4YQYA

Crystal structure of a putative dehydrogenase from sulfitobacter sp. (cog1028) (target efi-513936) in its apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
251
Chain Sequence
LGTENLYFQSMDLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEGSSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPKIRVNSLCPGMIDTDFHNRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Dehydrogenase
publication title Crystal Structure of a putative Dehydrogenase from Sulfitobacter sp. (COG1028, TARGET EFI-513936) in its APO form
rcsb
source organism Sulfitobacter sp. nas-14.1
molecule tags Oxidoreductase
total genus 87
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yqyA00
5JO9A 2HAEA 3PJFA 3PDUA 1NASA 2I3GA 4J4BA 4O5OA 5T5QA 4X54A 2X58A 5IZCC 1GUFA 2JKVA 3H7AA 1XYGA 1WZIA 4BNKA 5JNLA 1O95A 1KS9A 2HMVA 3IUSA 3VZPA 2AQIA 3DOOA 4XCVA 2HMUA 4P4NA 4CMJA 1EFLA 1PGOA 1PS0A 4IDAA 5AXAA 2ILTA 1GADO 1YB5A 4M87A 2JAHA 3BA1A 3TNLA 4H3VA 3S8MA 4DIOA 4XEHA 1K5HA 2VWPA 4TRJA 1DOHA 1HE4A 3C85A 4EZBA 1ISMA 3KSDO 3ZWWA 3DAFA 4CV2A 1NVMB 4FFPA 1BXGA 3PEFA 3G3EA 5AXDA 3ZHZA 5IXYA 3H5RA 1D1SA 1LDGA 5KKCA 1HLDA 1PTJA 1SO8A 2RAFA 2B5WA 4L73A 4MVJM 1C14A 1GYRA 4QX6A 1PZFA 2D3TA 2OZPA 2QZZA 4J3FA 3GK3A 4RVDA 4I5GA 4J0EA 4HX5A 1ZW1A 3UFXA 3I6QA 4ZHSA 4PG7A 1GV1A 3GUYA 2CZCA 4DGSA 4D42A 5EMHA 1VJTA 3F4LA 4XA8A 1NWHA 2EIHA 3QE3A 4YVFA 4JX8A 1N1EA 3I23A 5KJCA 2OBYA 1IZ0A 3Q9UA 4B79A 2RHCA 3P2YA 3IJPA 1Q0HA 4WEQA 2EGGA 3K73O 5CP8A 3JYOA 5KWEA 3U4DA 3BMNB 5B37A 1UZNA 3UCFA 2BGMA 3H5NA 4BNXA 4HBGA 4ND2A 5TNXA 3SBOA 4OOFA 4LGVA 1LLUA 3H9EO 4YJDA 2J5KA 1U2GA 2PLAA 1KC3A 3EDMA 1XR3A 1MC4A 3CXRA 4GX0A 4E21A 1ZEMA 3ONEA 1P74A 3KUXA 2W90A 4JJGA 5CDYA 3CKYA 3GDFA 1YQDA 4QXMA 3W6ZA 4J43A 4GSKA 2RH4A 4WOKA 3JSAA 4L74A 3BMQB 3ICPA 4J6FA 3E03A 1DIAA 3DZIA 4J1TA 4Q3EA 4DBVO 4DIFA 1HYHA 2UUOA 1JVBA 1U9JA 4CMIA 2IRWA 4FIZA 4NZ9A 4MP8A 3VVCA 4A2CA 2NU8A 2CVQA 3DEYX 3I4FA 4RJTA 4DC1A 3JQGB 4CM5A 4MKZA 1DXYA 5ILGA 1B8UA 2DPHA 3ASVA 3TZKA 4HKTA 5TLSA 3JV7A 1G1AA 2NVBA 4BNGA 5CPBA 4AFNA 1JKFA 1VL8A 5EQFA 4CM3A 4TRRA 2X22A 1YWGO 1I3LA 4RGBA 2GLXA 1AHHA 3OM9A 3JD1A 5CPFA 4NBTA 1V8BA 3ADPA 4XB1A 5CDTA 1BXKA 3V2HA 5BSGA 5JC1A 3IAHA 3EW7A 4J2OA 1ZXLA 2GPTA 2Y0EA 4JN6B 1D1TA 2W2KB 4IQ8A 3I9MA 3WGHA 4CMAA 3C1TA 3WS7A 4F6LA 1NX6A 4CQMA 3VDQA 5HS6A 1D8AA 1LSUA 1YJQA 3W4JA 3LU1A 2NU9A 1PGNA 4GSLA 4QT0A 2AG8A 2NM0A 4XWYA 4LMRA 4YBZA 1LSJA 4EBFA 5HRUA 2VHZA 1L1FA 2ZKLA 3ULKA 1ZK0A 2R00C 4JLWA 3UVEA 5JCXA 1GU7A 4KQWA 3SVTA 3ANLA 3JQ7A 4RLHA 3OETA 3ITKA 1ZIDA 3S2EA 5BNIA 3CSDA 3ZV4A 1U1IA 2ZATA 4HP8A 5I7EA 4DLLA 2PGDA 4FJ2A 4RORA 4D41A 3WYCA 4JQCA 2G5CA 1ZK4A 3KYDA 5J23A 1JU9A 1QLHA 2VUTA 2ZYAA 3ETEA 1NQ5A 1LSSA 2QG4A 1WPQA 2I99A 5FF9A 3JQDA 4B3JA 3O8QB 3ETGA 3P19A 1JAXA 4JBGA 1P0CA 3KVOA 4J9UE 1Z45A 3DWFA 4TZTA 4XGIA 5G4LA 3MWDB 1PJLA 1H6CA 2W2LA 4J4HA 1XU7A 3L4BC 1I3MA 1LC3A 1LA2A 3HDHA 4R4JA 4CMEC 4Z9FA 3M6IA 1R4MA 4PVCA 2DFVA 1IHYA 4YRDA 3T4EA 4J1NA 1EZ4A 4PN3A 1DHRA 4ITUA 4DWVA 3UCEA 5K9ZA 4J0FA 1V3UA 1GY8A 2IZZA 4NI5A 4FOOA 4U6SA 3TSCA 3G1UA 3B20A 4ZGWA 2WDZA 1TEHA 4GKBA 1BDBA 1A27A 1PL8A 3HFSA 1Y8QA 4GKVA 4MVJF 1VL0A 2RIRA 4Z0TA 2Q2QA 1M76A 1VC2A 3L6OO 1X1TA 4CM4A 5L4LA 4U7WA 1Q7GA 4U5QA 1UXGA 3GHYA 1ZSYA 4CLRB 1O94A 1QRRA 3DZKA 1P31A 2WM3A 3WQRA 1KC1A 2DBZA 3UKOA 3BMOB 3VPHA 3E82A 1NFFA 1R4NB 4E13A 2FHSA 3NX4A 4M8SA 1SEPA 4FR5A 1LDNA 2Q1UA 2HKIA 3T4XA 3AM4A 1KBZA 1M2WA 1R16A 2GRAA 1HSOA 1F06A 1NWCA 4IJVA 2RBEA 4FJ1A 4XR9A 4A27A 4NBRA 4A10A 1DFIA 1QXSA 1V35A 3ENKA 2Y1OA 5LCXA 1HF3A 3P2OA 1VL6A 3VZQA 5G0WA 2P4HX 2JJYA 1CQJA 2RHRA 3FR7A 1GDHA 2WYVA 4WLUA 1JWBB 4TKMA 7ADHA 4ZQEA 3MTJA 3PTZA 1BRMA 3AI2A 4I8XA 4IM7A 2VRBA 1FDVA 3QVOA 4BO4A 4GAEA 1TVEA 2FOIA 3V2UA 2QRLA 1QSGA 2VZ0A 1P77A 4R1UA 4A03A 1DLJA 2DT5A 1ML3A 4GWGA 1VJ0A 4AJKA 5EERA 3S1LA 3RJ5A 4F46A 1T2EA 5G0TA 2PZLA 4YRAA 4D43A 4DUPA 2YUTA 3DHEA 2C54A 3ZH2A 1HDGO 1E3EA 1XCBA 4CL3A 5G0VA 1HYEA 3F3SA 3JQBC 4S1VA 1HXHA 2HUNA 3LK7A 3RI3A 4E5PA 4NK5A 5H82A 1QYCA 4DL9A 4NPCA 3JQ8B 3K92A 5CEEA 3Q0EA 4I5EA 2O23A 3R6DA 5KJ6A 1WDKA 3BHIA 3ZHBA 2X0RA 4DTIA 4PLGA 3V1UA 4PG8A 2GF2A 3DC2A 4G81A 1HWYA 1WXDA 1U8XX 2J3JA 2HQ1A 1C0LA 2Q46A 4YDRA 1H5QA 1ZBQA 1I10A 3STHA 3R1IA 3P7MA 5IDYA 3DZBA 3K9QO 2E49A 2PNFA 1BXZA 4D3FA 1B8PA 4WOJA 3PFFA 3OHSX 3I6IA 4RVHA 3K5PA 4UEOA 3KM0A 2P4QA 4IPTA 4W7HA 2HCTA 1UDBA 3BTVA 4PLCA 2A4KA 1U3WA 4IZIA 1SB9A 1BXGB 5JDCC 1ZK3A 2ZYDA 2UV8A 4GX2A 4PLZA 2GCGA 5U4QA 5A05A 3PK0A 5ITWA 1P1KA 2C2YA 2PD3A 3VPFA 5CHEA 4DC0A 3OJ0A 1UP4A 3DTYA 3OMLA 5BNFA 4D3DA 3T7EA 4GH5A 3ROMA 1VLLA 1MV8A 3EY4A 3PIDA 2UDPA 5F21A 4PG5A 3PHGA 2NLOA 3M1LA 5GZ3A 2B4TO 2YY7A 2NUAA 3IOYA 1DHTA 1DIGA 4ZVVA 3BYZA 4DXHA 3NGXA 4AJOA 4I9HA 2P68A 3LT4A 4WUVA 2ZCUA 1IB6A 1KIFA 4LVUA 5JXWA 1QG6A 4IMRA 3WDSA 1NAHA 3WSWA 2WD7A 1H2BA 1OMOA 2YJZA 3RBXA 4R1NA 5ICMA 1Z73A 1WP4A 3MZ0A 4NJOA 4HFJA 4M89A 1ZMTA 1P3DA 3I52A 2FR8A 2EF1A 3KHUA 5KJ1A 4OQZA 3JD0A 4R9RA 4P8RA 4CMIB 1QYXA 4K26A 5JSFA 4LRTB 3DZFA 3KTDA 4IINA 1CWUA 5L51A 1T4DA 4W7IA 4BO5A 4DQUA 2WJPA 5I8WA 3LVFO 5DN9A 5EL0A 1VJ1A 2HK7A 2D59A 1L7DA 2CSUA 4BO7A 4ZRNA 4ALJA 1E7QA 2B35A 2PA3A 2Y1GA 1LNQA 4IDBA 1HLPA 2DUUA 1YH3A 3WTBA 1XA0A 3AY3A 2VHWA 5TT1A 1ORRA 4KDEA 4BUCA 3V1TC 3PLNA 4J9VA 4NK4A 3I9NA 3IIEA 2R6JA 1FJHA 3INGA 1HDRA 4OGWA 3QRWA 3WIEA 1TLTA 1ZVMA 2RH8A 3VZSA 1ZO8A 1YL7A 4K9DA 5KJFA 2H1SA 3ONFA 1C0PA 3Q9NA 4JP2A 4E5NA 3LT2A 1DO8A 1ZK1A 3UH1A 4WPGA 4YPOA 4OSPA 1B7GO 3L77A 2VYND 5A1TA 2B36A 5JYEA 1RM4A 5LDGA 5A06A 2Y99A 5B4TA 2OORA 4AJPA 1OC2A 2VQ3A 4MJLA 4LN1A 1E3WA 5K6AA 2YV3A 3ZDFA 3JQ7B 2PZJA 4II2A 1N9GA 3E5RA 5CDGA 5ICSA 3NT5A 4W6ZA 2ZB4A 4EUEA 3QHAA 3RSHA 2IXBA 4QQRA 2ZB8A 2AE1A 2VT3A 1GZ6A 2X7HA 3CUKA 4YJFB 2CVOA 3KYDB 4BMNA 3HFGA 4UVDA 1NFRA 3F1KA 4R5MA 2Y0CA 1J0XO 1B3RA 2BLLA 3FD8A 1X15A 1SMKA 2OFPA 3JYQA 1WMBA 4ESOA 2JCVA 2Y67A 1GFSA 1SOVA 3AI1A 3ETDA 1ZSNA 3WICA 3GRKA 5I9LA 1GCUA 4FPXA 4J7CA 3VAZA 3ABIA 4CM9A 2GASA 4K28A 4W4TA 4CLEA 2GZ1A 4HFMA 5C7OO 2I76A 5A9RA 3JCZA 4TWRA 1XG5A 5IN4A 2XAAA 4ID9A 3D7LA 2TMDA 3VPXA 5KNLA 3WMWA 4BGVA 2IEDA 1GCOA 3PI7A 4LW8A 5JY6A 2PGJA 1NYTA 1X1EA 5G4KA 1HDYA 2PR2A 2Q1TA 1TB4A 3HJAA 4KTVE 5A03A 2BH9A 4MIYA 2CDBA 3HUDA 1WDLA 2DBQA 3FN4A 4PVDA 4ALLA 3WXBA 3D3WA 1DIHA 2O3TA 1A72A 2FMUA 4U0KA 4C4OA 4PG6A 1PIWA 2C59A 5I9MA 4MIOA 3U62A 5THQA 3HN2A 4EW6A 2HK9A 4NG5A 5CDSA 1X0VA 3K2EA 1LC0A 1J49A 4BNWA 4EUFA 5BR7A 3JD3A 2HRZA 3JD4A 4CM4B 4IZHA 4YAIA 3NYWA 3FNHA 1MA0A 3MTGA 2EW8A 2OXIA 3UN1A 1Z7EA 4R69A 1H94A 3O9ZA 5CEJA 1E6WA 1JKIA 3AOEA 5GZ1A 3KSUA 3MWEB 4FGSA 3N74A 2WYWA 3H3JA 3BTUA 3DZGA 5I9NA 5DULA 1E1LA 1VSUA 4EUHA 1EDZA 3AI3A 4GWKA 3VH1A 1YGYA 4JBIA 1HSZA 4PG4A 3VH4A 2VTDA 4HY3A 4XQCA 2GERA 4GLOA 3RUIA 4QFDA 4L8VA 2IEBA 1QV6A 2QYTA 3AUAA 4E6PA 4Y9DA 2NVUB 3OF2A 4CM6A 5C37A 3VDRA 4P38A 3KRTA 1ZFNA 4BIIA 1B16A 1GQQA 1TT7A 2GUGA 1U2DA 2VOJA 2Y0DA 3Q3CA 4OXNA 1CERA 3CE6A 2CDCA 1PX0A 1QYVA 4EJMA 3I9LA 3L07A 4YAJA 3F46A 1NQOA 4PZDA 4E5KA 4OM8A 4BNYA 2X0IA 4BKRA 1UXJA 4CQLA 5A9SB 4ND5A 2G0TA 2I67A 5A5FA 1LRJA 2EHDA 2IYPA 3CZMA 2BKAA 2W98A 4YRBA 1GEEA 1T1RA 4MINA 3TOXA 4QSMA 3AY7A 4OO3A 1GQYA 4EGFA 1I2CA 3H5AA 2O4UX 4YJGA 3IP3A 1NAIA 4BO8A 3OICA 1BTOA 4NHEA 4YJHA 3AW9A 3TF5A 4OKNA 1T2DA 3O38A 3OIGA 3QA9A 1PJ4A 4UVGA 4D7AA 2O3JA 1EVZA 1JVSA 1E3IA 1OI7A 4HXYA 4BQPA 1LSOA 2BFPA 1Z75A 2O7QA 1YQGA 1UZLA 3IP1A 5DDIP 3UF0A 3RC9A 1EBFA 1E1NA 3S2FA 1E7YA 3OJFA 4II3A 1GTMA 3FBTA 4BB5A 5FWNA 2B37A 1ENPA 1J5PA 3ROKA 1KOLA 1Q1NA 2DVMA 2CF6A 4QUKA 2XPCA 4D3SA 1OZAA 2VYNA 4G5HA 4BHTA 2QW8A 4S3MA 2HSDA 4TSKA 3KYCA 3IUPA 2D0IA 3JQ9C 4B7UA 2NU6A 1E7WA 1KYQA 1MGOA 4YT5A 5CAEA 3EUWA 5I7SA 3IKTA 2FN7A 2ZQYA 3KLPX 4EI2A 2P9EA 5HM8A 3H65A 5LC1A 3ITDA 3MJ4A 3CEAA 3AUTA 1Q7BA 3D5QA 3CPSA 3KO8A 4UVHA 5DP1A 4UVIA 1NPYA 3ZWYA 3OJLA 1ADGA 1DLIA 3ZU3A 1ADCA 3TZHA 4D44A 2FPGA 4AJEA 1T25A 1B26A 3B6ZA 3TL2A 2ZB7A 4FOSA 1CDOA 1Z7BA 3C7AA 5JPIA 5HBRA 4P4GA 1NP3A 3FF4A 4YT2A 1F0YA 2B0JA 2PY6A 1CQIA 2V6FA 3H2ZA 4FQ8A 4NJMB 4WJZA 1H9BA 1JQBA 2X0NA 3QIVA 3RUEA 1BMDA 4A73A 6LDHA 3JQFA 4Y6RA 3LT0A 3H9QA 1WWKA 4UAGA 1MB4A 1M6WA 1EUCA 4M1QA 2VNSA 4FCCA 5BSHA 2J3HA 3HZZA 1SB8A 2A92A 2BI7A 3NRCA 3PPIA 3RQSA 3GVHA 4MO2A 2Y1DA 3A9WA 4JROA 1YO6A 3RBVA 2Z1NA 3VC7A 5KIAA 2J8ZA 4WE3A 4CV1A 1E1KA 2C82A 4XRRA 1VM6A 1PZEA 2YDXA 4LISA 1DAPA 3R0IA 4XIJA 2DKNA 3T7CA 1AGNA 4HFRA 1Y8RA 5A02A 4ND3A 4YR9A 3IC5A 4I5FA 2WD7B 4I9UA 2DAPA 1IHXA 3BAZA 3D64A 5T57A 5A04A 1WW8A 1PZGA 2O3UA 1NM5A 2JAPA 3A14A 3NTQA 3KETA 3PGXA 1PL7A 2JD2A 2IDZA 1B15A 1SPXA 1FMCA 1MX3A 1YL5A 4N5LA 3BHJA 1C1DA 1H6BA 1D3AA 4LCEA 3MOIA 2CD9A 3RKRA 3DXFA 2B4QA 4YWJA 3TQHA 1R66A 2BHLA 2Y1EA 4IS2A 2H6EA 1K6IA 3CINA 4BNFA 2EERA 3WIDA 1R0SA 1LDEA 1W4ZA 1GL3A 1I32A 3Q6IA 1HETA 3LLVA 1LLQA 1DJNA 1UP6A 3ORFA 5CEFA 1BGVA 2YHUA 4C7JA 5TS3A 2GSDA 5AQ1A 4U8GA 1U4SA 3TN7A 4JJFA 3HB4X 4YACA 1B2LA 4H15A 1EFKA 3QVXA 1HTBA 3ADOA 1R0KA 3PJGA 1KY5A 7MDHA 1PZHA 1WAMA 3WJ7A 5G0SA 1N92A 2X23A 4J1QA 1R0LA 1RWBA 2JD1A 4RO0A 4JCOA 4PLTA 2YW9A 2NU7A 1PSDA 2IXAA 2VCYA 1XELA 3F5SA 2B83A 2C20A 5FFFA 1UXHA 4Y6PA 2Q50A 4KWIA 1PJ3A 4IMPA 2PV7A 2A9FA 4GMGA 3LC7O 2BI8A 3VTZA 1A4UA 2ZYGA 4CUZA 2J3KA 5L3ZA 4XR4A 3ZNQA 4GPD1 1ARZA 1JAYA 1LI4A 1CF2O 1QORA 1YOVA 2FZWA 3K8ZA 5DOZA 1UZMA 1N9GB 3WGGA 1BSVA 4Z3DA 3H9UA 4D46A 2NSDA 1PGQA 1ENOA 5BSFA 1TXGA 4KZPA 1MC5A 1X14A 4JGBA 1Y6JA 3SJUA 3OFSA 1IPFA 4HADA 4A7PA 4DYDA 3W1VA 2C29D 2PFGA 5GY7A 5IDXA 2I65A 4DMLA 3ZNNA 4ALIA 1XWFA 2YQ4A 2O3SA 3PVZA 3RU7A 3NTOA 4CPDA 2X5KO 3GAZA 1EQ2A 3QLJA 1B0AA 3E8XA 4YCAA 2YQ5A 4FSHA 2VWHA 1EVYA 3FNGA 3DMTA 3C3XA 1KEUA 4XQEA 3FR8A 4LVCA 4XQGA 4DRYA 4AVYA 1I30A 1RM5A 4CR6A 5IZCA 3ZZNA 4EDFA 5DT9A 4PLPA 2DTDA 5G4KB 2D8AA 3GR6A 3X2FA 4IUYA 1IL0A 4N5MA 3WMXA 5C3MA 3UICA 4DBZA 5A9TA 3D3WB 3AWDA 2GDZA 4RF5A 1YL6A 4W9NA 3WLEA 3DAGA 2WTBA 2X0JA 2SCUA 1K6JA 1R15A 2CF5A 1PWZA 2G82A 2Q1WA 3LC1O 4QTZA 1P1IA 2X6TA 3QWHA 4MVJI 4BL5A 3KOUA 1EMDA 1ZNQO 4BQRA 4WASA 3AUSA 1E5LA 3AY6A 4DYVA 3DO5A 2YV1A 4JJIA 2FWMX 1DB3A 4GMFA 1N7HA 1SEVA 4G65A 4Y8VA 3GGPA 5JY1A 3LF1A 3OQ1A 5JMPA 1LDYA 3DBRA 4QO8A 1DRWA 2HO5A 5DNAA 5G2OA 3M2TA 3MJCA 1AXEA 4XDZA 4TVBA 4R16A 3ANMA 4WCFA 3TWOA 1P1JA 3U09A 3I83A 2BFOA 3EZLA 1FK8A 2EKLA 3QWIA 5CG2A 5KVSA 2PKRA 4XD2A 4AJJA 1PU2A 2BFMA 1BW9A 3RC7A 2YFQA 4OHUA 1JTVA 1ULSA 1ENZA 4IIVA 2EXXA 4RPHA 4FC6A 5L7YA 1ONPA 4KQXA 1P1HA 4MVJD 4RPGA 1XHLA 2O2SA 2HU2A 3WTCA 2X4GA 4BS9A 1K89A 3HWRA 1U3UA 1A7AA 3GQVA 3QV1A 4OOEA 5KCZA 1HL3A 2EKPA 1UAGA 3WB9A 4FB5A 3GRPA 5ES3A 4RZIA 2YHIA 2BMAA 3PWSA 5DCUA 2O2YA 3D5TA 3VZRA 5IDQA 4ZU3A 4E33A 3IL2A 1WVGA 5H83A 3GPDG 1I0ZA 1SC6A 1W0CA 1DSSG 4RQTA 1JWAB 2Y05A 3QVWA 3ZCXA 3L6DA 1DBVO 3E9MA 1YBVA 4MVJP 5T8KC 5IXSA 1Z6ZA 2JD0A 3UGKA 4YJGB 5JW6A 1PQPA 1FXSA 1OBFO 2PZKA 9LDTA 3KEQA 4LCJA 4Z0PA 2Y66A 4YAEA 3EGOA 3K2BA 1DC5A 1U3VA 5AYVA 2GD1O 4PLVA 2X9GA 2PWZA 4TKLA 3UUWA 2X5OA 3V8BA 4Q3BA 4BGIA 4RV9A 1V3TA 3QJ5A 3PIIA 3QWAA 3Q11A 4IIUA 2G76A 4Z9XA 3AM3A 3UCXA 4CUJA 1P1FA 4CM9D 3ZWOA 3W4IA 1LU9A 5AOVA 3KXDA 4AICA 1GUYA 1VKOA 4OJNA 3HDJA 3LSYA 4OAQA 4E2ZA 3ZW9A 2DUWA 2EJVA 3SEFA 1YRLA 4BB6A 1JA9A 3KYCB 4BVAA 5DZSA 5IJZA 2AQHA 4BKPA 5JLAA 1NXQA 3ANNA 1Q2XA 4WGGA 2DM6A 2BGKA 3L4SO 3QP9A 3O26A 3UXYA 3D3EA 1MUUA 2P5YA 3NJ4A 1Y7TA 4PLHA 4NU6A 4WNCA 3VH2A 1ADBA 3TRIA 3DONA 5DCYA 5F3RA 1R37A 4H16A 3R3JA 2X9NA 1PJQA 3OQ6A 2VZ8A 1ID1A 1ZK2A 2NWQA 1YVEI 4FJ0A 4QFCA 1BDMA 2GO1A 5TJ9A 4DREA 4AL4A 1NPTO 1PS8A 1YDEA 2JFHA 3QW2A 4BV9A 5KJEA 3ZV3A 3DAPA 4NFHA 4IGFA 5ER6A 5ER9A 3FRJA 4UUPA 5ILOA 4XQ9A 4FD3A 4IS3A 1UP7A 1I33A 3OJEA 4PZEA 4YB8A 1LXCA 3GC6A 3F1LA 1WZEA 4ND4A 3OIFA 1YBAA 1P44A 4LK3A 2ZJ0A 5JAMA 1BVUA 1NBOA 3CIFA 3KYBA 3U5TA 4BNIA 4NNJA 5TJHA 3AOEC 2I3AA 4RF4A 4AJ1A 4N5NA 4HNHA 3I5MA 1XSEA 1ONNA 4CV0A 1LEHA 2DBRA 1V0JA 1GV0A 2GZ2A 1Y8RB 1DJQA 1KERA 3C24A 1NNUA 1EBUA 1NHWA 1QKIA 1ZMOA 2NTJA 4FFLA 1KVUA 4YAGA 3VOSA 2AEMA 1M75A 2H9IA 3Q2IA 2YZ7A 4WK6A 3C1AA 3B1JA 3GFGA 4MKXA 2GNAA 3ZN2A 4BO2A 4NR0A 3A06A 3RUDA 5HWSA 2PKQO 3EC7A 1EUDA 4XYLA 4CLOA 2EP7A 1ZSVA 2NV6A 4L0QA 3UAGA 2I6TA 1XKQA 3RVDA 2IYOA 2W8ZA 4Q39A 2DFDA 3FTNA 3I9OA 1C1DB 4AJ2A 2G17A 3KZVA 5FI3A 4KDFA 4L4RA 4M86A 2YV2A 1KVRA 3SX2A 3EVTA 2P2SA 3H4VA 3N58A 1DC3A 1XU9A 3GY0A 1YKFA 4KP7A 3PJEA 1DFHA 5KVQA 1N7GA 3OBBA 4ZQFA 3AK4A 3WLFA 5IDWA 1JLLA 4UVEA 1O0SA 1PQUA 3ROQA 1AN9A 2QX7A 2JL1A 4L75A 1E5QA 4RVSA 4BKUA 4F3YA 4RVUA 2AEFA 3GGGA 4E5MA 3JTMA 1AXGA 1DFGA 3WYBA 4R3WA 3WNVA 4AJNA 4ND1A 1FF9A 4BKQA 5C7IO 4MKRA 1NVTA 4CM7A 4CLHA 1VRWA 1MG0A 2XXJA 1Y5RA 3E6AA 3GOHA 2IE0A 4D0SA 4MVJA 1HZZA 5JDIA 4NH4A 4RVGA 2Q45A 2I66A 2VT2A 1P45A 1DRVA 4XKJA 2AQKA 4PCVA 1A9YA 1Q0QA 3JQGA 4XYGA 2VOEA 5K0ZA 3BTOA 3HQ4O 1ZKMA 3OH8A 1WNTA 4BO1A 4CJXA 1DC6A 1ISIA 4CQMB 5L53A 1W6UA 2BFAA 1E3SA 2J5QA 2TMGA 1I24A 4UUOA 4UEJA 5ADHA 2WD8A 4ALMA 2EJWA 4WLOA 2C07A 2DC1A 3H2SA 3H6KA 4KMSA 4Y67A 2GZ3A 4E12A 3ZWNA 1QYWA 2ZK7A 1EQUA 1GPDG 4IDCA 2NACA 4OXKA 1T26A 4R3NA 3WJAA 4K6FA 4PFJA 4B3IA 5C5IA 1O9BA 2OP0A 3GZ4A 5DBFA 4DQVA 2Q4EA 3NTRA 3PP8A 1Y9AA 4A26A 1GR0A 3JQBA 4DLBA 2NNLD 4B4VA 3WGQA 5TGDA 2ET6A 3OA2A 3GUCA 2BD0A 3NDRA 1GYPA 2DTEA 3LQFA 4MIEA 4RPLA 1ZXBA 2DQ4A 4TROA 1NQTA 3V1YA 1F12A 4TRNA 2WE8A 1F8FA 2Z1MA 1AE1A 4OQYA 1R4MB 3GA0A 2EEZA 1I3NA 1HRDA 4FN4A 4RLSA 2B5VA 4ZQBA 1O6ZA 4ZA2A 1LQUA 4IY1A 1A9ZA 4O0LA 5AXCA 1C0IA 1PL6A 3GFBA 4MVJG 5B1YA 1E7MA 3DFZA 1KEWA 5TX7A 1LRKA 3O8QA 4INAA 4DPLA 5I7FA 1YS4A 3JQAD 2YYYA 4CMHA 3PWKA 3WWZA 4WLFA 2FSSA 3B1KA 1MG5A 3PXXA 4L4SA 1Y8QB 1CEQA 1T24A 4GVLA 2BRUA 2E48A 3GEDA 4BNNA 4BO3A 5T64A 4A0SA 4PRLA 2JCYA 3GEMA 5COAA 3NKLA 3MJTA 3I9KA 1KETA 2Q2WA 3DL2A 1BWSA 3WG9A 4BGUA 1M6HA 1RJWA 1SCUA 3FI9A 3WFIA 2JFFA 1VSVA 3PRJA 3GNQA 5GMOA 3FCOA 3PHHA 3RUAA 2CMDA 5DCWA 3DMYA 4WCFB 4XX0A 3GT0A 4BNZA 1H93A 1HDXA 2E82A 4HV4A 4YQZA 5THKA 1BG6A 5IF3A 3LLSA 1FDTA 4XYMA 2AXQA 4JK3A 1GD1O 4DVJA 1MFPA 3GAFA 1CJCA 1BW9B 2GR9A 4N7RA 3BMCA 4R54A 1P33A 3V2GA 5I7VA 1M66A 2D5AA 3U49A 2OGUA 1ENYA 1U5AA 2JHGA 4OMUA 4O1MA 1HE5A 2UUPA 4GLLA 2C5AA 2Y68A 1IUKA 1NQAO 1CYDA 3ON5A 4BMSA 4BMVA 4YT8A 3MCVA 2P9CA 1KEPA 1WLYA 3GVPA 3L9WA 4Z6KA 2VNAA 3U4CA 3HE3A 3F9IA 1IPEA 3PZRA 3ZWMA 3FWNA 1R4NA 3ZHYA 3OQBA 2FZEA 4CM8A 4QO7A 1YB4A 2YHIB 4I1IA 2X1HA 1YXMA 1EUZA 2E4AA 3QY9A 4TMFA 2FRDA 5IZ4A 4PLYA 4Q3AA 4QECA 2VZ9A 5FI5A 3BXXA 2HMWA 3INRA 1I3KA 4R41A 1E3LA 3K6JA 4W99A 5ENDA 1HDCA 5EQDA 1Z74A 2RCYA 4J16A 3MJSA 1EVIA 1I5RA 4P4LA 3IJRA 2NTVA 1DC4A 4TZKA 2F1KA 4RPJA 3ROPA 3DZHA 5JS6A 5DOVA 5TIIA 4UUMA 3EVNA 4IGEA 3WGOA 1U3TA 4FBGA 4CMGA 3PHIA 5L4SA 1PWXA 2PTGA 4J7UA 3FNFA 3GHHA 3D1LA 4OYRA 1K0UA 3LZ6A 4J7XA 2HK8A 3NJ8A 1RKXA 3U0BA 4BV8A 3OP4A 1V6AA 3QQPA 4WLVA 3VKUA 2ZIZA 3GGOA 3LT1A 5KVCA 1ZCJA 3I1JA 1DRUA 2X5JO 4XGKA 3GG9A 2GN4A 3RFVA 4C7KA 5A4DA 3HN7A 4IBOA 3U4IA 5TQVA 1GYQA 4DLAA 4XJTA 1MXHA 1H9AA 1S7CA 3W8FA 1YONA 1NR1A 2G1UA 3ZU4A 3JQ8A 3F4BA 3X2EA 3G1TA 3BHMA 4RPKA 3S2IA 3E9NA 2OOSA 3RKUA 3VKVA 4CLXA 1Z82A 2AMFA 3ZWBA 4CL8A 4EEZA 3GNTA 2CVZA 3AM5A 3JYPA 1Y1PA 1HDZA 2OP1A 3ZI0A 3DMTC 4PZCA 3KV3O 2O3QA 3RUHA 3KBOA 3LF2A 1PJ2A 4I5DA 2YFHA 3COSA 1LDMA 2O3RA 1S6YA 3NEPX 3I3OA 2ZTMA 2PH3A 3FHLA 1RYDA 1HE3A 3GN2A 3WSVA 3GMSA 4B3HA 3RASA 1OFGA 4ZRMA 1PQWA 1XEAA 2J5RA 4FC7A 1N8KA 5TRTA 4ZJUA 3PQEA 2ZB3A 3L0DA 5L7WA 4W9NC 1L7EA 1DPGA 1I8TA 3A1NA 4M49A 5JMWA 1UUFA 3ZV6A 5ENVA 3QVTA 1U28A 3JQEA 3HDQA 4CR8A 1EK5A 4PRKA 1PEDA 1ISHA 1LTHR 1N5DA 3HSKA 4HFNA 1F17A 1VI2A 4AJHA 1G6KA 3HDYA 5HTOA 3I4CA 1HE2A 3WX0A 2FPPA 1R12A 2FP4A 4O6VA 4R68A 4TQGA 3GZNA 3PDJA 3PHLA 1OOEA 4B8ZA 4BO9A 2VYVA 1HZJA 3DBHA 3G49A 1I2BA 1IZ9A 3MOGA 3C7CB 5DF1A 1MP0A 3OEWA 2PH5A 1VPDA 4WCFC 1DIRA 1X13A 3TPCA 3D4PA 3M1AA 3EZYA 2X86A 4ZQGA 3JQAA 4QEDA 3RIHA 3MJEA 1R6DA 2LDXA 1WDMA 3JQ6A 2GYYA 1U5CA 4DMMA 1ZJZA 4CLOB 4IXTA 3GEGA 2CY0A 5EESA 4JP3A 3DBLA 3JD2A 1SOWA 2UVDA 3PWZA 4DA9A 4LMPA 3GVIA 3FSRA 3SLGA 4CLDA 1N1GA 4CUKA 3VPGA 1C1XA 1NHGA 1U4OA 2C2XA 2QQ5A 1GZ4A 4YTEA 2Q49A 2JHFA 1AUPA 3B1FA 2NADA 4Q9NA 4U0JA 3EHEA 4GX1A 4URFA 2EGHA 1K6XA 3BTSA 3PJDA 1E77A 4WECA 4KUGA 4UUNA 3K30A 3AUUA 4JNKA 1W73A 1CETA 2WEKA 5TF4A 1RM0A 4IDDA 3RFTA 4ZN6A 2VRCD 4GGPA 4DIBA 3ZNPA 3GNSA 4N54A 4CMCA 1TT5A 2D4AA 3Q2KA 4Y6SA 1A5ZA 4RZHA 2HJRA 5BSEA 3BZUA 5TC4A 1UDAA 1Y9EA 3OA0A 3OIDA 1RYEA 4DPMA 1T4BA 2AQ8A 3E5MA 3D4OA 1A71A 1U7HA 1E3WB 1Y81A 3GLQA 3DOCA 4R5HA 2GN9A 5F5LA 4E2WA 4MVJE 3FNEA 3WGYA 3E48A 3TL3A 2HRBA 3PYMA 3ST7A 6ADHA 1RPNA 2OBNA 2H5LA 4IQ0A 1LBEA 1XIVA 5B4UA 4YXFA 3HB5X 3RD5A 1T2CA 3ZWCA 4MDHA 1HT0A 4RVFA 1A4IA 4AJIA 1PJTA 2I9PA 5DBIA 2VN8A 5T67A 2OL4A 2V7PA 2PK3A 2PKQP 5COBA 2C0CA 2C5EA 3DTTA 3JQCA 3ZGYA 1DIBA 1NFQA 4D79A 3V5NA 5I8ZA 1UAYA 5AVOA 1UR5A 2VHXA 5H81A 4YJFA 4YEDA 5F5NA 3TFQA 4N18A 1HDOA 4J1SA 1CRWG 4XIYA 1NR7A 3VTFA 5B12A 3TFOA 1E92A 3QSGA 3RUFA 5FEUA 3SC6A 2XF8A 3WR5A 1LLCA 2HLPA 2PD4A 2C7VA 3JQ9A 4ALNA 3LC2O 3W6UA 3CMMA 4DQXA 2JCXA 2VTEA 1KEVA 3CTMA 4EJ6A 1PR9A 1QR6A 2WMDA 5IN5A 1BHSA 3KB6A 4IDEA 3INTA 2BELA 1PGPA 3FPLA 3FBGA 2NVWA 2V6MA 4CMBA 1ISJA 5L40A 4GI2A 1B14A 1H6AA 4E2XA 5L9AA 3KSZO 4MP6A 4E4YA 4BKOA 1XLTA 2ZCVA 5CFZA 1K2WA 2D2IA 1IY8A 3G79A 1Q0LA 3RJ9A 3ZWAA 3F6YA 4BOYA 5C7LO 4FS3A 2FR1A 2QZ9A 3WBFA 3WGZA 3DOJA 3O03A 4L9RA 3BMCB 3NUGA 3K96A 4IQGA 1GEGA 5JYDA 4BO6A 2DBVO 1KVSA 2XOXA 1FDWA 1ONOA 4JXKA 5G0UA 3WYEA 4IDGA 4E32A 3TDKA 4ILKA 4BNMA 3N7UA 5A3VA 2P5UA 3FWZA 3RWBA 5MGBA 3HG7A 3DHYA 3PYXA 4CM8B 3LDHA 1NVGA 5COQA 5U9CA 1X7GA 5MDHA 3PQFA 3GDOA 2OO5A 4W82A 4JBHA 2IZ1A 4E30A 1LLDA 2POQX 3H3FA 1ZJYA 4CQLB 3WNQA 2EW2A 1KVTA 3ZHXA 5JDIC 2NVUA 4AJ4A 4FW8A 3AU9A 1Q7CA 4GX5A 3KLMX 4GL4A 2R2GA 1E6UA 2Z5LA 1FDUA 4XYEA 1FDSA 4MPDA 1IE3A 2WWRA 4ONEA 3RBZA 4NBWA 4E31A 4HWKA 3G0OA 1O8CA 1SBYA 2Y93A 1YQXA 2PGLA 3W8DA 3DBVO 4YJHB 3ZWVA 1QMGA 5DP2A 5L4NA 5T6BA 4PLWA 1MXFA 5K6AC 2X8LA 4Q3NA 1J6UA 2FPIA 3PGJA 3D4NA 1OC4A 4WLEA 5JBIA 3ICCA 5F1KA 1ZZEA 5A9SA 1K3TA 2VRCA 3M2PA 1UJMA 1BVRA 3CH6A 1GUZA 1J4AA 2X9VA 1XQ6A 3U9LA 1QLJA 2CNBA 4E5YA 3WGTA 4ZD6A 4ZQHA 1JN0A 1HKUA 5IFLA 4NQZA 3ASUA 2J3IA 3ZWPA 4K1LA 2QHXA 1E7SA 1UXKA 2D1YA 2WYUA 4Z0HO 1E3JA 2Y1CA 1LDBA 2NQ8A 3C7DB 3IDSA 4J4TA 1LRLA 3EMKA 5B4VA 4R9SA 2R00A 5CDUA 1SNYA 2ZQZA 4RL6A 3NT2A 2WSBA 3P5SA 4D0RA 4WCDA 4PIVA 3ZNOA 1JDJA 4FFNA 4E0BA 4YA6A 2O48X 3GF4A 5EN4A 1ISFA 4ZICA 3UOGA 3W4KA 4AG3A 2OMEA 3VPSA 3HNPA 4NMHA 3DZJA 3RUCA 4EYEA 3FPCA 3GMDA 4G2NA 4KOAA 1H0KA 3EK2A 1ULUA 1M67A 4O63O 4D45A 2Q4BA 3S2GA 1XQ1A 4BNTA 3L4BA 4CODB 3GZNB 1T2FA 4F6CA 3DBHB 3IS3A 4B8WA 1JKJA 4CMEA 5LDHA 3TOZA 4XJSA 4FFOA 1D4FA 1O89A 1UDCA 1QV7A 4RCVA 4WLNA 1D7OA 1LJ8A 4YQYA 4ALKA 2ZJ1A 1SAYA 4NJMA 2ZTUA 4KWHA 4OH1A 4P22A 5EINA 3RROA 3JQAB 2O4CA 4LRSB 5JFOA 4XGNA 1QYDA 3WWYA 5CG1A 1C3VA 5HS4A 1VE9A 2O50A 3RU9A 1EE2A 3IMFA 2VHVA 1SZJG 3H9JA 3DBLB 2DU8A 4R51A 5F1PA 2DPGA 2EKQA 2IZ0A 5JE8A 3NV9A 4GVXA 4B7CA 3UHAA 3F5QA 2HMTA 5U1PA 3QWFA 8ADHA 4R01A 3DR3A 1MFZA 5BT9A 4IXWA 3FTPA 3BMNA 4NFSA 4ROSA 1C1XB 4U6QA 4B7XA 4JIGA 5JAZA 3TZQA 4I9NA 1PJBA 1U8FO 2J6IA 5BQFA 1B3BA 3ONDA 4PLFA 1O5IA 3VHRA 1I2ZA 2ZTLA 3JYNA 1EDOA 2DLDA 4XYBA 4A5OA 3GN1A 3ZU2A 2YDYA 1C0KA 4L4XA 3GH3A 4TRMA 3LYLA 4LSMA 1V3VA 5BNTA 3GVCA 4NDNE 3U4HA 1LUAA 2VUSA 3AU8A 3NDJA 3OEYA 3GDGA 1T2AA 4IJUA 3SLKA 3NAQA 2E6UX 1KVQA 3R3SA 5JCJD 4HUJA 3BMQA 3C8MA 3VVBA 5JC8A 2ZTVA 4GBJA 3A28A 2PZMA 4RF3A 4KUHA 3WQQA 1LQTA 1E6EA 3PYLA 3PFWO 1TT5B 3H9GA 2HMSA 2P91A 3AJRA 3RC2A 1DAOA 1TA4A 3E18A 3TZCA 1IYZA 1E0DA 1RM3A 1ZUD1 3OECA 2LDBA 5JAIA 1WMAA 1PR3A 2EG9A 3D0OA 3MJVA 3E1KA 1P9LA 1KY4A 2VUUA 2HDHA 4UEKA 3AFNA 4PGFA 1T1SA 3EYWA 1YOVB 3WBBA 3Q1LA 4WKGA 4EITA 4UREA 2VWGA 1GZ3A 4BNJA 3SC4A 2IODA 1P0FA 1UH5A 1JW9B 5EJ2A 2F00A 1I01A 2QRKA 3QWBA 4LSWA 3SXPA 4CM1A 1V9LA 3W8EA 1P1RA 4WNIA 4BNUA 1VKNA 2EV9A 2W2KA 4FFRA 5T8KA 2VHYA 1H6DA 3AOGA 4EEXA 3RFXA 4RF2A 3ZWXA 4IJWA 2Q3EA 3G17A 8LDHA 4HNGA 2PD6A 1F8GA 4I08A 4O59O 2VWQA 3HADA 1X0XA 4TVOA 2A35A 2I5PO 4Y98A 3OJOA 4J2HA 2AG5A 2EP5A 1IOLA 2V65A 4M55A 3K31A 3RAJA 4CR7A 1Y5MA 1AHIA 5GZ6A 4OIMA 2FR0A 4FGWA 1IULA 4Q3CA 3MEQA 4B4UA 3CMCO 3GVXA 2AW5A 1YB1A 3CZRA 2AEJA 4BNHA 3OSUA 2VYVD 4WEOA 1YBMA 2Q1SA 1GAEO 1W8DA 1HYGA 4GQAA 5HA5A 3L9XA 3GG2A 3DQPA 2HJSA 3JQFC 4B4OA 2OHXA 4K6CA 1G0NA 1EEHA 2BF7A 5F1OA 4H7PA 4RDIA 5JAQA 4XB2A 1X7DA 5AXBA 4GGOA 1LX6A 3H8VA 4E3ZA 5FYDA 3L6EA 1X7HA 2QRJA 1DDOA 5TSDA 4CV3A 4Z3KA 5KTKA 4RDHA 1CIVA 3WQSB 3PZBA 1MLDA 4EJ0A 1E7RA 3HHPA 5JDCA 4YT4A 3WGIA 3PHJA 1F14A 3I9JA 1XGKA 1ADFA 4XZ3A 2GGSA 5A3JA 3DBRB 3PQDA 5IG2A 3SJ7A 5L7TA 5IAAA 4OL9A 2Z95A 4NFYA 2D5CA 4MP3A 1PJSA 3UW3A 2A94A 1NPDA 2FSVA 1XDWA 3O4RA 3PLRA 4OSOA 4J91A 1PS9A 2JFGA 4F45A 2Q2VA 4KUEA 3IQDB 2E37A 3WOHA 4CMKA 1A7KA 2P9GA 2XXBA 1GQ2A 1ISGA 4MOWA 3ZU5A 2FY8A 1PJCA 3A4VA 4CLRA 2H63A 4J49A 3DHNA 3TZ6A 2Y1FA 2GN6A 5KOIA 4IDFA 3BMOA 3ZW8A 1ZH8A 3B70A 3IKVA 4NBVA 1EE9A 5JO0A 2CUKA 4YAKA 4YYZA 5EIOA 4IJKA 5TT0A 2CFCA 4OXYA 1DEHA 2B4RO 2GN8A 3DDNA 2WE7A 4OKIA 2NTNA 2C7GA 4RQUA 5KKAA 2CDAA 2OUIA 2DTXA 2UAGA 3C1OA 2AA3A 2EWMA 1EVJA 3DB2A 4FDAA 2QYSA 2QIOA 4R1TA 4BNLA 4FFMA 4XDYA 4BGEA 3S55A 1H2HA 3WFJA 1E1MA 1N2SA 3E9QA 1I36A 2W4QA 2O7SA 4CQMD 3ENNA 3BIOA 3NDIA 5L95A 2UYYA 3EAGA 2Q99A 4UULA 3AFMA 1OAAA 1G0OA 3QVSA 4B4WA 2V6BA 5L45A 5JCJA 4NBUA 4M54A 4Z9YA 4NU5A 4XRGA 1U7TA 4MVJH 2AE2A 3U3XA 2V6GA 5ITVA 1YDWA 4Q3DA 1GPJA 4J90A 1YE3A 3F47A 4BNVA 3JYLA 3GPIA 5EPOA 3VH3A 1B8VA 1NTOA 4KTTE 5DBGA 3RCBA 3RC1A 3TJRA 3NT4A 4E2YA 5A5EA 4L76A 4R1SA 4NIMA 3DFUA 4BO0A 1HEUA 3ZV5A 2BGLA 1EK6A 1PGJA 1QP8A 1TI7A 4DPKA 5KVVA 1ZEJA 2AHRA 1UXIA 3NGLA 9LDBA 1YJ8A 2B69A 2W2LD 3KEOA 2NQTA 4AJLA
chains in the Genus database with same CATH superfamily
5JO9A 1MV5A 1GFZA 1M6EX 1COZA 1YASA 3D7NA 2ORED 4OHRA 3DE6X 4R05A 4WOPA 3HCCA 5T5QA 1SBHA 2AJLI 3ECCA 2PLWA 2X58A 1FXWF 3A3PA 3ELUA 5GV7A 2DMRA 5ALKA 2COUA 4BASA 4BNKA 1KHHA 1O95A 3N0RA 3P4YA 1QE3A 4OATA 2AQIA 3DVLA 4WFJA 1KH1A 5E4TA 3N1UA 2AD1A 4ZCSA 3LE8A 4ZO9A 5D86A 3OEHD 1ZU4A 2BKLA 2HMUA 4JI7B 1H3FA 4MVWA 5CFOA 3VA7A 4YHBA 1PGOA 1PNOA 1SD5A 1PS0A 2ZVJA 1HT1E 4OF4A 2IEYA 2KW5A 3N0VA 4Q21A 1UK8A 4QICA 5K51A 1YB5A 1AV6A 3BA1A 1VKRA 1A69A 1D04A 3AFGA 2W43A 3S8MA 4C7MA 4EELA 1K5HA 1FFWA 1DOHA 1T6NA 4EZEA 1HE4A 4QUJA 2LV8A 3AWIA 4CV2A 1RPTA 3DPUA 4FFPA 2OVFA 1BXGA 3PEFA 5JAPA 1YI8A 5KYXA 5ENZA 1DC8A 1OV6A 3H5RA 5JIBA 2ATCA 1F0KA 1XAHA 2XWPA 1HLDA 1PTJA 4TGLA 4B2IA 2QYOA 4FYPA 4CCAA 2B5WA 2DOKA 2HEIA 4XM1A 3K9BA 2WAXA 1J7JA 3HTXA 3V4ZA 1WZCA 3TW0A 1RHQA 2OZPA 3FBWA 3S99A 2QMHA 4J3FA 3BZBA 4DJDC 4ESHA 4ZK2A 5T41A 8ABPA 1ZW1A 3I6MA 4A92A 1Y7PA 4PG7A 3B89A 5AJHA 2VC2B 2H57A 2NYAA 4BEJA 4Z5XA 4TS3A 2Q0QA 2MMCA 3UOWA 3LHSA 3FTFA 1EDDA 2B4YA 3CTPA 2AJBA 1VJTA 4NICA 4XA8A 4KXFB 4L6CA 4U2GA 3CRW1 5K0BA 3CURA 4QDJA 2J0VA 1NT4A 2ACWA 1OLSA 3GFVA 3RHZA 1IZ0A 3CLSD 5A4JA 5KJCA 2QD1A 3IJPA 3NWOA 3K73O 5CP8A 1LPBB 3WFZA 4L9AA 5B37A 1UZNA 3UCFA 2OGWA 2C3UA 1K08A 4V0QA 4CQNA 3H5NA 4GNKA 1E2LA 3SBOA 4CGYA 2UXBB 2IP1A 3U31A 4LGVA 1LLUA 5AKZA 5MGNA 1U2GA 4KQGA 4MQEB 3AYZB 3EYAA 3EDMA 1XR3A 1WIWA 4BMCA 1Z0ZA 2JGKA 5TQ0B 3VJRA 1XRQA 2B25A 3AF3A 3E70C 1WPRA 5F5XA 3CKYA 3OBIA 5EHGA 2PG3A 4J43A 5LB4A 4GSKA 5IT0A 2RH4A 4FWTA 3EXHB 1B93A 1IN6A 3BMQB 4J1TA 1ODFA 3IBFA 3L1UA 2QP9X 1SG0A 3PA6A 3K0CA 5CFRA 5K6RA 2AC4A 4HS9A 3U1TA 3HFRA 2C4WA 4FIZA 4WSOA 5IJWA 4MP8A 1JHRA 1CT9A 3VVCA 4A2CA 1C9JA 3S4YA 2Z9CA 1TJ4A 1UC4B 1DRKA 2CVQA 3FUUA 3R0XA 1LPNA 3DEYX 2B94A 2I1QA 4EA6A 4RJTA 2CL0X 5FH9A 1B2RA 2Z83A 3ILSA 5E7JA 1WCIB 1QIJA 1B8UA 2DPHA 5F73A 3ASVA 3EW9A 4LXXA 5EI5A 3UH0A 2C96A 1INLA 1UBMS 4E22A 4RA9A 4AFNA 1JKFA 2JLUA 3RTCA 4TRRA 2H85A 3ZW7A 4B40A 4EGSA 2X22A 1U5BB 1CZHA 4Q1CA 4PHHA 3GJZA 4I3HA 2QV0A 2GLXA 1PQ4A 1AHHA 1TL7C 3B9QA 4N0QA 2CLEB 4G37A 2GS9A 1DEAA 2FF5A 3NETA 3RV4A 4LPKA 4LGMA 4GPZA 2C7RA 5CDTA 1XK7A 1NUHA 2WK1A 1NVBA 3PUIA 5BSGA 1YT5A 3OOJA 4OLJA 2VDMB 3HH8A 3K9WA 1XNRB 1NI3A 1ZXLA 1HPLA 2Y0EA 1D1TA 1RLMA 1ZPDA 1TJNA 2C92A 1OGJA 2PJDA 2W2KB 3FYUB 3I9MA 3WGHA 5ERGB 1WOYA 1Z18A 2XB8A 5L3QB 1RAFA 1YJQA 3SK0A 4QBTA 1PGNA 3A0RB 4URHA 2AG8A 2JK1A 3X3HA 3W06A 2ZAMA 2O2JA 4EBFA 1KAHA 4EGCB 1EH5A 1OXMA 1I7SB 1BOFA 3V00A 5A4MS 1ZK0A 3F78A 5JJLA 4FU0A 4V2UA 3KWFA 1RYHA 3JQ7A 1J1ZA 2YRWA 3DW1X 3ITKA 3OETA 4HF7A 3S2EA 3FLMA 2YTZA 4AUMA 4D4JA 4DIMA 3KQUA 1GA6A 3N2NA 1L1RA 3ZHTA 1GRNA 3BWDD 2IUFA 4Z8YA 5ECDA 2ZR9A 4YP7A 3NHYA 4RORA 5DHAA 1SOUA 1FFAA 2HV8A 3HZOA 4NYMR 3ET5A 4MUKA 5FQNA 1NQ5A 4XLLA 1XRLA 1NNLA 1WPQA 3H1PA 5KYGA 2A6PA 2GXUA 4CCYA 4US1R 2HYIC 1VLQA 1QDEA 1JECA 1OUMA 4O0MA 1DCFA 5C80A 5G4LA 1BFKA 1SA0B 3DPSA 3FCXA 1RIFA 1ZD9A 4ZFNA 1H6CA 2W2LA 4J4HA 4PU0A 4LVOA 4Z7NB 1XU7A 2BZSA 1GTJ1 4ZHQB 5K03A 2VHEA 3IAS6 3HDHA 3KEMA 4ME6A 3LUFA 5HZGA 5HDQA 1NMXA 1XZLA 3GFTA 5LP6C 1C1YA 4YRDA 3HJGA 4V0NA 2PEYA 2WVJA 4C7OA 3Q85A 2HA2A 5EZYA 4ER5A 2KSQA 4HG2A 2J08A 4DWVA 3L04A 1AUQA 3WMFA 4BVGA 3RTBA 4DILA 2HWYA 3W5AA 2IZZA 4HNRA 3ZWQA 2B8JA 2C00A 4LHXA 4DCPA 5KO2A 3B20A 4LOIA 3WOHA 5H16A 4DAEA 4DBLC 1S9HA 3AUFA 3ZG6A 6ABPA 4V39A 2F9MA 1XT6A 1L0BA 1XD9A 4L07A 4LYHA 4RKQA 4M7PA 2I2DA 1SK9A 4IVNA 4M0KA 4LOJA 3FPKA 4MIKA 1VL0A 2I55A 2RIRA 2WM9B 4Z0TA 5P21A 3BK1A 3PUWA 5DXJA 1SWWA 4XM2A 1P6QA 2JLSA 4YRZA 1TTPB 4RMHA 2BT4A 2Q8QA 1G3RA 2YJTD 4INZA 1CY7A 1X1TA 4CM4A 5KOJB 4GE0A 4U7WA 3W3ZB 2W8BA 1HNXB 1M5RA 1CZLA 4Y6GB 4NKRA 3T15A 1RZUA 1XL0A 1RWQA 2J4FA 3FPGA 3WA6A 3WQRA 2FA9A 1KC1A 4ENPA 3ETNA 3L8FA 1FRZA 1GZ7A 3A3OA 3L0YA 2W6JD 2R8RA 4ZPXA 3VPDA 1NGSA 4Z7JA 1LDNA 2REQA 3X1WA 1JYFA 1KBZA 1PZMA 3AM4A 3DCIA 4M9CA 4BLSA 3OZGA 1XP8A 4HQFA 3N8DA 4C20A 1L8QA 5CLIA 4EA9A 2C4KA 2IU3A 2Z9BA 1VXOA 3IT0A 5LCXA 5DTRA 1TUEA 2JIDA 3H2JA 1QS0A 1VDZA 4HLUA 2CHQA 5G0WA 1R5OA 2QTMA 1OI3A 2ADFA 3HKDB 1TIPA 3LQYA 2WYVA 3T7DA 4U7FA 1ZX1A 5EIHA 1R8JA 3A10A 3R5HA 4WBNA 5CCEA 3AESA 4ZQEA 2JF0A 4I8XA 5SICE 4YLEA 1V4BA 3SYMA 3TTXA 3BX1A 4I50B 4B6FA 1TVEA 5BN3B 4CIBA 5FFMA 3DDHA 1VLMA 2R44A 1CUWA 3HXOA 2EX0A 2EFHB 4R84A 4A03A 2BBTA 1BEEA 1QVZA 1GSAA 2HO4A 5EIBC 1C8BA 1RC1A 3I2GA 1W34A 1T2EA 5G0TA 4F1WA 3I8XA 2YUTA 3DHEA 4LMBA 1NUSA 3Q5DA 2Q5OA 5G02A 4C6RA 2M6KA 1IOVA 1N5LA 3DVAA 1T5BA 3E3AA 2Q1XA 4PGHA 1GGHA 2G8LA 3ZOKA 1UBCA 2A1TR 2OBMA 4EG6A 3RI3A 3TBHA 5H82A 1NURA 1QYCA 3D6MA 4NPCA 3JQ8B 1MW9X 2C2KA 4X6YA 2EJBA 1SUCA 4TQUS 1M1UA 4C2UA 4Z4HA 3F98A 1QVRA 5G1PA 1FJGB 3FH0A 1VE1A 4JOSA 1UQTA 1JAIA 3FB4A 1S0UA 3Q2OA 4ZVKA 2GF2A 4Y3UA 3MXOA 3ZCUA 4CI9A 1G8HA 4OQFA 4D0GA 1BZYA 1DJLA 1PUXA 3WL5A 2A78A 4IOKA 2MTBA 1IK6A 2F3PA 3FVRA 3E7DA 2HQ1A 2Y27A 2R96A 2IYYA 3UJNA 1U2QA 1ZBQA 2E4ZA 1I10A 4MAFA 3STHA 3P7MA 1G3UA 2HJHA 1OPRA 5IDYA 2HPAA 3DZBA 2FV8A 3I5YA 2OPBA 2PNFA 3IDFA 2D62A 5I5GA 1B8PA 3W2HA 4JBXA 3GUUA 5AJWA 2RHOA 2R8XA 4MYDA 3TR6A 5A4FS 2AX4A 2F4NA 2WRZA 3AM1A 1N8SA 2F1OA 1NUUA 1TJ3A 2EX4A 2YWFA 3FKSD 1JDNA 4R7TA 3OOHA 4RZSA 3SMVA 4D0NA 3ERCA 1U7WA 1USWA 4IPTA 4NCXA 4LGYA 5E6SB 1N2CA 1U3WA 3I28A 4MUYA 3ZR4B 5ALJA 4DUGD 4E88A 1BXGB 5DW3A 4W5TA 1VL5A 4B6QA 1NV9A 3L8EA 2WWGA 1E9RA 2FPLA 7ABPA 3N3AC 1CDDA 3L8ZA 1JJAA 4HDNA 2G4CA 1DWQA 1H5UA 2ZYDA 4YAFA 5FOUA 5BOSA 3L8CA 1M5UA 4EKGA 2Q3LA 1QGAA 3BZWA 3DM5A 3W5VA 4NZMA 1BX3A 3CNNA 2JIQA 2PL5A 3C6QA 3PK0A 2XRFA 5ITWA 1TYDE 4LZNA 3W3AD 1ETHA 1QLWA 2ZM5A 4FW9A 1UBEA 3I3SR 4OB8A 1AZWA 2P3LA 2XAUA 3TD9A 4ZO7A 5AWFC 3T7EA 5CB4F 1CW2B 4L4ZA 4GH5A 2WJAA 5DYWA 3T9EA 2FX2A 3KDAA 3PIDA 1MQAA 1Z5WA 2Z6UA 1MVNA 4G26A 4G4SP 3E7XA 5TPZD 5KNBH 1XQ9A 4MUGA 2ALJA 1ZOLA 3M1LA 4F38A 1TM4E 1XVIA 3CX3A 3NONA 2QZ4A 1YHZA 1E18A 1P8JA 5LXTF 4UD6A 2C1EA 3MGBA 2Y1XA 1DIGA 3M6VA 1ES9A 3BYZA 1F5SA 3NGXA 3BIFA 4HRXA 3E5NA 1H42A 3PSHA 4I9HA 3FFTA 2A14A 5EHIA 4MDEA 2XCSB 2ZCUA 1EFRA 3N53A 5HR5A 1JYEA 4EY5A 1S1MA 1FW6A 5H7XA 3UPTA 2Z6VA 5JXWA 2R8BA 5FLXA 1M6NA 2OVBA 4IMRA 1F8UA 1NBMD 2WM8A 1H2BA 5DHPA 4H0NA 5JHGB 1CF4A 1Q3HA 4LQ4A 3VGJA 3N6XA 3MZ0A 2Q0SA 4NJOA 4PONA 5AO9A 4M89A 2FR8A 3RF7A 1A88A 3K6SB 2ORYA 2EF1A 4QDTA 1TRHA 1Z5UA 3SM9A 1KMNA 2HWUA 1QYXA 1EFAA 2QN1A 1WTCA 5JSFA 1N6RA 3OESA 4MMYB 2VJAA 4QFBA 3TTUA 1JLSA 1T4DA 3UV7A 1VTKA 1E2PA 2CJYA 1KA9H 3PNYA 3C5HA 5DN9A 5EL0A 2D59A 4OGKA 2CMFA 2CSUA 2WUEA 4WACA 1W5EA 2PA3A 2W6JA 2VCEA 1BU5A 1Z6QA 4RA9B 4D8WA 4EF4A 3CBGA 1EK2A 2YJNA 1HLPA 3BSFA 4FYXA 3O92A 4C76A 2E5WA 1H0SA 5KTSA 4KDEA 4BUCA 4FOTA 3V1TC 3FPFA 2B98A 5A3QA 1AO0A 1SWVA 1S4MA 4KQIA 5C81A 3JWHA 1Z0JA 5JI2E 3I92A 2ZT7A 3TTTA 1WPXA 5ECYA 4MW7A 4PX2A 3VZSA 1ZO8A 4NYIR 4ZU1X 4ETNA 1ETUA 3BE6A 1DBWA 2GF9A 3QUCA 2BCEA 1KY3A 2B8NA 2H1SA 4MUXA 4PRYA 4GZ6A 5EXPA 1XTPA 2Z4TA 1GGFA 5PNTA 3GA5A 3MQ4A 4FGZA 4B7ZA 3RVLA 1L5HA 4YV0A 5JWHA 2B36A 3RVRA 3PC6A 3UW1A 5FAKA 2Y99A 2O2XA 1JLMA 5J5VA 4AMZA 2BF4A 1OC2A 3RK0A 4FX2A 4MJLA 5BVGA 4LN1A 4XGRA 3AERA 2WG1A 4WNAA 4KQKA 5T4BA 2UYCA 1FW8A 4KFSA 2HSWA 3JQ7B 1E9CA 4II2A 1U7XA 2O8VA 2FPWA 4HFNA 1U1EA 5ICSA 4TYPA 3CRZA 1QVWA 4W6ZA 5JXJA 1HE1C 3SHOA 3RSHA 4A0RA 4V03A 4Y7CA 4QQRA 1YVDA 1NVVQ 2DECA 4CEHA 4LHVA 3SS7X 1GZ6A 2X7HA 13PKA 3CUKA 3DT6A 4W1QA 2CVOA 4YJFB 3KKKA 4BMNA 1QM5A 1Z8HA 3N8GA 2ZS9A 1QVAA 3Q6MA 4UVDA 2JBWA 1NFRA 4ARAA 2NIPA 4CCYB 3F6EX 5A0FA 5J2UA 2DULA 3BBLA 1UM8A 1KDYA 1JDUA 3JYQA 5JRJA 1T15A 1U28C 1EX6A 3MGKA 1YGPA 2Y67A 2Y76A 3U39A 3U16A 3AINA 2ZRLA 2C31A 3KVNA 3ESCA 2GA9A 1QZXA 4HH0A 2R751 3CZCA 4J7CA 4IIXA 4R2HA 2ECQA 4OBWA 4RS4A 1Y98A 3M1IA 4W4TA 4NJEB 2FVXA 1TK9A 3KJFA 4UU1A 5JQGF 2VP4A 3JCZA 2Q3DA 3TPZA 3V8RA 4O5AA 2ZAIA 4BVKA 4ID9A 4PN7A 2ARKA 2TMDA 3B6JA 4UDXX 3VPXA 3TEMA 4C7OB 4L57A 1LVHA 5KYKA 2WAYA 3OD1A 3WMWA 5B3KA 4AI6A 2GTHA 3OZSA 1GCOA 4WRRA 1M2OA 4DM7A 1QG0A 1V7CA 4B46A 1A76A 2FWIA 1NYTA 5AW6A 3UWKA 1JPJA 1YQTA 2HIGA 5AI8A 1HDYA 5G4KA 4P0QB 4TV9A 1ZIYA 4L5IA 2GLTA 3HGMA 4MIYA 4F8EA 2DBQA 5ICCA 2Q2OA 2F67A 3D3WA 4I9GA 5TPWA 2JKYA 3DBIA 2O8CB 4HGQA 4RW0A 2XCUA 3RS5A 3O3NB 1PIWA 1WO8A 2RG7A 4BU1A 3O2JA 4OLHA 5I9MA 3U62A 3KUCA 1J99A 5THQA 3TX2A 2HK9A 1FU4A 4DUGA 3EVEA 2HA5A 1Q92A 221PA 5KWEA 2IOFK 3GFRA 3JD3A 4CM4B 3OCVA 3EVAA 4M88A 5EXSA 4JSYA 3T3PB 1UM9B 1Z2AA 1MA0A 3FNHA 3VKFA 3UN1A 3AH8A 4R69A 4ZVOA 3O9ZA 5CEJA 1AKRA 1JKIA 1TC1A 3R5TA 1G3IA 3FCUB 4PPQA 1NUPA 3TXXA 4FGSA 3R5FA 2VRNA 3L1HA 4LK2A 2A3NA 1XYVA 1ZJ6A 2WYWA 3N74A 3BTUA 3ND6A 3OVMA 3W3AA 5I9NA 4BX3A 1S1CA 3ILXA 3P4XA 1RACA 2A5FA 1ZMXA 4N6NA 3S40A 1Y3HA 4HVAA 1V5FA 5D5HA 3SU8A 1AZLA 3DP9A 2WSSD 5LZ5A 5C34B 5C1DA 5LNK6 3I8SA 1P9NA 3NI2A 4HY3A 4OA8A 3VH4A 5HPYB 2NVOA 2GERA 5TPZA 4YPVA 5BSVA 3RUIA 5KDOA 3A2KA 4L8VA 2X7JA 2HD4A 1Z4PX 1WZUA 3HVHA 4RJIA 4Q19A 4Y9DA 4HMPA 3GYGA 3CVVA 4CM6A 4OUKX 4G2TA 1AQNA 1QS0B 3KRTA 1B16A 4K40A 3Q0TA 3N7TA 3D2BA 4GPAA 4F5WA 4MJ3A 3U4GA 1YZ3A 4WBXC 1YNOA 3EN0A 1CERA 2WMNB 2GZRA 3KXKA 4KFUA 1AK9A 5EWJA 3G2JA 2FXIA 1OWOA 3AESB 3GFPA 3EULA 3Q3GE 3EFHA 1T0IA 1KK1A 1T3LA 1XJWA 1NBMA 3K5HA 2Y9PB 1NQOA 4G1VA 4XIIA 3A9RA 2BDUA 4E5KA 5G53C 3FCYA 4OM8A 1XEWY 3EF0A 2FPIB 3T3NA 2X0IA 1XCJA 1ZHHA 4MJ7A 2B9EA 2XBUA 1UXJA 2J0UA 1TA9A 3VBEA 4CQLA 1CR6A 2Z09A 1U3DA 4G5SA 1X1RA 5LQDA 2I6UA 2W98A 1A5TA 4B5KA 1W1UA 1T1RA 4PR0A 3LQKA 2QA5A 4N3CA 3OM0A 4O2BA 3DLCA 1EZ1A 4WT7A 1SXGA 2WT9A 2W70A 2YBEA 3RFUA 2YR0A 2VT7A 1T0UA 3EMDA 3T41A 1OXVA 3HNRA 3ETHA 3H5AA 1MVLA 3IP3A 3LS2A 3MTIA 4BBAA 1QMPA 2BGUA 3H42B 3AW9A 1IY2A 3DE0X 3FNQA 3OZBA 3FWKA 4R7ZA 1UEIA 3O38A 2TMYA 4JHLA 2AV6A 2GEUA 1MORA 2C5GA 4FE3A 1AY0A 1PJ4A 1YMVA 2PLRA 4RABA 1TMGE 2AI2A 4UZEA 4LXTA 4HVCA 2P3OA 1OI7A 4HXYA 2J5XA 5C9ZA 5EWLA 1YQGA 3DMDA 5DDIP 4QEZA 4BP3A 1EBFA 1E1NA 3S2FA 2JH8A 3FBTA 1E6LA 4AZTA 2AZ4A 3A26A 2EFGA 4LBVA 1KOLA 2DVMA 3BXGA 1L9KA 1ORDA 2WZCA 4LWZA 5K4AA 2CF6A 1ZIOA 4PHFA 4U9UA 4D3SA 5JD4A 2M98A 4G5HA 1FUYB 3UKJA 2QW8A 1QBKC 2RKBA 3TCNA 3U7EB 3QBTA 4QXPA 5EE5B 4AROA 4BFZA 3KYCA 2WQ7A 2CXNA 1O6BA 1KO4A 1D5WA 1E63A 1XCOA 5FL7D 5DNCA 1MGOA 2YH2A 4X65B 5CAEA 5AVWA 4TUYA 3U7GA 3VNQA 2P0YA 2PX8A 5LC1A 3ITDA 2FFRA 3LHKA 5FI1B 5DGCA 4AWXA 2PJZA 1G5HA 3UAZA 1UBLS 3KO8A 5DP1A 3KUDA 3OUUA 2G40A 3H75A 4RSHA 1DLIA 2ZAYA 5JATA 3DPIA 2L69A 1JMYA 2FPGA 2FZ5A 2FWNA 2I7VA 4POAA 1B26A 2OV3A 3BWEA 3WIUA 5BOSB 5K20A 1DV2A 3LXMA 4HAIA 2QSZA 1ZNWA 3COJA 3ZCVA 2P75A 1A5BB 3I1IA 1RR6A 3IDZA 5BWLA 2F8SA 3OIYA 3TW6A 1XLTC 1XZKA 3OTIA 2B0JA 4R8SA 2RGYA 4TT8A 1DUSA 3DXXA 4E07A 2QQ0A 2GBFA 3WISA 1GZDA 3D6JA 3HLKA 3JQFA 1XTRA 3CNOA 1FFDA 3OZEA 2VDJA 1QAMA 3ZHQA 1N2CE 4U7DA 2ZSHA 4UNRA 2XQGA 3K70C 4CNBA 1EUCA 2AN4A 2ID9A 4NMWA 1RXSA 4QYMA 1PFGA 5BSHA 2J3HA 3HZZA 2ESRA 1Q7TA 2BI7A 3NRCA 2IF2A 5IJ9A 3PPIA 4JUIA 3RQSA 3WQHA 3DBOB 5BWNA 4RULA 1FOEB 1ADJA 2Z1NA 1CJTC 1CRPA 3GMTA 1E6KA 3L06A 4WE3A 4X84A 5D6NA 4C0XA 2I1VB 4LISA 2YDXA 3RKSA 5FBWB 2WU3A 1P3Y1 3DDOA 1DAPA 3R0IA 1S96A 2AF4C 2JH3A 2DKNA 3T7CA 4W8HA 3TBKA 2L0XA 3F7NA 2J59A 3EZ9A 2VJYA 2VK2A 1Y8RA 1PP4A 3QX7A 4KYIB 3ONWA 3PKIA 4IIGA 3TB4A 4I9UA 1K75A 4OHYA 1D9XA 1ONSA 3BAZA 5T57A 2B4KA 2ECPA 2WKSA 4NONA 5A04A 2RHTA 3AILA 3SVZA 1P5FA 4DLTA 1MB2A 1T1GA 2JHPA 1CS0A 1XD8A 4OJMX 5EGSA 3A14A 1JBEA 1KWKA 3CONA 3FOAA 4Q9KA 3OZAA 4GZ5A 4FVTA 1PL7A 2JD2A 4BFYA 4EB6A 4PS0A 3PITA 2W2PA 4C87A 3IRUA 1JEYA 1D3AA 4LCEA 2RHGB 3KSMA 3IMCA 4P08A 4O2AF 3RTEA 3SZMA 2PM8A 3V8VA 4BP8A 3W3AH 3TQHA 3V3TA 1BMTA 1X1BA 4QDKA 4XOIA 4U39A 1XZNA 3RT1A 2RK4A 1JB1A 2H6EA 2X4DA 5HF6A 5C18A 3MVEA 4C9BA 3F8SA 4JR2A 3T9BA 4AJ2A 3GA7A 1P17A 2GD6A 3VOAA 3NHAA 1LNSA 4MS1A 5GGXA 4LG1A 1BRTA 1UP6A 4FHDA 2WSSA 3HB0A 5HRAA 2M6RA 1GG8A 3QXXA 4YFYA 4ZVRA 3LLMA 4XFKA 5F7JA 4FKBA 5LMZA 5EE0A 3U37A 4BZPA 2WYOA 3LUHA 4QVIA 1V5WA 5SYNA 3R7WA 2C3PA 1CJSA 5LD2B 4L27A 3HACA 1E96A 1EFKA 1RADA 3C3BA 3OIWA 5DNWA 3VC2A 1WSDA 4W6QA 4NDAA 1N0WA 2V58A 3WJ7A 1N92A 2PJUA 5AM4A 1YR7A 2CHVA 3F74A 2CD7A 4P34A 4M1SA 1L5HB 1QTRA 1R0LA 2PS0A 4D0LB 1Q22A 4PAOA 2I7XA 4B6GA 2WWTA 3S8EA 4PLTA 1QP7A 2NU7A 5FTKA 2WABA 4QU5A 3OQIA 4A0GA 4AN1A 2DFLA 3O1JC 2SKDA 1CPYA 2A9FA 2PV7A 3FTQA 3ZDCA 5DLPA 3J80A 3VTZA 2FW7A 3KJEA 4QBHA 4A5SA 3GCZA 3ZNQA 4GPD1 4CL0A 1ARZA 1LI4A 2FZWA 1CF2O 1P73A 3ZDDA 1UZMA 2HDWA 5C5CA 1O2DA 1QK4A 1BSVA 4Z3DA 4AS1A 3H9UA 1CRLA 1D2AA 4ZDJA 4MO9A 3QG1A 2NSDA 2AOWA 4HH3C 4X60A 3SC3A 4ZU6X 2OD7A 2IZ7A 1PGQA 2XE6A 2ZJ6A 1E5XA 3QMVA 2X40A 4GRIA 2ZT6A 1GTL1 1PG2A 1ZUHA 1MC5A 1X14A 2W71A 4OHKA 5CVVA 4ERNA 1K8YB 1OXXK 1PFKA 5EC8A 3SJUA 2PGIA 3W1VA 5BYKA 3M3PA 3OU6A 1UXOA 2PFGA 2I65A 1IBMB 1FSZA 5J2UB 3CJQA 3ZNNA 2O0HA 1EDBA 1Z63A 4ALIA 4AT1A 5LUAA 4L4YA 3NANA 2ZW9A 3IQEA 5B3JC 1K98A 3PRYA 1GCAA 1JDVA 4DN6A 3BDVA 5LQJA 1JG3A 1T3HA 2X6QA 1U2PA 3C4JA 3G13A 3OF5A 4IFEA 3COVA 1KAEA 1GKUB 3BKWA 4FSHA 1YZHA 1BJRE 5AM0A 3SZ3A 4P35A 4FILA 1W52X 4F5ZA 1NE7A 4MA5A 4XQEA 2PUEA 4XQGA 3UEOA 2LCFA 3UGTA 1RI3A 4DRYA 1WQ3A 2FCAA 4F5YA 2AG1A 1TW2A 1JKXA 1M2OB 4N6OA 1NLFA 1R6AA 4UD2A 1X3LA 2BFFA 4HVLA 2DTDA 4O4HF 3ZXXA 5G4KB 2CLDX 4TV9B 1RHJA 4OLFA 3WMXA 4GM1A 5C3MA 5FL7A 3UICA 1AB6A 3D3WB 3KHTA 3SPXA 1PR5A 3LBNA 4MWOA 1CFJA 1LV8A 4MGIR 5IKXA 3E23A 1K6JA 2W6QA 1M1XB 1G5RA 3R6WA 4G4JA 4F4HA 3Q9LA 2G83A 1EXWA 1EMDA 1ZNQO 3IQZA 1TLFA 5JVDF 2ORIA 2XUPA 1E5LA 2RC6A 5DW0A 1YI0A 2YV1A 4OQPA 2FWMX 1KL7A 3GLRA 4YALA 4MV4A 1N7HA 4G65A 2EEPA 3DVSX 4ZVQA 3OQ1A 4AJIA 4LHEA 2RGDA 3O8DA 3TD6A 1X94A 1COWD 3C4VA 5DNAA 5G2OA 3O9MA 1U0NA 1P4GA 3MJCA 3AQ4A 1Z88A 3ABZA 4FMDB 3IO3A 4K46A 4LHWA 4TVBA 5B57C 2BR5A 3TWOA 2C5BA 1YFZA 2Z2YA 1LJUA 3QWIA 4B48A 1FSGA 3C16C 1NW4A 2I6SA 5KVSA 4KR9A 5KX5F 1JHDA 1WXXA 2HB6A 1KTIA 4XD2A 4AK9A 4YAOA 3C87A 4P9NA 1FL9A 4BX9A 1BW9A 2YFQA 3VZDA 5AIAA 3MGCA 1X2BA 2D1FA 2YJ3A 3D6TB 3TE6A 4RPGA 1P1HA 1E9BA 2OBXA 1MJGM 1L8AA 2CXRA 2R7KA 2ZRGA 4Q6WA 1SZPA 4IDOA 3PXGA 4HSEA 1K89A 1FJXA 1AA6A 1A7AA 5EWJB 2TRSB 3QELA 1USUA 3G0GA 2XUGA 4OOEA 5J47A 2A5GA 4MKGA 5BOVA 1Q0SA 3FY4A 2EKPA 3WB9A 4BLQA 3HJFA 1WXIA 1NJ2A 2ZSFA 4N41A 1GNLA 1EBBA 3CCFA 1YDHA 1E9DA 3L7CA 4ENUA 1OIWA 1HOTA 3I45A 4RA6A 5EXDA 2J0UB 1TIBA 4HN2A 3PQ3A 1X1SA 5EJEA 1T5OA 4LYAA 4D9MA 2P6NA 3AIOA 3FYHA 1RI2A 3OJWA 4H7DA 3MINA 5IAJA 1WW2A 3LVRE 1UODA 1CZOA 4JI5B 3I76A 1K68A 1P4HA 4O2BB 1WXFA 4FR2A 5E9QA 3QVWA 2ZI3A 4JB2A 2MSLA 3ZCXA 4F3KA 2IGTA 3E9MA 4MVJP 3GQBA 1NBME 3GW8A 3K1ZA 2JD0A 1ESEA 2NV2B 2FFQA 4CF5A 1TFRA 1JR2A 3VI4B 2EKDA 4D4LA 4JUCA 5ADUS 9LDTA 4ARCA 2CLSA 2C94A 3CX4A 2M6SA 4EHDA 2XWQA 3ANSA 4YLYA 5BWOA 3C2QA 3K2BA 3I05A 3IALA 2G9QA 1GQSA 2AVNA 1BU8A 5BSUA 3V7WA 4A1FA 4BJHB 4EY6A 1NXXA 1GNQA 2PWZA 3UUWA 4UBKA 5EJFA 1CQXA 3C8HA 4RV9A 1V3TA 3X43A 4Z9XA 4CUJA 4I81A 1ZRMA 3UCXA 3GJ7A 1Y1QA 4YT2A 5EWLB 5B30A 1EEXB 1P1FA 5K2MA 4CM9D 1U81A 2CBZA 2XUJA 4GVPA 2AUNA 3ZWOA 2H2HA 5AOVA 1R0BA 3KXDA 2PYIA 2J85A 1GUYA 1VKOA 2K5UA 4OAQA 5CA0F 5CCBA 1RWOA 4PSCA 2IOQA 2ZXEA 1CRZA 2Z8ZA 3CVWA 2I1LA 3RQIA 2V96A 2XBLA 4KLRA 2IDMA 3A27A 1GSIA 1T5TA 3KYCB 5DZSA 5IJZA 4BKPA 5JLAA 4BEWA 3OM1A 4O2LA 4EYSA 3ANNA 1NF8A 1Q2XA 4WGGA 2DM6A 3AGQA 1RFLA 2QMZA 3OHMA 3L4SO 1O1YA 2Z0MA 2FEWB 2R1VA 3WRYC 1WHSA 1KI8A 2PIAA 4RHTA 2OYRA 4NU6A 4WNCA 3IOEA 5CMLA 1ADBA 1OI4A 3QFCA 5IYZB 5DCYA 5F3RA 1R37A 2A30A 2WAOA 2WVGA 2EJTA 3NP9A 4IIDA 1XCMA 2FPGB 3NJRA 4YJ2B 3I2YX 4D97A 1ZK2A 3EGDA 3RAGA 3DS8A 1BDMA 4MRSA 4J0KA 1V25A 4AL4A 1DAEA 3MF4A 1NPTO 2C78A 4JNCA 1C80A 3WP0A 3PFNA 1Q74A 1C81A 5IVIA 5HGJA 4TVSA 2ZE7A 3B6EA 3H4TA 5KJEA 4QDUA 2W42A 4LXQA 3RF6A 3CR7A 4IGFA 4G0XA 1FFEA 4MPPA 3FRJA 4UUPA 4XH9B 4JC8A 3BWMA 5KC8A 1L7RA 3MS7A 3KJZA 1KYWA 1EUCB 3I5XA 2DB3A 3L79A 3O4FA 2FSVC 3D7KA 4KNYA 1F0PA 2MMGA 1XTUA 4QOFA 2HT1A 5IJ9B 4Q9DA 4PQYA 4B47A 1QO0D 3IX7A 1V48A 3IHTA 4RPCA 1MJHA 2C4UA 4HYYA 1A4RA 4RK6A 3EUEA 4BNIA 1NXPA 1RYFA 2ZSDA 4JR0A 3OE7A 3MD0A 4C43A 4EJSC 4AJ1A 4ZREA 2PMBA 4Q7MB 1TIKA 4C01A 1IZZA 3FHCB 3HA5A 4DOMA 1M83A 5FT9A 3HWWA 3KELA 1GV0A 1Y8RB 2YY5A 1KERA 1NNUA 1NHWA 4KXQA 1TUBA 2RSLA 5JAHA 3VOSA 2AC7A 2QX8A 1L8XA 2FWRA 1FX0B 2H9IA 3Q2IA 4B32A 1OLXA 4WK6A 1AXRA 3C1AA 2O0LA 3OO1A 3GFGA 4MKXA 2GNAA 4BO2A 2V3WA 2ZLBA 3A06A 4JUBA 3TSAA 1CS0B 1H8HD 4KLAA 2X0EA 1EWKA 4ZV4A 2XUQA 4XYLA 2NV6A 5KYUA 1WRBA 3B1ZA 2QX4A 3MJRA 3ZGOA 1EKXA 3FTNA 4EB6B 1DQYA 2C0PA 3I9OA 3EVZA 3HSYA 1JEYB 4MLCA 4L4RA 3D2AA 4J2TA 4E15A 1SZCA 3JWIA 3IEPA 3C1UA 4PZYA 3I1FA 5F98A 1T0HB 3N58A 4BLPA 2XZDA 2G63A 2V7BA 1KOFA 3PJEA 1YZYA 3E9RA 4AF7A 3B5IA 2JEOA 3AK4A 4ZQFA 4RVCA 5ULLA 2XQVA 1O0SA 3BIXA 1COWA 3DOHA 2VDLB 3ORQA 4RCZA 4UVEA 4NS1A 3DL7A 2BKVA 2NOAA 4MS1B 2Q2NA 3CSSA 1GAQA 3M9WA 4G0WA 1IUPA 4OB7A 1AXGA 1DFGA 4P7FA 4PGGA 3D5EA 2H07A 2F7SA 4QLBA 1V71A 3QPBA 3P20A 1PDWA 1NVTA 5C2JB 3R7WB 3UHPA 4K9QA 1EJBA 4CM7A 1D2NA 1RYBA 3I2IA 1MX9A 2XXJA 3WK7A 3FHTA 3SIWA 2IE0A 5IJXA 4G5FA 1I51A 4D0SA 1CUJA 5JDIA 2OWEA 1N5JA 1W0JA 2VT2A 1P45A 3TX6A 5HQ3B 2AQKA 4PCVA 4YJKA 1A9YA 3M6FA 3QU9A 4XYGA 5DX0A 3W90A 4RTPA 1NULA 1A0OA 3AW8A 5K0ZA 3D6UA 3HQ4O 5M2QA 1K9SA 3OH8A 1SQSA 1WNTA 1SXPA 1ISIA 3OQIB 1UC5B 2C9DA 1W6UA 5CR9A 4UUOA 2ZRDA 1I24A 1XN1A 2ADMA 1YV9A 1MVOA 5ADHA 3DDSA 3STYA 5J5CA 2XJ9A 2VPZA 2DC1A 3F3YA 3RVQA 4E09A 4UUBA 3WL4A 1M54A 3H6KA 4OY3A 4MYHA 3SLRA 4B81A 4GBMA 1Z25A 4MLPA 3TJMA 1WBBA 3MUOA 2MSDB 3DP7A 3PFHA 3AF6A 3H0EA 4FXPA 2ZK7A 3N2ZB 3CLHA 3VU8A 4IDCA 1GPDG 3DXZA 3ACCA 4OXKA 4HTAA 3T7AA 1D4ZA 4B3IA 3C15C 3ZI7A 2OP0A 3COZA 2ZZMA 4IHJB 5KZMB 4H4CA 3STWA 2Q4EA 4PCLA 3PP8A 4MYSA 1CKEA 1N25A 1QANA 1VE5A 4DLBA 4ENVA 3RK4A 2WJWA 1QFMA 3HSSA 1P1CA 4BQOA 3FGNA 1WEKA 2CL7X 4KO8A 3IEIA 2BD0A 1D4OA 1ZW6A 3OOEA 5CA1A 1N7JA 1GFIA 2WHQA 4Q00A 4NPAA 2DQ4A 2FEMA 1ZIPA 4TROA 5FKJA 3G85A 3BILA 4NV0A 1F8FA 3FB1A 1O5TA 1MC1A 2C5LA 2GJ9A 2CLMB 4ND6A 4TT3D 5CLHA 3U80A 4LECA 1J56A 1JI3A 1NNSA 2AL7A 3ZY2A 3A6DA 5IRCD 2ZE5A 1CE8B 5LR6A 1DP4A 2QAGC 2XNDD 2JI4A 5LZ2A 4G09A 1UC8A 4FN4A 2B5VA 2HZBA 5F3WB 4ZQBA 1O6ZA 2XTAA 1CUCA 2DR3A 4ZA2A 2VAVA 4M2LA 2YJGA 3O90A 2I03A 3SYLA 1KZ1A 3T5GA 3VAAA 1S2IA 1ECFA 4H1TA 1DTWA 4O0LA 3K0FA 4MVJG 1LPAB 4BJ3A 4DV5B 3D7SA 3GPCA 4OPMA 1AM4D 1VE7A 2NSJA 5CNMA 1HQCA 3VR1A 5B1YA 2ECOA 4IH9A 1KEWA 1EHIA 3O8QA 3F2VA 3Q12A 4NE7A 2VSQA 2OZVA 4KH1A 5D6OA 4DNXA 3RANA 5I7FA 3OQOA 4QLOA 3IODA 4CMHA 1JWLA 2XNCA 3I1YA 4AF6A 5ALIA 4QDXA 3MWDA 4AS3A 3AR3A 1GAXA 5JMOA 4OJYA 4QPPA 2EJCA 3GEDA 4BNNA 1KFBB 4UBLA 1WY7A 2ODNA 4JB0A 4LJ8A 4LKRA 2R5FA 5COAA 3WLRA 3MJTA 2ZQ5A 4MVCA 1W9MA 3IURA 3T1QA 2Q2WA 1GZ5A 1BWSA 3DL2A 3GT4A 3I6BA 5A62A 1M6HA 2ZEJA 3UGJA 5JFTA 2P1ZA 2BL4A 1GLNA 2A59A 3WQBA 4KREA 1VSVA 3D3KA 1YULA 1V8DA 3JAWA 4ED9A 2UU9B 3C7KA 3TXAA 2CMDA 2VZEA 3DMYA 1NE2A 1SG9A 2J1LA 4W1RA 5EKDA 1ICEA 1H93A 3OQHA 1B43A 3M9LA 2RHDA 4E4TA 2G0NA 5THKA 5J4HA 1VA4A 3OLYA 4NX2A 5IF3A 3OIVA 1FDTA 4XYMA 1VMEA 2EDAA 4A9AA 4N6GA 4QWMA 3GAFA 1QO0A 1BW9B 4N7RA 1XZCA 1ZMBA 1P33A 3FZGA 3DM9B 3IQFA 1WU8A 4R8RA 4BBZA 2OGUA 2JHGA 4P7BA 2ZUBA 3CUWA 1ZVKA 1CB7A 3HU3A 1QRTA 3NBFA 2VPQA 3M89A 4BMSA 4BMVA 3ON5A 3QEMA 3H0CA 2ZAOA 3MCVA 3AKZA 1GLGA 2QP3A 3LZDA 3L9WA 1WLYA 2RH9B 3GVPA 3QELB 2VNAA 3FLBA 3KALA 4PANA 3TQQA 5FUYA 3BRWD 1EINA 1QCCA 4B33A 2PX3A 2F6RA 3F9IA 5BUQA 1IAVA 1ODJA 1YCDA 1R4NA 3Q7RA 3QMWA 3TEJA 4CM8A 4QO7A 3A32A 3C5EA 1YB4A 3DCYA 4UOQA 4KH0A 2FKAA 2Q5HA 2HSGA 4M0CA 4WN3A 5HZKA 3GEEA 2A1UA 3RW9A 2VJBA 4Q1FA 2D1SA 3FMPB 3E27A 4RA6B 3P9XA 4TMFA 1H8HA 4PLYA 4LNHA 4ZYZA 1Z38A 1LBIA 4UHJA 4RETA 2PE5A 1UJBA 1FRQA