4YQYA

Crystal structure of a putative dehydrogenase from sulfitobacter sp. (cog1028) (target efi-513936) in its apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
251
Chain Sequence
LGTENLYFQSMDLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEGSSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPKIRVNSLCPGMIDTDFHNRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a putative Dehydrogenase from Sulfitobacter sp. (COG1028, TARGET EFI-513936) in its APO form
rcsb
source organism Sulfitobacter sp. nas-14.1
molecule tags Oxidoreductase
molecule keywords Putative Dehydrogenase
total genus 87
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yqyA00
3ZN2A 1OC2A 4BVAA 3CMCO 2YHIB 1BXZA 1LLUA 2YYYA 3AFMA 3NDRA 2HRZA 4PLPA 4TWRA 5CPFA 3RJ9A 3WYBA 4E5KA 1R66A 2D5AA 1NQAO 2V6GA 3QE3A 1NBOA 1QXSA 1NPDA 4B3HA 3NDJA 3PQFA 4CM6A 1MGOA 3DDNA 1C1DA 4Z3KA 4UUPA 2PD6A 3TSCA 2VHXA 4E4YA 1FXSA 2AEFA 2C2YA 1MG5A 1GV1A 3PLNA 4HUJA 4II2A 1VJ1A 4RPLA 4J91A 5EJ2A 2DU8A 2JD2A 5BNFA 2O2YA 3ZU2A 1MX3A 5G2OA 1GQYA 3A14A 3BYZA 4R54A 3QY9A 2X9VA 1E1KA 1HRDA 3UKOA 4BNJA 1Y8QB 3GVCA 2PGDA 2W4QA 5JY1A 1E3IA 5DBFA 2G76A 5C7IO 1KETA 3PP8A 3SC6A 2OORA 3Q2KA 3B1KA 3JYNA 4CMGA 1R4MB 4ND5A 4AJ1A 4DREA 3UW3A 2BMAA 2EGGA 2I3GA 4BO2A 3UHAA 4EJ6A 2RHRA 2DBRA 4YJFB 1UR5A 1I5RA 1MA0A 4BO6A 2WWRA 4E32A 2Q1UA 3E5MA 3OJOA 4MVJM 4C4OA 1LRJA 4ESOA 2Q49A 1ID1A 3IUSA 1BW9A 1E77A 2P91A 2VWPA 2O4UX 1OOEA 3DWFA 1JWAB 2POQX 1H0KA 2D5CA 1M67A 1KEVA 1UUFA 3PPIA 4B7UA 5U1PA 2AW5A 4BHTA 5TS3A 1PJBA 2WE7A 1QV7A 2VOEA 3I83A 1M76A 1O94A 4BNNA 1EBUA 4Z0HO 4NJMA 2UDPA 3AU8A 3KLPX 3B1FA 4PLFA 2B37A 3SX2A 1E5LA 5GZ1A 4RDHA 1J49A 3P7MA 1D1TA 4JJIA 3H9QA 4OL9A 1EVJA 3DL2A 2BFPA 3P2YA 4WLUA 2RH4A 3ZU3A 2YFQA 3NAQA 1DPGA 5JYEA 3JSAA 3U09A 1GDHA 4FD3A 1U4OA 4KQXA 1B2LA 1PU2A 4QUKA 1W6UA 4QTZA 4XGIA 3RD5A 1DIHA 3AUUA 4F6LA 3SLGA 4D42A 4DMMA 5IDXA 3NT5A 5TF4A 1OI7A 3TOZA 3WGTA 4MVJP 4Z9FA 1UXKA 2I76A 3G79A 1ZSNA 1Z75A 2FSVA 1BG6A 1AXEA 3KSDO 3N74A 1PSDA 1WMAA 5CDYA 3QWBA 4LW8A 1E7WA 5ICSA 4E5PA 2EEZA 5L7TA 1LDNA 2J3HA 4L0QA 2HJSA 5I9MA 4ALKA 5AXCA 1QSGA 3E6AA 2HK9A 3BTUA 3QWIA 2Y1EA 1I2BA 4RZIA 4DBZA 2HJRA 3R1IA 3WQRA 3PHJA 1CIVA 1T24A 2Y99A 2WD8A 3WTCA 1DJQA 1ZO8A 4GBJA 4BL5A 4D3DA 3L4BC 3FWZA 1E3LA 2DTEA 1H6DA 2DQ4A 4A2CA 4EJMA 2PGLA 2JHGA 5C3MA 3WX0A 1MC5A 3DBLB 4GL4A 1WLYA 4D45A 4L8VA 1B7GO 1PQPA 3PDJA 4B4UA 1A72A 5HM8A 4WNCA 2YW9A 1EVIA 3WWYA 3VKVA 3W4IA 4R69A 5DP2A 5TSDA 2QZZA 3O8QA 1TXGA 1GYPA 4BO0A 1I3NA 3GC6A 1HE5A 3WGOA 3LC7O 3GK3A 7MDHA 1C0KA 2J8ZA 7ADHA 1DFIA 2DM6A 4BGIA 4PG4A 4XQ9A 4XKJA 2J3KA 1NFRA 4IM7A 4BNZA 4TRRA 1Y7TA 4O5OA 2VZ8A 1L7EA 1LTHR 1HDXA 1TEHA 2HLPA 5GZ3A 3DAFA 2H1SA 5T8KA 4EUFA 4CUKA 4IDBA 1UXHA 1ZEMA 3VH4A 3IKVA 4ND4A 4XGKA 3WFJA 1MV8A 2Z5LA 3RBZA 4FFLA 4CMHA 3GG9A 2VN8A 1AHHA 2OXIA 3I9NA 4RF5A 3L6EA 2ZQYA 4FFMA 4GI2A 2WSBA 5AXBA 1TB4A 3K6JA 4MJLA 1A4IA 1Y8RA 4BNGA 4U6QA 4E3ZA 1B16A 2P4QA 1Z82A 4CMJA 5B4UA 2GGSA 3UH1A 3IJPA 4ND1A 2O50A 3Q9UA 5GMOA 5KVSA 5L53A 3R3JA 4R16A 4E33A 5G0TA 3E5RA 2JL1A 2X5JO 1B14A 5TRTA 2Y1DA 2PKRA 1Q7GA 4JJFA 5HRUA 2Q99A 5KVQA 2BD0A 3RI3A 5JYDA 1KVTA 1UDBA 1ZCJA 3FBGA 1QORA 2CDBA 4D0SA 1V35A 4ILKA 1ZSVA 1E1LA 4JK3A 3G17A 1EFLA 3HQ4O 2VUUA 3N58A 1GAEO 2J3IA 5I9NA 2EHDA 3VH1A 2VNAA 5GZ6A 3WFIA 4KWIA 1JKJA 2WYVA 4RF3A 4U7WA 3UN1A 3UXYA 4XB1A 4HV4A 3GEGA 4Y6PA 1HL3A 2Q2QA 1PL8A 1E3EA 4IGFA 4BO8A 2OOSA 3DBRB 3RSHA 3VKUA 4E5YA 4JJGA 5TNXA 1NP3A 2YV2A 2X7HA 3ZW9A 3MJVA 3I5MA 3I23A 1HE2A 3KXDA 4WNIA 2AQIA 3KV3O 4WEQA 4ROSA 4CLRB 4CM5A 1P1IA 1T4BA 3PFWO 4RLSA 2GUGA 1CETA 5AOVA 3WIDA 3AOEC 3I3OA 4PLZA 1XIVA 4FJ0A 4MO2A 2AA3A 3FNHA 4IQGA 3MJ4A 5HBRA 3GR6A 1ZEJA 1UJMA 1DDOA 4CQMA 4M1QA 1C0LA 1ADBA 4CODB 5KCZA 1HLDA 5T8KC 1PX0A 4GX2A 2VWQA 3WYEA 4CV1A 4BS9A 1YKFA 4FC7A 4FW8A 4N18A 4ZQEA 3QQPA 5THKA 1X1TA 4IDDA 2PZKA 3FPLA 4EUHA 1E7SA 1GTMA 4N54A 4R1SA 4LVUA 5A3JA 2QG4A 1JU9A 3TPCA 4B3JA 4E30A 3E9NA 1P1JA 2FR0A 5EMHA 3LLSA 5DULA 3ZW8A 4XD2A 1HDRA 3GAZA 1ZK1A 4AJ2A 2IDZA 4D79A 3ITKA 4J3FA 3NTQA 1JAXA 3DFZA 2NLOA 4JN6B 2H9IA 5FEUA 1Z45A 3A06A 3GZ4A 2ZTMA 4XGNA 2C5EA 1DFGA 2BF7A 2FR8A 1FF9A 1P3DA 3U4IA 1GUZA 4UUOA 1K6XA 1DIGA 3ZWMA 5A5EA 3JD1A 1Z73A 3WGYA 2QRKA 4R5HA 3PJEA 2PFGA 1N7GA 4RF4A 1SOVA 3RFXA 5LDHA 2VQ3A 5DBIA 4P4GA 4BNKA 3DB2A 3PQEA 4QT0A 1PQUA 3U62A 4JIGA 4BO5A 1SPXA 1JVBA 3SC4A 4DIFA 1HYHA 1UAGA 3VHRA 4RGBA 2O4CA 4WOJA 4E12A 4CMAA 2EW8A 4E0BA 2X0RA 1NFFA 3OEWA 3LLVA 2JFHA 4YVFA 1A9YA 4CM9D 3QV1A 1YBVA 1ZK4A 2ET6A 5IFLA 1NVTA 1DIRA 1NAIA 1H94A 2PKQO 3VZSA 4Y98A 1XU9A 2WMDA 3L6OO 4NHEA 3LC1O 3K31A 4D46A 4RCVA 1U3VA 4HADA 3P5SA 3MTJA 5DCUA 1GEEA 3H7AA 2CZCA 1NPYA 1ZMTA 1NNUA 4PG7A 4J0EA 4CMEA 2BLLA 3HJAA 5IXYA 1PS9A 3EUWA 2YJZA 4NK5A 4GSLA 4YPOA 3NTOA 4LISA 4J4TA 1NFQA 2LDBA 3C8MA 1AGNA 5FI3A 5KKAA 3PIDA 4RVDA 3VZPA 3JQFC 3OQ1A 4N5NA 5L3ZA 2PD3A 3EVNA 4IPTA 3WR5A 3ZWVA 1NVMB 3F5QA 3G0OA 4PFJA 1PJ4A 2I9PA 2VHVA 4NJMB 4YT4A 1DC5A 3VH2A 1N1GA 1X7DA 4M8SA 4IINA 4MIYA 2YY7A 2GN8A 1FDTA 1Z7EA 4H3VA 4DRYA 1NHWA 5ITWA 2GDZA 5ITVA 2BHLA 3DAGA 4Z6KA 4AJNA 1ISFA 4PRLA 1FK8A 3UFXA 2VYND 2FZEA 4YRBA 2G82A 4IDEA 3PJGA 3CZMA 3NTRA 3ZWPA 4NBUA 1GV0A 2P68A 4L4SA 5AXAA 1GD1O 2PK3A 1HZZA 3UF0A 2ZKLA 4GGOA 2WYUA 5DOVA 4AJKA 5TIIA 3AY6A 5A05A 1UZLA 1FJHA 1XGKA 3L4SO 1U5CA 4LRTB 4M86A 4E2WA 2Y1OA 4IDAA 1L1FA 4O6VA 4BNUA 1YE3A 3MTGA 2AE2A 1YONA 2DPHA 5G0WA 3ZWBA 4YAGA 1KBZA 3QVTA 1H9AA 5FF9A 4NI5A 4XYLA 2E4AA 2O3UA 2GYYA 4DYDA 2FHSA 3LT0A 5JBIA 2I66A 3ADPA 1DHRA 2Y1FA 2AQHA 2X1HA 3UCXA 2Z1MA 3ZNOA 4Q39A 2DAPA 4ZQBA 2GO1A 1PJ2A 2J3JA 5KVVA 2F1KA 4L76A 5FFFA 1H2BA 1TVEA 3K5PA 4BNMA 4XZ3A 4IS2A 2X9GA 1V6AA 1U5AA 4EYEA 2Y66A 3TL3A 2HMVA 3GN2A 2O7SA 1R0SA 4CLXA 1U3WA 4IQ8A 1RM3A 2E48A 1BTOA 4LMRA 5U4QA 2EKLA 1B0AA 4EEXA 4GMGA 2DFDA 3JQ8B 5BNIA 5K0ZA 4YJHA 4U5QA 3KB6A 3D0OA 4BQPA 2C7GA 4Z3DA 3ST7A 4BB5A 3QSGA 4IJWA 5JNLA 2Z95A 4ZU3A 1Y9EA 3LK7A 1TI7A 2NVUA 3DR3A 5F21A 3CMMA 4TVOA 1CJCA 4EJ0A 4B79A 4D43A 2BFAA 1MXHA 4RZHA 3O03A 1MXFA 3C1AA 1ENYA 1G0NA 4CMBA 2EKQA 2XOXA 4CQMB 1QMGA 1G1AA 3ROMA 4NIMA 3ZGYA 3D5TA 1Q0HA 4NNJA 4RPKA 4BGEA 2JJYA 4BNXA 3MWDB 1D1SA 1PZFA 2P5YA 3DOCA 3ANNA 3K96A 4UVHA 3U3XA 2CY0A 4AJEA 3PQDA 1ADGA 1ZKMA 3AY3A 4FOSA 5COAA 1KVQA 1KVUA 1K6JA 3JD3A 1GCUA 3ZNPA 2X86A 1YOVA 1LDMA 1B8UA 4TRJA 3GAFA 4JNKA 3PDUA 1BWSA 2X9NA 2WM3A 3IP3A 1HDZA 4Q3AA 1O8CA 2EWMA 2FN7A 4QO7A 3TZ6A 3AM3A 3EGOA 3GHHA 4KDFA 1IL0A 1UP6A 1MB4A 2BFOA 3GVHA 1HF3A 2PGJA 4MVJH 1U1IA 3DQPA 1XQ6A 2X0NA 4XIJA 2Q3EA 4Y6RA 4XYBA 4O1MA 1BHSA 3PJFA 1T2AA 2BGLA 3E18A 4IXTA 4PLGA 1LDGA 3B1JA 4FIZA 2H63A 4YT2A 1HYEA 1ZSYA 4NDNE 4A5OA 3HWRA 2ZB4A 4RDIA 1F14A 3FI9A 3JQ9C 4O63O 4ALLA 4TKLA 3GLQA 4ZICA 4CLRA 4OIMA 3ZWYA 2CF5A 3Q2IA 4Q3DA 2BGKA 3LT1A 4BO4A 2YZ7A 1W0CA 1ZW1A 3KYBA 4QXMA 1XLTA 3HDQA 1RJWA 3AM5A 4E31A 1QLJA 4GWGA 1EBFA 3VH3A 3HZZA 1YL6A 4DQUA 3DHYA 3JQCA 3ASUA 2Q2WA 3ZHYA 1GYRA 1AUPA 2EP5A 2ZIZA 4MKRA 1VL8A 2Q45A 4DUPA 4YA6A 5IXSA 1V9LA 1W4ZA 4MP3A 1S6YA 1PS0A 3B20A 2YDXA 1NWCA 2RCYA 4J1NA 4M49A 4BGUA 3O38A 3OP4A 3F46A 5JAMA 4BNLA 2V6FA 1DLJA 3D4NA 3PI7A 3BTOA 2P9GA 1O95A 1LEHA 2D59A 3ZI0A 4IJVA 1PZHA 1KERA 2PTGA 2QYSA 2YV1A 1SNYA 4OYRA 1CDOA 3MJTA 5H82A 1WP4A 1MP0A 2VZ0A 5BSFA 2ZB8A 1VRWA 5L45A 4XCVA 3B70A 4DIBA 4WE3A 5JFOA 3MJCA 1RYDA 3IL2A 4JQCA 5I7SA 1YOVB 1O5IA 4B7CA 2UVDA 5KTKA 4YQZA 2NU7A 1Q7CA 4HFRA 3BMNB 4RVHA 4DC1A 3KYCA 3MZ0A 3S2EA 2X8LA 2WDZA 4ZRMA 2IXAA 3Q0EA 3LF1A 4FJ1A 1WPQA 3C1OA 5GY7A 3GDGA 3N7UA 2B83A 4IS3A 3RC7A 1PWZA 4NG5A 4ZN6A 5DCWA 3KBOA 3NYWA 4J1TA 2GZ2A 4BO3A 2WE8A 4HWKA 3NV9A 4WLFA 2R6JA 2XPCA 1GCOA 1PIWA 2NSDA 2PWZA 3QVSA 1P9LA 3GEMA 4ITUA 1I01A 2I6TA 5CDUA 4YJGB 3GFGA 1VC2A 1BVRA 1ML3A 3RQSA 3UCEA 4YAEA 1P1HA 1ZH8A 3NEPX 2FWMX 1RPNA 2B4TO 4CMCA 1LI4A 1NQTA 1X1EA 4ZD6A 4XRGA 1DHTA 4I5GA 3ROQA 4NJOA 3DZKA 2JCYA 1ORRA 4NU5A 2NTVA 3C7CB 4L9RA 1IYZA 1P74A 3DHNA 2AHRA 3WIEA 5ER6A 1XHLA 4OGWA 4CM7A 1VL6A 2FOIA 1X0XA 2OZPA 4J9VA 4WCDA 4J6FA 1PR3A 4CL8A 1QG6A 5LCXA 3U4DA 4HFNA 3PHGA 4E5MA 1PJ3A 3OEYA 1H6BA 4GLLA 4EGFA 4BNIA 1DRVA 4HY3A 1R4NA 4BNWA 4CM4B 1HZJA 5LC1A 3ZNNA 1VL0A 4LGVA 5I8ZA 1KC1A 4IIUA 3RFVA 2D1YA 5L4NA 2P9CA 3D64A 2UUOA 4AFNA 2JAHA 1WDLA 3EK2A 3FWNA 5TQVA 1QYXA 3TDKA 4DTIA 3CXRA 4MVJE 1Z7BA 5BSGA 4HNHA 3U9LA 1ZJZA 3ZU5A 2B0JA 4HBGA 1WXDA 1YL7A 2VYNA 1ZK2A 1WNTA 3TZQA 3M1LA 2ZK7A 3KRTA 2C07A 2GZ3A 3W4KA 2GPTA 3EY4A 5EN4A 4D0RA 4R41A 5ER9A 4LN1A 1PJTA 4XWYA 4HKTA 1M75A 3QJ5A 1WDKA 1CQIA 4MVJA 3F9IA 3PHHA 4M54A 4P38A 1P77A 3FF4A 4I08A 5A3VA 3OJEA 3ONFA 1B3BA 4MPDA 1Y8QA 3OMLA 2QRLA 2HCTA 2VOJA 4RF2A 2GRAA 2QIOA 2SCUA 4E13A 2GERA 2IODA 1EMDA 3AU9A 5ILGA 2PZMA 1DXYA 2DLDA 1BMDA 1XELA 3OQ6A 4TROA 1LJ8A 3JTMA 5DBGA 5JE8A 4W7IA 1K6IA 2E82A 1I3KA 2C82A 3CTMA 3VPGA 3UCFA 1QYVA 1ONOA 2YQ4A 4XR9A 4UREA 1IHXA 4AJHA 3RVDA 3G1TA 4RVGA 5FI5A 1R37A 1DAPA 1SB9A 4CLHA 3BAZA 1LQTA 3GDFA 4CQLB 3DMYA 4JBGA 4IJUA 3NGXA 2B4RO 2QQ5A 3OA0A 4OKIA 3JQAA 2X0JA 2P2SA 3E48A 1PGOA 5BQFA 3AW9A 4Q3NA 1EDOA 2Q1TA 4DBVO 4J4BA 1CWUA 4CR8A 2UAGA 4GX1A 4PG6A 4D7AA 3D4OA 2VWHA 2CMDA 2Q2VA 4R1UA 1UXIA 3ASVA 1HSZA 3EC7A 5KJFA 3H6KA 4NBVA 5L9AA 4UVIA 4CLOB 1V8BA 3Q11A 5F3RA 4OM8A 2WTBA 1CQJA 1Z6ZA 3K2BA 1VSUA 2VRCD 3ETEA 4BO9A 3BXXA 5T5QA 2V65A 3U4HA 4NQZA 5HWSA 1IZ0A 4J1SA 4J2HA 3FNGA 4KUHA 1P1FA 1PGQA 4UVEA 3ETGA 5A4DA 2A94A 3TZKA 1F12A 3D4PA 3KUXA 4XIYA 5C7OO 1C1DB 1P33A 4XA8A 1X13A 3L0DA 3PHLA 1JW9B 5JAZA 2CNBA 4R9SA 2GCGA 3CSDA 1O89A 4OSPA 1K0UA 4A27A 1O0SA 3P2OA 3WMXA 5I8WA 1G6KA 1TT5B 2AE1A 3ICCA 4TMFA 2D8AA 1GZ3A 2JD1A 3D5QA 4WLVA 4WASA 3K8ZA 3KLMX 4XYEA 3S8MA 1LSUA 2DVMA 3KYDB 1LC0A 4BKQA 5CG1A 2FZWA 1GL3A 3EVTA 4QECA 2YUTA 2FP4A 4YCAA 5K6AA 3IS3A 4U8GA 2PKQP 3RUDA 4CMKA 4DPLA 4HFMA 5L4LA 1LLDA 1ZXLA 1EUDA 3DBRA 2Y67A 3QWFA 4DGSA 1PJLA 3ZZNA 4J0FA 3B6ZA 2Q4EA 4Z0PA 1A4UA 2V6BA 2WJPA 4JLWA 5JDCC 5KVCA 4MVJI 1QYWA 5FWNA 5ENVA 5I7FA 1BW9B 1PR9A 1GFSA 3RU9A 5HS4A 2ZB3A 3O9ZA 1GUFA 1IY8A 3S2GA 2O48X 1U8FO 3SEFA 2A92A 1PL6A 2RH8A 1YDEA 2GF2A 5G4KA 4CM9A 3HG7A 2GSDA 4BMSA 4MKZA 2E49A 1DBVO 5JAIA 3AUTA 3H5AA 4IGEA 2DFVA 1E0DA 1R4NB 3ZHBA 2ZJ0A 1Q2XA 1HEUA 2C5AA 1VSVA 4W6ZA 3QLJA 3S2FA 4PCVA 2VNSA 2NU6A 1GQQA 3GFBA 2Z1NA 2P4HX 3GNQA 3HDJA 5HS6A 4D44A 1BXKA 3HFGA 3H2ZA 3H4VA 4YRAA 5IJZA 2PLAA 3RAJA 4CLOA 1DSSG 1JLLA 1WAMA 1JQBA 1T1RA 2EG9A 2I65A 5IDYA 3JQBA 1GADO 3DXFA 4QQRA 4UVGA 4BUCA 3OA2A 3VDQA 4ALNA 4GX5A 4ND2A 3LDHA 4JP3A 2HMSA 3FNFA 1XWFA 1A7KA 3WJAA 1J4AA 5U9CA 1NQ5A 4E6PA 1X14A 3X2FA 3QRWA 1R4MA 3L6DA 5JSFA 3ENKA 3GDOA 1U7HA 1VE9A 1X7HA 2C29D 4XX0A 5DP1A 1D4FA 1H2HA 1SAYA 1Y5RA 2G1UA 5T57A 3VDRA 3ENNA 1EVYA 3H3FA 3JQAD 4YDRA 3TZHA 1PQWA 1E3WA 3DBHB 1ISMA 4RORA 4B3IA 3KYDA 5COQA 1WWKA 3I9LA 2ZYGA 2NNLD 2AEMA 3ABIA 3E8XA 3EHEA 4INAA 1W8DA 4F45A 1D7OA 1ENZA 2OBNA 1K5HA 2CD9A 1H6AA 1PJQA 2X0IA 2C7VA 1EFKA 1JKFA 2DUUA 3HN7A 4Z9YA 5JMPA 2FPGA 4R1NA 1U8XX 4NFHA 1T2CA 3FPCA 1OZAA 8ADHA 4G65A 1P0FA 3PK0A 3OJFA 1R6DA 1JKIA 2DBZA 1LXCA 3WOHA 4FOOA 4CV2A 1CERA 5IN5A 1BXGB 2Y05A 4L73A 1DC3A 3TRIA 3IKTA 2ZTLA 2EV9A 1XSEA 4CUZA 1DO8A 3TL2A 1OBFO 3DZGA 2H6EA 3PYMA 3HDHA 4CMEC 5CDGA 1I3MA 2XXBA 2NQTA 1BRMA 1RKXA 4M55A 5T6BA 4BO1A 3JYPA 4X54A 2OP1A 4CM1A 3PZBA 3QP9A 4NZ9A 3UICA 2ZB7A 3M1AA 4CM4A 3RUCA 3VOSA 3PIIA 4XQEA 4IJKA 4UVDA 3QIVA 3WBBA 2QZ9A 1NVGA 3NT2A 4HX5A 1B3RA 3D1LA 2W98A 4KWHA 4FFRA 5TGDA 2EJVA 5I9LA 4DVJA 5TLSA 3VTFA 4DA9A 3IOYA 4TZTA 5JCXA 5JO9A 1QRRA 3QVOA 2EKPA 3ETDA 4WOKA 3DZIA 1DLIA 1H6CA 4D3SA 2VUTA 4ZVVA 5C37A 5IF3A 4KDEA 1I24A 4IZHA 3GHYA 3UGKA 2YDYA 3LF2A 3FR8A 4Y9DA 3PRJA 3DZBA 1LA2A 1X0VA 4PVCA 5KIAA 1C0IA 4FFNA 1P0CA 3OETA 3V5NA 3F1KA 5AYVA 5CAEA 5A5FA 4II3A 2QHXA 4RPGA 4PLYA 2BI8A 2R00C 4PG5A 4I9HA 4IQ0A 5A9SA 3R0IA 5BSEA 3IQDB 2OUIA 4I9NA 1YXMA 3BMCB 3ZWOA 1R12A 1VJTA 1IE3A 3H2SA 4ONEA 1T2EA 1YL5A 4DIOA 1KY5A 1PEDA 3HB5X 3I6QA 5TJHA 1V3UA 4D3FA 5THQA 4DPMA 4WECA 3RC1A 4BKOA 1EUZA 3V1UA 3EYWA 1CRWG 3PZRA 4U0JA 3VTZA 2Y1GA 2W2KB 2O2SA 1Y81A 2O3SA 3U4CA 3G1UA 5ADHA 4NBRA 1N9GB 3GGOA 4BV9A 2DTDA 1V0JA 2ZTVA 1DAOA 5JAQA 1LDBA 3C7DB 5L7YA 1E3SA 3RBXA 4ZQGA 4E2XA 2EW2A 1L7DA 1ZNQO 1LDYA 1YGYA 1V3TA 3F4LA 1B8PA 3D3WA 2IZZA 2XAAA 4ZQHA 4KUGA 5FYDA 2HU2A 1EK6A 2NTNA 4IUYA 4YAJA 2NVBA 1F8FA 2B36A 3DFUA 3I4CA 4A7PA 1I8TA 4YT5A 1HT0A 3RIHA 2AG5A 1VLLA 4PZCA 3GF4A 1R0LA 3OIFA 4I8XA 4ND3A 4R4JA 1M2WA 4LVCA 2ILTA 3LC2O 3BHJA 4FFOA 3CKYA 1VJ0A 2X23A 4G5HA 1P1RA 3OF2A 3LQFA 1AE1A 3WWZA 3GVIA 1I30A 3M6IA 1DOHA 2FR1A 1C14A 5EQDA 2ZYDA 5JDCA 4WK6A 4MOWA 4ZJUA 1LQUA 1M6WA 5G0SA 1JVSA 1XCBA 3HUDA 1NPTO 2VT2A 3GPIA 3CUKA 2DT5A 2PR2A 1HWYA 1E1MA 4HXYA 2Y0DA 3QVWA 3GG2A 5EINA 5K6AC 3INRA 4EUEA 4AG3A 5CEJA 3PHIA 3SVTA 1HDGO 2BELA 4XJSA 3RC9A 3L9WA 4Y67A 3TWOA 6ADHA 3L4BA 1BGVA 4IDCA 3GVXA 4OMUA 1I36A 2CVQA 4J16A 3KEQA 2FMUA 4I5DA 3ANLA 1R16A 2GASA 1PS8A 4YQYA 2PZJA 1R15A 1YRLA 3JYOA 4WCFB 3W1VA 4IXWA 4DPKA 4FBGA 4EEZA 2O7QA 2Q1WA 5MGBA 3WLEA 1YS4A 2C2XA 1K89A 3KM0A 4WGGA 5BSHA 1UAYA 4GMFA 4YRDA 4OAQA 3FTNA 4DL9A 4HP8A 4RPJA 5L4SA 1MG0A 2NWQA 3JYQA 4XQCA 1X15A 5IDQA 4WLNA 4B7XA 1HETA 1QLHA 2EXXA 5KJ6A 4JROA 4Q3BA 3KHUA 1DFHA 4FSHA 3ZHXA 5IG2A 3BZUA 3CH6A 1FDVA 2B5WA 4KZPA 1R0KA 4YEDA 4OJNA 1SEVA 2BKAA 2J5RA 3PWKA 2IYPA 1M6HA 1DB3A 4WLEA 1PTJA 3PWSA 3GA0A 5L95A 3QA9A 3GVPA 4OXNA 3E03A 3A4VA 3HFSA 5KWEA 4AL4A 1ZZEA 1N7HA 1JA9A 4RQTA 1XU7A 2JCVA 4BNYA 2B5VA 3GMDA 2NACA 4R68A 2A35A 4KTVE 3VPHA 3SXPA 3W6ZA 1NTOA 2JFFA 1DRUA 3DZFA 2GN4A 3U49A 2G0TA 4FGWA 3BA1A 3T4XA 4W4TA 4QFCA 1QYCA 1YO6A 1GU7A 2OGUA 3NT4A 4NMHA 3MOIA 4PGFA 3QWHA 3TJRA 5CG2A 3G49A 1XG5A 3ZWAA 1TT7A 5CDSA 4B4VA 1D3AA 1FDUA 3WGIA 4J90A 4PZDA 3C7AA 2W2LD 3DAPA 2I99A 4CQMD 1PGNA 2YFHA 3COSA 4GKVA 1QR6A 3WGZA 1LLQA 3VPFA 4B4OA 3OHSX 4OHUA 3U5TA 1B26A 1LNQA 2AQKA 2DC1A 4R51A 4YTEA 4YR9A 1T26A 5BT9A 4DC0A 4OQZA 2B4QA 4NK4A 4TRMA 2C54A 4PZEA 4JCOA 4O59O 1P1KA 2UUPA 3EDMA 1F06A 1J5PA 1E3WB 3QWAA 3V8BA 3JQ8A 1K3TA 2CSUA 1YQXA 2OMEA 1LX6A 2ZJ1A 1YBMA 4H7PA 3DBLA 1I10A 4Y6SA 2HK8A 3KEOA 3W8FA 4ALMA 2NVUB 2WEKA 1AHIA 3WGGA 5L40A 1IUKA 5TT1A 4XYGA 2P9EA 1YVEI 2HSDA 3INGA 3MWEB 3ROKA 2NUAA 3C24A 4QFDA 4TSKA 1LBEA 4Q9NA 1FMCA 3NJ8A 3ONEA 3FCOA 1BXGA 1UXGA 2TMDA 1KEUA 3JQFA 4FPXA 4QX6A 4EI2A 4GSKA 1Y5MA 3AWDA 2AQ8A 1NQOA 2WYWA 4XRRA 3KSZO 2DUWA 5EESA 3WICA 4FS3A 5B1YA 1EZ4A 4OKNA 4XQGA 2CVOA 4H16A 4FFPA 1T2FA 4FCCA 3BMQA 4M87A 2GR9A 1XYGA 1VKNA 1W73A 3CE6A 1NAHA 3IUPA 1IB6A 4KMSA 4CJXA 3RBVA 3DHEA 1QYDA 2GD1O 1XKQA 2Q4BA 2CF6A 3PYXA 4R3NA 5MDHA 4CM3A 1A7AA 1TA4A 1UH5A 1YWGO 4YACA 1E6WA 3STHA 3GNSA 1E3JA 5KJ1A 2O3QA 3D3EA 5DN9A 1E6EA 2C0CA 2FPPA 4OSOA 3M2PA 3JQDA 1U9JA 3WQQA 1GQ2A 2OHXA 1NR1A 3C3XA 4WCFC 4C7JA 2DPGA 3D7LA 3JD0A 4I1IA 4JBIA 4WJZA 1WVGA 4MIOA 3MCVA 1SEPA 3K92A 1P31A 3INTA 4L4XA 5A9TA 4WCFA 2Q50A 2DBVO 1NYTA 1HYGA 3GNTA 3IAHA 1HTBA 2PZLA 4CLDA 2NQ8A 1T1SA 3U0BA 5CHEA 1Y1PA 5DZSA 4P4NA 2YV3A 2PH3A 5DNAA 1DIBA 5T67A 3NGLA 4PRKA 2IRWA 4YJDA 2TMGA 1Q1NA 4OQYA 4MVJG 4QSMA 1NWHA 1MUUA 3Q9NA 3VZRA 5A02A 4A03A 4K6CA 3RFTA 1YQDA 4XJTA 1WZEA 1OMOA 3L9XA 1HLPA 1EUCA 1Q7BA 3DTYA 3RC2A 3LU1A 3UAGA 5JS6A 3I4FA 3DZJA 3TFQA 4F46A 1GEGA 1F17A 5TC4A 1XEAA 4P22A 3ITDA 1JTVA 3LYLA 3SJ7A 4NH4A 5JDIA 5IZ4A 2W2KA 3OJLA 3KO8A 4MDHA 3W8EA 1UZNA 3HDYA 4OO3A 5ES3A 4PLWA 4RVSA 2NM0A 2LDXA 4LSWA 1G0OA 1ZBQA 3VZQA 4EZBA 1D8AA 1JWBB 3HE3A 3GUCA 4UAGA 4CR7A 2A4KA 1U7TA 4ZGWA 2A9FA 3RUIA 1EQ2A 4KP7A 5H83A 2DTXA 4W99A 3V2GA 1IHYA 6LDHA 3AFNA 3TQHA 3I9KA 4B8ZA 2VTDA 3AI1A 3GMSA 3RUFA 4BQRA 4YYZA 4W9NA 4YWJA 3ZWCA 2ZATA 3LZ6A 5JO0A 2VYVA 1FDWA 2IEDA 1B8VA 2X5KO 3E1KA 3PGXA 3RKUA 3AY7A 2JCXA 3OIDA 3GQVA 3JQEA 1ONPA 5K9ZA 2G17A 5IAAA 1U3TA 1E7RA 3SBOA 2J5QA 3ZV5A 3AM4A 3NDIA 2EP7A 1KIFA 4DQXA 5COBA 5G0UA 3DONA 4AVYA 1YJ8A 3GEDA 3QVXA 3JQBC 4Q3CA 3QHAA 3OM9A 2G5CA 4J9UE 4J4HA 3I6IA 2B69A 1GUYA 3ANMA 2RAFA 3ZU4A 3H5NA 4MP8A 3AJRA 3PTZA 3TZCA 1NM5A 3KZVA 3KYCB 4NBWA 2CDAA 2Y1CA 4HFJA 4RQUA 5CDTA 3VAZA 2AG8A 3JQ9A 4TRNA 2C59A 1LRKA 4L74A 3V1YA 1T25A 3GZNA 3ZV4A 1XR3A 2O3RA 3FBTA 1LSOA 1T4DA 2WD7B 4N7RA 4S1VA 5KOIA 3OIGA 1NXQA 2R00A 3PVZA 4UEKA 1ZIDA 5LDGA 4AJIA 4M89A 4E21A 1C3VA 3HNPA 4MINA 3F3SA 4TQGA 5B37A 3GT0A 3H9UA 3AI3A 3S55A 4DYVA 3FR7A 3GY0A 3RASA 3WJ7A 4AICA 1EEHA 2HMTA 2VYVD 5ILOA 4BMVA 3HADA 1VKOA 5AXDA 3IMFA 5F1PA 4GX0A 3JYLA 3A9WA 3NUGA 4CM8A 3IC5A 2Y93A 3RROA 1XDWA 1DIAA 4URFA 1YB5A 1Y8RB 5KJCA 1WW8A 3AOEA 1A9ZA 3GPDG 4JP2A 2OFPA 4IZIA 4KQWA 3ZH2A 4B4WA 1ISJA 1ULUA 3IIEA 4GWKA 3FNEA 3K73O 3OICA 3F6YA 4CPDA 2Q1SA 1NR7A 2X5OA 5C7LO 3W8DA 2EERA 4U0KA 2XF8A 1KYQA 3BMQB 3GOHA 3I9JA 1YB1A 3PYLA 3WXBA 1LUAA 4LCEA 1TLTA 3EMKA 1Q0QA 1UP4A 3BMNA 4UUMA 3RKRA 1VI2A 5EPOA 3H8VA 4BGVA 4DQVA 3ZV3A 4GKBA 1PJCA 2CDCA 1B15A 1TT5A 1I0ZA 2O3JA 3ZNQA 1M66A 4S3MA 4LMPA 1ZK0A 5A06A 3VVBA 4BO7A 1KEWA 1HDYA 4EDFA 2DKNA 4R1TA 3JD2A 4UULA 1YQGA 4MP6A 4FN4A 4XB2A 2PY6A 1U28A 1VPDA 1Y9AA 3FD8A 3DOOA 3IP1A 3EZYA 1GR0A 3C1TA 1A27A 5I7VA 4YT8A 1MLDA 3E82A 3BMOA 4L75A 3K9QO 1I3LA 3CEAA 1SB8A 1MFPA 2HAEA 4AJLA 2IYOA 4N5LA 3DMTA 3QW2A 5A9RA 3ON5A 4PN3A 3GZNB 1A71A 4LRSB 1LDEA 2QYTA 3JQ6A 2YQ5A 5KJEA 2I5PO 1IZ9A 1N8KA 4FGSA 4BNTA 2ZCVA 4XEHA 3EZLA 3FSRA 4NBTA 5L7WA 2AXQA 4GPD1 1XA0A 4AJJA 4BNFA 1JN0A 1V3VA 2UV8A 1KOLA 4UEOA 1MFZA 4FJ2A 4Y8VA 4CMIA 4CQLA 4K9DA 1RWBA 3RUEA 3CPSA 3M2TA 1CF2O 2B35A 1HDCA 4E2ZA 2EIHA 3MEQA 3F4BA 4ZHSA 1HDOA 1YBAA 2JHFA 1E5QA 5BR7A 2HMWA 3V2UA 4W9NC 4CUJA 4P4LA 3VPSA 1BDMA 3LT4A 3CIFA 5C5IA 4UUNA 4HNGA 4YAKA 4OOFA 4GQAA 5JPIA 1O9BA 1FDSA 1BVUA 3EAGA 2Y68A 3E9MA 1PZGA 4PLCA 3H65A 3AOGA 3DTTA 2OL4A 5TJ9A 1ISIA 3GUYA 3I1JA 4WUVA 4WLOA 4PLVA 3DBVO 4YAIA 4BIIA 1EDZA 1J6UA 4FQ8A 4J43A 3AI2A 4JXKA 4JGBA 3DEYX 1EVZA 5ICMA 3WQSB 5CFZA 3OSUA 1QV6A 4OXYA 3ADOA 4NU6A 3FHLA 3OECA 1XQ1A 4ALJA 3ROPA 3AK4A 5IDWA 1MC4A 4IDFA 4NFYA 3RUHA 3L77A 2QX7A 5JMWA 1ENPA 1CYDA 3HHPA 4R01A 1ZK3A 2X6TA 1J0XO 4BKPA 2VCYA 1ZUD1 4U6SA 3TFOA 1H93A 1S7CA 4WEOA 1EE9A 4N5MA 3EW7A 1C1XB 1N1EA 3DZHA 2GZ1A 2YHUA 1RM0A 4GLOA 3PWZA 2BH9A 3I9OA 5G4KB 2PA3A 2ZTUA 4BMNA 3DC2A 1NHGA 2ZYAA 2UYYA 9LDBA 2CUKA 3BIOA 3WB9A 5DDIP 3W6UA 2AEJA 4WKGA 3ONDA 1JAYA 3RJ5A 3CINA 1GPJA 1WZIA 3PEFA 1WMBA 3LT2A 3NX4A 4DLAA 4AJ4A 1UZMA 2FSSA 4OXKA 3RCBA 4J7UA 1I32A 4A26A 5TX7A 3ZWWA 1YJQA 3HSKA 1GPDG 3JCZA 2VRBA 4RLHA 3PLRA 4LK3A 5EL0A 1LSSA 3JQGB 3RUAA 4RV9A 4QO8A 1PWXA 4IBOA 1SMKA 2X22A 1DC6A 1VM6A 5G4LA 2XXJA 3D3WB 2V7PA 2NTJA 2JD0A 3Q3CA 5IZCA 1AN9A 2FPIA 1E7YA 4B8WA 4FR5A 3PJDA 4IIVA 2RHCA 1K2WA 3FTPA 4K28A 2RBEA 3JV7A 3JQ7A 1UDCA 3KTDA 1E7QA 3S1LA 4Z0TA 5JCJD 2PNFA 4NPCA 2W90A 1KVRA 2E37A 3L07A 1KS9A 2HUNA 4BNVA 4GGPA 5DCYA 4JBHA 3WBFA 1LSJA 4A10A 1T2DA 1YDWA 3DO5A 4CM8B 1Q0LA 2VWGA 1DEHA 5CEFA 4IY1A 4RJTA 4KUEA 1YB4A 4CLEA 1PZEA 3ZCXA 4YJFA 4I5FA 3SJUA 4GAEA 3VVCA 2IXBA 1RM5A 5A9SB 4R9RA 4K1LA 1EE2A 4R5MA 2FRDA 4TZKA 2I3AA 4XDYA 4J49A 4BOYA 4CV0A 1LU9A 1IPFA 3W4JA 4AJOA 3WGQA 3IDSA 4EITA 5JDIC 1ULSA 1ZVMA 1ARZA 3K2EA 1WDMA 4K26A 2QRJA 3KSUA 3PGJA 1GZ6A 2JAPA 4RL6A 1H5QA 4G81A 5JLAA 3PXXA 2CFCA 4XDZA 1HXHA 3WGHA 5F5LA 1LC3A 2IZ0A 2OO5A 1SCUA 3ICPA 1N9GA 4ZRNA 2EGHA 3DMTC 4JX8A 1ZFNA 1C0PA 4I5EA 2IEBA 4MVJD 5DF1A 2NADA 3ZDFA 2JKVA 3DBHA 3MJEA 1C1XA 3WSWA 2VUSA 1IULA 3UVEA 1HE3A 2OP0A 3O8QB 4DMLA 3GN1A 3KOUA 2HRBA 1PJSA 3BMCA 1UXJA 2O3TA 4BV8A 2OBYA 5I7EA 4E2YA 4J2OA 1ISHA 1U2DA 4W82A 5F1OA 1EQUA 2W2LA 3F47A 1E6UA 1OAAA 2D3TA 5DOZA 4F6CA 1GY8A 2Q46A 3MJSA 2HMUA 5CPBA 4DLBA 4FB5A 1SO8A 5JW6A 3JD4A 3UUWA 1RM4A 1KEPA 1SBYA 5JCJA 1GYQA 2I67A 4DLLA 4MIEA 3WTBA 4TKMA 3TNLA 5EIOA 3WMWA 2V6MA 1BDBA 3BTVA 3P19A 5DT9A 5JC8A 3TF5A 4BNHA 3WNVA 3MOGA 1KY4A 3R6DA 1H9BA 5B4VA 4H15A 4YBZA 4PLTA 3VC7A 2GN6A 2HDHA 2YHIA 4NFSA 4F3YA 5F1KA 4CMIB 2IE0A 1X7GA 2BRUA 3VPXA 3JQ7B 4RVUA 4PG8A 3OJ0A 4L4RA 1LRLA 1AXGA 4CL3A 4ALIA 4MVJF 5IZCC 1Z74A 4RPHA 2QW8A 1IOLA 3GGPA 3R3SA 1QP8A 3HN2A 3PFFA 1HSOA 1QKIA 4P8RA 1Y6JA 2ZQZA 1N92A 3I52A 4EBFA 4A0SA 1E1NA 5A03A 1DC4A 3TN7A 1ADCA 1F8GA 1HE4A 5A04A 4RVFA 4FC6A 4GH5A 4OOEA 1BSVA 3O4RA 4R3WA 4XYMA 1KVSA 3ULKA 4O0LA 5EQFA 1SOWA 3RWBA 4FDAA 2NU9A 5T64A 2EF1A 3V2HA 2NU8A 1OC4A 5CP8A 3Q6IA 2WD7A 3SLKA 2O23A 5HTOA 3BMOB 3CZRA 5F5NA 3WLFA 4K6FA 2NV6A 2VHWA 1OFGA 4YJHB 3NJ4A 5TT0A 2GNAA 4IDGA 1SZJG 1RYEA 1I2ZA 4AJPA 1A5ZA 1PGJA 4UEJA 4YB8A 2FY8A 2PH5A 4PVDA 3OFSA 1YH3A 3GRPA 5J23A 2GN9A 1U3UA 3ORFA 2ZCUA 1DRWA 1PL7A 2PV7A 3WS7A 5AVOA 2CVZA 1O6ZA 1GZ4A 3ZV6A 1HKUA 5JXWA 3HB4X 5H81A 1CEQA 1U4SA 2E6UX 2AMFA 2HKIA 1F0YA 2J6IA 3K30A 4NR0A 4MKXA 4IMRA 5BNTA 1ZMOA 3OBBA 4CR6A 5CEEA 1ZXBA 2F00A 3H9EO 3ZWNA 3WYCA 4IMPA 1N2SA 3V1TC 4PLHA 3BTSA 2D0IA 2BI7A 5AQ1A 2H5LA 4XR4A 3A28A 4Z9XA 4J7XA 8LDHA 1EK5A 3T7EA 2D4AA 3O26A 4OH1A 5G0VA 3NKLA 3JQGA 5KNLA 3E9QA 2PD4A 3WDSA 1ONNA 3WNQA 2HK7A 2HO5A 3Q1LA 4ZA2A 1P45A 2C20A 3AUSA 3TOXA 2DBQA 9LDTA 3OQBA 3ZWXA 1NX6A 2Y0CA 3IJRA 3WG9A 3T4EA 3I9MA 2VRCA 2W8ZA 2R2GA 3UOGA 1U2GA 4DXHA 2VHZA 1DJNA 1ZJYA 3LSYA 5IN4A 4D41A 3ZHZA 4C7KA 5KKCA 5B12A 1JDJA 3GGGA 5JY6A 3AUAA 1ISGA 3FRJA 3C85A 4QEDA 5A1TA 1NASA 1LLCA 3BHIA 1ENOA 2HQ1A 4BKUA 2EJWA 2GLXA 1N5DA 4A73A 3T7CA 1P44A 4YXFA 2VZ9A 4DWVA 4LSMA 2IZ1A 3BHMA 3S2IA 2BFMA 4WPGA 4J1QA 3WSVA 4RO0A 3NRCA 4LCJA 1KC3A 2X58A 4G2NA 5EERA 3FN4A 5ENDA 4I9UA 3DOJA 2VTEA 4BB6A 3KVOA 3F1LA 3LVFO 4BKRA 2J5KA 1ADFA 5HA5A 3F5SA 5L51A 4GVLA 2BGMA 4EW6A 4PIVA 2Y0EA 3G3EA 3H5RA 3JQAB 5B4TA 3GRKA 3H9GA 2X4GA 1I2CA 1SC6A 4KOAA 2JFGA 4Q3EA 1E7MA 2D2IA 3H3JA 1UP7A 4E5NA 3GH3A 5JC1A 2NVWA 4KTTE 4GVXA 3H9JA 4YJGA 3RU7A 3X2EA 2VHYA 1PGPA 2RIRA 4J7CA 4CV3A 2VT3A 3KETA 3OH8A 1IPEA 1UDAA 4ZQFA 1I33A 1E92A 3A1NA 4ID9A 2P5UA 4W7HA 4TVBA
chains in the Genus database with same CATH superfamily
3C7KA 1SXJA 2JFNA 2ZLBA 4FEAA 4OMCA 1OC2A 3B3QA 2IWHA 4CIAA 4W9MC 3OE1A 2YHIB 1BXZA 5CPFA 4E5KA 1KPHA 3SDSA 4F5WA 3WYBA 3ISVA 3ORSA 4R71A 1T4CA 1CUIA 2VSFA 1RLJA 1DAFA 2V6GA 3QE3A 1EDDA 3ELUA 3T9DA 4WZAE 3UMJA 3U4MA 1NQVA 4B3HA 3NDJA 3PQFA 4CM6A 2JGRA 3IEVA 3TSWA 2Q5LA 4DMKA 1MO5A 5DHFA 3TSCA 4DWJA 5JD4A 3OZ7A 1Y3AA 1Z37A 2JA2A 3SSMA 1FYVA 3RUPA 3AZQA 4F0JA 1VJ1A 4RPLA 1NC1A 4TM7A 4P3OA 2JD2A 5BNFA 1TO6A 5KNBA 3ZU2A 4LFBB 5LQRA 2A1TS 1X87A 1KSGA 1GQYA 3D8SA 5GV7A 1E1KA 2CDNA 3NJRA 1Q19A 3SBXA 3SF8B 1E3IA 5DBFA 3FHTA 5KTRA 5H02A 3K9CA 4ERNA 3OEED 4UNQA 1KETA 2FW0A 2C9ZA 5KOJB 1RAHA 1BJTA 1UJ5A 1E20A 1F5NA 3B1KA 3IP7A 4ROTA 1R4MB 3EDOA 4PCAA 3W05A 1Q12A 3GZTB 4DREA 5JHHB 4G0VA 2PUTA 1JBQA 2EGGA 3R9KA 1Y4ZA 3UHAA 3UQYS 1TZJA 2DBRA 1TQ4A 2PUEA 3IRUA 4W5TA 5BPFA 1HI9A 2WWRA 3E5MA 4X84A 4YMHA 4IH9A 1SUDA 4ZYUA 4MV1A 2PX2A 1SKUA 4B34A 2ABWA 1SCUB 4P2GA 2Q49A 1ID1A 4HQKA 2HFJA 4EDHA 1ZS9A 1CUCA 2GUWA 2C3YA 2X5XA 3D3QA 3DWFA 1JWAB 5FPQA 2D5CA 5J1SB 1M67A 4D5EA 4BLSA 1KEVA 4QBHA 1FRFS 4CIYA 1A2QA 1Z0JA 4B7UA 1UJ2A 4JEUA 5U1PA 1KRHA 4BWGA 5L6MB 5TS3A 2OCBA 4TUYB 3WLRA 4HUQB 4MV4A 2H18A 3MGKA 1JKXA 2WAAA 2WE7A 4PSKA 1H4TA 1VZ3A 1TO1E 1TADA 2YZ2A 3VX4A 4WZZA 1K4MA 1SKMA 2UDPA 1A9RA 2C57A 2JIZD 1GNPA 2L17A 3B1FA 4RK1A 3ESAA 3UK0A 3FNBA 2CJYA 1J49A 2Y92A 4L50A 1JDVA 5T41A 4GXTA 2JI8A 1V8PA 2ZDQA 3P7MA 4G2TA 4D80A 5IT0A 1SA0B 1XLTC 4S2UA 4ZU1X 3R7LA 1D0SA 3KSBC 2IOFA 4HWRA 5ALNA 1NJ2A 1U5BA 2IYAA 3DL2A 1M6NA 4D99A 2YFQA 2JJ2A 2WTXA 4D9MA 1QZZA 1H4QA 4NY1A 3HMQA 1U4OA 4AS1A 2C8JA 1PU2A 4OA8A 4XGIA 4RMHA 3U80A 2OO3A 1AUOA 4DMMA 1G21B 5H59A 4HB2A 4GYYA 1XOIA 4O4LA 2F43B 3TOZA 1Z4OA 4U7JA 1P2DA 3PUWA 4Z9FA 4DNOA 3A0RB 3G79A 3Q10A 1D0VA 1ZSNA 4FW9A 4K9MA 4QELA 2HQSA 2NUBA 2VHUA 3GWZA 1K7XB 2YMMA 2C1ZA 1VMDA 4EY3A 3RYIA 2HHLA 3QWBA 3ZBUA 4N5IX 5ICSA 4QKQA 2EEZA 5GONB 3EGVA 4OI4A 3TYXA 2J3HA 1Z06A 4LNUA 5K1ZA 3G8DA 4BC1A 4GW3A 1K8YB 4B47A 3CNNA 2M1XA 3BTUA 3QWIA 5E6UB 1TUBA 4PX3A 2CZQA 4Q6WA 5LP1A 1L4MA 1CUZA 2NUTA 2O8EB 3C41J 2CLCX 1CIVA 4B74A 1GKLA 2FTKE 2F7SA 2WD8A 3KDSE 4KO8A 4Z3OA 4FDLA 3W6NA 3AHGA 1S0UA 2VPTA 3O9MA 1TPZA 1KKLA 2AG1A 1NUUA 1WCWA 4XDHA 5BN4A 5KTYA 2VQ6A 3DWIA 2XJ9A 2MDTA 1UK8A 3DBLB 4GL4A 4O02B 3N3BC 1UQUA 1AQLA 1B7GO 1PQPA 2GMWA 3PDJA 4I7EA 4QQKA 3GRYA 5HM8A 2WTAA 3BJIC 3MS4A 4P80A 1VBMA 4WNCA 5G1OA 3VKVA 4UC0A 2ZPAA 3WWYA 1QTQA 1FY2A 1U2TA 3AEUB 4EF6A 3WGUA 1M1XB 3O8QA 4AWBA 1YZHA 2WVAA 2H1VA 4Q01A 1C7JA 4D98A 2DRIA 3GCWA 3M0EA 3GC6A 1G64A 3HKDB 5LQCA 1QONA 2XB9A 3WGOA 3LDFA 1XTJA 1DKRA 3GK3A 2BHNA 4CIBA 1L5HA 1MO2A 3CBQA 3CVUA 4D9JA 1B74A 5KSPA 4KQCA 3M9WA 4EHBA 3WLOA 1ML4A 1JSXA 4QRHA 1VG9B 4MS1A 4PNZA 5AFSA 1EB9A 1G8PA 1ZN8A 3X2EA 3UJ7A 2J3KA 3WV5A 3NYRA 1JV2B 3OF5A 1JHXA 1BFUA 3HJCA 1R8SA 4BNZA 4DDVA 4JQOA 5D7NA 4UE6A 4FSXA 1FZTA 1D7AA 4KX3A 5FOQA 5EPEA 4C4RA 2GDJA 1JEEA 3BRQA 2VKQA 3A4MA 1ZEMA 3M3HA 4XGKA 2G1AA 1XQVA 3CVXA 4UHKA 4CMHA 4A91A 4D02A 5LFAA 1W1IA 1AHHA 3F5FA 1IG3A 1YS7A 2D7JA 1VIVA 3H2BA 4XOUA 1ND5A 2X3FA 3NTUA 3RFCA 4FFMA 3RRZA 4FYJA 3VXKA 1AOXA 4GI2A 4K0RA 4O4IA 1ODSA 1DBWA 5LMNB 2QPTA 2RAUA 1A4IA 3FYUB 3IDQA 4RCZA 4U6QA 3PGLA 3SEAA 3FMFA 3UH1A 3IJPA 4ND1A 5GMOA 5KVSA 3AF6A 1H5UA 1N6RA 3F5DA 1V9SA 5HTKA 3MWKA 3IDOA 3E5RA 3A4IA 5AKIA 2X5JO 3UUEA 3W3ZB 3CRZA 3SY8A 5A4IS 2Q99A 5KOHA 4WY8A 3RI3A 2Q3JA 1AZLA 4A0RA 4K3UA 1L4HA 3UB3A 3MWJA 3VNUA 2VJPA 5FOTA 1H3FA 3MERA 4GRIA 1K9SA 1Z88A 2D2XA 4B6JA 1QB8A 1Y1KE 1M8JA 2JGJA 4PGHA 4ZVKA 1M1NA 1J2YA 1X70A 2ETXA 2KM1A 3VH1A 2C2ZA 5E6UA 5KTMA 1QO0D 4PXAA 1JKJA 1QRAA 2WYVA 4RF3A 4U7WA 2ISQA 5ABPA 3T1OA 1CNEA 5LOVF 3C87A 3WMFA 1J8FA 4TMZA 2JA1A 1CY0A 3SF8A 1WSDA 3DDHA 3KBBA 3KFVA 3PUXA 4I3GA 3D5EA 3I2JA 4JJGA 3IKMB 4D56A 1YIAA 5GGYA 3ZW9A 1UOPA 1ZRSA 1YB6A 3L82B 3WISA 3M8KA 5IULC 5EKXA 3KXDA 4WNIA 1GGVA 2C9DA 3R3YA 1P1IA 4QHTA 4D9NA 1JFLA 2C9BA 1QIFA 4JOSA 4D8VA 5HOQA 1VLMA 2LP4Y 2XA1A 1Z5GA 2PT6A 1EVEA 3H4IA 3JXEA 4RBNA 5IBQA 5DWVA 3I3OA 1IC6A 1B42A 2AC7A 3EIXA 2AOWA 3FNHA 2HZBA 3KPVA 4IG9A 1GCAA 4Y7DA 3SE0A 3K6SB 2OPBA 3K5HA 3N5CA 1QO9A 2XT6A 4IHQA 4OY3A 5HMLA 2LTAA 2X0DA 4LOKA 3FPKA 2JVIA 3ZQUA 1G41A 2QW0X 3CVJA 4CV1A 2BGTA 1UDWA 1N3YA 5TF0A 3TLBA 3X1XA 4FC7A 4FW8A 2I4IA 4R9UC 2ZSAA 5THKA 1X1TA 2QMYA 4EUHA 1E7SA 2ZIXA 3Q85A 2LKCA 2L69A 1D5WA 2DUJA 2GXUA 1JU9A 2QG4A 4IVQA 4M22A 4OGGA 1PX2A 1EZZA 3FOCA 4G5RA 3ZCSA 1FUKA 2N1MA 1DQZA 2VDUE 1O4VA 3IAXA 3K6KA 3LLSA 3ZW8A 5B30A 1VRVA 5HYVA 3KQNA 2R84A 1ZK1A 4BQQA 3HM9A 1X7XB 3K35A 3OC6A 5L6LB 3X1KA 1G8JA 4KFCA 1DWPA 4YI5A 3TIFA 3S44A 1KOJA 3WE7A 3A06A 3GZ4A 5JWRA 3A6HA 3IMCA 3DBOB 4QUAA 2MSKA 2M6KA 3RIGA 3TLAA 1O6BA 1B73A 1LZKA 1R9JA 1FF9A 3U4IA 3ZDCA 3AVUA 4NAHA 1K6XA 5B5SA 4KR7A 4KX5A 1F2TB 3JD1A 3EFEA 3OAAD 4LJ9A 4WI1A 3WGYA 1QKJA 1UFOA 2IOQA 4HGQA 3IV6A 3E2IA 4R5HA 4RF4A 5FTWA 2WWYA 4QTXA 2J32A 4P4GA 3DB2A 4DCNA 3AHHA 2ZJ6A 4BMPB 1PQUA 5TEWA 3WQBA 4DIFA 1SPXA 3DMDA 4TXJA 1HYHA 2I3BA 3DOUA 5JR3A 2AL7A 3VHRA 4HCJA 2XMPA 4YDQA 2R1VB 2P6PA 2O2CA 4E09A 4HVCA 1VSTA 3OKCA 4AO7A 4CMAA 1JB9A 2Q7XA 4X1OA 5AHXA 2JFHA 3C5EA 1A9YA 3HEAA 3IXLA 1MB2A 4CM9D 2SNIE 1ZK4A 2CL5A 2ET6A 4F3RA 4BWYA 3QI7A 1DIRA 1NAIA 5KHOC 4C04A 3L7LA 1P8JA 1GZHB 3FVWA 1NRXA 4MB6A 4Y98A 3VZSA 1TZCA 4MGEA 1I7NA 2G3YA 2IIPA 3SX0A 3L6OO 2QK4A 4Z7NB 4O2AF 2P4UA 5IT4A 5LWHA 3GEIA 1U3VA 2IHTA 2O2HA 3P5SA 4KEAA 1XMIA 2O19A 3MTJA 5DCUA 2X6RA 3MTAA 3CUUA 2CZCA 5DNUA 1DCKA 5D5HA 4TOIA 1AGRA 4RPIA 3RREA 1V3QE 4EO7A 1T9DA 3HJAA 4TVSA 5IXYA 3EUWA 2MTBA 2YJZA 1UQRA 3ZD9A 2CDRA 2H8GA 4LISA 5AI5A 4YPOA 1FBTA 3AZPA 3KAQA 3OLYA 1VHDA 4GT1A 5TS2A 2LDBA 3FKSD 4Q0MA 5I7WA 3DKKA 2J33A 2ACKA 3H11B 4CF3A 5FDFA 5I4IA 1TMYA 3VZPA 4RFSA 3C0KA 5FPPA 3OQ1A 4C21A 3WAGA 1XTIA 1UMDB 3DZ8A 5L3ZA 2JK1A 4IPTA 1EWVA 3CRRA 1JFVA 5UKDA 3ZWVA 3AVWA 3G0OA 2Q4RA 4JLJA 1NW4A 1EGAA 1HLGA 1U0EA 1U9YA 1X7DA 2QJOA 4DNPA 5J59A 1QR2A 2Z5GA 3MXTA 3MYYA 2GN8A 2WF8A 3FGNA 2A33A 1NVVR 3OSZA 4HG2A 1RI3A 4HF7A 5HFNA 5ITVA 2BHLA 2YBEA 4KYTA 2W70A 1C9MA 1XN1A 2QROA 1SR8A 2JK0A 1HH4A 1FK8A 4JL6A 3N0RA 2OKGA 2PZBA 2XUZA 1ISRA 4IDEA 5L3SB 1TIKA 3BXGA 4NBUA 3RGWS 1MC8A 3MCZA 5AXAA 2PK3A 2GA8A 3FTCA 4LHWA 1TM7E 5EE1A 1WMFA 3GMTA 3KOOA 1Y37A 3AY6A 3L92A 4CKYA 4Q4CA 2AEEA 3E58A 3X3HA 4M8NE 3A1UA 2OGSA 1LK0A 2Y1OA 4MR9A 2H9YA 1SQ5A 4P1ZA 4C76A 1L1RA 1YONA 1ZUWA 2BDUA 1TW3A 1M2VB 3AR4A 3CN7A 1Z6QA 2BW0A 1UMCB 3GELA 3IFSA 3ZWBA 2IY7A 4BIMA 5IX8A 4JZKA 2PGXA 1M2HA 5JS1A 1QNLA 2GYYA 1ECCA 4JI4B 4K03A 3GT4A 4TKUA 3G5TA 3HLYA 1DHRA 4FDMA 1WMEA 1FRZA 1W47A 3T3EA 2V1UA 1R7RA 4ZQBA 5IUKC 3TMKA 1M73E 2GO1A 5ERGB 3WL4A 1E79A 2YJNA 1PJ2A 2VDMB 4YC7A 2FSHA 1OB5A 2QVBA 1VHLA 5CCDA 4L76A 1GGFA 1IEWA 4Q19A 4BDSA 3DUFB 4OQQA 1H2BA 2C95A 2BMJA 2Y4OA 1AX9A 2GHTA 3I76A 4KVGA 4QFMA 1Q15A 2XIQA 4IIXA 1POWA 2X9GA 4HDNA 1U5AA 1Q83A 2PO5A 2HQOA 2I6GA 5JISA 1FTGA 1MO6A 5JXHA 5AT1A 4AQDA 2IPLA 3GN2A 3CPHA 2YWHA 1WO8A 3A9CA 1TVKA 2FR8C 1RM3A 5U4QA 3SXUA 2FK8A 2RK4A 3B48A 4GMGA 2HHAA 4EEXA 5BQOA 3JQ8B 3OUTA 4ZJPA 3F7MA 3VV3A 5HJ2A 1DJMA 2J85A 4YJHA 1V43A 1NATA 3N2KB 4Q34A 4YQFA 2C7GA 3JAWB 3ST7A 3EOAI 1ISPA 2L42A 4ANFA 2QP3A 4MXDA 4ZU3A 4EG3A 1Y9EA 1Z8HA 3EGEA 4IXNA 3R74A 2D1SA 2NVUA 1CJBA 3D2CA 2YHSA 3MMSA 4EJ0A 4B79A 3F73A 1SZCA 1XALA 3RYFA 1J1UA 1MXHA 1OX6A 3P9YA 1PV1A 4RHEA 3LPLA 4P6VF 1WCIA 1HYBA 4MVCA 2HWYA 3ORRA 1LD3A 5T3YA 3C1AA 1ENYA 2QRVA 4M0FA 5JNSA 1OH5A 4CMBA 1H5NA 3E05A 1E3MA 4L8YA 4X97A 2JLQA 2VF4X 5CUQA 1E2KA 2WAXA 1G1AA 4ZMRA 1RD4A 3H75A 1EFTA 2G72A 1Q0HA 3LG2A 3SZUA 4QT4A 3QY0A 4BGEA 4AZSA 4KRYA 2PSFA 1IVSA 2CLFB 1Z18A 3IAEA 2P5YA 3DOCA 3MWDB 2IUTA 4H7HA 2JLZA 1XTUA 2J3DA 2KHZA 3I04M 3NHAA 4ZOLB 2UYGA 4P7BA 4DAOA 1KL7A 2VK4A 5GADl 4GRDA 3PQDA 3KVRA 4M0LA 4MQEB 1H1LA 1W5EA 2JG3A 4WNYA 2ORED 3AY3A 1SUCA 4N0PA 4NV3A 1FP1D 1KVQA 1AVTA 4LY3A 4C0LA 1P1CA 2D1FA 2E4UA 2XNSA 3JD3A 3MWLA 3ZNPA 8AT1A 3Q8LA 5DK6A 2PZ8A 2WK1A 1SVIA 4GXRA 4JELA 3PDUA 4NVRA 2DKFA 1BC5A 3IP3A 1NXPA 2ZUTA 1O8CA 1NW3A 3LLMA 2FN7A 1ORVA 3TZ6A 1VJRA 1K5GA 4JCCA 3GHHA 1JG1A 1VECA 4KDFA 1IL0A 3ZIAA 4C89A 4ZMBA 5CBPA 4G0WA 5G02A 3GVHA 2PGJA 2Q6IA 3CT4A 4R0VA 1XQ6A 4EENA 3AC0A 3VMFA 3SVTA 3EGIA 4KXYA 2WM9B 4MZDA 3ODPA 4FMCF 2WTNA 5D3MB 4DMHA 3AJAA 1DINA 4CCYA 2BGGA 5DHRA 3B1JA 2ODWA 3KTFA 3AH8A 1OILA 3KYIB 1JF8A 4NYJQ 1H0SA 1AC5A 4A5OA 4CNQA 5L3QA 4HH3C 1QS0A 1E6LA 1H69A 1SU4A 3FI9A 3JQ9C 4R31A 4TKLA 4LF9B 1MAAA 1YVDA 2PCLA 3P5BA 4GI5A 4FNOA 1IY0A 4Q3DA 3ZUGA 1KAOA 1VHJA 1YS9A 1W0CA 1ZW1A 2QX8A 5AVUA 2BDEA 4E07A 1ZMBA 1ZD1A 3KELA 5ECWA 3K6SA 3A4TA 4PHCA 4ZAXA 2XNKA 4FGKA 2JGDA 4CEHB 3GARA 4IHJB 5TVKA 4BQFA 6CHYA 5ICGA 5BR4A 3AEQB 2JZOA 4BRZA 1Y3DE 2JJ1A 3DHYA 3SDBA 1TZMA 2JI4A 4MKRA 2EP5A 2ZIZA 4PQRA 3FVRA 1VL8A 5IC5A 5IXSA 4YA6A 3H1TA 1ZD4A 3H2KA 1W4ZA 2JJQA 4MP3A 4A8JB 4XDGA 2IUFA 4GC9A 1EGHA 2Q7OE 1ZAKA 2D2VA 1NWCA 4G09A 2ORVA 3B9BA 4HQLA 5C80A 3N2NA 4W8GA 4ZVNA 2YXEA 3AKCA 4BAUA 3ZX4A 4C30A 4EHIA 1VA4A 3NALA 2ZYTX 3QKRA 3TSOA 3PI7A 3BTOA 4JQZA 2P9GA 2YWFA 5BW5A 3ZI0A 4MEAA 2FK7A 4IJVA 5CT8A 4UD6A 4KRFA 2PQMA 3EIQA 4AY2A 1A8IA 1A7UA 3WDMA 1TQHA 1QDUA 1G9SA 2ZYIA 1SBCA 2W11A 2PTGA 1T6YA 4L27A 4CXMA 2PWPA 3QEKA 1L3BA 3MTQA 1NW6A 2AMYA 2BFCB 3I0NA 3MJTA 4FKZA 1WP4A 1W5BA 4QIHA 3V4PB 4QYIB 2QRGA 3EXFB 5LLDA 2JZCA 3LY7A 5IM4A 4XCVA 3B70A 1SN7A 2QTTA 4D0LB 5JH7A 2ID4A 5JFOA 3MJCA 3IL2A 4JQCA 4D25A 2W6JA 1LPMA 1ETHA 1F2VA 3JQPA 1FFWA 1XTTA 2Q2OA 4YQZA 3Q9SA 3WO1A 4YPVA 4HFRA 3TBKA 4DEVA 2C5BA 2YVKA 3KYCA 2ODEA 2XNHA 2GVDC 1SCAA 2RFLA 2X8LA 1VQ1A 2IW1A 2WDZA 2ZI6A 1CVIA 4UNPA 4YX9A 3IE1A 3ZHVA 2BR5A 1SKBA 1R2QA 1EJ6A 2XB8A 2QUKA 3GDGA 1JDBB 4Z1MA 4DHWA 5D6NA 2XUPA 3GJ4A 1FFYA 1IUOA 2DH6A 1PWZA 2YN2A 4NG5A 5DCWA 3NMUF 3KBOA 2B7LA 5IRCD 2XD4A 5FORA 2Q3MA 4XPIA 1M2NA 3VSEA 1PHPA 3VR4A 4HWKA 5I9IA 5HP4A 4JOCA 1USWA 2L0XA 2XPCA 5IS2A 1JZQA 1NBHA 2BUAA 3A9VA 3NHMA 4MVJG 4MRMB 5JSYA 3UXHA 5CJ2A 4HNTA 4MUEA 2FHPA 3NRBA 1ML3A 2AYXA 1WA5A 3EXEB 3UANA 4RVCA 1ZH8A 4BZWA 1DBPA 1Z2DA 5ARDA 5TQ0A 3CLSD 3OCCA 1FU8A 5A4KA 2VHTA 1XMSA 2NPIA 3IPAA 3CG4A 2FN4A 4FR0A 4M1ZA 4NZMA 5FR2A 3ZE2B 3PA6A 3ILHA 2NTVA 2P9HA 3SZMA 5BV0A 1T29A 3DHNA 3PPWA 2AHRA 3EBPA 4RY0A 2OHJA 1XXHB 4OGWA 4FE7A 5C31A 2MT9A 2W4IA 4I1YA 4M0EA 5ALLA 4ER7A 3SI7A 1X0XA 2OZPA 3INYA 4J9VA 3U13A 3V48A 3QLVA 1XDDA 2QLMA 5GOZA 1UM9B 4HFNA 1K63A 2B1QA 1ODJA 1PJ3A 2JASA 3V7NA 4KR2A 3AILA 3QNWA 2QT0A 4MW2A 3FI0A 2VFAA 1AKMA 4GLLA 4DSOA 5EHZA 2IFTA 3AL3A 2FMKA 4BNIA 3GLIE 2FDCA 2QR2A 3UFXB 4W7SA 1R4NA 4CTMA 1BE8A 2GQ0A 5EKUA 5HCNA 5LQDA 2BMDA 1JHZA 3LX5A 3R3VA 5TR9A 3RFVA 4NCNA 3VNSA 2P9CA 4F6RB 2I2CA 5BUZA 2EFEB 2JH3A 4H35A 1IN1A 3L8GA 3OZEA 1WDLA 2SICE 3EK2A 4MQEA 3OZRA 5E2BA 5G40A 5FTLA 3SYLA 4MS4B 4MKFA 3BWCA 5AM5A 5CA1B 3BB1A 3ZIUA 3LGXA 4WESB 3ZY3A 3WWDA 2VK1A 4BV2A 1WXDA 2Z9CA 1YL7A 3ZR4B 1T8SA 3UBTA 1WF6A 3CNQS 1E3QA 3SM9A 3COPA 3A26A 3DD5A 2Z4TA 1LWNA 3AESB 4QGFA 3U37A 2CLKB 1JIXA 4R41A 3RADC 4EHAA 1LI7A 4PSDA 4TKVB 3PCXA 3B78A 1M75A 1ECLA 1XZ8A 1CQIA 3C1UA 3F9IA 4P38A 4I08A 2P0EA 1P39A 4MQ6A 3OJEA 4QWWA 1B3BA 1Z25A 1KYWA 2IV2X 4BFZA 4EY4A 1HQKA 2QRLA 5B7PA 5SYNA 3GROA 1HORA 2QIOA 1RZRA 1SQSA 2NVOA 2IODA 4TXNA 1G291 1N2CB 4PTYA 4Z9BA 4HHEA 4NL4H 1P7VA 4ZO9A 4WZBA 5E3JA 3TGPA 1J1IA 1MNQA 1K0FA 4LXYA 4QUEA 1GTVA 1GQFA 3GRAA 1P5FA 2QMUA 4TROA 1LJ8A 2NXCA 3DO6A 5DYTA 4RXUA 5F7ZA 1NOIA 3TXXA 1I3KA 4MPPA 1ONOA 2YQ4A 2YYSA 4UREA 4XR9A 3MIIA 5EJGA 4R6XA 4AF8A 4AJHA 5FLYA 4AZ3A 1VLVA 1GDDA 1Q16A 4RVGA 3F2IA 5FRDA 5FAXA 4FMDF 4N41A 5HG0A 2OAQ1 3P97A 5C1OA 3ZDQA 5CVDA 1YE5A 5C8YF 5HK9A 1U7WA 2AN3A 2QQ5A 2VP9A 3M5CA 4RD2A 3TZLA 3H4TA 1O3YA 2X0JA 3U3JA 1MMFB 1D1PA 1PGOA 1XQWA 2VHQA 3NC1C 1WVIA 2PXAA 3LC0A 3NASA 4QICA 5EAIA 4RHUA 3CW9A 4Q3NA 5T3UA 5ALUA 3F3MA 3FRHA 4N65A 3IEUA 4CR8A 2UAGA 4I66A 1I94B 4L4YA 2VWHA 2HB6A 2PX5A 4P08A 4KV7A 4OMDA 1UXIA 5DIFA 3ASVA 3EC7A 1E8MA 4ZYVA 4GZ6A 1RADA 3EIHA 4NBVA 5JTTA 3KT0A 4CLOB 1I7PA 1G6HA 5F3RA 4EMUA 5HHTA 3DLBA 3UWOA 1O95D 1CQJA 2CMGA 3HKEA 1T5BA 1GPNA 2O0JA 1JLSA 3HJBA 3I72A 1VSUA 3LHFA 1LK7A 3M6MD 3O4VA 3NDBB 2V4MA 5DNCA 3LX4A 3QF7A 1SUPA 4H7FA 1IZ0A 4MWEA 1Q91A 4J2HA 3IH5A 2QN1A 3VI4B 3G2NA 2AV6A 4DR7B 2C3OA 4RDCA 3M89A 2FUKA 1M6VA 3C5VA 3PHLA 1WPRA 2IYRA 3GLKA 3THWB 2JJ1D 2VO1A 1JW9B 2P7IA 1N6HA 3F8WA 3O7MA 5JAZA 1USKA 3O75A 1JU4A 1M83A 2F43A 4OSPA 4UMDA 5DNWA 4YCSA 4F86A 2FXIA 3QUCA 3OCZA 4MR8A 4XPZA 1HYQA 2DWUA 3A31A 4GQBA 2EU8A 1ZM9A 2GPNA 1TT5B 2F1JA 2I1QA 3C8HA 3IJ5A 4H0CA 1GZSA 3ZYCA 4DAEA 2D8AA 1GZ3A 3S8MA 3GNLA 1SPBS 3UM9A 3K0CA 4P5EA 1AKNA 1GNLA 2GD6A 1J99A 4MV5A 5HKAA 4R83A 4G37A 3BUSA 3EVTA 1OLOA 5LOVB 3FGPA 3QVGB 2VSYA 1JG3A 3AF1A 3L7IA 2MSWA 4QJ4A 3AM1A 5BSRA 1GM5A 2OD2A 3T06B 3K1TA 3H84A 3QBTA 4I2NA 5DT2A 1PL0A 3NM4A 5FWYA 4TQAA 4C7OA 3FROA 2P11A 1OYYA 2Y67A 4DV7B 3X1MA 1U4NA 4NEGA 2ZYHA 1MAHA 3O90A 4Z0PA 2WVGA 4W6QA 5AUOB 2WJPA 1WZUA 1YNOA 1OWNA 2EL7A 4MVJI 3ZWQA 5K3EA 1E4EA 2RHDA 4ZDIA 2W00A 2XGGA 3HBLA 1PJZA 2AC2A 4UW9A 5AOBA 3VR0A 3ETNA 2KI5A 3I34X 2X8JA 1ULBA 1WQ1R 1IZ7A 5HR5A 1C50A 4MROA 4ENVA 3OT4A 2O48X 1SHLA 5AQEA 4LJ4A 4PYMA 3CQ9A 2XYVA 1PL6A 4RTJA 3DWEX 1OYWA 3A58B 1B8OA 3CX7A 3CW2A 4L5AA 4MKZA 3QM1A 1PT7A 2CNDA 2VXOA 5A0VA 5GGXA 5D1HA 2OV6A 3H5AA 2OG2A 3CUEF 4J0IA 1KNXA 2DFVA 3C3MA 2WI8A 1R4NB 3AGPA 2ZJ0A 1HEUA 3ZJUA 1VSVA 1N25A 3S2FA 1EXVA 3W3AH 4GU5A 2MHCA 4MV3A 1P62B 3JWJA 4BP9A 2YIJA 1AMUA 4DV1B 3K5IA 2J46A 3RTCA 1KQOA 3HFGA 3H2ZA 1NR5A 2RGXA 1A50B 1DRKA 2YJ3A 5IJZA 4REQB 4ZZIA 5A4MS 2PLAA 3RAJA 1PNRA 3L7AA 5KC8A 1I6KA 3WFZA 2O2XA 3I0ZA 3B51X 3F6SA 2VF5X 3I1YA 3V1NA 3W78A 2ETVA 3SSOA 3H2GA 4RAOA 5CD1A 2DX7A 5AKKA 3VDQA 2BEJA 4YHHB 1WP9A 4ALNA 4GX5A 4IWNA 3S1AB 2B1RA 3DE1X 2HMSA 4M6WA 4K9KA 4ZAGA 3WJAA 1J4AA 5GV8A 3X2FA 4PRYA 1QQTA 5FFNA 1YA6A 3OD5A 4WKBA 3L6DA 1ZGGA 3RV4A 2XZOA 3U56A 3N7TA 1ZG3A 1QOZA 2F90A 2P1ZA 2BGUA 2OZEA 3R0VA 1X7HA 1EFDN 4FOTA 5DP1A 3QF4A 4YUVA 1D4FA 5K20A 4K40A 2ODTX 3DTVB 4GOXA 2VNHA 4R98A 4W1QA 3RT7A 4AQYB 4YV1A 3A9UA 1JTEA 3LUPA 4BZXA 2ZQ5A 1DKUA 3TZHA 2HDWA 2C5SA 1ISMA 1ST2A 2J9YB 3KYDA 4B3IA 1WWKA 1XQ9A 1ZU4A 4N6NA 3K0SA 4BKMA 2A5FA 5AUNB 2PGIA 2ZYGA 1X1BA 2BEWA 2I0FA 5F2KA 3H99A 2AEMA 3MHTA 1GO2A 4XWTA 3HVKA 1RC0A 4RD1A 2EW1A 4F45A 4PV7A 1ENZA 3FVQA 4HUQA 1K5HA 3LKBA 1PJQA 2V9CA 1VE6A 3ILXA 2C7VA 4GBGA 2MSNA 3CRQA 1R00A 3HN7A 4GPTA 5JMPA 5TXGA 1CC1S 1JJVA 2OXEA 2WJVA 4NFHA 1T2CA 2IA5A 5CNMA 5D2CA 2NUAB 1W4BA 1OZAA 3MD9A 1E9SA 3B3GA 3AYZB 4G65A 2ATXA 4H1TA 4HAUA 4KVZA 5DNVA 2CL6X 4DWWA 4G56A 1UM9A 1R6DA 4I4TF 5H3LA 4E03A 3DMGA 2PSHA 4FOOA 4MGIR 4UATA 5EIHA 1Z2PX 4CV2A 1BXGB 1RTKA 4G1FA 3LX6A 4HAYA 3VPBA 2ZTLA 3QXJA 2AVNA 1P9NA 1D9ZA 1PKXA 4N0EA 3UHJA 2C9OA 3ZD8A 2G07A 1Q2UA 4UZSA 3AWIA 4Q5IA 4CUZA 5EGSA 3W2FA 1XHEA 1DO8A 4DMFA 1P9RA 3LQQA 1D5CA 4EMTA 4CMEC 1TUEA 4F4IA 4XUDA 1PV2A 1CP3A 1OFUX 3KU1A 1XKXA 3AXTA 1GGEA 2EBWA 5KYXB 2ZROA 3JYPA 3JAKA 3EHDA 4I81A 3THYA 4NZ9A 5BO5A 3RFFA 1ZOLA 1YHNA 1Z2AA 1ODIA 5E8RA 1G8HA 4CM4A 4D81A 4EUNA 2IQ5A 3RUCA 3VOSA 3JQRA 2HK6A 4XQEA 2GM4A 5HIKA 1K5DA 1PQ4A 2FSVC 2VBFA 5ALMA 3F6CA 5JCOC 3FPHA 4D4HA 3NT2A 2Q4DA 1DOAA 4MQ4A 4RIGA 2W98A 3RGGA 4FFRA 4UASA 5AM4A 4J1TC 3IOYA 5IWAB 3K70B 3FTDA 5JO9A 2HSZA 1T0IA 1TJ3A 3F98A 4XXHA 1MW9X 4WOKA 1XQYA 1W19A 2VUTA 1IATA 3U3ZA 1CJVC 3K5WA 3PNVA 3ZXIA 2BSQA 4ID3A 1KK2A 2OHGA 1LBSA 4YP5A 4ZAVA 2A67A 2V7UA 4DJFC 3CU5A 2P9ZA 2YVUA 4AF7A 2WIKA 5A4JA 2OD7A 3DZBA 3KHTA 4JT9A 2X0EA 2YWJA 2PX4A 2RAVA 4FFNA 5EP4A 1P0CA 4KE6A 6REQB 2IYTA 3V5NA 5AYVA 3SS9X 5C2JB 1CS4C 3I42A 3RSGA 5CAEA 5KTOA 2JFOA 1VE7A 3HVRA 2QHXA 2YXBA 1VJCA 1L8XA 2R00C 2CHVA 1G8SA 5BSEA 1QANA 1FB5A 1X19A 1Z5NA 1V95A 4O33A 4KQFA 2OUIA 4RV4A 3UAVA 4IHKA 4I9NA 4MARA 5H8WA 3E7FA 3NLLA 3BMCB 3RS9A 1K7YA 1R12A 1U9IA 1VJTA 4WDRA 3AXSA 1AKWA 2F1IA 1KY5A 3HB5X 3NEJA 1THTA 3KXLA 1NNI1 3IQEA 3QPBA 1ZA2A 3H1EA 4J2TA 3D81A 1IM2A 1EUZA 3GZJA 3V1UA 5CBKA 1VMKA 2Z30A 2FG6C 3PZRA 2R79A 4U0JA 4HDNB 1T9KA 2CHFA 5BNWA 1Y81A 1FEZA 4AKTA 4KSYA 2OSBA 1E2JA 4UHFA 1D2NA 2DTDA 1V0JA 4LZAA 5CX1B 1DAOA 2QGFA 4GM4A 4HD8A 5L7YA 2WKPA 2WWGA 1NRJB 1G38A 4IF6A 1L5WA 5BXYA 1JQ3A 3RYHB 3ZLJA 1YGYA 3KQVA 3HXMA 3NOOA 5JSKA 2JGLA 2XAAA 4KUGA 2AN5A 2HU2A 1EK6A 1IJKA 2KJQA 2NVBA 1IWPB 1IQRA 1ULTA 4F7WA 2MYUA 3U7FB 1L1EA 2WA2A 4N48A 1S89A 2DPMA 3RV3A 5L3SA 2AOTB 3KE9A 3IUYA 4R4JA 1CNMA 4BQOA 3ZQKA 1Y98A 3R24A 4ABTA 1CHNA 3BHJA 3TGLA 5CB0A 4Z4QA 3E53A 1DU4A 3V3KA 2QYOA 3LX8A 3BB4A 2ZT6A 2RH5A 2DF8A 3HR7A 3IOCA 5ICFA 3GVIA 4EJFA 2IHUA 3M6IA 5HQ3A 2VTBA 1VRCA 2AZ4A 4E11A 1KJYA 3LNTA 2VQDA 2NT3A 5EQDA 1VB5A 5JDCA 2XWJI 1USIA 3HY4A 5SZHB 1D04A 2WIBA 5JYBA 4EYGA 2QTVA 1TQ2A 1JVSA 2JIPA 3K2IA 5DNYB 2NSHA 4X1KB 5E3IA 4JJ8A 3E3AA 5EIFA 2PUDA 3QBVA 2P2YA 5H5JA 3FB1A 3GPIA 4KJXA 5IK2A 4WXPA 5AVTA 2FNAA 1QF6A 3V8VA 3M70A 1X38A 3NBYC 1TYCA 2WBLC 3GG2A 4AG3A 2C92A 3NG1A 3O83A 2H2DA 3L9WA 4LYGA 3VSAA 4M9SA 2D5BA 6ADHA 3L4BA 2WSYB 4J8PA 4Q93A 2EBHX 4IDCA 4PO3X 3L7YA 3ZK9A 2FMUA 1VCIA 4R1LA 4RACA 3A7EA 1KIMA 1AXRA 2H54A 1ZXXA 2GASA 2P2ZA 3ANLA 3DE7X 4QDZA 2H0RA 1T10A 1WXEA 1EK0A 2GVZC 2IHJA 3JYOA 2IYWA 1FVXA 3C3YA 3K4HA 1Z13A 4WCFB 5MGBA 5TQ2A 3M4YA 2VJNA 2WG0A 5JPCA 3EA5A 3OQOA 1EDBA 1ZRHA 2IIQA 2AN9A 3P2JA 3SMQA 2CCGA 3NBQA 4OAQA 3WRVA 2RDMA 4B76A 1MQ8B 3FTNA 2CXPA 1MG0A 1DX6A 1DAHA 3BPSA 5EHQA 4G1CA 6YASA 5L4SA 4RCYA 4JEIA 3BREA 1Z4QA 4TQ9A 4XAQA 3T9FA 2IXFA 4JLOA 3V97A 2Z8YM 1NN5A 4RZUA 4EW1A 3VC2A 3BE6A 3VOTA 3ZTYA 1OGYA 3GPLA 1AM4D 3QE2A 1EGVB 1DFHA 1RAEA 3RTAA 3ZHXA 1NXSA 5FA5A 4PY2A 4ETMA 4IX1A 4UJ5A 2HYIC 3NKFA 5FLEX 2CNWD 1TM5E 1GG2A 4YEDA 3WL5A 2CB9A 3ILSA 3PEVA 1NSFA 2BKAA 2J5RA 2Q21A 4H7DA 3JAKB 4C4XA 5FT9A 5C9ZA 3PWSA 1E1RD 3Q3IA 2QTCA 4GNRA 3NVDA 1RQLA 3S68A 4LOHA 1ZZEA 1WCYA 4LXHA 4CKXA 4RQTA 1VL5A 1DGQA 2B5VA 2R1TB 2WNIA 4JJ4A 3LOUA 1T9CA 4GZ3A 3T1YB 1J56A 3V55A 4B3XA 4HAVA 4JY7A 4TL9A 3SR3A 2GJKA 3DZFA 1PK9A 2F3PA 5F35A 3U49A 3U81A 4FM9A 3BA1A 1SOAA 4H77A 1Q84A 4QFCA 1G55A 1GU7A 1DI0A 1II0A 3M1IA 4TLDA 3T5MA 1IIBA 1LVGA 5DX0A 2VP3A 5CG2A 3WLHA 3R6GA 4MTCA 2NO5A 4QUGA 1XG5A 3B9QA 3WQHA 2C8LA 2WMOB 1AGPA 4UCXA 5FLKA 2VJBA 1TF5A 2UXBB 4M6WB 2I99A 2HX1A 3SCZA 2I87A 1PGNA 4C7VA 5BN3A 4K9PA 4GKVA 4KGVA 2XECA 1QR6A 3CZ5A 1SG0A 1C7EA 1NLFA 1WD5A 3C4JA 3IQHX 3OHSX 4HVTA 3KQSA 1B26A 1EVQA 4R51A 5LQAA 3K71B 1Y7IA 2XQVA 2ZI4A 2A1UA 4U6NA 5G41A 2Q3DA 1I7LA 3DCJA 1BKSB 3IUBA 1FS5A 4CW7A 2C54A 4RSMA 1KJQA 2P7HA 3C6ZA 1E62A 1IU9A 3P9IA 5H68A 1T9AA 3IEKA 1ESMA 3BK7A 1FZQA 2UUPA 1G3MA 4C3VA 3MINB 3F3YA 1P7CA 1K3TA 2CSUA 1WTCA 1IHOA 4LJKA 3GUZA 3VR5H 2Y1KA 2WAYA 2ONKA 4HOYA 3BIFA 2OCAA 3IA7A 4MLCA 4P0QB 4H7PA 2GM5A 3HTXA 4Y2QA 1RQPA 1TKRA 1QGDA 1XT6A 2FWNA 5H80A 2QD1A 2A9JA 1QQ7A 3CR3C 3E0QA 5EMNA 4GGMX 2O2GA 1FSZA 2HSDA 3EGCA 2WHRA 3INGA 3MWEB 2NUAA 3C24A 3P9KA 5F12A 3WGLA 2B6HA 3CVVA 3CJRA 3LPMA 1ZH6A 1P5RA 2PO7A 1D2RA 4JT4A 5K0FA 1QJCA 2GB4A 4FGZA 5AM0A 4YH1A 5KKNB 1AHPA 3TRKA 2RCNA 2OR3A 2HF2A 2OAGA 3D6HA 4YPFA 3FCOA 1MD9A 1BXGA 2TMDA 2CCKA 3PNKA 3V1KA 1UEXC 3JQFA 3EZ6A 3KSMA 1ZVKA 1X1AA 4FPXA 4QX6A 1B8NA 4D6XA 4ZI2A 1VE5A 2J6CA 3HB1A 3K8YA 4Y6OA 2HXSA 5SICE 1TC2A 4CYMA 1Y5MA 2NXEA 2AQ8A 4AMGA 1FDRA 3MUOA 5HCUA 3WICA 3HO1A 2VH1A 4FS3A 3MRTA 1DQPA 2FFJA 4K9OA 1IBLB 4R2MA 1NJGA 2PU5A 2HLDD 1E60A 2HUPA 4FFPA 1T2FA 1JQAA 2YS7A 3KR1A 5ALGA 3T3HA 4Y9RA 1KMMA 3DUWA 1VKNA 3EXHC 4PYIA 4ZU6X 3PUIA 1SZDA 2NYAA 5AKXA 3IUPA 4TYYA 1I3OA 1U80A 1QYDA 5FV7A