4YQYA

Crystal structure of a putative dehydrogenase from sulfitobacter sp. (cog1028) (target efi-513936) in its apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
258
structure length
251
Chain Sequence
LGTENLYFQSMDLKGKTAIVTGGRGDIGRACVLELAARGANVAINYMASSEGADSAVAEIKAAGGNAFALQGDMTKEADVAALVEKTVKEFGQVDTLVHVTGGLIARVTMSEMTLDHWQSVMDVNLTSFVLMVRECLPHMTEGSSIVGLASQAGRDGGGPGASAYGASKGALMTLTRGLAKELGPKIRVNSLCPGMIDTDFHNRTHVANVSPVKREGTSEDVAKLAVFLASDDAAFITGANVDINGGMLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a putative Dehydrogenase from Sulfitobacter sp. (COG1028, TARGET EFI-513936) in its APO form
rcsb
source organism Sulfitobacter sp. nas-14.1
molecule tags Oxidoreductase
molecule keywords Putative Dehydrogenase
total genus 87
structure length 251
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yqyA00
4NPCA 4YDRA 5DP2A 2X8LA 3F46A 3DWFA 2AA3A 1X1TA 2A35A 5JFOA 2OL4A 4S3MA 4D43A 4AICA 5CP8A 3CTMA 2PGDA 3PWSA 3WLEA 4DLLA 1OFGA 1JVSA 1JVBA 2O4CA 2ZATA 3OJEA 1ZBQA 4RVUA 3VZRA 3ZH2A 4CM8A 4PN3A 2X1HA 3GAZA 1J0XO 4PVDA 4KDFA 1I8TA 4WLOA 2PZLA 2YYYA 2PGLA 1E3SA 2CDBA 1IHYA 3IDSA 5ENVA 3U49A 2C2YA 2D59A 4LMPA 1O89A 3LT4A 1HT0A 1UH5A 2VWQA 3JTMA 3TN7A 3DOOA 5JBIA 1FXSA 1X7GA 2VNAA 3ANLA 4OKIA 2Y93A 3NTQA 2DT5A 1XKQA 4E2XA 5AXCA 1U1IA 2QIOA 1XYGA 4CM9A 2X23A 5A5EA 4HUJA 4BMVA 5G2OA 1JN0A 1M6WA 2GLXA 3OJOA 3LDHA 1JW9B 1E0DA 1VJ0A 4WCDA 1NHWA 3UUWA 3WTCA 1DIHA 1EUCA 2WSBA 2W8ZA 1WXDA 1P1HA 4XB2A 4WCFA 2J3IA 3ETGA 2OZPA 3D64A 2PK3A 3BMOB 2IEDA 1KEPA 1MP0A 4NJMA 2C7GA 1HDGO 3QLJA 2JD0A 5EESA 4CQMB 1BW9B 3K31A 3W6UA 4QXMA 3WIEA 3BMQB 2X7HA 4PLFA 1UZLA 3TZHA 1L7DA 4HWKA 5I7SA 1LRKA 2B37A 3OP4A 4TVBA 1KERA 1YRLA 4YEDA 4URFA 1NQAO 1DEHA 4XQCA 4BV8A 4XGNA 3PPIA 4N5LA 1DB3A 1MFPA 2IE0A 2X22A 3NAQA 2CZCA 3OJ0A 4P4GA 1PZGA 3BTUA 4IJWA 1T1RA 3JD1A 1M75A 4I9NA 1BXGB 1T1SA 4GL4A 4INAA 3DBRA 4CMHA 1ISFA 4B4VA 3HQ4O 3OQ1A 1A9YA 4XIYA 3U3XA 4PLYA 2NU8A 3ZWAA 4A27A 1R12A 1P1JA 1QSGA 3JQFC 2OGUA 3BYZA 2X6TA 4GQAA 2HMSA 3OF2A 3ENNA 1Z82A 1LLCA 4OL9A 1YB5A 1IYZA 2VRCD 4IQ8A 2J6IA 4BKUA 3VPSA 1V0JA 3Q9NA 2FY8A 5A04A 1E7WA 5BNFA 4A03A 3F9IA 4ZQBA 4R01A 4E30A 4NK4A 3VPXA 3UCXA 1T4DA 5BNIA 5JDIC 1QXSA 3Q2KA 3PLRA 3UF0A 4YT2A 4E5MA 4UVHA 4GSKA 1M6HA 4F46A 1ADBA 2EW8A 4NU6A 3PWZA 5DOZA 3TSCA 1ZIDA 4BNTA 1HDYA 3ZWPA 4I5GA 2VHVA 4IJUA 1PU2A 1FJHA 2PNFA 4NJMB 4WGGA 1UZNA 2JKVA 4BNVA 3GQVA 5KJ6A 2X4GA 1LDYA 1Q0HA 1CIVA 4WCFB 3RBZA 5L95A 2VHZA 3LF2A 4N5MA 1OMOA 1UZMA 1GZ6A 1VM6A 3PQFA 4B79A 3QY9A 2RH8A 2B83A 3U4HA 2OP0A 3PQDA 4FGSA 4AJOA 3DAFA 4MP8A 4UREA 1DIRA 1WDLA 1XCBA 1KBZA 1UXHA 2VHXA 3NJ4A 3RAJA 5IJZA 2BKAA 3LLSA 1J6UA 4CUJA 4JJIA 2OMEA 2G5CA 3PHHA 4CMEC 1SOVA 1U2DA 4DPLA 3O9ZA 5AOVA 4XYGA 4BNZA 2FPIA 3ADPA 1EBFA 2EW2A 3M2PA 3S8MA 4RJTA 3HFSA 4M1QA 3WGZA 2BELA 1DOHA 2VQ3A 3AWDA 3LU1A 2NU6A 4IINA 1HZJA 2Y66A 5K9ZA 3ZW9A 3WGOA 3KYCB 3RC7A 3H5AA 1AGNA 4C4OA 3LT1A 3JD2A 4AG3A 1NQ5A 3VH4A 3AY6A 1Z7BA 4JK3A 3DHNA 5JY6A 1ADGA 3UVEA 2NSDA 1KEUA 1ZSVA 5TSDA 4CM1A 3GLQA 4BNGA 5CDYA 1ZVMA 4QQRA 1AN9A 5B12A 1U5AA 2C5AA 4E4YA 1XGKA 4PG4A 2D5AA 3PZRA 4E31A 3SX2A 1PQPA 4FGWA 2Q2VA 4GKBA 5A9RA 2QRKA 3BA1A 4FFOA 4P4LA 3LZ6A 1B15A 2HU2A 3DZHA 3ONDA 5BT9A 3RC2A 4M49A 7MDHA 4XEHA 1QR6A 4DL9A 4D45A 4WNCA 3I4FA 2C59A 1PJBA 3DQPA 4O6VA 3WYEA 3E18A 3STHA 3KSUA 4FN4A 4Y98A 4LVCA 2Q1TA 4XQ9A 1P45A 4XQGA 4ND2A 3MWDB 1S6YA 1ZXLA 4Z3KA 1IY8A 4UVGA 1D8AA 1AUPA 2BRUA 4M86A 4YJGB 4ZN6A 1U4OA 2EERA 4NU5A 3PJDA 4KOAA 3LLVA 1HETA 4NZ9A 4YJDA 3T7EA 1U3UA 4Y67A 2C54A 4DMMA 1ZH8A 3GGGA 1YJ8A 2C82A 4M54A 4Q3CA 4FC6A 4MVJG 3KSZO 3ROQA 3HB5X 3OIDA 4B3JA 4WECA 1N8KA 5JY1A 2QQ5A 1TA4A 4CR7A 2NM0A 3S2GA 3NDIA 4R1UA 3TQHA 1PGJA 5F1KA 2HDHA 3P7MA 1BMDA 3EDMA 4H7PA 3UAGA 3U5TA 1MV8A 3LK7A 4BKQA 4YCAA 5L4SA 4ZRNA 2DPHA 4DC0A 5ENDA 3NT5A 4ZRMA 2Q1SA 5KVVA 3H4VA 1Y8QA 4OHUA 2G82A 1Y8RB 3PXXA 4U6SA 4RO0A 4IMPA 1Y9AA 3JQEA 3HJAA 2O3SA 2Y1FA 1VPDA 4OSPA 4W99A 2B5VA 3AY7A 4XX0A 4RL6A 4YYZA 2AQ8A 2PD6A 3GY0A 1D4FA 1P3DA 3WGGA 5L7YA 3MEQA 3PIDA 4L75A 4J1NA 4JBHA 5CG2A 3QW2A 2JD1A 2QRJA 2H1SA 1B16A 1I01A 2QW8A 5JO9A 2E49A 3NX4A 4TVOA 2PKQP 1H2HA 2ZQYA 4NBTA 3HB4X 3I5MA 4ONEA 1K3TA 5EINA 5AXAA 4DPMA 3EZYA 5A03A 5EN4A 1K0UA 5A3JA 3F1LA 3GOHA 4C7JA 1BW9A 3GK3A 3HN2A 1GV1A 4D79A 3H65A 1Z75A 3ZDFA 3BTSA 2Y67A 3GZ4A 1UJMA 5LDGA 2G76A 5C3MA 4J1QA 4YACA 4JJFA 1X14A 4OXYA 2NADA 5T67A 1LTHR 4MVJE 1DSSG 1H93A 4BMNA 3FPCA 1S7CA 1J49A 4OJNA 3ITDA 2EWMA 4W4TA 2B0JA 2JCVA 1DPGA 1NBOA 1TT5A 3W1VA 3QWIA 4TRJA 5L4NA 2VT2A 1GDHA 2FPPA 4ALNA 3WGYA 1YB4A 2YDXA 4OQYA 4BO9A 3VPFA 2BI7A 1PS0A 2HMUA 4YT8A 1PJLA 5C7IO 1R37A 1RJWA 2CSUA 3C8MA 5FEUA 2YY7A 3O8QA 1DAPA 5BQFA 3I1JA 4TSKA 4C7KA 3BMQA 1OAAA 1W0CA 2WD7B 2Z1NA 4R5MA 1YKFA 1GU7A 2D4AA 4IXTA 1UXGA 3RUHA 1BDMA 3IKTA 1QYXA 1R6DA 4AL4A 3GEDA 3F4LA 2DC1A 1SBYA 2PTGA 1F06A 1HYGA 3ST7A 5CAEA 1QYVA 2FR1A 5CDGA 2AHRA 4DYVA 4A26A 1QRRA 2ZTVA 3RUAA 2HCTA 3L77A 4BNIA 3I83A 2RH4A 3L4BC 4MKXA 1ENPA 2CDAA 1K6XA 4JX8A 3UHAA 2AE1A 4TZTA 4FS3A 1ZZEA 1QLJA 2C2XA 4ALLA 2B4RO 1QMGA 3TZQA 1GL3A 4ND3A 4GLLA 1YL5A 2GERA 4JGBA 4XR9A 1UP6A 1GYQA 3JYOA 1N9GB 1GCOA 5U4QA 3PJGA 2CNBA 1XELA 3TZKA 1WNTA 4J90A 4XZ3A 2BFOA 3DBHA 2J3HA 3GFGA 1DLIA 2WEKA 3I9OA 3KOUA 3DTTA 4MIEA 1I10A 3F6YA 1KEVA 4O1MA 4BQPA 4CM8B 3DMTA 5TT0A 2JHGA 3M2TA 4FFMA 4JQCA 1WVGA 2Y0CA 4RF4A 2Q50A 3QVOA 1NM5A 1ZK4A 4AJJA 1EEHA 1BDBA 1GY8A 4GSLA 3WSVA 3KXDA 1HKUA 4G5HA 2I66A 4ROSA 5JO0A 3WFJA 2QHXA 3VAZA 4KP7A 2VHYA 4A10A 4PZCA 1E6WA 1H0KA 2EEZA 5JXWA 4YRDA 3RKRA 2V7PA 4ND5A 3ULKA 3DOCA 1ULSA 2AG8A 3L6DA 2P5UA 3NEPX 4TRMA 2EKLA 4KWIA 1ZFNA 1GAEO 3FI9A 4O5OA 2PD4A 2V65A 2ILTA 1JKIA 3I3OA 2AEJA 2H5LA 4YAKA 2PKQO 1JDJA 1MB4A 1I36A 4BHTA 3NGLA 2VUSA 4IM7A 3JQGB 4MO2A 1H6BA 3T4EA 4RF2A 4GKVA 3EC7A 2VUUA 4FR5A 2BLLA 3NUGA 1XLTA 1NPDA 4GVXA 3DEYX 2GN4A 2IDZA 4CM4A 3VH2A 4YXFA 5TGDA 4OQZA 3JQ7A 1Y6JA 1K2WA 1BXGA 3V5NA 3UICA 3LC1O 5COAA 5COBA 1H6DA 3K9QO 2Y0EA 3C1TA 5LC1A 2DUWA 3MJVA 3ZCXA 3OETA 4RPJA 3ZWWA 4E32A 4GWGA 4CLRA 9LDTA 5L51A 4Z6KA 3L4SO 1KIFA 3JQGA 3HZZA 4CMIB 3RC9A 4IDEA 3AUSA 4CUZA 2UYYA 1R4NB 3BMNA 3E9QA 4IGEA 1QLHA 2EHDA 3L6OO 4W82A 4EZBA 5JYEA 4TMFA 1ISHA 1OI7A 4AJ1A 2O3QA 4MDHA 3UGKA 4IQGA 4OM8A 3AU9A 4PZDA 1CYDA 2W98A 3GEGA 3H5RA 1O94A 2EIHA 2J8ZA 1GZ3A 2O2SA 2A9FA 3D0OA 3VKVA 1GD1O 3BMOA 3I4CA 2HSDA 4E5KA 3X2EA 2EGGA 1C14A 5L45A 1OC2A 3ZWNA 2O3JA 4YT4A 4PCVA 3S55A 2FSSA 1N7HA 3LF1A 1HDZA 1R0SA 3ASUA 3ZV5A 2CFCA 4RGBA 1N1GA 4KWHA 3JQDA 1Z73A 4Q39A 1PJ2A 3IJRA 3NRCA 2W2LA 1ZK0A 3D7LA 3KHUA 4J4BA 1MUUA 2WTBA 3B6ZA 3D4NA 4CQMD 1ZK1A 3H8VA 1QYCA 2YV2A 3DBHB 3U4IA 3GDGA 4TRRA 5G0WA 4FJ2A 4R9RA 1X13A 1KVTA 4ZD6A 1N9GA 3QWBA 4AVYA 5DBFA 3EGOA 2DTEA 1VRWA 3DAGA 2EJWA 4CM5A 3ROMA 4BKRA 4M87A 1M67A 1KC1A 4E12A 5JC8A 3QRWA 2YJZA 3ZGYA 3H3FA 5G0SA 1RKXA 4YAJA 2I3GA 2A92A 4O63O 5CDSA 2Q1UA 3WBBA 1XDWA 4FD3A 3H9JA 3JQ9C 1EMDA 4R68A 4I8XA 4H16A 1KYQA 5C7LO 1T2CA 4EUHA 4MVJH 2CUKA 1ISGA 5GZ1A 3KYDB 3PJFA 3RU9A 4KDEA 4YPOA 4HY3A 3M6IA 2BGMA 4Q3NA 4BO5A 5HM8A 1MG0A 1IPEA 4BGIA 2A4KA 5G4KA 2GZ2A 1DIGA 3ZW8A 4ID9A 1SO8A 2NTNA 3FCOA 3NGXA 4F6CA 4RQUA 1NPYA 1EE9A 1PJ4A 3JYLA 2DFDA 3KLMX 3O8QB 4UVIA 4EJ0A 3R3JA 3U09A 1RWBA 5ITVA 2VZ8A 1LC3A 2FMUA 4OGWA 3L6EA 1WDKA 3KRTA 3JQFA 3EK2A 5TT1A 3UH1A 4BV9A 3AI3A 1MXFA 1NYTA 4BQRA 3QVTA 5BSFA 4PIVA 3WOHA 1DHRA 2WJPA 2XAAA 2PH5A 3WB9A 4PFJA 3K92A 2YFQA 5IDYA 5JLAA 3WIDA 1TT5B 2CF6A 3PI7A 4FQ8A 4DIBA 3WXBA 1B3RA 5ES3A 5JAMA 1XU9A 3EZLA 3HG7A 3H7AA 3BAZA 4WLNA 3RI3A 3JQAA 4J7CA 3QHAA 2BGKA 5A06A 2X9GA 3MTGA 3S2IA 3NTRA 4BO2A 3I9MA 4D46A 4NH4A 4XR4A 1L1FA 3H9UA 1NFFA 3KEQA 5L53A 1UR5A 4I5EA 4IS3A 1VI2A 4DREA 4CMGA 4WLUA 2YUTA 2X0IA 3W6ZA 1ULUA 1DLJA 3Q6IA 5IZ4A 5JC1A 3BHJA 3BMNB 1LDNA 2IZ0A 1VC2A 3GG9A 3DZGA 3MZ0A 1DFGA 3GGOA 2BFMA 5IAAA 4DA9A 1NXQA 1PQWA 4R54A 2DPGA 4I08A 5L7WA 1LDMA 3WWYA 1X0XA 4KUGA 2OUIA 4EW6A 2B36A 1UXJA 1LX6A 4JCOA 2X58A 5TNXA 4WOKA 1A7AA 3W8DA 3GEMA 1UAYA 3TOXA 3SC6A 1V3TA 1RM4A 2FZEA 3W4JA 4DMLA 1TB4A 3DZBA 4QECA 1YL6A 1M2WA 3L07A 4ZQEA 3TL3A 1ZW1A 4L8VA 4Z9FA 4J6FA 4NFHA 5G4LA 5KJ1A 1LJ8A 1XEAA 1W4ZA 4RPKA 3X2FA 5HA5A 1PQUA 3S2FA 1Q7BA 2QZ9A 2WYWA 2R6JA 2Q4BA 1WZEA 1I30A 4Z9XA 1PS9A 4CQMA 1CERA 1PEDA 2IODA 5KVSA 4QTZA 4JP3A 3O03A 1PGPA 1P1RA 1RYEA 2HMVA 3ABIA 3QJ5A 1VKOA 3A14A 1U3TA 3KETA 2VT3A 2HJRA 5JDCC 2ZYDA 4CUKA 3ICPA 4J2OA 3O26A 4BNUA 3RC1A 2JJYA 1SMKA 2QYSA 1GV0A 1TT7A 4RPHA 4Y6SA 3OIFA 1YOVA 3QWHA 1NFQA 2Q1WA 4WCFC 4X54A 4E2ZA 1ZXBA 2V6FA 4DQXA 2FWMX 4AFNA 3FWNA 4RVDA 1JTVA 1PZEA 4YR9A 3OICA 3RSHA 3FNFA 1P1FA 3E48A 2C7VA 2VUTA 1XWFA 3Q3CA 2PR2A 3IQDB 4BMSA 3G17A 3WNVA 2OORA 1GPJA 2D1YA 3BHIA 3HDHA 4EGFA 2JFFA 1WMAA 5ILGA 1PR9A 3VH3A 2NTJA 5I8ZA 4CODB 1R15A 3FNEA 4FFLA 4FW8A 5BSEA 2R2GA 1PS8A 5F21A 2O4UX 1GQYA 1XU7A 2B5WA 4OSOA 2DTDA 4QX6A 3IP3A 4IDAA 4UEJA 4A0SA 3LQFA 2PLAA 1LSOA 2VYNA 3RD5A 2PD3A 4FPXA 4HNHA 5EPOA 3O38A 1E3WA 1XHLA 4LSWA 3ZWYA 4M8SA 4E0BA 2I6TA 1A4UA 2HJSA 1H2BA 3KO8A 1ZMOA 2EP7A 3PGXA 4GLOA 4K9DA 4NFYA 5AQ1A 3R6DA 4OAQA 2GR9A 1UUFA 3DZIA 1HXHA 3P2OA 4Z0PA 1D1SA 1MLDA 4EBFA 3RUFA 4DQUA 4E13A 3HN7A 2DQ4A 3ZHXA 5C7OO 5KJFA 3FTNA 1A5ZA 2JAPA 2CF5A 2HQ1A 1JLLA 1E7RA 1DO8A 4CL8A 1QV7A 2NTVA 2GO1A 1YOVB 2OFPA 4DBVO 5IDWA 1JQBA 4UUPA 1U4SA 4M55A 1ZNQO 4H3VA 3TZ6A 1DRWA 3B1FA 1LRJA 4L4XA 4GGOA 2IXBA 4Q3AA 3JV7A 4CLOB 2BGLA 2VHWA 2LDBA 4YJFA 4DLAA 3I9LA 2DKNA 4B3IA 3LYLA 4BS9A 1SOWA 1H6AA 1JKFA 4J0EA 3ETEA 4CM6A 4BL5A 3G3EA 2FN7A 3GNTA 1WMBA 3D3EA 2Z95A 1YGYA 6LDHA 1UP7A 4XD2A 2VYVA 2FPGA 1BG6A 4D42A 3ANNA 1T2DA 1GUFA 2GGSA 1Y1PA 4CR8A 5IG2A 3IKVA 1EVIA 3DZKA 1LI4A 4CLOA 3ZHZA 3L4BA 3FR7A 4HBGA 4IBOA 4RF5A 5DDIP 4XRGA 5ER6A 1G6KA 4UVEA 1YH3A 5AVOA 4CM3A 2FHSA 3RBXA 1W8DA 3H9QA 3OIGA 1E5QA 1P1IA 3RUDA 3HWRA 2P9CA 3UXYA 1UDBA 5T57A 4YTEA 3CUKA 4WOJA 2HMWA 2Y68A 3JQ7B 4P8RA 1SPXA 2WDZA 4LN1A 2UDPA 1C1XA 3KLPX 4QSMA 1BSVA 2BFPA 5EJ2A 1O6ZA 3QQPA 4GVLA 4NBUA 2B35A 4BO7A 4OO3A 3ZNPA 4P38A 4XA8A 1Y8QB 2ZTLA 3G1TA 3DDNA 3RU7A 1ZSNA 5JDIA 3V2GA 5L4LA 5ILOA 1ADFA 1E6UA 1I32A 3CEAA 2W2KB 4XYEA 4J16A 1DC3A 3GRKA 4PLTA 1C0IA 3WSWA 2AEMA 2WD8A 2EV9A 5LCXA 3F1KA 3L9WA 5JS6A 3WQQA 4RPGA 5ITWA 4CLHA 3PFFA 5DNAA 1PZHA 1E3WB 2YHUA 3SLKA 3DFUA 3M1LA 4GMGA 1C0PA 4HNGA 2Q2WA 2EXXA 4BNMA 4B3HA 2W4QA 1EVZA 1EFKA 4B8WA 1NR1A 4GI2A 4UUMA 3F47A 2RHRA 5G0VA 3KVOA 4QFDA 4YBZA 4EJMA 2X0NA 3ZWOA 2I9PA 2ZJ1A 3ZWCA 4HV4A 4LCJA 1IZ0A 3OEWA 4GX0A 1SB8A 3ETDA 1YJQA 1ZJZA 4R1SA 4BIIA 3MOGA 3B1JA 3C24A 3CE6A 1NR7A 1N92A 3FWZA 3OA0A 4OXNA 3W4IA 1YONA 1IPFA 1H6CA 3CINA 1E3JA 1KVSA 1GZ4A 1NHGA 1N5DA 4YB8A 4J49A 4FBGA 1IE3A 4ZQFA 3VTFA 4B4OA 1LQUA 4WK6A 5KIAA 4PG8A 2W90A 4WJZA 4RPLA 4M89A 2CY0A 4PLWA 4KQWA 2ZB7A 4IMRA 1NFRA 2X9NA 1HDOA 1EVYA 4L0QA 5JAZA 1DFIA 4QO8A 3CMMA 2RCYA 3IAHA 1D3AA 2JCXA 4I5FA 3PYXA 4NG5A 1SEPA 1EE2A 3HNPA 4CMAA 3GFBA 3MJ4A 1WAMA 5THQA 4BO3A 1X15A 1T2EA 1PIWA 4RZIA 3RCBA 3ROPA 5T8KC 3TWOA 3V1YA 1DBVO 1NPTO 2Y99A 1U8XX 4BO8A 2PGJA 5DN9A 3D1LA 3WS7A 1XIVA 2Y0DA 3G0OA 1ZSYA 3V8BA 3ANMA 4D3SA 1Q1NA 1RM3A 4BKOA 4E6PA 4DRYA 4U6QA 5FWNA 3PZBA 5CEEA 4YVFA 1E7YA 4IDDA 1I3KA 3C85A 3AM4A 1RM0A 2AE2A 3PGJA 5B4TA 3AI1A 3ZWXA 4RV9A 4JN6B 3MJSA 3P19A 4XGKA 1M66A 4TZKA 4K6FA 4ZA2A 1EZ4A 2X5JO 3O4RA 4BVAA 1E1KA 1HE2A 2O7SA 5HRUA 3Q1LA 2PY6A 1PGNA 4IZIA 5L3ZA 2J5KA 3MJCA 4MVJI 2ZCVA 3AU8A 4L4RA 1HTBA 4YJHA 3G49A 4U0KA 3GPIA 4IZHA 4RORA 4J4HA 3LVFO 4JNKA 1KETA 1OC4A 3F4BA 1PJCA 3DAPA 5T64A 4CPDA 5JDCA 3I9KA 4WE3A 4Y8VA 2X86A 4E21A 2Q46A 1IB6A 1LU9A 2UAGA 1G0OA 3GVPA 4RVFA 3N74A 4F3YA 4YRAA 4BGEA 2R00A 2GCGA 1L7EA 2FR0A 1PZFA 1A7KA 2HRBA 1VL0A 1P1KA 1F14A 3ZU4A 4CM7A 4R51A 2GD1O 1PGQA 2JAHA 3EAGA 3RJ9A 1HSOA 3G1UA 3W8FA 6ADHA 2JCYA 2GDZA 2WMDA 1ADCA 2RHCA 4WLVA 1LDEA 3HE3A 3SJUA 4II3A 4YQZA 5A9TA 2ET6A 2GZ3A 3AM5A 4KZPA 4AJLA 2IRWA 1FF9A 3UCFA 2HO5A 5BSHA 3QWFA 4J9VA 3E9NA 4LSMA 2DBRA 5JE8A 3B1KA 3E5MA 4R5HA 4TROA 1LDGA 1AHIA 4YAIA 4IDCA 5F1PA 3I6QA 3AW9A 4JROA 1Y8RA 2TMDA 3VPGA 1HYHA 1FMCA 2VRBA 5FI3A 4CV1A 3OJLA 4WEQA 1YQDA 1Y81A 4F6LA 5KJCA 1T2FA 3WGHA 1B8PA 3PP8A 5TX7A 3OM9A 5L9AA 2DFVA 3MTJA 4Z9YA 5U9CA 1TEHA 3TFOA 4EEXA 4HFMA 5ICSA 1K89A 3AI2A 1FDVA 4Q3EA 1TVEA 2P4QA 5FI5A 3H9EO 1KVRA 4G65A 1WPQA 1OOEA 3TOZA 4XQEA 1FDSA 4OH1A 1ZJYA 3IOYA 3I52A 5EMHA 4HFJA 3EW7A 3GMDA 5I7EA 4N7RA 2PA3A 2WD7A 4W9NA 3H6KA 4XIJA 5DP1A 3ROKA 1VLLA 4CR6A 5A3VA 3JD0A 3COSA 4LGVA 4YA6A 3F5SA 3QVSA 4G81A 4FFPA 4XKJA 4IIUA 2CMDA 4BNXA 4WKGA 3GUCA 3BZUA 2Z5LA 3V2UA 3TPCA 3FSRA 4B4UA 2DBVO 3UN1A 4DUPA 1SCUA 5LDHA 4OYRA 4CMCA 4IDBA 4B8ZA 3RKUA 5KJEA 2E37A 4MKZA 3QE3A 1HDXA 5MDHA 4DPKA 3WG9A 4L9RA 1X7DA 3GN1A 4MP3A 4IDGA 4S1VA 3ZU2A 5ER9A 1U7TA 3W4KA 2EJVA 3GT0A 1XSEA 4J1SA 1EQUA 3HSKA 5F1OA 4BNNA 2SCUA 2C29D 4BO1A 4IQ0A 3WBFA 4PRLA 1C0LA 2D5CA 2FSVA 1OZAA 5EIOA 4H15A 4NBVA 4O59O 1BRMA 1AXEA 8ADHA 4A2CA 4YRBA 1QORA 2WE8A 4AJ2A 5JMPA 3ASVA 5KNLA 3IL2A 5IXYA 3E8XA 2DLDA 3DR3A 1B0AA 1CDOA 4IJKA 1CRWG 2VWHA 2JHFA 3BTOA 2H6EA 3ITKA 1I2BA 1LSJA 1ZKMA 3PVZA 3KYCA 3DO5A 4XYLA 4B7UA 2VWGA 1YDEA 2UUOA 3ZWMA 1E3LA 3K8ZA 4RDHA 1Q0QA 3DBVO 4CMIA 2XF8A 5B37A 1QKIA 4J1TA 4B7CA 4D44A 5DF1A 4ZHSA 2B4QA 4CLRB 3AOGA 3AJRA 4J7UA 5KCZA 1E7SA 5JCJD 2VTEA 2VRCA 3GR6A 1GYPA 4NI5A 4MP6A 1X7HA 3CPSA 1DJQA 1LLDA 3KB6A 1EUZA 4Q3BA 3H2ZA 4FFRA 4O0LA 4UUOA 5DOVA 5JPIA 1EDZA 4RDIA 1DC4A 2P2SA 3BIOA 4U8GA 2CVOA 1BXKA 3ZV3A 3D4PA 3GA0A 4CV3A 3CXRA 2Y1CA 1MA0A 3I6IA 3KEOA 5AXBA 2IEBA 3RFVA 1B2LA 1N7GA 1SZJG 2W2LD 1QYWA 3ZZNA 1I24A 3PJEA 3OHSX 4NK5A 4OKNA 3VKUA 3OEYA 3RQSA 3A1NA 2ZTUA 2VZ9A 1N2SA 5EERA 1XQ6A 4RVGA 5A1TA 4E5PA 3WDSA 4A73A 2Q99A 1KY4A 3DOJA 4R1NA 1LC0A 1YL7A 1DC5A 1KEWA 3EHEA 1VJTA 4GGPA 1Z6ZA 3C1OA 3JYPA 3EVTA 1YS4A 2VNSA 2DM6A 1LLUA 5TJ9A 2C20A 1VL6A 5ADHA 1E1MA 1F17A 3E6AA 3HDJA 3KUXA 3V1UA 2NQTA 1ZK3A 1DJNA 2VOJA 3VZPA 2NVUA 1Y9EA 4XRRA 4DBZA 2O50A 3KM0A 3ZNOA 1MXHA 2I3AA 4YAGA 3VOSA 1I33A 4MIYA 5TQVA 4YJGA 1R0LA 4WLFA 1PGOA 1W6UA 1WZIA 1O0SA 5B4VA 3GNQA 2HRZA 4UEOA 2BI8A 4R3NA 4ZGWA 2H9IA 4YJHB 5I8WA 1IZ9A 1I3NA 4EEZA 3RIHA 4PLVA 3AOEA 3VH1A 2O7QA 3RWBA 3DBRB 2DU8A 1PTJA 2YV1A 4UVDA 1VSVA 5EQDA 4AJHA 4PG6A 3CKYA 5DBIA 4IXWA 1JU9A 5FFFA 4E5YA 1I3LA 3DTYA 1TXGA 3G79A 3GMSA 3KTDA 3NDRA 4DGSA 3WICA 3VDQA 1PX0A 3BTVA 1HEUA 2CDCA 1AE1A 5I7FA 2G0TA 2Y1GA 3E03A 1BTOA 4E33A 5T6BA 3INTA 3PIIA 3F3SA 3QA9A 3BMCB 1T25A 4E3ZA 3ZNQA 2BH9A 4K26A 1V9LA 4YAEA 2ZB8A 3TF5A 2ZK7A 4D3DA 1DRVA 2FRDA 2O3UA 3QVXA 3JQBC 5DT9A 3Q2IA 1P9LA 3GG2A 4E2WA 2O3TA 4DTIA 2Q45A 3JQBA 3DZJA 2NACA 3FBGA 5A5FA 1BVRA 4J2HA 3LT2A 1HL3A 4HKTA 3CIFA 3V2HA 5JW6A 3HADA 3D3WA 3ZHYA 4YWJA 4D0RA 3LT0A 2UV8A 2GPTA 1I2CA 3C3XA 1V3VA 1HF3A 3PHJA 4L76A 2DBQA 1GQ2A 4PLGA 4BO4A 5L40A 3S2EA 1HLPA 4TRNA 3LC7O 1U7HA 3C7CB 4QO7A 2W2KA 4ALMA 1DRUA 1R4MB 1DC6A 4CLDA 4I9HA 4ALIA 4CLEA 3DC2A 3ICCA 1KC3A 3JQ9A 4AJPA 1XQ1A 1AHHA 3DHYA 2YQ5A 4ND1A 3RROA 5L7TA 3L9XA 3RASA 4JBGA 3INGA 1U28A 4Q3DA 4U7WA 4CMKA 3RVDA 1CQJA 2VCYA 3IP1A 1LNQA 4KUEA 1Q7CA 3A4VA 4DWVA 3WQRA 1QG6A 2GASA 3AUUA 4IS2A 2FP4A 5B1YA 2NUAA 4BO0A 4OIMA 1NVTA 5EL0A 3WQSB 5JSFA 4DIOA 1K6JA 3WYBA 2V6MA 4MVJF 4RVHA 1NASA 3MWEB 4BKPA 5BNTA 1YQXA 1JKJA 2YQ4A 3K2BA 1CEQA 4MJLA 1F12A 9LDBA 4BO6A 2CVQA 3GAFA 1PL8A 3LC2O 2GN6A 4IY1A 5GY7A 3FTPA 3SC4A 4CJXA 1PWXA 5MGBA 1SB9A 1P0CA 2HUNA 4KQXA 1Y5RA 4KMSA 1QYDA 2BF7A 4R41A 5GZ3A 4IIVA 4D7AA 1MX3A 1O95A 4Y6RA 4PRKA 2OO5A 4NQZA 4DQVA 3UW3A 1QV6A 2EKQA 1AXGA 1NQTA 2OXIA 4J3FA 3E9MA 5G0TA 5IDQA 1JAXA 4TKMA 4R16A 2DVMA 1KY5A 1MC4A 1ONNA 1F8FA 3GRPA 4PG7A 5DZSA 4UAGA 3JQ8A 2HKIA 3PFWO 3MJTA 2HMTA 3HFGA 3CSDA 4MVJM 5TIIA 1A72A 3K2EA 2YZ7A 1UXIA 4EITA 1GUZA 3FHLA 2J5QA 2V6GA 1EDOA 1E1LA 2AG5A 2X0JA 1CWUA 3QP9A 4R4JA 1JA9A 1I5RA 1G1AA 1WW8A 1NAIA 5JYDA 2B69A 1BGVA 2GZ1A 1PJTA 3CZRA 3ZU3A 1YBVA 3QVWA 5IFLA 2C0CA 3FF4A 4CLXA 1JWBB 4MOWA 1GCUA 3GHYA 1ONPA 5CPBA 5HTOA 2POQX 4MVJP 3AUAA 4GH5A 1EK5A 3IS3A 1PWZA 4LCEA 3TL2A 1IHXA 4PLCA 1PSDA 4G2NA 4L4SA 2HAEA 3GDOA 4KUHA 3EYWA 1ZCJA 1HE4A 5H83A 1MC5A 2A94A 1NVMB 3AOEC 3IUSA 4ALKA 1U2GA 2DBZA 1ISMA 4YJFB 1NX6A 1EQ2A 3JYQA 3Q11A 3OSUA 2OBNA 3ZU5A 4EUFA 3ADOA 4FCCA 3GN2A 2Y1EA 5JAQA 1QP8A 4IUYA 1M76A 5A9SB 3NDJA 1E77A 5IN4A 2H63A 1WDMA 1YVEI 3PLNA 4D3FA 3P2YA 2X5KO 2NVBA 4JLWA 3INRA 4J7XA 2ZQZA 2ZB4A 3WYCA 1GQQA 2IZ1A 2WM3A 2J3KA 2DAPA 2QYTA 4J4TA 2AQIA 1T2AA 4XYMA 2YV3A 2ZJ0A 5TLSA 4BGVA 2GUGA 1LA2A 2Y1OA 3K73O 4HADA 5TF4A 4ZQGA 3ZHBA 1C1DB 3U0BA 1T26A 3NKLA 2I5PO 4AJEA 1NWHA 1NQOA 4B4WA 4CM9D 2R00C 1OBFO 1UDCA 4W7IA 4ITUA 5CPFA 2JFGA 3KYDA 4RZHA 2I99A 3PEFA 4ZVVA 4BNLA 2DTXA 2CVZA 2PZKA 2Q49A 2AMFA 1F8GA 1ZMTA 4CV0A 3GH3A 3KZVA 4QFCA 4P4NA 1ARZA 2Y1DA 1ML3A 1EK6A 3E5RA 3OQBA 1GEGA 1R0KA 3A06A 2UUPA 2PFGA 3UFXA 1B14A 1T24A 2Q3EA 2P9GA 3CMCO 1VSUA 2PKRA 4CMBA 2DUUA 4AJKA 2PZJA 5A05A 2NWQA 1ZEMA 3WMWA 3OFSA 3E1KA 1TLTA 3MJEA 1LDBA 3PHLA 5U1PA 4CMJA 1ONOA 2GSDA 2EG9A 1Y7TA 2WYVA 4RLSA 1C1XB 3I9NA 5TRTA 3TFQA 3GF4A 1LXCA 2D8AA 4UUNA 2FOIA 2VYND 4EJ6A 1TI7A 4NBWA 5A02A 5HWSA 3M1AA 4HFNA 5A9SA 1E6EA 3R3SA 4N5NA 3ZV4A 2VOEA 2FZWA 3BXXA 2JFHA 3DBLB 1KVQA 3AY3A 4J91A 3WWZA 4NIMA 1X1EA 2E4AA 3MOIA 4P22A 3ZWBA 2BHLA 3IMFA 4FB5A 4RLHA 3DMYA 2VWPA 2NNLD 1HWYA 1K6IA 2NQ8A 4E2YA 4LRSB 1ID1A 1ZK2A 4Z0HO 3CZMA 1NAHA 1E1NA 1VKNA 3C1AA 5IXSA 5CDUA 3FNHA 3PYLA 4PLHA 4EDFA 1UXKA 3TRIA 2PWZA 4D41A 2PZMA 1J4AA 1VE9A 5HS6A 3ZI0A 4OMUA 4DLBA 2X9VA 3JYNA 5DBGA 5F5NA 4AJIA 3NTOA 1NTOA 4PLPA 4RQTA 1VJ1A 3RBVA 4GWKA 4W7HA 3PHGA 3C7AA 5HS4A 4IDFA 5ICMA 3JQAB 1BHSA 1PJQA 1HLDA 4HXYA 3FN4A 3DL2A 1YXMA 4PLZA 1YE3A 3Q0EA 4CV2A 1E92A 2O48X 2IYOA 1EFLA 4NDNE 5K0ZA 3HHPA 1KS9A 3QV1A 4BNHA 2FR8A 3H3JA 5CG1A 1A71A 3B20A 2C07A 3I9JA 2BD0A 4NFSA 3JCZA 4GMFA 4CL3A 4NJOA 4XDYA 5FF9A 1O5IA 2WYUA 3H9GA 3OJFA 2O3RA 2QRLA 4GX2A 3WJ7A 3NT2A 2NU9A 2XXJA 5AYVA 1P31A 5CEFA 3IC5A 3TZCA 1V6AA 1C0KA 1ENYA 4RVSA 2ZKLA 1C3VA 1U9JA 1Q2XA 5A4DA 2AQKA 4FDAA 4AJ4A 4FJ1A 4NHEA 3WLFA 1ISJA 2NLOA 1CJCA 2ZIZA 3OQ6A 3ZV6A 5I9MA 1Z7EA 3H2SA 1YWGO 4NNJA 5F5LA 1R16A 1VL8A 2X0RA 1ZUD1 2YDYA 3DBLA 1H94A 3E82A 2CD9A 1E7QA 4BNFA 1A4IA 4I1IA 3WMXA 2VZ0A 1FDUA 4I9UA 3VC7A 2XOXA 4MINA 4QT0A 2YHIA 2ZB3A 3HDYA 3TDKA 2UVDA 3WNQA 1PL7A 1E3IA 4E5NA 2HK9A 1B8VA 1WLYA 2QZZA 3MCVA 3KV3O 4QUKA 5COQA 4W6ZA 3CH6A 2NV6A 1FK8A 3AFMA 2ZCUA 1D7OA 3AUTA 3PK0A 4BGUA 1K5HA 5DULA 2YHIB 2P4HX 1DDOA 1JWAB 1Z74A 1XR3A 1U3VA 2Q4EA 2G1UA 5DCUA 3RFXA 3SJ7A 5K6AA 4ALJA 1ENOA 4YQYA 1A27A 1DIBA 1P77A 5C5IA 4UULA 1BWSA 2HLPA 3EUWA 4W9NC 5JCJA 1MG5A 5GZ6A 2E48A 3ENKA 4J43A 2RIRA 3NV9A 4XJSA 2E82A 4MVJA 5IN5A 4CQLA 4ND4A 5I7VA 5JMWA 4WPGA 4LK3A 4Y9DA 2NU7A 4HP8A 5GMOA 3JSAA 3W8EA 1FDWA 4ZJUA 3FR8A 5IZCC 1GPDG 2X5OA 3B70A 1LEHA 1NNUA 3GVXA 3N7UA 4U5QA 4ZICA 4TWRA 1O8CA 1GR0A 3IJPA 5TC4A 1DFHA 2AW5A 4HX5A 4JJGA 1LBEA 3FBTA 3FRJA 5CFZA 3SVTA 1DIAA 2C5EA 5T5QA 2JD2A 1GTMA 3D5TA 2P68A 2HK7A 4LW8A 4PG5A 3NT4A 4F45A 7ADHA 5F3RA 1V35A 5H82A 3T4XA 5T8KA 5TJHA 5AXDA 3GZNA 3N58A 5JNLA 3EMKA 2YFHA 3VHRA 4J0FA 2Q2QA 3ZNNA 3AFNA 3DB2A 2F00A 2YW9A 1HDRA 1XA0A 5KKCA 4MIOA 3PHIA 5KOIA 3OA2A 3VDRA 1E7MA 3EY4A 3WGQA 3A28A 1U5CA 3QWAA 3WGTA 3ORFA 1P74A 4WASA 3T7CA 5I9LA 5DCYA 1A9ZA 4K6CA 4FJ0A 1I2ZA 4LRTB 4XJTA 1MFZA 4PVCA 2AQHA 1X0VA 3P5SA 3KYBA 2TMGA 1R4NA 3UOGA 2OHXA 1RYDA 1W73A 5IDXA 1O9BA 1UAGA 3LSYA 4KTTE 2GYYA 3SLGA 4R69A 4ZQHA 4XWYA 2ZYAA 4QEDA 4EYEA 4Z3DA 5IZCA 3VVBA 4BB6A 2VTDA 2GRAA 1ZEJA 3WX0A 1BVUA 4MVJD 4OOFA 3GVIA 3H5NA 3SBOA 2ZYGA 1GYRA 4DIFA 1PR3A 1PJ3A 2P9EA 4CM4B 1YBMA 3KBOA 5DCWA 2BMAA 4N18A 5BR7A 3WGIA 1I0ZA 2GN8A 2PH3A 2WE7A 3GUYA 3OECA 1YO6A 2VN8A 4GAEA 3PYMA 3SXPA 1SNYA 2OBYA 1JAYA 4N54A 4XGIA 5CDTA 2Y05A 1PJSA 3AK4A 3PTZA 4K28A 5HBRA 1YQGA 3GVCA 2O23A 4JIGA 4CMEA 1RPNA 1R4MA 2I65A 3I23A 3R1IA 4ILKA 5K6AC 3K6JA 3FPLA 5KVQA 1Q0LA 4BOYA 2AEFA 4HFRA 2G17A 4XDZA 2V6BA 1E3EA 3OMLA 1F0YA 1LRLA 1GADO 3VZSA 3L0DA 3U4CA 3GDFA 3RUIA 3VTZA 3EVNA 2I67A 3JD4A 1V3UA 2F1KA 5TS3A 1SC6A 3RUCA 1B26A 3DXFA 2J5RA 1HSZA 2HK8A 2IXAA 3GZNB 2GNAA 2J3JA 5C37A 2PV7A 2QG4A 8LDHA 1ZO8A 4R9SA 4GX5A 3GPDG 5KKAA 2NVWA 1B7GO 1C1DA 1H5QA 4YT5A 3KSDO 3GNSA 3BMCA 4IGFA 2WWRA 4Z0TA 4EUEA 3OH8A 1D1TA 1DHTA 3FNGA 3U4DA 1DAOA 2E6UX 3PWKA 4FC7A 4BNWA 1KVUA 1LUAA 1UDAA 1HZZA 3D4OA 4I5DA 3NJ8A 4Q9NA 2OP1A 3DZFA 5CHEA 4DVJA 1IULA 3VPHA 5JAIA 1LSUA 4BNKA 4XYBA 3V1TC 2RBEA 3JQ6A 1HDCA 1UP4A 4IPTA 4PZEA 5I9NA 4GX1A 4R1TA 2BFAA 3QIVA 5B4UA 2OOSA 5KWEA 2IYPA 4CQLB 1YDWA 3DMTC 5G0UA 1U3WA 1H9BA 1XG5A 1GUYA 4J9UE 3D3WB 3JD3A 2IZZA 4Y6PA 4UEKA 3JQAD 4TQGA 3DONA 4BNYA 2O2YA 4FSHA 3ONFA 3S1LA 4WUVA 1HYEA 3UCEA 4AJNA 1LSSA 3VVCA 1SAYA 5J23A 5BSGA 4FIZA 1RM5A 1GFSA 2NVUB 4D0SA 3WR5A 4NMHA 1CETA 3ONEA 2ZTMA 2EF1A 1MGOA 5FYDA 4BUCA 3WJAA 5THKA 4DC1A 4FOOA 5H81A 3ON5A 3DHEA 2B4TO 4NBRA 4GBJA 4MPDA 4RCVA 3PDUA 4EI2A 3PDJA 1FDTA 1CF2O 1N1EA 1J5PA 3GC6A 1ENZA 1IOLA 5JCXA 3U9LA 3UKOA 1R66A 3K30A 3GGPA 5KTKA 1P33A 3VZQA 1U8FO 3K5PA 4MKRA 1I3MA 3PQEA 2VYVD 3JQ8B 1CQIA 3PRJA 4U0JA 1SEVA 3C7DB 1PL6A 3GVHA 1LLQA 1NP3A 1ISIA 1IUKA 3DFZA 4BB5A 2P91A 5EQFA 4A7PA 1LQTA 2EP5A 2EKPA 4WLEA 3ZWVA 4L74A 1NWCA 2GN9A 1Q7GA 3ZN2A 3SEFA 1KOLA 3BHMA 2AXQA 2JL1A 3K96A 4KTVE 3GHHA 2EGHA 4LVUA 1V8BA 1Y5MA 4IJVA 1T4BA 1P44A 2D0IA 3IIEA 4WEOA 1WWKA 4OOEA 4RF3A 1B8UA 4OXKA 3U62A 2XXBA 1IL0A 1GEEA 2D2IA 1EVJA 4BNJA 2QX7A 1EBUA 3QSGA 3OBBA 3HUDA 3RFTA 3WFIA 4ZU3A 4ESOA 4GPD1 4LISA 3R0IA 4JXKA 1HE5A 1BXZA 1G0NA 1H9AA 4WNIA 1EUDA 1HE3A 2LDXA 3F5QA 5CEJA 1E5LA 4PGFA 3WTBA 5KVCA 4XB1A 3TJRA 4XCVA 4JBIA 5IF3A 3JQCA 2P5YA 4R3WA 3A9WA 1ORRA 1P0FA 3D5QA 4NR0A 2I76A 3NYWA 4DYDA 3IUPA 3FD8A 1HRDA 3HDQA 4K1LA 4DXHA 3RUEA 1DXYA 1WP4A 4FOSA 4A5OA 4JP2A 4II2A 1Z45A 5G4KB 2RAFA 4TKLA 2Z1MA 2D3TA 2GF2A 3RJ5A 3AM3A 4FFNA 4LMRA 3TNLA 2XPCA 4B7XA 4L73A 1YB1A 1NVGA 3Q9UA 1B3BA 1YBAA
chains in the Genus database with same CATH superfamily
5ERYA 5C1IA 1NLZA 4NPCA 5HM6A 3F8SA 3ADBA 3R6GA 3ZOZA 3NW9A 5J4VA 3E70C 3GGDA 3WRWA 4MGYR 3AC0A 4S3MA 3LDFA 4A0GA 1H3NA 1OASA 2OZVA 2ETXA 1P2FA 2XKBA 3IVXA 5CP8A 1DO2A 2WT9A 1IN6A 3RAEC 1XPJA 4MKGA 1UC4B 2PYDA 2YMLA 3ABZA 3EOZA 5FUYA 1SXJA 3WADA 5JI3E 1HPLA 3WYGA 2O4CA 2OV2A 1ZBQA 1P2VA 3EY9A 3GAZA 5MFZA 2WWYA 2ZJ4A 3MCTA 2YYYA 1TMYA 1SU4A 2G3YA 2W6OA 1E3SA 1X3LA 1EWKA 2X9QA 3PUIA 2GCOB 3IDSA 4B9EA 5DWVA 3UXMA 3LT4A 1HT0A 2EF0A 3LUKA 4RA6A 4EATA 2PYIA 2Z3VA 3DOOA 3SI7A 4C0HA 1V5IA 2FG6C 4YMHA 4KXWA 2YXNA 1PUXA 2VNAA 4OKIA 2Y93A 3RHSA 3EIEA 4NG4A 1QHNA 3PRKE 2WFMA 3TIVA 4P4SB 4IIDA 4Z9AA 3IT3A 5AXCA 4V0NA 2K5UA 3F6RA 4BQSA 3EAFA 4UCWA 5A5EA 4BMVA 4RK1A 5G2OA 1K7EB 3CF6R 3PF9A 2QY6A 1BEUB 1M6WA 1PJRA 4I2NA 5PNTA 1QHIA 1JW9B 2R25B 1N5OX 3L02A 1NHWA 2WJVA 2OV4A 3LDHA 3LP8A 4QIHA 3HKCB 5CNMA 4EPWA 1EUCA 1WXDA 1P1HA 2LR0A 2ENUA 3OLCX 3SZRA 4XEUA 2OZPA 3D64A 3CV3A 5KI6A 3O0DA 3EGEA 4JITA 4K0RA 4O8CA 1Z34A 3H2KA 1RJDA 3N53A 3SNKA 3T7IA 4D9JA 3X1ZA 3IQXA 1CS0A 5H5JA 4XSGA 3QLJA 4ZYYA 3TI9A 4MEBA 4IHJF 2OCPA 5CLQA 4EHFA 1Z83A 4ASUD 2G0NA 3BMQB 2PCLA 3DZCA 3K09C 4PLFA 4YASA 3QG1A 3TZHA 1SELA 1J8MF 1M2VA 2WJIA 4HWKA 4OV6B 3ZKWA 3EPJA 3OP4A 2ZPUA 4WI1A 5TPZA 4URFA 5FO0A 5D3MB 3LX6A 4DRXB 2HT6A 1FJ2A 1JQDA 4H1WA 1NUPA 4PWYA 1NF9A 1TZKA 4PAGA 2JIOA 4J76A 2IE0A 4TTPA 4WZ6A 3E7WA 5JHGB 1R0YA 3DW1X 4YJ3A 8ATCA 3Q6MA 4KH0A 1L5NA 2G04A 4I9NA 2V45A 4Q93A 1DADA 4CBVA 4JT9A 4QPPA 4CMHA 3GWGA 4PHHA 5HQ3A 1ISFA 2A1UA 4UAVA 2X8JB 1KY3A 4KR6A 4P33A 3HQ4O 4FYXA 2MYTA 3IVGA 4FS8A 1N3IA 1M2NA 2I80A 3I2FA 4A27A 2NYUA 1P1JA 1QSGA 4QWWA 1KH3A 1KY2A 4Q7QA 3OF2A 2IF2A 1B43A 1Z82A 4PO3X 4NZZA 2N75A 1IYZA 4IQ8A 4PSCA 3U39A 2BE9A 4WAUA 3RVLA 3VPSA 1AQNA 4DEYA 1P7ZA 6AT1A 2QF7A 4W5RA 2A2ZA 5IM4A 3N9IA 1NI5A 5BNFA 4BP1A 3NHPA 3QEMB 2C9CA 3TNFA 3REGA 3ZUGA 1WJGA 4U7TB 3P9QA 2XVZA 5C8YA 3R7DA 1JBEA 3ELWA 1ORTA 1T4DA 2OCXA 1JX6A 4OI1A 3UCXA 1W85B 3FNRA 2VXCA 3LXRA 3ZD6A 3UF0A 3CNLA 3PLRA 2SKDA 4GR4A 2D06A 2DEUA 2CBXA 2A86A 3DXYA 5BSKA 1GN8A 5K8UA 2RE8A 3V2IA 3LUDA 2FUKA 3C45A 3MJHA 1RLOA 4EB3A 2R9VA 2OGSA 1TJ4A 4TMZA 3ZWPA 4I5GA 2VHVA 1SN7A 2WLTA 1RPJA 1PU2A 1FJHA 2BW0A 2PNFA 1C7FA 3IFSA 2Z8ZA 1NURA 1RQPA 1SCIA 2FEAA 4HPXB 4FKBA 4WGGA 5CNKA 1HGXA 4EY7A 1I9CA 1NXOA 2ZM5A 3GQVA 4CG1A 3H83A 2Q9AA 5HG0A 5KJ6A 5J5AA 3FGZA 4WCFB 2BJWA 5L95A 3RBZA 1O03A 5HOEA 4NEGA 1GZ6A 3QY9A 1DAMA 2RH8A 2B83A 2VF5X 3PQDA 2GUWA 4EO9A 1N3YA 1U7DA 5H9VA 5CXUA 2F3UA 2Q7XA 2ZRQA 1JLKA 4ZU1X 4Y18A 1DIRA 2BMVA 5C1PA 5TQ0B 3ZJ4A 4HUTA 1KBZA 5I48A 3KQKA 2VHXA 1BVYF 4AQDA 1NL3A 3A6PC 2BKAA 1VYUA 1J6UA 1BHJA 1M1YB 1TAQA 2C4WA 2CMHA 4B3MB 4HPWA 4AZ3B 3PHHA 2J0UB 1ZR4A 2QQFA 3AW8A 4HRAA 2Y0PA 5J4LA 2F8SA 1RP1A 4B87A 3ADPA 1A2KC 1QAMA 1VLHA 3TBKA 1KDVA 4PN7A 1EBFA 3BIFA 1YZTA 1O6FA 4HSEA 4O2BB 3WGZA 2ONJA 1DOHA 4HEHA 1EUQA 3AWDA 4XUCA 1PFVA 1KNXA 1HZJA 1Y33E 2F67A 2Y66A 1N0WA 4MKHA 5TVKA 4CTJA 3EIHA 1IUNA 2Y2UA 1YJAA 2RGCA 3FBWA 4A8JB 1XUOA 3FPGA 3DHNA 2HY7A 3UVEA 3TIFA 1IWBB 1Z6PA 2R44A 5JH7A 1GHTA 3PVCA 5TE9A 1QAOA 1Z0IA 1U98A 2YHAA 1OF1A 1ZSVA 4BNGA 2QVBA 3O2QB 1QUFA 3R77A 1XMJA 3URMA 5E8JA 5AW8A 4XIGS 2WYIA 1A3CA 5LLSA 3HCDA 4E4YA 2GCEA 2V5UA 1RJ9A 2CLCX 3AUJB 3OJWA 3UWDA 3PZRA 4WXRA 4D9GA 1KFEB 4R2KA 4FGWA 5A9RA 2PLFA 3MUEA 1TM2A 2HL6A 1FRFS 1P0MA 7MDHA 1FUUA 2QX6A 3E22B 4XEHA 5AKEA 1OX4A 2OD7A 1Y3AA 1UC9A 2PUJA 1KSGA 4D45A 1SQ0A 5JTTA 1DC8A 1KZGB 3PUJA 3AQ4A 4O6VA 2OHHA 3RTEA 3WYEA 3CY6A 3NNDA 3E18A 4RY8A 4CYMA 4DA0A 4DLPA 3ND6A 3NP7A 4U4AA 1WXHA 2PX5A 3IVCA 2Q1TA 2A9PA 1ZUIA 3OLWA 3C14C 3R23A 1E98A 3VO9A 5BSVA 1ESZA 1AUPA 2WHPA 4JX9A 3DDHA 4DMGA 5GM1A 1YRQA 3WHLA 1ZAKA 2EERA 3T3PB 5A2QA 1GTVA 4NU5A 4JLOA 3PJDA 5HJEA 2JBWA 5LU9A 4KO8A 1HETA 1HLFA 1RADA 1G5HA 3IE1A 1U3UA 4EJ2A 3GGGA 2ZIAA 2C3MA 1V45E 5HCNA 2C8KA 1EFRA 5ABPA 5EJMA 3KL4A 4FC6A 5JI2E 2HU8A 3D0QA 3KSZO 3D6JA 4YV7A 3QFRA 3B48A 1NMZA 4PYOA 4WECA 1M1XB 3LA6A 4UU8A 3BWEA 4LTMA 3C4VA 2QQ5A 4RAQA 5JY1A 4LNUB 5LKRA 2ZYSA 1OXXK 1Q21A 2YYSA 3L7JA 4CR7A 5BR8B 4K3VA 1Q77A 3DL4A 3K0BA 4S2UA 5J2UF 5F1KA 1RSZA 3NZEA 3P7MA 3LQ2A 1U0OC 1A77A 4MEAA 4MW5A 5D7BA 5SICE 3EPLA 1VFPA 4OQPA 5AKZA 3UAGA 1OW3B 2PYZA 2XNKA 1SCDA 2Z1DA 3MRTA 3LK7A 4BKQA 3OQMA 4BB0A 4JA2A 2NUBA 4I1OA 4KVAA 4QGGA 2W6PA 1Y1KE 1TW2A 2BUCA 3O95A 3QKRB 3UMSA 3AIOA 4WESA 2I2CA 3VJKA 4GZLA 4JBNA 5HIIA 2FPKA 1JG6A 3MT0A 1WETA 3ZDCA 1UQTA 5K3DA 3CGWA 4Y2GA 4OHUA 2F1RA 2OLKA 3OEHD 4O08A 3DKVA 4O4HF 5D5QA 4RO0A 4IMPA 3ZDZB 5JS1A 2ZI3A 2HJ9A 4EDHA 2Y1FA 4W99A 1G1MA 4DMKA 3T3IA 2ARKA 4L27A 4XX0A 1MH9A 2WIJA 3GY0A 1V25A 4IHAA 3HGMA 4DJAA 2XD4A 2N1BA 4HGYA 4PTZA 1D4FA 1P3DA 1YT5A 2ONCA 2VJDA 2XT6A 3WGGA 4L5AA 3MEQA 3PIDA 5JHHB 3BIXA 2FMHA 4J1NA 4DZTA 1TCAA 5J5CA 1D9XA 1M83A 2EJCA 2WIDA 2QW8A 2FJPA 2OFFA 2ZBGA 1ZL0A 2PKQP 2VPWA 1H2HA 1YVPA 2HLHA 2B2CA 5DM0A 4NMWA 1RRKA 3G8DA 4F84A 1BEEA 1F1JA 2WTNA 1K3TA 5EINA 1EIWA 4UOEA 4EKYA 1B4DA 2CLDX 1P7YA 1QIIA 1TF5A 1BEZA 3GFRA 3HB9A 1T0UA 3T06B 4D9EA 1DJMA 1R5OA 1W5AA 2VJMB 3H65A 3ZBQA 1GG2A 1ADJA 3C8UA 4Z49A 5JXHA 6ABPA 4UM8B 3NALA 1KI6B 4LE2A 1E3QA 3S6JA 4O4HB 1CJMA 4A8TA 4J1QA 4R8KA 4JJFA 4OXYA 2NADA 3E9RA 4QDJA 5CHYA 5JISA 4IAOA 5FORA 1KK1A 1HZZC 1Z5PA 2AXEA 4RHTA 2JZCA 4BMNA 3CFYA 1TYEB 2ZVDA 3HKBB 2E18A 2IOYA 1QVWA 1B0PA 2A1UB 4OJNA 3ITDA 4Y2QA 2B0JA 2FPXA 3U4QB 1R10A 1WNFA 4D0GA 4MX8A 3GFPA 3SJBA 5CIYA 2O5EA 1L6RA 4TRJA 1PDWA 2ZCJA 4XW2A 3A6EA 3S0JA 2K7ZA 3C16C 1Q84A 3ZE7A 4ALNA 1QZXA 4ZKEA 4PQRA 1YB4A 2HLDD 3H87A 4OQYA 4RCYA 3T12A 4AMUA 2BI7A 2HMUA 5MN4A 3EZGA 2NT4A 1NVVQ 1PJLA 4HH1A 5CCXA 2WT4A 3O2SB 3NBXX 8MHTA 3D7NA 4DCVA 5EEHA 3PCXA 4X84A 4AS3A 1NVUQ 1UQUA 3O8QA 1FVFA 3QBTA 3I1JA 1CR2A 1PW5A 3KLNA 3NHMA 1U90A 3RRNA 1XLUA 3BMQA 1WU7A 4HR7A 4LRYA 1W0CA 2ZUTA 4MPPA 5CX4A 2WD7B 1D4AA 1CS0B 1VDZA 2I6GA 4OB8A 1EP3B 2P4EA 4RBNA 4OHBA 1SU6A 4IXTA 1VSBA 2QMZA 1R6DA 4V39A 1VYHA 3F4LA 1TU4A 4I6JA 5HBGA 3ST7A 4RLQA 3ORRA 5IVKA 2IEAA 2FUNB 4C2BA 5JSZA 3ILYA 5IDVA 2DR0A 1MEOA 2ZTVA 2P2GA 3RUAA 3ABQB 3L77A 4BNIA 3QFTA 2RGNA 1BU8A 2ZRJA 3D2CA 1YK0A 2P6UA 2B3TA 3L4BC 5SY6A 4HWSA 3UHAA 5HCUA 4M22A 1KK2A 4MQUA 3VPDA 1CY6A 1QLJA 2Q0QA 2CZGA 5BSTA 1MZPA 3NRBA 3LPNA 1FYXA 3B8HA 1QMGA 1FFHA 1GL3A 1N6RA 3AUFA 2HK6A 3C39A 4NLLA 3ZD9A 3QUCA 2OWDA 1O6BA 2K87A 3GQBB 3RSZA 4UTVA 1Z4OA 5FHQA 4QM6A 3OOSA 3S2ZA 1AKVA 1UMKA 1VJ5A 2BZSA 4XR9A 1UP6A 3E58A 4Q3OA 3U2QA 4P53A 2QZSA 1EHCA 1N9GB 2VDVE 4MH0R 2ZDQA 1TAGA 5KINB 3M9WA 3O4IA 4N7BA 1WNTA 4PRYA 4BLUA 1RDFA 2J3HA 1DLIA 3GFGA 1GRQA 2LV8A 3DTTA 4LJ5A 3WZ2A 4YMVA 1KEVA 3CUUA 2YS7A 5HUJA 3DVQX 1EUDB 3M2TA 4FFMA 4JQCA 4KACA 1WVGA 5ALWA 2Y0CA 3EFHA 4HMQA 3QVOA 1ZP6A 2PL5A 4E08A 5AK0A 3HLKA 3R5JA 5J2TB 1V16B 2BR3A 2NSJA 5ALHA 5GOZA 621PA 2OQIA 1Y80A 2FVXA 4N12A 4KP7A 5AM3A 1DKUA 1TKRA 1P7VA 3LAWA 4PZAA 2OHGA 3O4VA 1E6WA 1OA0A 2XNJA 5KHLB 3CX3A 2EEZA 5E9AA 3FOCA 4MLDA 3DOCA 1ULSA 3CH4B 3HLTA 1CUFA 1VLZA 1KK0A 1YQEA 3OZAA 2FPMA 4G8DA 9GPBA 4AO7A 2O8EB 2EKLA 1ZGBA 4MRSA 2F90A 1YF3A 3RRZA 4QNNA 3FI9A 4O5OA 1T5DX 1GOTA 1S01A 3ESCA 1UPUA 3FZNA 2J0VA 4Z1MA 3BILA 2ILTA 2CXHA 4HCJA 3NEYA 1LZLA 1P2DA 3I3OA 5ALZA 4QE3A 3LHSA 3HCBA 4U9IS 1I36A 1KKMA 1RAAA 3FYUC 2Q9UA 2RGNC 4H27A 4Q15A 4MO2A 3EGXB 3T4EA 3D6MA 2A5LA 3N6RA 4FR5A 1O58A 1TTPB 4U1RA 4UDNA 2GN4A 1YQUA 1G6OA 3GGSA 1MENA 4KCGA 3QKRA 4B84A 1FSPA 1JJAA 3JATA 4WERA 4UE6A 3KXLA 4Q9JA 1ZOOA 1WU8A 3U3MA 5DX0A 3TLYA 4EB6B 2DUWA 1ZN9A 5CCEA 3ZWWA 4E32A 1CJVC 2O0KA 1Q57A 1Z4JA 1T0HB 3I39X 3KKPA 4ISCA 4CLRA 5L51A 2R4TA 2O8DB 1R4ZA 5A3RA 5DLQC 3SE0A 1J7KA 5I7AA 2BP7A 2BFBA 3DV0B 1BC5A 3EWAA 3HZZA 2WFLA 3WLNA 4IDEA 4G01B 4DV7B 3HXKA 3IR7A 1R4NB 3E9QA 4I1SA 4YUYA 4W82A 5BV7A 3FTQA 3R8CA 3H5OA 4TMFA 2ZTHA 4HQLA 1W5SA 3UT0A 4M8KA 3STTA 3HP7A 2O3QA 4MDHA 5JJCA 1RLTA 2BGIA 1EH5A 2R7KA 2QRQA 3A1DA 4MRNA 3UGKA 5C31A 4YCNA 1S3GA 3UPUA 3H5RA 2EIHA 2J8ZA 1UINA 2O2SA 2PIAA 3DVAA 4AD8A 3VKVA 1GD1O 4LS3A 1PNQA 4BEWA 1C14A 2GEFA 4NYMQ 2JHAA 4QOHA 5L45A 4RKFA 1NXSA 1OC2A 1U2SA 1PKEA 2R8ZA 3K5WA 2AXNA 2FRXA 4PCVA 1R6XA 1P80A 3VR4H 2H2HA 3SS8A 4FFDA 4DEVA 1Z73A 2Q6IA 2Y1LA 4OX9Y 3C3KA 1RBQA 2I03A 2RKOA 3P0JA 4YRSA 1J2EA 4DR5B 2FW8A 1U63A 2WIKA 4P3XA 2VPZA 1X80B 3D7LA 3MTAA 4J4BA 2XHEA 3D4NA 3B6ZA 4I99A 3UJ3X 3W5IA 1ATZA 1ZK1A 2GHTA 5G0WA 3GDGA 3VR0A 1OLXA 3WSTA 4B75A 4FJ2A 4DBZA 4ZYZA 4ZD6A 2JJ1A 4F04A 5ELXA 4C4ZA 4AO8A 3Q3EA 3L0IB 1BQ4A 1OGIA 4AVYA 5DBFA 1E1YA 3HEBA 1A9TA 4B3DA 2DTEA 5HUHA 5GQSA 1TPZA 2WY2D 2OZLA 3M9XA 3DAGA 3P9XA 2WWFA 4CM5A 2IS2A 4EKEA 4X85A 4ZDWA 2EL7A 2PQ6A 3OIUA 2ECOA 3QRWA 2YJZA 1IONA 3U4MA 2I3GA 2A92A 5LR6A 3CM0A 3ODPA 3SBDA 2RKWA 3B1YA 1KZHA 3H9JA 1ZGJA 4B82A 3B12A 3SZ3A 1EMDA 3TW0A 4I8XA 4WZAB 4OJYA 7MHTA 2CFIA 1KYQA 4H16A 2FLWA 1KI7A 3HKEB 2CUKA 1REQB 1WMFA 3A58B 5DWQA 4JDPA 3FMGA 2C03A 4V0RA 4ZOLB 2R6AA 1JE0A 1GSAA 1J99A 2GPNA 1CP2A 1P60A 1VL2A 5BN4B 3VR5A 3M6IA 4OQNA 2IYFA 3WYFA 1G3QA 4BO5A 3A2KA 1ITZA 3TX6A 2VDJA 1O77A 2JEOA 1KA9H 3O4JA 1N6HA 4TV9A 2GZ2A 1QFZA 1JV2B 5G4KA 4D3XA 4JI0B 2A5YB 2BZGA 3GJ6A 3MCUA 1F3OA 1WW3A 1YS6A 3FCOA 5A62A 3NGXA 5GADl 3RJTA 4GNKA 3JYLA 2DFDA 4KB5A 1ESDA 3BFVA 1THMA 4NYIQ 3T6KA 4E03A 1Y7PA 5IU6A 1XXLA 2HPVA 1GTZA 1CEEA 2FRDC 5LA6F 1SBHA 4BV9A 3T7JA 1C2YA 4ILEA 1FC0A 2OK7A 2P65A 4OI0A 3WMEA 1SUPA 1B93A 1MXFA 4BQRA 1QGAA 2PKEA 3X1WA 4TL9A 3O8RA 4OYHA 2I7DA 4XPIA 1DHRA 2PH5A 5ICFA 3WB9A 3K92A 2YFQA 5IDYA 4AWXA 4RTJA 1W36C 3QKWA 2QT9A 3OIWA 2L0XA 3SM3A 5CLFA 1T0JB 4B3RB 1RMYA 2FPRA 1XQVA 3I3SR 2QXYA 3W34A 1XU9A 3EZLA 2ATVA 3Q7QA 4BX9A 3H7AA 1E3TA 1QLWA 3RI3A 3ZXIA 3QLUA 3E0QA 4Q7LA 3VR4A 3G2OA 2JFWA 5D5HA 4ECAA 2X9GA 3S2IA 3LCMA 4BEVA 1AZTA 3I9MA 5BV1A 1ZW6A 2ZE8A 4PX5A 4XWOA 4XR4A 2MU1A 5HFNA 3ICVA 5L53A 1R6AA 1QX3A 5F35A 3SPXA 5JVDA 1NBWB 4IUDS 4LDJA 4NJEB 2QNBA 3IMGA 4E70A 5EAIA 2QI9F 3C7TA 1G3IA 5FLEX 1V7CA 1T91A 2BIFA 2CBGA 2YUTA 2X0IA 5IASA 1N6LA 4G8JA 3RIYA 2DHEA 2WUVA 1NUSA 3QE4A 2O7RA 1X39A 5JD3A 1SUEA 2M2IA 3LUPA 4OA8A 4ZO8A 1DKNA 1UWLA 3BMNB 5ERGB 1LDNA 3CRNA 2YRWA 1KMQA 3EA0A 4RXTA 1XKXA 1USGA 2PS1A 3DFMA 3GGOA 3VZCA 3VSBA 4R54A 2UUCB 4I08A 1C7RA 2PPVA 2ZRKA 4KUGA 4QOIA 5HR5A 3I32A 2B36A 2IC5A 4M36A 1LX6A 2LIPA 2OORC 2X58A 4JCOA 4LJSA 4WOKA 4GIBA 1FPQA 4DR2B 4CKBA 1E96A 1I0IA 5KBYA 1EHIA 1UAYA 4LHEA 4Q1BA 3QU7A 2UYHA 3BWDD 1UF9A 2H7CA 1RM4A 3RFCA 2XCUA 1U81A 4DMLA 2E5LB 1ELOA 1JIIA 3DTVD 5IMBA 5B7NA 3PD7A 1YL6A 4DANA 5KQSA 2CV0A 3L07A 1IMOA 4ZQEA 1JHZA 1ZW1A 4MVCA 4N5DA 3DDZX 3L84A 4D4JA 3OKFA 2GAAA 4NFHA 3FHCB 5AIBA 1JDSA 1LJ8A 1PR5A 3P9NA 5D3MA 5LQKA 1JIKA 3D5EA 4B7ZA 5HA5A 3C7KA 2WTXA 1EK0A 3AVOA 2Q4BA 5HOQA 4RZQA 4OB6A 1XCPA 3TM5A 1S4MA 2F8MA 3LHKA 3QG5A 3VNBA 1GNLA 3NTVA 1I7QB 1A4RA 1Q1BA 1T5HX 4N7MA 4PYRA 4W1SA 4OP2A 4DLBA 1Y5NA 5KVSA 4QTZA 3O0TA 2OO3A 5C46F 1BJRE 4YROA 1G8MA 1P1RA 1RYEA 2HMVA 4BFLA 1QG0A 5FPPA 3TDNA 3ND8A 4UXIA 3W2FA 4JGIA 5CAEB 5IYZB 3CZAA 2V5VA 2OXRA 4RC9A 4DDTA 3F67A 3KQWA 3PRYA 5E9WA 2D8MA 1KMHA 3O26A 5LQCA 2M6RA 2UUAB 2PJUA 1KFBB 2JJYA 2ZBPA 1SGWA 1SMKA 2HLDA 2QYSA 3IQGX 3KUKA 5FFNA 1GV0A 3TKAA 4EBBA 1E1CA 1N77A 5EVJA 5KYUA 5FBVB 3UJ7A 3OIFA 3IAS6 4JVSB 1KJYA 1IK4A 1YOVA 3W2IA 1ZLYA 2WAOA 4ABYA 4BFXA 1K97A 1P2UA 4GLBA 5JT1A 4DQXA 3MYRA 3L5OA 2JZOA 1NNLA 3FNFA 3OY7A 1HTWA 2MIIA 3CLTC 4JEIA 2GM3A 1ORWA 2PR2A 1ZHFA 4KI7A 5REQB 2AJLI 1OGYA 3G17A 3DBOB 5T6MA 5FWAA 1OZ0A 3BHIA 2CFTA 1KJZA 5ILGA 3MWYW 1MH1A 4JLDA 4EIWA 2I2WA 1UC8A 2VDLB 5AI5A 3UWOA 2I3DA 5KNDD 4O4IB 3SFZA 3CR7A 2ZJAA 4ZP1A 2P9FA 2DTDA 3HY4A 1LI5A 5A0FA 1XV5A 5EA2A 4A0SA 2CLLB 1JXOA 2IV3A 2E5FA 3M0EA 1R5BA 1Y4DE 4ZK2A 5FOVA 2PD3A 2NUPA 2W83A 4ZT7A 2ZRGA 1KKUA 1PT7A 1DAHA 3AYZB 3LUGA 4WACA 4QZVA 1PT8A 2H1CA 3R0JA 5BQPA 3COVA 5K99A 1MB2A 2KPOA 2XDYA 1GUDA 2NZXA 2FDCA 1JG1A 2RHWA 2EYUA 4EHHA 3HWWA 5DHRA 1K06A 2EP7A 3EOBI 3PGXA 4Z7NB 3E3NA 1TIPA 4L72A 3R6DA 4OAQA 4ZT2A 4ZCSA 4DVGA 1WW2A 2H1HA 4UXJA 4EG0A 3TJZA 1Y3IA 1VJCA 1LW6E 1P2TA 2J87A 3LBFA 1J2YA 4MCAA 1MLDA 5AHRA 2CV2A 2AWOA 2EARA 2DQ4A 4HNAA 4AN0A 2ESRA 3MQ2A 4EW2A 1H85A 2R84A 3JXEA 1YIDA 5FRDA 2BMJA 4BU1A 4JKYA 1BNCA 1WOYA 1RAIA 3DE5X 4AZ3A 3OKCA 2NTVA 3HL4A 1P7CA 2JASA 4JBWA 4TV8F 3RVQA 2X2FA 4ER7A 5IFKA 1UIMA 1E2IA 1X7XA 2P41A 4YAOA 4FDLA 1OBCA 2J08A 2XUAA 4LVNA 2YMPA 1H0RA 2AMLA 1LRJA 2HEGA 3DWGA 3U3OA 3VJLA 3PJRA 2VEDA 3JV7A 1RYHA 3MS4A 2XZPA 4N3GA 4QQ8A 3IOBA 1BWPA 1Q7RA 3RVKA 3I9LA 3LYLA 1R74A 4MITA 3ZJYA 2J46A 3SHQA 3ZQKA 1SOWA 3BFPA 4QODA 1F48A 1MORA 1L8AA 3KKLA 5E0OA 3ZCSA 4BL5A 1ZNZA 3G3EA 1ZJ6A 2XUGA 3FVVA 3TW4A 3WLRA 3D3EA 5AKJA 1I94B 1YGYA 2ATEA 6LDHA 3EGIA 2VYVA 1OU4A 4U7JA 1N2GA 2FPGA 4P4TA 4TQUS 3D3NA 3LKBA 4Z99A 5BRNA 3R5KA 1ZD1A 3OTQA 2EKBA 4E4TA 2NXEA 3DZKA 3CVWA 2VCEA 3L0SA 5FULA 3HZOA 4CLOA 2JDID 3ZHZA 3L4BA 2O8DA 4PCLA 5J5VA 1KZ9A 1Q1QA 1RRMA 4WTOA 1SR8A 1J0CA 1E5QA 4GPIB 1CQZA 1V8PA 1HBJA 5DGIA 3RTBA 4GBMA 3RPEA 1G3RA 2W6JA 2HWYA 5CLIA 4EI7A 3HYTA 4M0UA 1KHTA 1SHUX 1SPXA 3AEYA 4OM7A 2JGDA 4BLOA 3AFOA 1C1XA 1BSVA 4IJ5A 1E94E 4AY6A 4NXMB 2CMKA 4KXMA 4NBUA 2B35A 4BO7A 1FZQA 3C6ZA 1QGZA 4IV5A 4S1OA 3ZNPA 3DFIA 4PYIA 4QNMA 3NAMA 4Y0AA 3L06A 3OTOB 1BS1A 4N7JA 3V2GA 3G8CA 4C0SA 5BV0A 5L4LA 4AY2A 2Y6UA 1E6UA 1U04A 1I32A 4YC7A 3W6OA 2EFGA 4FEEA 4H7KA 2V8BA 1TVKA 1XT6A 1VG0B 5BPHA 3LUAA 1RIIA 3TG8A 2JFBA 2FWJA 1IXYA 4CTOA 1YUNA 4H31A 4C5AA 4FE7A 5C18A 1O97C 2WJAA 3I53A 4EELA 1YR6A 5EJFA 2C83A 4KN5A 4BUZA 5KEIA 3V55A 3DFUA 3KAJA 1JPJA 3L7BA 4BNMA 3ZKWB 4HHEA 4B3HA 5A6SA 3LK6A 2W2QA 2HQRA 4B8WA 4EB8A 3HA7A 5M2QA 2XWPA 3INNA 5D87A 5JAMA 3ESDA 4UUMA 1VPWA 4IHKA 4Q1CA 3D02A 1E2JA 2SECE 4RTSA 3ICQB 2EWWA 4QQKA 3ZWCA 3FNBA 1JSZA 1K3FA 1KJIA 4W6QA 1IVNA 2ADMA 4G0UA 1WEHA 4R1SA 4S1NA 3D6UA 2XTZA 2W6ZA 4H3HB 4OBXA 4DRZA 2WFZA 3CU5A 5C2JB 5FOTA 2DHCA 1GPMA 4HAYA 1OVMA 3OA0A 4RJIA 5B1IA 4ASUA 2JH8A 1ZH4A 3PCRB 1H6CA 3CINA 2LD4A 2WKWA 1GZ4A 4R7GA 4YB8A 5J3JA 4J49A 2QRNA 5FUXA 3VTFA 1V26A 3IAS1 5ALRA 3AR6A 4QVGA 5DNDA 3T99A 4PG8A 4WQMA 4G0NA 3OPYB 5EEGA 3UUFA 5IX8A 2TECE 2C78A 3KHTA 1GJRA 4NZNA 3N76A 2A9RA 2CY0A 3NS7A 4PLWA 3RIEA 5BVGB 1C3JA 3Q5EA 3ER6A 4LJAA 3D7MA 5CW1A 4G24A 1EVYA 3ZX4A 3PGVA 4RZXA 5ALNA 3NIWA 4LDQA 3DUFA 2MYPA 4OMCA 1N5JA 1PR4A 2AI1A 4F1KA 1DCKA 3CVJA 1DP4A 3GCZA 1ZG3A 2PKXA 3L8DA 4AMGA 1JQEA 2VPTA 5AVWA 4OGGA 1WXQA 4I5FA 1DGQA 2O2JA 1L8QA 1SEPA 1EE2A 1LPMA 2PRIA 3GFBA 3HNPA 3MJ4A 1QJ4A 3ETNA 3PDHA 5AJXA 5K6TA 1X15A 5LLDA 1QDLB 2C2KA 4RTMA 3V1YA 1V2GA 4RMHA 4N4AA 3LT5A 1ZD4A 3EZ6A 4G0QA 3ASZA 5ESRA 3ZI7A 1TVCA 1P3JA 1V7ZA 4JL8A 2OV6A 3WS7A 4O4JB 4R31A 5DLYA 1XIVA 2D62A 4WH0A 3LIPA 2PMKA 3G0OA 5JQGF 2JLSA 1X3SA 2WWHA 4JUFA 1M1YE 4H0CA 4C0JA 2ZJ8A 2QEQA 4DRYA 4U6QA 4N6OA 5FWNA 1UQRA 3TIGA 1E7YA 2FEOA 2XVXA 1GKIA 1I3KA 3AG5A 1TOAA 3FMFA 4N03A 3DD1A 3FJYA 5EE9A 1RM0A 1D6MA 4G26A 4QLAA 2Z5VA 3Q85A 3AR5A 4IIEA 2FPIB 3EZXA 1KDOA 1VE5A 4I55B 4EF6A 2IY9A 1XTPA 1PSZA 3P19A 4HWOA 3HB7A 1ILEA 1DAKA 3A27A 1W0KA 4EGJA 4KIGA 1OJ7A 1U4NA 3K94A 4MQ5A 1NC1A 4ZA2A 5FT9A 3O4RA 4BVAA 2C4MA 3NORA 1QH8A 2O7SA 3HY3A 1JZSA 3FF1A 3PNBA 1U7ZA 4LRQA 3GLIB 2IL1A 4MVJI 3C3BA 2ZCVA 3DPSA 4L4RA 4YJHA 3W5HA 4HPJB 4PXYA 2L17A 1XZBA 2XOKA 3G49A 3GPIA 1AG9A 4BRSA 4J4HA 2VQDA 4RNCA 4UZSA 5C7YA 3F4BA 1Q7TA 4DEXA 1GAWA 4EJSC 5DNEA 4CPDA 3PC7A 3I2IA 1V71A 2P2NA 1DBQA 3OWXA 4KWTA 4OBBA 1K0FA 4H1TA 4PC1A 3Q8MA 2PR7A 2ZRIA 1RYZA 1W4BA 2H5EA 4DSOA 1AZSC 3KPYA 4B6EA 2F1IA 3BJZA 4BFSA 3EDYA 4PZ9A 4RVFA 3H1AA 4TS3A 4LBWA 2NSLA 1Z25A 3PC2A 3H84A 4YONB 5IVPA 1AH2A 1VIDA 1F2TB 2R00A 4DADA 2FR0A 1IRXA 1PZFA 2C9DA 3CNQS 1P1KA 1F14A 2ZBDA 5K3FA 3FFBA 2JZNA 4QRHA 3OQJA 3FOEC 4DIKA 4N39A 3Q12A 2JIBA 2J45A 3VSCA 3NIGB 2GDZA 2WMDA 5BV2P 4YRGA 1LDEA 1EPUA 3HE3A 2B2NA 4M53A 5A9TA 4YQZA 1Q0TA 2GARA 3EE6A 3Q87B 1BCSB 2HO5A 4G86A 2DE0X 5AHWA 2C77A 2ID4A 2BBOA 2II6A 3C2QA 3QWFA 4XX0B 3I5YA 4H4CA 3E9NA 4HDMB 4LSMA 4V2UA 3KDAA 2E87A 3B1KA 3E5MA 1HUQA 1VMAA 1LDGA 1U2QA 1VLVA 2LKCA 4IDCA 4MZDA 4QU5A 3O8CA 3AW9A 1V1RA 4HN2A 4JROA 4R71A 3PEVA 4F5ZA 1T1GA 1V1JA 3NPAA 5JG7A 3GT4A 1OIVA 3HCRA 4F91B 2E85A 2OR3A 5GP1A 1VIMA 2AFIA 2HRRA 2LCFA 4CV1A 1X7XB 1Q17A 1R50A 3CH7A 3LXMA 3OQIA 4TS1A 4IX9A 5KJCA 3SC3A 1O87A 1VMEA 3I8SA 4DV0B 3W9BA 2VSXA 1NJ5A 1VJRA 4GPEA 4UNIA 4NOMA 4F7WA 1M9NA 3HXOA 4EA9A 2GAFA 3AVUA 4DR4B 2V7XA 3MTJA 4LIPD 4DM7A 3TFOA 4F4FA 4KE6A 4EEXA 4ZMBA 1K89A 4HZGA 1FDVA 2A9QA 3TGWA 1TVEA 1WSAA 2ROQA 4WFKA 4WKNA 3PV0A 3R5TA 5FI5A 2RC6A 5LD2B 2I9KA 4F85A 4MWZA 2D7CA 1N0UA 3DNFA 4XQEA 3V6MA 1ZJYA 1MF7A 1RYFA 3EW7A 3S7TA 5TQ2B 5TMEA 3WY9A 4N7RA 4W9NA 1NSFA 2KX7A 2LVBA 3DYBA 4XIJA 3DOIA 1TTQB 3JQRA 1VLLA 2PSJA 2ZR8A 3GA5A 3QM1A 1UFQA 3ZIAD 5KNCH 1VRCA 4W5QA 2PCJA 4BVHA 3COSA 3CO0S 3F5SA 4G81A 5EKSA 2EDCA 2PG3A 1R0XA 1O97D 4PFQA 4EMBA 1H9CA 4OPMA 1C9EA 4BNXA 3MXOA 2Z5LA 2EFCB 4OQDA 3EC2A 1PTKA 1XRQA 5EKXA 3UN1A 1SCUA 1IFXA 1MN6A 4OYRA 3WP1B 4IDBA 4TL7A 4DUPA 5AUOB 2E37A 4ZOCA 3VZDA 5FV4A 4UDOA 3F97A 4C0QC 2YTZA 2ZJ7A 4IDGA 4S1VA 3ZY5A 1TL7C 2B8EA 4Y7DA 3RRYA 4DW8A 1OTHA 1OXUA 2C3PA 3GT0A 1V1MA 1XZMA 4Q3LA 3HSKA 3NWOA 2VPYA 4DILA 1T0IA 1FVXA 2CCGA 2GKSA 1UJBA 1IY9A 3IPRA 4CT5A 1OKKA 5TQ0A 1BE6A 4A2QA 4RJ2A 1L3BA 2L69A 3WBFA 1C0LA 3M7IA 1OZAA 2AUTA 1II9A 1SCUB 4JJKA 2QBYB 1DBRA 3C6MA 2E7ZA 1O96B 2PWYA 4YRBA 4OLJA 4AJ2A 3EISA 1TJNA 1SVSA 2QP9X 2UYGA 3ASVA 3MN1A 2YS6A 1G8FA 2XSZA 3DOEA 2DLDA 1IHDA 5LBUA 4TTIA 5J4KA 5KUTA 5K8IA 3IESA 3N70A 1B0AA 1P0PA 1VI5A 3GFSA 3G2QA 2NPIA 2VWHA 2JHFA 3BTOA 2Q0SA 3CA8A 3OBIA 1FNMA 1I2BA 1LSJA 1ZKMA 3AHFA 2QN2A 2W7TA 4L7VA 4LHSA 4HGQA 1GU1A 5BSUA 2JCSA 2UUOA 1G8KA 1W34A 1FNNA 3FW1A 3MJRA 5F5XA 4ZZ3A 5EIXA 1RWXA 1U2TA 3EXHB 4LMBA 1CB7A 3D81A 1T1EA 3LO5A 1KQGA 4B7CA 1A98A 4ZHSA 4WZZA 4KR2A 3WRYC 4BQFA 1O0CA 1HEYA 3AOGA 4ZI3A 3E0XA 1XTQA 3CZ5A 2G67A 4I50B 1C1YA 4J7UA 5F2EA 5IT0A 4RM2A 1NP7A 4E14A 2VTEA 3CJQA 4Q66C 2VRCA 1E9SA 4HQRA 4RFLA 5LYYA 3ENQA 3ZHUA 4B80A 6REQA 3CPSA 4DNPA 3KB6A 3KJXA 1NN0A 3DLBA 3I04A 2WHRA 3M82A 4Q3BA 4UD2A 3GLGB 1DQNA 3DDSA 1EEXB 5JCPA 1LZKA 4RDIA 1DC4A 1HC7A 2D1RA 4U8GA 5AI4A 5A4FS 4DR6B 3F3MA 2EZ4A 4JUDX 2FJ0A 3IRVA 2O2GA 2FN8A 5U4XA 4NS1A 3GA0A 4EHAA 2G8LA 4CV3A 1YI8A 2NTYC 1E2PA 3QI2A 4KKVA 5EZQA 4OTZA 4NNPA 1CZNA 2IT1A 1B2LA 1JEOA 1F51E 1N7GA 1SZJG 4KBYA 3WKAA 4QXOA 4H1VA 1E8MA 5FBZA 3W8NA 3PJEA 3QMVA 5LXTA 1T2UA 4BN4A 3GCXA 2WRZA 2TRSB 2FZLA 3FYDA 3RQSA 4DWJA 4EAAA 3FUWA 1EX6A 2IU3A 5EERA 4CE6A 5A1TA 3T0FA 5DMXA 1YR2A 1U0HC 4KXYA 2H4JA 3TSZA 2A88A 4BFVA 5DBOA 3DOJA 1K7FB 5G3YA 1H2RS 2ZW9A 2A1IA 1Z6ZA 2C1EA 4BFYA 4RLFA 4ENVA 2PL1A 3ZYZA 1MQ9A 1LLUA 4QGAA 1C7ZA 2C20A 1VL6A 3B2QA 3H2GA 5KYGA 4KPGA 1XZ8A 5DHAA 4MQEB 3V1UA 3HDJA 4AO6A 3JWPA 2XCTB 1DJNA 5H4GA 1LD3A 1AU9A 1KZ4A 2WAAA 3BORA 5JQGA 3HKDB 1S96A 3SQNA 3A9RA 2I3AA 2WU8A 3BWMA 3TW8A 1H69A 3ZGVA 1QR2A 2G40A 4WUTA 2BKVA 3TAHA 3ONNA 5I4KA 1Y6QA 1E0KA 1O0SA 3I30X 3G5TA 4ZGWA 4Q82A 4RDCA 2GBGA 5LQRA 4KE8A 3A36A 2RJNA 4ERXA 3X1KA 3IBGA 3WXMA 2JLXA 5AJUA 2JGIA 5PGMA 3OUUA 3U3JA 2QSJA 1DX4A 3RWBA 4KPEC 3GBSA 3DBRB 3EQ6A 1U1CA 4UVDA 5EQDA 3OF3A 3W3AH 3O4HA 4D5EA 1HG1A 4E5YA 5FFFA 3WL8A 1I3LA 2OPHA 3KTDA 4EI2A 3NDRA 3GIDA 3CZCA 3F6PA 3OAAD 2H4YA 3LNCA 1COWA 1C7IA 4AMVA 3WI7A 2CDCA 1YIOA 3AJEA 2MHCA 2V9ZA 2QE6A 3H99A 1ODLA 4CKCA 3PIIA 3F3SA 1P81A 1U7OA 1SUDA 3IDAA 1LCIA 3BMCB 1T25A 3KJHA 3QA9A 1YJ5A 3EMDA 1YZYA 4NZMA 4UBIA 1USIA 3ZNQA 3CO5A 3BSYA 3RODA 3BHNA 3USCS 5FBRB 4WXYB 2WPDD 2FRDA 4DDMA 3G2PA 3WMFA 1ZGCA 1D4ZA 3JU3A