA 3GGOA 1SOMA 3RARA 4U8HA 3WR5A 3WC4A 2DKOA 4G1VA 4RSMA 5KMGB 1JDTA 4S3MA 4UBMA 3ZHTA 3H7AA 5LZ9A 3RK1A 3PVCA 4TTJA 2H1RA 1IZ0A 2EW2A 3C97A 4GP7A 5JI2E 4NH4A 3ER8A 4RTLA 1DUSA 5SYNA 2LKDA 4OX9B 1E1RD 1Y3CE 1R0XA 3M2TA 3EMVA 3DR3A 3KDSE 2OY0A 3M7IA 4MVJI 4UDNA 1E2QA 4RTJA 4AQYB 1DKMA 3CTMA 1YE3A 3EXHB 4DNXA 3KKQA 1L4MA 4L8LA 3PE6A 4CKCB 2NZYA 5ARBA 3HXMA 1K8YB 2H4HA 1Z6ZA 2JHPA 1G7CA 2JFWA 5TMDA 1UBJS 4Q9HA 1L5KA 3CNHA 1F48A 3ZY4A 4FILA 4HYEA 4QYXA 1XZCA 1KOLA 4JBLA 2H6EA 5E4FA 5HKLA 1YHZA 2GPBA 2XQIA 4DCUA 1HNNA 3NEJA 4JJ6A 3ANSA 3D5QA 4NECA 1XLVA 4OLFA 4EWLA 5AVZA 3U7HB 1KC1A 2CHUA 2IYVA 1JZQA 2PLAA 1YOVB 2JGMA 5DLPA 1G5FA 3WGYA 5JO9A 4YRFA 3G9XA 3T9DA 3S7TA 1RXWA 1P0CA 4IQ0A 1SB8A 3V34A 3PLNA 1IQUA 4RD6A 5ICGA 2NP7A 3DMPA 2PWZA 1DBSA 3PICA 4ZVOA 1RYMA 2J4DA 4JU8A 4OVKA 2JANA 3ZQJA 3NWBA 3O8NA 3CVUA 1VG8A 4JCOA 4Q4JB 2VHXA 1T3GA 1CRQA 5FF9A 1Z4PX 4BMYA 1QK4A 2P6UA 3OOSA 4J0KA 4KFSA 5AKJA 1L7BA 2EW8A 5DTQA 1KH2A 4REQA 3ZHRA 4LY0A 3F5MA 3SYNA 2HA3A 2QW0X 4Q82A 4QKQA 4ZCLA 5JAIA 5E6RA 1DIHA 1E9FA 2G76A 5AVTA 3G5LA 3GRRA 1NBOA 4C4TA 4D4MA 4PO9A 4MICA 1DKRA 1KZ6A 1VKNA 2OOSA 3LLCA 4QAQA 1MX1A 4ZV4A 5MFPA 2P2LA 2BFOA 3C85A 1KAQA 1A9YA 4MWDA 1U9ZA 4A8JB 1MA3A 2OO5C 3R20A 2GEKA 5BN4A 3PD0A 1QF6A 3MBIA 1KJNA 1OXVA 3MXTA 2JH8A 4LOJA 5EPEA 3TDNA 2BMEA 2ZWMA 3DE7X 2YYZA 2PGNA 1MIOA 3SS8A 4I55F 2XUGA 4CMAA 4K6FA 2WQ6A 4JP8A 5CXSA 1USIA 4P82A 3L7NA 1XD2A 1ODTC 4Y18A 5H02A 1CLEA 1ZH4A 2GXSA 4MS1B 1E0JA 2R1ZA 3NIDB 1JQDA 3DM5A 1TT7A 4AWXA 4LV8B 5KZMB 1U2TA 3RRFA 1KFBB 4HAOA 4RVHA 2E1RA 1TM5E 2H2HA 4CZ2A 5AM3A 4Y3UA 3OZAA 2XHEA 3ZOZA 4F9EA 2E87A 4UREA 2J45A 2CCJA 3H99A 4ENTA 1RHRA 4PM4A 3PEYA 3FLBA 4I1IA 3OA2A 1DWQA 1NV9A 1Z0JA 1Z0AA 4A8PA 4FM9A 2QP4A 3UQZA 1VKJA 5EMMA 4AS2A 1VZ2A 1IY1A 2QM8A 4M36A 3QW4B 4DCJA 3ZUPA 1X1EA 3DFUA 5EVJA 3UTCA 3J7AC 2ZAIA 3UMMA 4TZ0A 1ZY2A 3NHSA 5EKDA 1CQJB 1EAMA 5T5QA 2FWAA 1F5SA 4JELA 4NYIR 4AS3A 3O9ZA 4BRSA 1DBWA 3BD6A 1KVRA 3Q87B 3PFCA 2B3DA 4E30A 2SBTA 4HX2A 5F98A 2J3DA 2R751 4X6LA 4XASA 4XUCA 3FX2A 3L7LA 1G2QA 4PRYA 2R3SA 4PU0A 1O08A 4BU0A 3FOCA 3Q2KA 4LK3A 1MTZA 1CJTC 1SURA 2VWPA 3ETDA 3ME5A 4NP6A 4RDIA 1Y4SA 3RFVA 2J48A 1CJKC 4RJJA 3O7WA 3K9HA 1K3TA 5HUQA 4E31A 4H1WA 5CFLA 4FZJA 2OWDA 2QU8A 3PFGA 2D2EA 3PRJA 3USES 1ZXBA 4LC9A 4RTRA 2ZQYA 3DCYA 4UE2A 1L5MA 1QZ3A 3KZOA 1Z68A 1GL6A 4ZAFA 1C7FA 3RQIA 2ZZNA 1MR3F 1FMCA 1VZ3A 1Z13A 4JBYA 3KAJA 4XGKA 4MEJA 1FVHA 4NBSA 1Z34A 3EGIA 4BPBA 1RKQA 3SKVA 1ENPA 3K4HA 1N2CB 5GJCA 1HI9A 1W75A 1XK6A 4OXNA 3UOAB 2FDCA 3RV3A 3UMBA 3F6RA 2AR9A 1ZUIA 4P9NA 1KYWA 1AKWA 1P6XA 2GESA 1DJOA 1IOZA 2FSPA 2JS7A 3SSAA 4R8SA 4EY8A 2R8EA 4JJEA 1JNYA 1KERA 4YRCA 1P4AA 3HBMA 4GX2A 1YBHA 4KIWA 4G8DA 1PUJA 4B45A 3TOSA 3B36A 1RTTA 3B85A 3U40A 1JNXX 2I80A 2H1IA 2VC2B 2C5GA 1BZYA 2QRZA 1X7YB 2XHZA 2GTHA 3D8UA 5FOXA 2CF5A 4EFDA 1MW9X 4ZVSA 2ZT7A 3QPBA 1IAVA 2C29D 3W0LB 1E20A 3WL5A 3OFVA 1CETA 4WGFA 3GNQA 3Q3VA 2O2HA 3I4CA 4AG6A 4KMSA 1OAAA 4TL8A 3IUBA 1J24A 3KXPA 5G4LA 5HK8A 4PFQA 1AQYA 3ROMA 2BZ0A 1MZPA 3ND7A 3RYIA 3RG8A 4XLLA 2NTYC 1YWGO 3GFOA 1B1AA 5KWSA 2K6GA 3RAEC 1D7AA 1UZLA 1BOFA 1CVLA 2HJSA 1AGXA 2JLCA 1JQAA 1XJWA 1ZSYA 2O1WA 2HIAA 1FP7A 3SR4A 1UMCB 4IR7A 4HB2A 2AD5A 4QQNA 2KBEA 3D0KA 2DKFA 3GL9A 5HXAA 3HYCA 3KQNA 1IN8A 2XH8A 4KQGA 1JRLA 5BRAA 1LBEA 3L7DA 2PRKA 3DVLA 5E4JA 3PPXA 2WMOB 4ARUA 8ABPA 3FHJA 1RXUA 1T1SA 2W0SA 3RIGA 2QU7A 4JLJA 2VAMA 3G9TA 3W8DA 4PE5B 1AF4A 3PGLA 3VHXA 4C3VA 1DT3A 1WY5A 1BQEA 1P0MA 3OT1A 3R23A 3TLCA 5IULC 2DFKB 1L3IA 3MCUA 1QG0A 2YQ5A 3MSXA 1G7TA 2ZE6A 4YIKA 4ZMBA 3LX6A 1YKFA 1ZK4A 2A5GA 4W1PA 1J0XO 1G1MA 4GI7A 5CD9A 1U3GA 4ZQBA 2Y27A 3GCZA 2IXDA 2AEFA 1Y9JA 3RAFC 4B3FX 5J2TA 3AJEA 2WYWA 4FYMA 1SZJG 5EE0A 2O8BB 1QP4A 4BGIA 3KOZA 5BXYA 4KXXA 1FSGA 3ZS8A 2CVHA 4EHLA 4ER3A 2F3PA 2ZTMA 3TLZA 4YMLA 1DOHA 4QU0A 3SX0A 2GILA 4RTOA 1TW3A 4N7JA 2R8RA 3PGXA 1NW3A 1G7RA 1TJ3A 2BBTA 4ZALA 3CVJA 2ZUBA 2EFEB 4JROA 3N8NA 4MYRA 3SEQA 3CG0A 3QKWA 1NXPA 1OILA 5E4TA 1KYIA 4GVXA 3ESAA 4PZAA 4RIGA 4XDYA 4C0BA 3I6YA 5LIRA 3PR2B 2B8EA 1IL0A 4LSZA 3EYAA 3IOBA 2Q4OA 1II8A 1KJJA 1OI2A 3VDXA 3F47A 4ZOLB 2UUCB 2XBUA 3HCOA 3PKIA 3EAFA 2WUWE 2IBSA 5HCNA 3HB0A 4FWTA 2MSKA 2W83A 3JV7A 4C22A 4IDFA 3H86A 3RKSA 4DADA 1NUUA 2WIJA 4D96A 4IKOA 2PGXA 3WNQA 4H16A 4OQ4A 2J3IA 2AW5A 4W7IA 3ACCA 4DOMA 1F51E 3IQIX 4IGAA 5TGZA 3X43A 4X71A 2AXEA 2BWJA 1MNAA 4Z4GA 1U2PA 4ISCA 3FB4A 1DX9A 2HH9A 2O52A 1N2CA 3N05A 1E69A 1EK2A 4FR0A 3LKVA 1SBNE 2JH3A 5KC9A 4NZMA 3MHTA 3PQCA 5TNXA 1TTQB 2DY1A 5CYPA 2HKIA 1DTSA 1EHCA 1BQ4A 2Z57A 3D64A 3K9BA 3M3HA 1IOLA 4CF6A 4MB6A 1N9KA 1RYBA 3MWJA 2GD1O 5E2BA 2QA5A 2N1BA 3I61A 3RAPR 1QB7A 3L6RA 3K70B 5FP0A 2AEEA 1P5HA 4HYQA 4D2IA 3IQFA 4DCGA 1EFPA 1TE2A 1WMEA 1ZI8A 4F2PA 2EX4A 4PZYA 1I13A 3GJSA 3OF5A 3E7DA 2HJRA 2R6R1 1N5RA 1P2FA 2HMVA 1D9ZA 3BIFA 4YALA 2ZGVA 3OCXA 3TXXA 3CURA 4W5OA 5AI5A 3OCZA 1KOFA 6ADHA 2D1YA 2Z2KA 4JC4A 1JA1A 4ZQEA 1JDVA 4ZT7A 4QJ3A 1MQ9A 3HXLA 3FPEA 1ODIA 2O06A 3KUXA 4QYWA 1R15A 2C3OA 3KYDB 2IY9A 4A5OA 2V98A 4NCXA 5C5CA 4MSUA 3L0CA 1RPJA 1U2ZA 2G4CA 4ZPXA 1UMCA 3OE7D 4IFEA 1XQYA 4ARSA 1F4VA 3RIMA 1TK3A 2HQOA 4A0RA 1FFSA 2G71A 4ARCA 3T1VA 1VE7A 4MI9A 3WGMA 3E35A 2W6MA 3MJEA 1GZVA 4OHMA 2O8FB 4OQQA 2I65A 2BJHA 3N3BC 2IS2A 1JDBC 2PO5A 1ESDA 3C70A 4HQRA 2Z43A 4Q4HA 4UVHA 2YHUA 2D2XA 2JGKA 2FQYA 5AVKA 1VMIA 4NWIA 3OM1A 1IJBA 4XOUA 4J07A 1SUPA 3LLMA 3QFSA 1A5TA 2DT8A 2FW0A 3KPWA 4LBVA 2MYTA 3I9V6 4X94A 5I3ZA 4DB2A 5ICMA 3OC6A 1Z4MA 1ZL0A 3QI2A 4TKUA 2QMYA 2RHMA 4DHEA 4MCHA 1W0JD 3VDRA 1RKBA 5K3FB 5K3AA 1G63A 2B3TA 2OXCA 5CFOA 2X6QA 5EMHA 2AK2A 4Z7OB 4YV1A 3IOMA 2O8BA 1E0DA 2YNMA 3CLVA 1T5SA 2IEIA 5LCXA 1MHTA 5C4GB 3OZ7A 3IDSA 2VHVA 2WFMA 4MR8B 3X0DA 5E9WA 3MD9A 5JASA 3CWQA 4ZDJA 1TM7E 3EZXA 1YE8A 1E5QA 1WX1A 2UYQA 2YZ2A 5AVOA 5GVRA 2OEPA 1BGVA 4GPIB 4I55A 3VI4B 3WYBA 5EHXA 1YA6A 4FYIA 1O95C 1NT2A 1PR5A 4R2IA 3D0OA 4UU1A 2YHIA 3K1YA 1D6MA 3IR6A 2DM6A 4PRZA 4AP9A 1JLLB 4ENVA 2ONZA 2RH4A 4QZVA 3DQPA 3PDIA 2W2LA 1UFVA 1Z5VA 2LCFA 3F97A 1NYTA 4JFRA 1D4AA 5ENZA 1B4DA 2CK3A 1Z33A 4DYHA 3VYTB 2Q1SA 5FWXB 1RMTA 3ZXIA 4XQEA 1W8IA 4M0CA 4OUDB 4CUJA 4D9JA 1FJ2A 1SBCA 3GEHA 3ELDA 3IALA 1K8XB 4QARA 1M8JA 1PWZA 3NIFB 5F7ZA 3MCTA 3NBYC 3VPXA 3GFGA 4MO2A 5DN6A 3H6GA 4FHFA 1F6BA 2CYAA 2GLXA 3IO5A 2Q5IA 3CG4A 1B74A 4ON9A 1ID8A 3DPUA 3N59A 3IJPA 2WJVA 4XVQA 4EHIA 5AVSA 4W5RA 4WPGA 4CMCA 2BE9A 3WMWA 2IYRA 2VHTA 5LN1A 1I3OA 5G4KA 3SQOA 2VHWA 1BWSA 4KX3A 5J23A 1FFGA 3HVUA 3OLWA 4BUCA 3HC7A 4I8DA 2C9OA 1OIXA 1YR2A 3NVAA 2Q0SA 2B30A 2FVYA 1K7XB 4IJ6A 1H23A 1UQTA 3IPAA 2OQRA 2VJCA 4JLSA 4Q9IA 1GN9A 3A2NA 3RFFA 1KDTA 3D3WA 3MZ0A 2ONKA 5JNTA 3CCCA 1RFGE 4BNGA 4OMFG 3UMYA 4Y6SA 4EI2A 3E0XA 3C74A 4B6OA 3HKDB 3QKSA 3DMGA 2ERYA 2RB5A 4QOGA 4CF4A 2L0XA 3FZEA 4MCIA 1KKLA 4DEVA 5FV4A 1Y33E 2DQSA 1M2GA 1TIBA 3DMRA 3S68A 2JAUA 1H6CA 1BXRB 3OBIA 3EXG1 4RFVA 2EERA 3E5MA 4G26A 3BD9A 3DVAA 2R97A 3R3YA 4B74A 1AJEA 3QPCA 1ATZA 1MFZA 1VSTA 3EZ9A 5CLHA 1T34A 3N2YA 4PCVA 3VBEA 4UUOA 4I4NA 1UOEA 1BDBA 1P44A 2EX1A 4CM4B 3T54A 1GYQA 5JNVA 2Y6UA 3K6SB 3TQFA 1WPGA 4IJWA 2PD3A 3FJOA 4R71A 3SQMA 4UUBA 2CBZA 2VHEA 4J1TA 3ED5A 3O21A 3Q7PA 2IGTA 4GG1A 5BQPA 4AI6A 4YX9A 1HT3A 4QJBA 1GEGA 1E2FA 2GZSA 3K0BA 4W63A 1KAMA 1I4LD 4DM4A 3KNZA 1QFZA 1C1DA 1YS9A 2VSFA 3UWSA 5T4FA 1U80A 1DJPA 1ND5A 2VEDA 1G19A 1Q77A 4JR2A 2RONA 5IVIA 3U0BA 4OXKA 4IZOA 1RPAA 1BXGA 1W2HA 4OP3A 4D97A 2W2PA 5IJXA 4XQGA 1ZWLA 1BE0A 1C2YA 2NV2B 2PTGA 2ST1A 5K3FA 3RKRA 2XF8A 4RKRA 1IRIA 3KCQA 2LPMA 4S35A 1QP8A 2CXRA 3L0OA 4RKWA 2ZB4A 3RS0A 2PQ2A 3OAAA 1ODLA 4ZCRA 4NY1A 4V02A 5ITSA 1RAIA 4Y98A 5TQVA 5J1SB 4LQLA 1N8NA 3KYIB 1TGYA 5LDGA 4Q3KA 4IGFA 1N3BA 2AV6A 4IIYA 1B14A 4LGVA 2CMGA 2I54A 2R85A 5EL0A 1I3LA 4BX8A 1GQSA 2AUNA 2R00C 3T5MA 3LWZA 1X39A 2XMDA 4N3BA 5ENDA 2G67A 3TW6A 1OZGA 5EWMB 1SUIA 4FDMA 3KLBA 1NVAA 4XAQA 4B2LA 4DE5A 5CA0B 3NDRA 2QNBA 5K8JB 3C15C 4S2UA 4BO6A 4BQSA 5JAHA 3IEMA 2E4XA 3V8PA 4X1YB 1PNRA 1BCRB 2ILVA 3D4PA 5HILA 1MVLA 1RI5A 3A10A 4E0BA 1E59A 1ZKMA 3NLLA 4MRAA 1O3YA 1QDEA 1Y63A 3EGXA 3H18A 4IDEA 3T5AA 2ZS8A 1UL1X 2GFQA 2AN5A 3T3MB 4KXFB 3U49A 4OY3A 3I42A 3INYA 1JWLA 2BTOA 4QUAA 2OLJA 3DKIA 5CPFA 3WKCA 1EX7A 2IBMA 4AW9A 5L53A 5LDHA 3FUWA 5JJIA 4CM5A 3FIJA 1IN1A 5CH5A 2VAWA 1E3LA 3W2GA 1US8B 4RS4A 1BE8A 4B44A 1EFTA 1Z28A 3FYUA 1HH4A 4CIDA 1YZFA 2PSJA 3OESA 3ABRB 4MGIR 3V32A 4QXMA 1GNPA 1WPQA 1ZHHA 3RCBA 1WP9A 2BFEA 3ZZTA 3KTOA 1P75A 5HE9A 2YJ6A 1GQQA 4IF6A 4CTKA 5KPDA 1PV2A 1Y48E 3A27A 4OJYA 2CNKA 1V47A 4QREA 4CCYB 4TYNA 3R9KA 1C1XB 4WOKA 4RMGA 5KWIA 5KDLA 4Q00A 2X7XA 1KMHB 1LJLA 3LRXA 4G1MB 4OBXA 3HEBA 4R3NA 1FL9A 4KK4A 2NZ2A 2UYYA 3EZNA 4WW0A 3WMEA 3ZDAA 5EJ5A 3HKDA 3M4JA 2Z56A 4IUCS 2DUMA 4C7OB 1E4VA 1O54A 5EHNA 3KYCB 3DS8A 3DWGA 1DC3A 1EFDN 1QGED 3WHKA 4RVCA 4H7IA 2WICA 1Y9AA 1XTQA 2B1QA 3RHZA 5AW0A 2PWBA 3A1UA 1YCHA 5IJ0B 2V1XA 4MKGA 3VYSB 4UAGA 4CMJA 5HR5A 1U5BB 4PQGA 1GL9B 2FQXA 5A1TA 5EKTA 1AZWA 4PG6A 4PPYA 1POWA 4XGNA 4HOYA 2FMIA 2OVBA 3PXEA 1Z06A 5JNWA 2HNKA 1G2IA 1THMA 3DLHA 4JUIA 1ZK3A 3BA6A 1ZNYA 5DULA 4GYYA 3UICA 3NNSA 2JARA 3ONFA 5M29A 4BXOA 4MNTA 4C4OA 1O96A 5T3UA 1R6AA 2C5EA 2NQ2C 4F4FA 1UBOS 5MN4A 3IQHX 2I8AA 1WLYA 2CV2A 1RJWA 4YONB 3H5VA 1GEEA 3UJHA 3VU1A 2VDUE 3WP0A 5BQ3A 4MW2A 1XXHA 1R66A 3SIRA 3CLSC 5JJLA 1DJMA 2PAAA 3VKHA 2HY7A 4JJZA 2DFLA 2NGRA 1XZBA 1SHLA 2VDWB 4P80A 4ABTA 3KUDA 4B5KA 3G9ZA 1JBEA 1GN8A 2NU6B 1MO4A 3E3OA 3M6IA 2I22A 4RQUA 3STTA 1XNRB 4DB4A 4BQNA 2FEPA 3TQTA 1JXMA 3KYJB 1MO6A 1T1EA 2WT9A 2R4TA 3BH0A 4JJ4A 5ES4B 4Y6OA 2L82A 1B26A 1GTG1 2HLDA 3C98A 3CLHA 3WO1A 1MQ8B 4QASA 3U09A 1WUYA 2CFIA 4QSHA 3L1IA 5D3ZA 5HFAA 1OXTA 5I45A 2X9VA 1SC1A 4NC9A 4ZIRA 3TNFA 3HU2A 1BWRA 1Y8AA 1CY4A 1NTOA 2C2OA 2JI7A 1E7YA 1UPUA 2Q50A 3IHWA 4KH0A 3GFQA 2Z6AA 5A0VA 2ZQ5A 3B1FA 4IM7A 5AVQA 4GLOA 1ZAKA 3HBFA 1YBFA 3LXMA 3NNNA 2DWPA 2BY4A 2ZG6A 3GDFA 2XRYA 1ORDA 4C0KA 2ZBDA 4N03A 3UFXB 4UDOA 3MA0A 5DLEA 2B1IA 3KS9A 1P1FA 2E5WA 3H83A 2FFQA 2V6BA 3D3QA 4W1QA 1V8BA 4I08A 4TX1A 5TY0A 2J7PD 3I73A 3CRZA 1L4NA 3AB8A 2EU8A 4PXAA 4GZ6A 4Q34A 4U2FA 4N5MA 4YUVA 1FLNA 1PFWA 3L0IB 2NVOA 1E2PA 4K8OA 4NMMA 3ZBQA 3N0XA 2G5GX 3ECSA 1RDFA 1QQAA 1SVKA 2QTLA 4MUHA 2RGGA 3G7SA 4GFDA 5I7HA 1JV2B 3GWGA 5C35A 5IJZA 3BRWA 1US8A 2HSEA 2X0IA 3CQ9A 1U1EA 4QUEA 3FLEA 3M9WA 4MPRA 1XAIA 2PSEA 3IBSA 1HSOA 3O8OB 1WSWA 4B75A 3K2QA 1JYFA 4P3NA 5A5VA 4Z7QB 1CJBA 2X8LA 1NASA 3DE3X 3ZHVA 2BGRA 2OR3A 4NE7A 2VA9A 3DP9A 4NL4H 4EAAA 4CCYA 4Z54A 1Z75A 2Q1TA 2Z8YA 1G59A 1HMPA 4LXGA 3BX1A 2IE8A 5ALIA 2H2WA 4A8JA 2ENUA 4GI1A 1PR3A 3FFWA 5K0NA 5HM6A 3WSTA 3BJMA 4M38A 5E2AA 3IUEA 3ST7A 2VTDA 3GHHA 3RH0A 1HFWA 2GERA 3LS2A 4IKPA 3ROQA 2WWYA 1HC7A 1DO0A 3UATA 5I9LA 4FFBA 2R6GA 3NPAA 4ZMSA 3LZ6A 3QMPA 1GDDA 2Z98A 5CT4A 2WNHA 3CY6A 4HDRB 4LJ9A 2IU0A 3SZ3A 3ZDDA 1VKOA 2WHPA 1VJTA 1GT91 3E9QA 3IUNA 2WZBA 3NHMA 4TWAA 4BZWA 1G6KA 1E1RA 4EUHA 2BI4A 3DE0X 1U7DA 3ENZA 3D8BA 3H9JA 4IY1A 4KO4S 3I5YA 3IPRA 1RHJA 1B43A 3GA7A 3DZIA 4COKA 4GC9A 4BLSA 2PZKA 4PS1A 3OPYI 1GRRA 1FDSA 2REOA 3O8LA 3KJXA 3PC6A 4GMKA 2VRBA 1N2IA 4RLHA 1EHYA 4E6EA 3VU0A 1EFLA 2XQVA 2I1QA 1K8RA 2CDNA 3QPDA 4NKRA 3VU3A 1SIBE 1C50A 4ZYLA 1K88A 3LGAA 2PFGA 2GJKA 5JMWA 2PYZA 2CFSA 3CNLA 4G07A 1SCQA 3VC1A 4O3MA 4LTNA 1OV4A 3AHHA 3PTZA 1MT0A 4R1NA 4C6TB 4Q4CA 1SKUA 1XQWA 4R8LA 4XI9A 1JTEA 3IJEB 3M1YA 2CE7A 4LQCA 1P6QA 1E2BA 1NFFA 4Q1VA 1V95A 3KDPA 4MIEA 5LQKA 4FHZA 3AUSA 2NU6A 3ILHA 1SA0B 2ZWAA 3CW2A 2YJZA 3AF2A 2PA0A 2WJ6A 1XFDA 3D7NA 4ZANA 5G0SA 4C89A 1GFIA 1N0WA 2P68A 1FCJA 4NK4A 4N5DA 2D1QA 4XR4A 3ZOKA 4ENWA 1RI1A 5C52B 2ZIAA 3HGQA 3C16C 2P62A 3IEKA 1ISRA 2A94A 3CSDA 2H4YA 2ZIVB 3GJ6A 2IYLD 3P0FA 3R5FA 4M21A 2YHSA 2V97A 5CU7A 3VHLB 2IZ6A 1X8XA 2PK3A 4EAQA 4MR7B 1Q15A 2QJTA 4F3YA 4NDNE 4XWTA 1EWTA 3RNOA 5AHWA 4E5UA 3W5CA 3GA0A 3ELYA 3FUCA 2XGMA 3GP5A 4PAQA 1DXHA 5AMXA 5TJHA 1ESMA 2AFHB 3FYSA 4DAEA 1P5ZB 2ZAMA 1KDZA 4ZYYA 2NIPA 5DNCA 1J07A 2QUKA 4Z3DA 4KPEC 2IKQA 4XIJA 3UFXA 1HDRA 4EVQA 1O0CA 2MWMA 3GJXC 5A3RA 2CZCA 2ACVA 4GSKA 1R10A 5BSGA 3DCNA 1HDEA 3IEUA 2RGUA 3LUCA 3Q8XB 3WVNA 4V1CB 4UM9B 2QLNA 2O8NA 2V7WA 1E6KA 3HA5A 2M98A 3KSBC 3BWBA 3NHZA 4NESA 4QUHA 1J0BA 4AJNA 4B73A 4S2EA 2F4NA 2I9KA 4F7WA 2P4SA 3RSCA 4Y2YA 5LC1A 3IVGA 3ZDEA 2YW2A 3QNUA 4NONA 4RZHA 3LFUA 4B87A 4CKEB 1FJGB 4ZC1A 1DDOA 1UXJA 1UWLA 3F46A 4OEHA 3GIDA 4OCZA 4K9QA 1QPZA 2JAQA 1ZMXA 4AUNA 2UDPA 2BR5A 4F3CA 4ARBA 1TVMA 2Q4EA 3VU9A 1ECFA 1MJHA 4QDUA 1PFVA 3LDFA 1LWOA 2XAUA 5B6JA 3DMHA 1NNUA 1ZITA 3ORSA 4CG1A 3KQOA 2DGDA 3NUZA 1NY6A 3NTLA 4TL6A 3TQCA 4XCXA 2DC1A 2C9MA 5K0EA 4UZFA 2BI7A 2R6ZA 1MOZA 2TECE 1T9KA 2FE4A 2XUHA 3I39X 4DARA 4C01A 1YGPA 3I2IA 2BCEA 1E4OA 3DZHA 5B7PA 5HIAA 2ZR0A 5EMLA 3MUFA 1E89A 5DHQA 2FTKE 4ZXFA 3ZHOA 4NXNB 1E60A 3U80A 5IASA 10MHA 1QYIA 1Z0ZA 3AEUB 4WDRA 1SBYA 2IY7A 3JW8A 3ET5A 1A9TA 1UJBA 1RE1A 4J76A 3EGDA 2WUVA 4KO1S 4Y2UA 1KQNA 2DWUA 2Q5FA 4FSDA 2P4QA 3H5IA 4HDRA 4XGIA 2F59A 4BASA 3X1MA 3C3YA 1T6BY 1EEXB 2DPLA 1ZGAA 2GZAA 1YMQA 2R7LA 3A1NA 3EWAA 4JQOA 4K5QA 4LDRA 1SZDA 1SRQA 1U5CA 3OTGA 1V6SA 1XLUA 4OQXA 2JI6A 4R9UC 2QTHA 1UMDB 3LHKA 4B3XA 3EQ8A 1CZRA 3ZHYA 3MBKA 1PN3A 3ETJA 1YQDA 3HVRA 1LPOA 4MVJE 3MM4A 2QRUA 1CZHA 3ID6C 2VPPA 4FJ1A 3RR2A 4XWOA 5L6LB 2QN2A 2ZTHA 3AL2A 4O33A 1EUCA 1OTYA 1YRAA 3M6MD 3ZNOA 5D3QA 1G18A 2XNDD 4UU7A 1VCNA 4G65A 4PZEA 4JC8A 4RADA 3VR2D 1L5SA 2GT1A 1KQOA 3PPVA 1SEPA 1KY3A 1SUDA 1JFFA 2GAJA 7GPBA 4CTJA 2MINB 3ABZA 2W2QA 4GXTA 1Z2CA 2YJTD 2GN8A 3KT8A 1QCZA 2CEAA 3BGIA 3NKVA 1T9GS 2HN9A 2R6FA 1V1JA 3FHLA 1CZKA 4FK8A 4M60A 5T64A 4KQHA 4M37A 4C0WA 3FDJA 4ZZ3A 1I9CA 4DR1B 1JN0A 2YBEA 4JOQA 3R74A 4IXMA 4BRUA 5AW1A 4NBUA 2ZBGA 2V1UA 3VYRB 3TQIA 1DEAA 4QDTA 3MTAA 1BQ3A 1BCSB 5LBIA 5BO5A 3ROEA 4BVLA 4BX2A 4JLUA 1BEUB 1UJ6A 3FPLA 4NJEA 2I6FA 4B4DA 3HR8A 5I7EA 2RARA 3IE2A 2D3WA 4PYIA 5KOYA 2CV0A 4HD8A 2OFWA 3H5AA 3H2GA 5GZ1A 2GM5A 3U9TA 2QP3A 2VHCA 1KZ9A 4JBWA 5FJIA 1YQQA 3VYWA 3TIIA 5JXGA 3PFWO 4MWGA 1W4RA 2KHZA 1PT7A 2XWBF 3DE5X 3ZHCA 2R5WA 4PO3X 3CJQA 1SPBS 3A31A 1I7PA 3I05A 1R8YA 1GPMA 3EODA 3N58A 4M9SA 1URPA 1T29A 3ISTA 5ALZA 3O83A 4FUQA 4WLFA 1QOZA 4UASA 3WB1A 4DQUA 1F2TA 1Z0SA 1XMJA 1XT6A 2GAFA 3B6ZA 3BK1A 3NV7A 1DEOA 3O91A 4P3KA 1GR0A 2YVQA 4ALNA 4DBLE 5HS4A 1JHPA 3HL0A 5K20A 1WBDA 4BBPA 4XIGS 2WSIA 4OKNA 3W4JA 3BGWA 2PXCA 3B8HA 5GV8A 3OKCA 1XDDA 4WBNF 1FB5A 1VKRA 5LU9A 1E18A 1YFZA 3FYCA 2XGOA 2JGEA 1M2WA 1T2NA 1QR6A 3Q41A 4CM1A 4DSNA 1ZJ4A 3UHJA 3BWCA 1PP4A 2QNIA 2P6MA 1D03A 1XDBA 1X38A 3HE3A 3PX2A 3A2LA 4XE5A 3BE6A 2QQ5A 3N5CA 1M6YA 3MNFA 4RTPA 3M1LA 4Y2SA 1U1DA 2JNWA 3TBKA 2WHQA 3LIPA 2X42A 4TLDA 2IXFA 4JV5B 1I2DA 2ZIXB 3KSUA 1XL0A 3JTMA 1BD3A 2C7VA 1C41A 5DCYA 5EQTA 2ZUEA 3SIPA 1SCBA 2V7QA 1FF9A 4TLMB 3EIFA 4HAIA 2I87A 3R7WA 3FOEC 3THXA 5D5QA 1GNSA 3GRFA 1GUFA 4JB8A 4MYSA 2QPOA 5CURA 5HTOA 1INLA 1T8WA 4F1KA 4F91B 3EC7A 1XZHA 2V4MA 2PEYA 3H84A 1L5YA 1P1BA 1M1YE 3R0JA 5ICEA 3ZE2B 4DRYA 1MT3A 3C4VA 4OK6A 1M33A 2IYQA 3ZVLA 3GMDA 5LMNB 3LCRA 1KY4A 4TKLA 1UPCA 4KYIB 1L1FA 3TAXA 1BEEA 2C57A 3DFMA 2PAFA 3DQZA 3RS2A 3VQTA 2Q3EA 3AI7A 1JJ7A 1C3EA 1U9IA 2ZI6A 1U1IA 4WL0A 1XRSB 2A57A 1DC8A 2J6CA 4YCNA 3DEZA 2ODEA 1VMKA 3AETA 4C20A 4EKNB 2PUAA 4A26A 3T4PA 4M1YA 2FFAA 3AIOA 3VZCA 1RJ9B 3DAOA 1RXEA 3H8WA 3AV0B 1Z6YA 3IP9A 4H1UA 4LXUA 2UXBB 1P72A 1QH1B 2VT3A 3C24A 1A97A 1NJ1A 3JASA 4LF4B 2I1VB 3O3NB 5CXUA 3MOIA 4J91A 3RLFA 3VZDA 4DNPA 1ONBA 3LG2A 2GNAA 2ILTA 4RLSA 3D7LA 3W5BA 2YNMC 4IMIB 1RRCA 1VKZA 1JHQA 1L7NA 1DOAA 1PHPA 2IPLA 4D9NA 1KI1A 2X9QA 3ROKA 2EYUA 1DC7A 2A6PA 5KOIA 1CUJA 3PFBA 5LZ4A 4LF6B 2RI6A 2I6UA 4PR0A 3UK0A 4C6SA 5KNCH 3GNLA 3ZWOA 2BCGY 1W4LA 5HZMA 3OLVA 4ZAXA 2W6ID 3ZWPA 3JWEA 3WKDA 3K31A 4YMTA 4D9KA 1UJMA 1VJCA 2Q1WA 4OOFA 1ANKA 4K9LA 2DPHA 4GOKA 4ESEA 1T9DA 4K87A 2VT7A 3I9MA 3VPAA 4MDYA 2PUHA 1LPAB 2JGJA 1D07A 2ORED 2QD3A 1UKAA 1WUJS 3Q7RA 5CT6A 4ZVRA 5KVCA 4DSTA 3UT6A 2VOJA 4GKBA 4ITVA 2BUBA 4EABA 4HMQA 3SS9X 1GPUA 2VR1A 1EDBA 5EE9A 1L4UA 1M34E 4AJKA 5CK5A 2ZRJA 4DQXA 2BM9A 4QFBA 3S8EA 1FFXB 1I1HA 2JGIA 3TXYA 3I3SR 4I81A 4RH1A 3STYA 4Z49A 2D7JA 2H06A 1KDYA 3ZCPA 2BEKA 2Q62A 2WEKA 2X0JA 2WFLA 1KZGB 4K28A 1YZ3A 2FZEA 2V6IA 3KVVA 4JCCA 3W90A 4ZT3A 1C2TA 5GGXA 3UV3A 4NAVA 1VXRA 2GBFA 3TTXA 4M53A 2QN9A 1NRWA 1R7RA 3N0VA 3OHMA 2VDKB 3GLHE 1E6UA 2NO1A 4POOA 3FJYA 1H05A 2Q6TA 4HLDA 3OE7A 1VIDA 3G17A 4RTNA 1MVNA 2B92A 4UEKA 4Y1RB 2ETVA 1V45E 1JU3A 1YU9A 1DRVA 3A4VA 1O5IA 1WCIB 3AL0C 1YUNA 1G8KA 1D4FA 2ZTUA 5IM5A 3EEYA 4NE2A 5B37A 2RK4A 3SC2A 3GRYA 4W1RA 1J06A 1Q7GA 1H5QA 1ZGCA 5DHTA 3SC4A 2D00A 4BKOA 1XCPA 3P9NA 1S89A 1EP2B 1NVDA 1JA9A 2ZIXA 4IUBS 4W7SA 4EMTA 2H18A 1T1IA 1E94E 1N7HA 2XUOA 3AGQA 2FUG1 2XYGA 4KRGA 1W0JA 2HF7A 5EKSA 4GEGA 3A8TA 4OJMX 4NENA 3M5PA 4PNEA 3WYCA 3A9RA 4UHDA 5F1PA 3AEXA 5G02A 2DPMA 3CN9A 5D84A 3R8CA 4WLUA 3PCRB 2RCNA 2J09A 1L4YA 4XJVA 3TVTA 1WLSA 4U7FA 2G7MC 4UHCA 4FT4A 3HCEA 6CHYA 4UNPA 2C2HA 5G1PA 3DUFB 1GUBA 4YQFA 4J1TC 4A7PA 4LC1A 4Q1CA 1PS8A 5A9SA 1VJ1A 5KVQA 2Q0HA 2YICA 4UHKA 4MQFB 4QGHA 1HOTA 1CQWA 1OXBB 1L3CA 4P0TA 1ZXLA 4UHBA 3RS4A 3WNVA 1S2IA 3BD8A 3FMFA 5CYOA 1TU4A 1L9XA 4BBZA 4HQ6A 2CZGA 2XE7A 4RZXA 3NFYA 5AHOA 3JVEA 1QQ5A 5L3SA 1RJ9A 3U3XA 3MAGA 3WIVA 4EELA 1TCUA 4DT1A 5FFMA 3DV0A 3IT0A 4GBJA 1QH1A 3GLGE 2EQBA 2AF3C 1MU0A 1CY6A 1JQKA 1M1NA 2D3TA 2VSQA 4NIMA 3SZUA 1V39A 4Z86A 4XVUA 1OVGA 3BAZA 2HREA 3LGXA 3CMMA 3BKXA 2RC6A 1L3BA 5KJFA 3IMKA 3TCXB 4B32A 4FHCA 3NRJA 1IBCA 1SZPA 5EXPA 5LQNA 5GWXA 4M0FA 2EIXA 1CR4A 1RC0A 3F4BA 1D3AA 1PLLA 1RXYA 3AR9A 4P36A 2W7TA 1ZSVA 5EJIA 4IOLA 1G5TA 2KSQA 4BNXA 5KYVA 5L3QB 1QIFA 4IV8A 4AZ3A 1ADGA 4XRGA 1HLPA 1HMYA 3BUSA 4D8TA 1EKXA 1FDTA 2AJLI 3YASA 3AM3A 5FLEX 4DNQA 5BORA 4ZAGA 4JJAA 2WAXA 2CXOA 2PU5A 4DTIA 5B64A 1P7ZA 1A5AB 1KOGA 3UKJA 2J5RA 3OFKA 4YAFA 4E5PA 4F6CA 4JI7B 1VIVA 1J33A 2BHLA 1JR4A 2IYNA 1JG2A 1KEWA 1TT5B 1A3CA 4GZ3A 3HZRA 3ZXUB 3GUUA 3CNNA 3WLTA 1Y5NA 2CB9A 3G8DA 3NM4A 1OJLA 3WE7A 3FRHA 3EZ6A 3GGPA 4KZKA 4EVSA 1SXJD 1RJFA 4YPFA 3SJ7A 3JAMA 2CFTA 2GZHA 4QFCA 1KQ3A 3C3PA 1WWKA 3PQ6A 2IEAA 3E3NA 3FYUC 3MAAC 4ZQFA 2NVUB 1ZMBA 2RGNA 3GO4A 3IUJA 2QVXX 5CNIA 1QGOA 3LOUA 4DQLA 2HCJB 1JDJA 1G21E 2ZJ6A 1M54A 1QG2A 3HB9A 4WOCA 1EBBA 5CITA 5FEUA 5H5JA 4C2AA 4ZVVA 4ZK2A 3SICE 1ZD9A 1NQ5A 1J0CA 3CINA 3SMQA 3SEAA 2W42A 1WB4A 3HABA 1MRSA 3ZCUA 3EULA 5CYFA 2HCBA 3HV0A 4BYGA 3KPVA 3T9AA 1RR6A 2FW1A 4HGZA 3WRYA 5H4GA 2VBCA 5KYXA 4WXMA 5JDIA 3KL2A 1U3CA 2FSVA 4KQFA 1JH8A 2HMWA 4WX2B 3RLIA 5JY6A 1L5RA 4QBIA 3DEIA 2WYOA 4DJTA 4GPBA 1Z16A 5KJCA 5HK9A 3AKCA 2HDWA 1EX9A 1W1UA 3EW9A 3GUYA 1QVAA 1BEZA 3GDOA 2II6A 3TRJA 1F20A 1WU8A 4LJ7A 4X84A 1T5OA 2V7EA 2A78A 1DKLA 2ZBFA 3K30A 1HZZA 3WL6A 1XPJA 4ENRA 2XE4A 5F76A 4ZYVA 1VMDA 4CKWA 2FN8A 3H1BA 1ENOA 4TSRA 1OH8A 4YJ3A 3ED1A 1RQ2A 4K9SA 3W6UA 3VZBA 5ERXA 3AFMA 2W6ZA 1N8TA 1VPDA 1C0KA 1F2DA 3G3EA