4YRBA

Mouse tdh mutant r180k with nad+ bound
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
303
structure length
206
Chain Sequence
b'PPRVLITGGLGQLGVGLANLLRKRFGKDNVILSDIRKPPAHVFHSGPFVYANILDYKSLREIVVNHRISWLFHYSALLSAVGEANVSLARDVNITGLHNVLDVAAEYNVRLFVPSTIPRTIYGVSKVHTELMGEYYYYRYGLDFRCLRYPGIIMMYISDCLRATLEVMEAPAERLSMRTYNISAMDSNARKDWGWKHDFDLPELVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-threonine 3-dehydrogenase, mitochondrial
publication title Structural insights on mouse l-threonine dehydrogenase: A regulatory role of Arg180 in catalysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 60
structure length 206
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2015-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yrbA00
6ADHA 2Y1DA 4AJ2A 4DPLA 2G5CA 4QECA 1LJ8A 3IS3A 3ZU2A 4E2XA 3WR5A 4WGGA 4QSMA 4HUJA 3LLSA 5J23A 5BQFA 2Q4BA 3DMYA 1TB4A 1ZMTA 2EIHA 2RIRA 4WECA 4N7RA 2BFOA 1P9LA 4IDDA 1ML3A 5G0VA 3KSDO 4CLHA 5IG2A 5U9CA 3AI2A 1D7OA 5JDCA 3GVHA 1K89A 3U4HA 3K8ZA 4CL8A 4Z9XA 3I9OA 4IS3A 5KTKA 1BXZA 2NTVA 2NU8A 4RORA 1NXQA 1M6HA 5BSEA 3F3SA 4YB8A 2AEMA 4NDNE 3H4VA 1BHSA 4OJNA 1WNTA 2Q99A 2GRAA 4BO4A 4HXYA 4W9NC 4GPD1 4NBWA 3FPLA 3Q2IA 2GZ1A 2HK9A 3DBRB 2ZTMA 4IDBA 5TX7A 2HLPA 1U5AA 2I3AA 3SJUA 5T6BA 1PU2A 1GQQA 3WMWA 4GGOA 5JYEA 3OECA 3O26A 4NK4A 4IM7A 4Z6KA 1QORA 3AY6A 4XCVA 3ZH2A 2YQ5A 1B8PA 5I8WA 1JVSA 1MX3A 5AXCA 5TJ9A 4QT0A 4OKNA 5EERA 5GZ3A 3JQ9A 3JD1A 2C2YA 4H15A 4K6FA 4MKRA 4YT4A 2FPIA 1B26A 4XGIA 3PHHA 4BGEA 1PS8A 1YDWA 1V8BA 4EDFA 1DO8A 3O38A 1DIAA 3I6QA 5F3RA 4J7CA 3M2PA 4Q3CA 3H9UA 1L7DA 4Q3BA 2QHXA 4AVYA 1H6BA 1B16A 4YAKA 2FRDA 4PVDA 1DJNA 4AJ1A 4O6VA 5ENDA 1HLPA 4PZDA 3PGJA 3L9WA 1KBZA 2O2YA 2WYWA 1PJTA 3JTMA 2DUWA 3RJ9A 1E7SA 2DFDA 4NU6A 4YAGA 2QQ5A 3PDUA 2Y68A 4CMJA 1XG5A 4OXYA 4A73A 4IMRA 4MVJI 4FR5A 4NU5A 3DFZA 1EZ4A 1PX0A 4IINA 2EKLA 1ONPA 3D5QA 2I66A 3Q3CA 1I33A 3GRPA 3KYCB 4YJHB 1CYDA 4P4GA 4CMIB 4DQVA 3UCFA 3VVBA 4XRRA 4FC7A 5COQA 2OBNA 3RUDA 2B4TO 4DL9A 3MWEB 3VTFA 1MC4A 4CUZA 3STHA 4BNHA 2GDZA 1CIVA 4FFLA 3EVTA 3UXYA 1YB4A 2WYUA 3ZHZA 4BNYA 3WOHA 5A5EA 1Z75A 1GYPA 4CMAA 2GZ2A 3D0OA 1LRJA 4BNGA 4NR0A 5BSHA 3DOOA 2Y1FA 1B7GO 2D3TA 1C1XA 4B4OA 2AHRA 4DGSA 1I8TA 2SCUA 1EMDA 3CPSA 3GEGA 3TSCA 4MKXA 4RQTA 2ZTUA 3KYBA 4TRRA 2J8ZA 3FTNA 4ND3A 4L4SA 4BNMA 2GN6A 1PQWA 2JD0A 2NACA 5CEFA 4L0QA 3G79A 4OO3A 2HDHA 2GASA 3UW3A 4PN3A 3GUYA 4CLOA 2O48X 4H3VA 2NU9A 2VYNA 4IQ0A 1N9GA 1OOEA 2YFQA 2Q1TA 4IUYA 3FR7A 3CMCO 1ZSVA 2A4KA 1VJ0A 2BRUA 2HMTA 1DFGA 1X7HA 2HRZA 1QYXA 3ON5A 1TVEA 2P9EA 1PJ3A 2WD8A 5A05A 2HMUA 1YL5A 3ZI0A 4DLAA 4KDEA 4QQRA 1IPEA 4UVEA 2CNBA 3NT5A 1DIHA 1J49A 2G76A 4DRYA 3DC2A 2DPGA 1X0VA 2AEJA 1EUCA 1J0XO 2PNFA 1F8GA 3JYNA 3R3SA 5FFFA 3PGXA 1J4AA 1P1HA 4AJPA 1EQ2A 1H9BA 3AU9A 4GL4A 1ZO8A 2I9PA 1T24A 5L7YA 1WDLA 4Q3AA 1O95A 3G1TA 3M1LA 3QWHA 5A5FA 5EIOA 2VTDA 1M6WA 2VUUA 3E18A 4WKGA 5TQVA 3GMSA 4J7UA 3KV3O 3W8EA 5IDWA 2CF5A 1A9YA 3JQBC 3OIFA 3FSRA 4JBHA 4BNTA 1ADFA 4BMVA 3OJOA 4DPKA 5AOVA 4KUEA 4A03A 3K6JA 5KOIA 1T1SA 1YBAA 4WK6A 2VTEA 1ZK1A 1WDMA 3OICA 4I1IA 4YAJA 3SXPA 4MIYA 5JC8A 4U6QA 4BB5A 1Y9EA 3KLPX 3WYCA 2Y1CA 3TFOA 1YL6A 3ZWNA 3GK3A 1ZZEA 4CMKA 3PRJA 1JLLA 3GG9A 4GH5A 4XQEA 3BTOA 3NX4A 1Z82A 1E3EA 1UP7A 1NPYA 4J9VA 4JIGA 5JDCC 2O2SA 3OFSA 3DWFA 3WJAA 3NJ4A 4AJOA 4LSMA 5F1OA 3A28A 3WSVA 1JKIA 1HDRA 1DSSG 5CDYA 1SAYA 1F12A 5C37A 4PLYA 1HETA 2B0JA 2B37A 3EGOA 3UN1A 1NQOA 3K30A 3AOEA 4E5PA 1CQIA 2CVOA 2NSDA 4OAQA 4RVSA 4BNWA 5IF3A 4BNKA 3DOJA 3G49A 4PRKA 3LC1O 1U5CA 1PIWA 1U28A 4IGFA 1HDGO 5CPFA 4NK5A 3S55A 2EEZA 4FIZA 3GGOA 3OHSX 3T4EA 3DZIA 4ZQBA 2ZJ0A 3DZFA 5IXSA 2GCGA 2PGJA 1UJMA 4NHEA 3U62A 3UF0A 2PH3A 5KJFA 3VDQA 4HFJA 2EKQA 4TKLA 2DLDA 1MGOA 2X5JO 4ND2A 4Y67A 3ZGYA 4N5NA 1GU7A 1P0CA 4L4XA 1KC1A 2P5UA 1IZ9A 2PZKA 3IP1A 4Y6SA 4U0KA 4YTEA 1JWBB 1X1EA 3CSDA 5JLAA 3E9NA 2E6UX 4NNJA 3SLKA 2Z1NA 1PQUA 2RAFA 2IYOA 3N58A 3PYLA 1E7YA 2FPGA 4OSOA 3H7AA 1PS9A 1VJTA 2A94A 4DA9A 2GYYA 1DLIA 3E03A 5B12A 1C1XB 1EQUA 4RPLA 4J3FA 3S2FA 1NX6A 3AU8A 5TF4A 1QV7A 1Q7CA 1S7CA 3WDSA 1Y5RA 3NJ8A 2YHIA 1HE3A 1QRRA 2JFGA 1SZJG 4YRBA 4RVHA 1LTHR 1RPNA 1GL3A 3BIOA 1E7MA 1YB1A 2O7SA 3HE3A 4D43A 3QWBA 3LSYA 2VZ8A 1ISHA 3ANNA 4TVOA 4CLOB 1DC4A 3IL2A 1N9GB 2Q4EA 1H6AA 3ZWCA 4UEKA 5FI5A 5H81A 2JHFA 3K2BA 1MLDA 4IDGA 5IXYA 3I9NA 5BNTA 1GEEA 4UULA 4R1SA 1HZJA 1SMKA 3NYWA 4WOKA 1NR1A 5ITWA 4OOEA 2PA3A 3GT0A 3JD2A 4D7AA 3LDHA 1C0IA 4JBGA 3SVTA 3I4CA 1AXEA 5I8ZA 1EE2A 3W6ZA 3L6DA 3ZHBA 1T4DA 3P2YA 4A10A 3PHJA 3E82A 2FOIA 3BTSA 3M6IA 1EE9A 4BNNA 4ZJUA 5JW6A 2G1UA 3B20A 4MP3A 5F5NA 2HMVA 3GQVA 4FS3A 2PKQO 4J7XA 2AEFA 5B1YA 1N5DA 3ADPA 4LSWA 1K6IA 3H9GA 2O4UX 5T64A 3RIHA 2J3JA 3VPHA 3OEWA 2PZLA 2VRBA 4JP3A 4CM6A 3I9KA 4LISA 1NAHA 4DLBA 1HWYA 1ISIA 4HADA 5TJHA 3KOUA 5AXDA 3HDQA 3I1JA 2XXBA 3TDKA 3HNPA 1P3DA 3HN7A 4XX0A 1GV1A 1BMDA 1VI2A 4WLUA 3I9MA 3V1YA 3G3EA 3H5RA 3LLVA 4BGIA 1GD1O 3I5MA 1JAYA 1V6AA 4UEOA 2Z1MA 1YH3A 1MP0A 1G0OA 1P44A 2IE0A 1T2EA 2CD9A 1E7RA 4MVJG 3GNQA 2IZZA 3RKRA 5TGDA 4UUPA 1PGJA 5L4SA 4B7CA 3LYLA 1K5HA 4XJTA 3OMLA 2QG4A 4BGUA 4AJEA 1ZK2A 1XGKA 3HHPA 3GH3A 4DBZA 3LQFA 1JKJA 2IEDA 3ZU3A 5AXAA 4R4JA 2FSVA 4MP6A 1Y8RA 4AJNA 3EMKA 1JTVA 4LGVA 1GDHA 3WS7A 4E21A 2DTDA 3JV7A 3L77A 1B15A 3HB5X 3W8DA 1N1GA 4E4YA 3PJFA 4GX5A 1PTJA 3QSGA 4Z0PA 3VDRA 1HDZA 2JL1A 2VT2A 4MKZA 3GDGA 2E4AA 1BDMA 4UVDA 4ZQEA 3JYLA 2J3KA 2HJRA 1HYGA 1LA2A 4DBVO 3PP8A 3SBOA 1YOVA 3WIEA 1VLLA 4BV9A 3OQBA 5G4LA 4BO3A 2I65A 4L76A 5AYVA 4WE3A 3FBTA 4QXMA 3H9JA 4E30A 2J5QA 2NU7A 4R16A 2JD2A 3QA9A 2Q1UA 5COAA 5DCUA 4A0SA 4D45A 5TRTA 3QHAA 2I99A 1H93A 4I08A 1W4ZA 1C0LA 4IDEA 3PJDA 2EERA 3S8MA 5K6AA 3VPGA 3QIVA 1DIRA 3ENKA 1N8KA 3NAQA 1KEUA 3NV9A 1TXGA 2Y0DA 4K6CA 4P38A 3AW9A 3PEFA 5KNLA 4LN1A 1GYRA 4KWIA 3COSA 4NBRA 5I7SA 3E48A 3EAGA 4E0BA 3AUUA 2C5EA 1HKUA 4ZD6A 1CDOA 4Z9FA 2PFGA 1TEHA 2FY8A 3EDMA 4L8VA 4OGWA 4BKRA 4NZ9A 2YHIB 4XB1A 3BHMA 3FTPA 1LDBA 3EZLA 3V1TC 4EJ6A 5JCXA 4R1UA 2AQ8A 1EVZA 1NASA 1E3IA 4RZHA 2GERA 3RVDA 1LDYA 4J2OA 4JK3A 4OHUA 4AJHA 1U2GA 1LRKA 2E82A 4LMPA 3FR8A 3QLJA 4FJ1A 2F00A 1AUPA 1D4FA 3TN7A 2EF1A 3BTUA 3DO5A 1PL7A 3GUCA 5BNIA 3ZCXA 4XEHA 3KRTA 1V0JA 1WDKA 1Z74A 1ENYA 5EN4A 1C14A 3N74A 4RDHA 1GUYA 5GY7A 4FFRA 4BNZA 4AFNA 1NWCA 3H6KA 3WTCA 4W7HA 1P33A 4BVAA 2WYVA 4LRTB 3D3EA 4PLCA 2VUTA 4PCVA 3H9QA 4OMUA 4HNGA 1XU9A 3PPIA 5MGBA 3LVFO 4I5DA 3SLGA 4BNVA 1Z45A 4R1NA 4YA6A 4CMEC 4W7IA 2FZEA 1Y6JA 1ZJYA 3ZN2A 1XIVA 1R16A 4BGVA 1BWSA 3W4KA 3ONEA 1IY8A 1GPDG 3EUWA 1K0UA 1VSUA 4E6PA 3OH8A 1R15A 3E6AA 1H9AA 4IGEA 3PFWO 1YBMA 1LC3A 4HV4A 2VRCD 2YV3A 1E1KA 1MC5A 4QTZA 1E1NA 3AM3A 7MDHA 1EBFA 4OIMA 2ZKLA 2ZJ1A 1EVIA 1ZW1A 1DLJA 3W4IA 2VHZA 2QYTA 3CXRA 4PLWA 5H82A 2BGLA 1Y9AA 4BMSA 3MCVA 2CF6A 4FD3A 1DDOA 4ZGWA 5ICMA 5JCJD 4QEDA 4WLFA 3BYZA 3K96A 1N2SA 4ND1A 3FN4A 1EK6A 1UZMA 5IJZA 1Q1NA 4MINA 2BD0A 2X9VA 4E2ZA 1Q2XA 1JKFA 2H5LA 1R6DA 1XCBA 1ZEMA 5A4DA 2VWQA 3K31A 3WGGA 1E77A 3GPDG 4RQUA 4IQGA 4AJKA 5CFZA 2GLXA 3GGPA 3KUXA 2C0CA 1PWZA 2CY0A 1K3TA 1E1LA 2C59A 1ENPA 1M67A 1UAYA 2ZQZA 4WLOA 3UVEA 2GF2A 1ZK4A 2JCXA 3HFGA 4RO0A 5IDXA 5U1PA 1DB3A 2BH9A 1UXIA 1X7DA 4CUJA 3E8XA 3JD3A 1DXYA 3ZV3A 2DTXA 4CLRA 3HDHA 4FBGA 5HS6A 3RUHA 3MJSA 1M75A 3AFMA 1YOVB 4I9HA 4PLTA 4IQ8A 4JLWA 1WVGA 4YJDA 4HY3A 2NQ8A 2QYSA 4ZVVA 4DVJA 4A26A 3O8QB 1P1RA 2O4CA 2PD6A 4ZQHA 5JAQA 3H8VA 1HLDA 1QYDA 3C3XA 1DC3A 2P4QA 3RU9A 1MA0A 1RKXA 5TLSA 2WE8A 3UCEA 2DUUA 2VWGA 2VHWA 1HYHA 1X7GA 4IDAA 3GRKA 3PWZA 2GO1A 1P0FA 1R0LA 4DMLA 1J6UA 4W82A 4YCAA 3H2ZA 3WLEA 4R3NA 1YRLA 5LDHA 1H2BA 1E3LA 3G17A 4M8SA 4M87A 1UAGA 2Y0CA 2I6TA 3QW2A 3QWFA 4RVGA 5KVSA 2V6BA 4RPGA 1XSEA 1TI7A 3A1NA 2VUSA 4DC0A 4M1QA 4PG7A 4M55A 1PJLA 3ROPA 4CM1A 1J5PA 4PLVA 5DBGA 3RD5A 3PHGA 2NQTA 4GSKA 3VPSA 4J4TA 1ZIDA 1DHRA 2CUKA 4PLFA 1DFIA 1DIGA 1KERA 2WM3A 3PJEA 2FR1A 2IYPA 3LF2A 2J5KA 1OC2A 4RVUA 3AI3A 5COBA 1P77A 1X1TA 4EUEA 4BO9A 2Q46A 4AICA 4ND5A 4AJLA 3C1TA 3DAFA 5C5IA 1SO8A 5L4NA 1DIBA 1SCUA 2IEBA 3IIEA 2NVWA 4K9DA 1NNUA 4K28A 4CR8A 3GDOA 2PZJA 2BGMA 3PHLA 2RBEA 2VHVA 2WE7A 2YDYA 4IDCA 1VPDA 1I30A 3CINA 5A06A 4ZU3A 1DRUA 4CV0A 5GZ6A 5JMWA 5JY1A 4KTTE 5CEEA 3ZWVA 1BXGB 1PQPA 4JQCA 5DCWA 3ETEA 3TFQA 1YKFA 5BSFA 3OIGA 3U0BA 5IN4A 3UOGA 1OI7A 3QP9A 2PGLA 1CJCA 3JYPA 3AM4A 1E0DA 3VKUA 5JFOA 4Z3DA 3ROKA 2C7VA 4CV3A 4XJSA 1I32A 4RPJA 4JJFA 4Z9YA 1YB5A 3GMDA 4Y98A 1L7EA 4EEXA 2VCYA 5IZCC 4IBOA 4RDIA 3RC7A 1DAOA 4L73A 4OOFA 1XYGA 3GDFA 3EVNA 6LDHA 2O50A 1AHIA 3C24A 2FR8A 4KUGA 2AQHA 4UUNA 4GI2A 3H3FA 5L95A 2OZPA 4BNXA 3IUPA 3JYOA 2GN4A 4Z0TA 2AXQA 1JW9B 2HAEA 1Y5MA 1SB8A 3I52A 1PJCA 1LLUA 3OJFA 3WGYA 1I2CA 4U6SA 2E49A 3ZV4A 1KEVA 1Z7BA 3Q1LA 4OQYA 4WCFA 1MXHA 2X8LA 4GGPA 5ENVA 1GQ2A 4NIMA 1JU9A 2GZ3A 2JFFA 3QJ5A 1K6XA 2G82A 2Q2QA 5G0SA 3CKYA 4Q39A 1F06A 1SEPA 3DBLA 4QFCA 3TNLA 1YS4A 2NVBA 3RKUA 4PG8A 2JJYA 4I5GA 5KJEA 4O63O 5TC4A 5JSFA 5LCXA 3H2SA 4BNJA 3L4SO 4CLRB 2PGDA 1QP8A 3JQ8A 2B36A 4HP8A 3ICCA 5DDIP 2Y05A 2OL4A 3A14A 4MVJD 4CL3A 5KVVA 1I0ZA 1LI4A 1MB4A 2CSUA 1BDBA 1T4BA 1BVUA 1BSVA 1D3AA 3D4NA 3DTTA 3DHYA 3HG7A 4XIYA 2VOJA 3JSAA 1GQYA 3WGQA 1EUDA 2Q1WA 4BS9A 1YE3A 1LRLA 5LC1A 2DPHA 2X9GA 3GZNB 4J49A 4C4OA 4N54A 4URFA 2C7GA 1XLTA 4Z3KA 5I7VA 1W8DA 4Y6RA 2ZTVA 3QE3A 4FCCA 1IULA 3F4LA 2B5WA 4RF5A 4B8ZA 1KIFA 3LC7O 2B69A 1E6WA 3JQCA 1KETA 1SB9A 3ZZNA 3VVCA 1HF3A 3BTVA 2VWHA 4I9UA 1D1TA 2ZYAA 1WLYA 5G4KA 5L51A 5L53A 2VN8A 4DQUA 4JNKA 3F4BA 5ADHA 3H5AA 2X58A 4DUPA 1DFHA 1W6UA 2O3TA 2FP4A 4HBGA 3EZYA 2PV7A 1DHTA 3O4RA 4J90A 3RWBA 3W4JA 2B4RO 4BO1A 5CP8A 1LC0A 4GVLA 5K9ZA 2DAPA 3U5TA 3SC6A 3MZ0A 5FWNA 1YQGA 1Y81A 2ZB3A 3OIDA 4FFMA 3ZNOA 1KVSA 1LLDA 3GLQA 1LDMA 4QO7A 2X5KO 4ITUA 1P31A 4IS2A 3S1LA 1FK8A 1XELA 5JBIA 1CWUA 1LQUA 1QLJA 1SEVA 3IKVA 4O1MA 3CE6A 2VRCA 2WSBA 4TZKA 2W90A 4IJWA 1IHXA 4D3DA 4FPXA 5H83A 3DB2A 2R6JA 3IAHA 4W4TA 4GSLA 2JHGA 3KSZO 3WMXA 2IODA 4Y8VA 1B3RA 1HE5A 3LC2O 1X14A 4NJMA 1WXDA 1YDEA 3LT1A 4BO2A 4CM9D 4YRAA 5JCJA 3D4PA 4CM5A 4YJFA 1NM5A 2OP0A 1GZ6A 1A71A 2P9GA 3NEPX 4GVXA 2AG5A 3GF4A 1LSJA 1HT0A 3A06A 2OBYA 3INTA 3RBZA 5JYDA 4J43A 2NTJA 2O3JA 4XQCA 1GPJA 1IB6A 2WJPA 3ICPA 1PJ4A 3GNTA 2V6MA 4IXTA 1T26A 1QKIA 5EESA 3IC5A 3WLFA 2ZATA 4BNLA 2D2IA 1I3LA 2O23A 2DKNA 4YBZA 1YO6A 3WWZA 1E3JA 3RUFA 3GVPA 4TWRA 1GCUA 2W2KA 3P5SA 1ENZA 2GUGA 2DBVO 4YT2A 5JO0A 1JVBA 3PWKA 4AG3A 4EW6A 2HRBA 3KLMX 4R5MA 3X2FA 5JAZA 3GHHA 2CZCA 1HSOA 4WEOA 1Z7EA 3V1UA 4X54A 4D46A 4D42A 4ALIA 1QYWA 2D8AA 2HO5A 1DC6A 3VZSA 2P68A 3ZWWA 8LDHA 1HE4A 1PR9A 3JQ9C 3ZV5A 3TZHA 4ZN6A 3FF4A 5JMPA 3I9LA 2Y1OA 1ADBA 3K2EA 4WCFB 3G0OA 4W99A 3W1VA 1Y8QA 2I3GA 5BT9A 1S6YA 4BHTA 4BIIA 2G0TA 1OZAA 4R9SA 3VC7A 1XQ1A 1KVUA 2UUPA 3DBLB 1KEPA 2EP5A 2Q1SA 5HTOA 3QQPA 1HDXA 1NR7A 2FSSA 4YDRA 5F1PA 4E13A 4MJLA 4WJZA 5A9RA 2JD1A 3A9WA 3ONFA 2VZ9A 3ITKA 5DT9A 3INGA 4P8RA 3JQ8B 5G0TA 1E92A 3ZWXA 1YONA 2CVQA 3F6YA 2NWQA 1EVJA 3BHIA 4IJKA 1KC3A 1U3WA 1PZHA 3ETGA 2GN8A 3FNEA 3TL2A 2EKPA 3CEAA 3LT2A 1LBEA 3FHLA 3KTDA 1KY4A 3UCXA 3JQFA 2R2GA 3OQ1A 4RF2A 1DAPA 4B7XA 4J2HA 5DZSA 4YRDA 1V35A 1BVRA 1ZXBA 3PJGA 3Q2KA 1VL0A 3V8BA 4ESOA 4WCFC 3JQEA 3PZRA 1Z73A 5TNXA 2RH8A 1K6JA 5JDIA 5DULA 2B35A 4BKQA 3JQGA 2EG9A 1Y7TA 2OORA 2X0JA 2GSDA 2CDAA 3KBOA 3BAZA 3KXDA 1HSZA 3MJ4A 1Z6ZA 2PY6A 1DEHA 1MFPA 3JD4A 3V2HA 5EPOA 2YW9A 2E37A 4DPMA 2PD3A 1V3VA 3GVIA 3OJ0A 3A4VA 2OP1A 1WZEA 3GC6A 5JXWA 2JAPA 1A5ZA 1LX6A 4ROSA 1D1SA 3L6OO 3VKVA 1KEWA 4FJ2A 4XYEA 4HWKA 2YV1A 3E5RA 2I76A 3TOXA 1F0YA 2RHRA 4L4RA 3DHNA 3HSKA 4Q3NA 4Q3DA 4C7JA 4R9RA 2QRKA 2PR2A 4D0SA 4H7PA 4WASA 3TZKA 5I7FA 1Y1PA 4WOJA 3WX0A 4XYBA 1DRWA 1IE3A 2UV8A 3WGTA 4MIEA 3DONA 1U3VA 1D8AA 2HQ1A 2X86A 4FOOA 4NJMB 1VJ1A 4YJFB 3H5NA 3KSUA 1U1IA 3ASVA 1I3NA 3O03A 1E3WA 4IIUA 5FEUA 4TZTA 3AUAA 2EHDA 1K2WA 3OETA 1X13A 3FWNA 1A7AA 3ZWBA 3ZNNA 3CTMA 3U4CA 1IUKA 3L07A 3ZWPA 1FDVA 3CIFA 2BFMA 2V65A 4JN6B 3LU1A 3JYQA 2CFCA 3DBVO 3EHEA 5I9NA 4DREA 2Q2WA 3KM0A 3QVXA 2UAGA 5G0UA 4JX8A 4CLDA 2H9IA 1R4MA 4TVBA 2J6IA 2W2KB 3GN1A 4DTIA 3GZ4A 4LMRA 3F1KA 4JJGA 8ADHA 2I67A 4FJ0A 1KVQA 2HK8A 4IJUA 3SX2A 1TT5A 4R1TA 5DCYA 1XKQA 2EXXA 2O3UA 1EVYA 4YAEA 4YJGA 3JQAD 4MVJA 5DF1A 4OL9A 3LF1A 1VM6A 4GWGA 1SPXA 1SOVA 5JAMA 4J9UE 2ZB4A 4NPCA 3K9QO 1AXGA 1KVRA 4NBUA 2FN7A 4FGWA 3B70A 3UHAA 1NQ5A 4GMGA 4D79A 1UDBA 1A7KA 1BTOA 1KVTA 4II2A 1T2CA 5G0WA 4BNFA 3BMOA 4P4LA 1FDUA 1V3TA 4WEQA 3FI9A 2VHXA 2HUNA 1JAXA 2BI8A 4KZPA 3ZNPA 1Y8QB 4A27A 1C0KA 2H1SA 1GADO 4W9NA 4UUMA 4C7KA 3INRA 1RYDA 4E5YA 3RU7A 3GG2A 1U4OA 1PJBA 3OEYA 3AOEC 4MO2A 3I4FA 3HB4X 1WPQA 2AW5A 4XGKA 2QW8A 2IZ1A 3MOIA 4HNHA 3AUSA 4CJXA 5JS6A 1U8FO 2VNSA 3ZHXA 2P2SA 1FXSA 3OA2A 3IDSA 3KZVA 1MG0A 2LDXA 2QZ9A 1BG6A 1HZZA 2WMDA 4E5NA 3W6UA 4E3ZA 1WZIA 2P91A 3UICA 3ZHYA 4YYZA 2DU8A 4NG5A 4RVFA 3NDIA 3OP4A 4IIVA 1ULSA 3TZQA 3PIDA 3K92A 1IPFA 2Q2VA 1R0SA 4N5LA 4XIJA 4XD2A 2D5AA 4OYRA 3L0DA 3PLNA 3E9QA 1UXJA 5EQDA 4B8WA 2JAHA 2Z95A 5EJ2A 4DIFA 1NVMB 1R4NA 3BMNA 3QRWA 3F46A 3OA0A 1AHHA 1EBUA 3NTQA 3E1KA 4RV9A 4TRNA 2VOEA 3PHIA 2PTGA 4DYDA 4F46A 2A35A 2NV6A 1RM5A 1T1RA 3FRJA 1E6UA 4UVHA 4CM9A 4IZIA 4MP8A 1NHWA 1G6KA 3JQGB 4NFSA 4ZQFA 5FI3A 2C82A 3S2EA 5L40A 2ILTA 3WWYA 1U4SA 1YXMA 3NT2A 1PJ2A 2B4QA 5JNLA 2B5VA 2XXJA 1ZFNA 3WIDA 4I5EA 4F45A 4LCJA 2DT5A 3KYDA 5T8KA 4Q3EA 4FC6A 2FMUA 3GY0A 5IDQA 2RH4A 3P2OA 2VNAA 1VSVA 3PQDA 4MPDA 1UR5A 4M86A 4NBTA 1WWKA 4K26A 4PLPA 5B4UA 4QX6A 5L7WA 3TZCA 3IMFA 5HBRA 5KVQA 3L6EA 2Y66A 2ZYDA 5CEJA 3DZKA 3ZU4A 2GPTA 1NAIA 3AFNA 3AY7A 3HADA 4HFNA 2J3IA 2OHXA 1ZXLA 3I9JA 5CAEA 3WICA 4FGSA 5C3MA 2YY7A 3UGKA 1T2FA 3H65A 4R5HA 4MVJP 3JQFC 3ZWAA 1U8XX 4KQWA 4XWYA 3FD8A 3QVSA 2EWMA 1GCOA 1AE1A 4RPHA 5DBIA 1OFGA 3DZHA 3HDJA 3BZUA 3IP3A 4Y6PA 3RUAA 4IXWA 3VZRA 4IMPA 5CDGA 3KETA 1E3WB 1HDYA 4FSHA 4RVDA 4E33A 1CERA 4N18A 5F1KA 3GFGA 3NTOA 2W98A 3VTZA 3PVZA 1Y8RB 4R01A 1ISFA 4BL5A 5KJ6A 5ILOA 4UAGA 1I3MA 2UYYA 1NHGA 4M49A 1QYCA 5MDHA 4JGBA 3BMCA 2WDZA 3P7MA 5DN9A 4FW8A 1ISGA 3DQPA 3DZGA 1R4MB 1V9LA 4INAA 3C1OA 4PZEA 1HDCA 4BO6A 4J1QA 2P5YA 3NGXA 1B0AA 4J1TA 3D7LA 2VHYA 4RZIA 2FR0A 3BXXA 2X23A 1IHYA 3CMMA 3BHJA 2Y93A 4QFDA 1TT5B 2X22A 1O6ZA 1JDJA 4TKMA 4XDYA 2EGGA 5HRUA 3HFSA 4PZCA 3VPXA 1UZLA 1Q0LA 4YJGB 5L3ZA 1T25A 3GEMA 3DAGA 1HXHA 1O94A 1W0CA 1G0NA 3GOHA 2X9NA 4R3WA 4GKBA 1TA4A 4XA8A 3WGZA 4F6LA 3GA0A 1X15A 1Q0HA 1A72A 5A9TA 4BNUA 2VZ0A 1XWFA 2HK7A 3ROQA 1HTBA 1NVGA 4NFYA 4XYGA 3BMOB 3GNSA 4XZ3A 5IN5A 4EZBA 2E48A 1N7HA 2C5AA 3IJPA 4HKTA 4U5QA 3WBFA 1VE9A 5ER9A 3WG9A 1LDGA 1R12A 5K0ZA 1CF2O 3RBXA 4GX0A 4YR9A 4O0LA 5C7LO 2QZZA 4CQMD 2EJWA 5L7TA 2POQX 1PZFA 1PSDA 1R0KA 4JBIA 4B3IA 4S1VA 4R69A 4M89A 4AL4A 4HX5A 1OMOA 4JROA 2JFHA 1H2HA 9LDTA 1PGOA 3OQ6A 4XKJA 5U4QA 4BO0A 1U3TA 4DYVA 5CHEA 1SBYA 4LCEA 3KEOA 3PK0A 4KMSA 3QVWA 3ZWOA 2AA3A 4KP7A 3DBHA 3GHYA 2Y67A 1UP6A 3NDJA 1SNYA 1O8CA 4DC1A 4GMFA 4KUHA 3FPCA 2Y0EA 4I5FA 3HDYA 2VQ3A 2GNAA 3FBGA 1O89A 2NU6A 2ZQYA 3DZJA 1R4NB 1VL8A 3BMNB 5EINA 5I9LA 4LVCA 4CPDA 3MTJA 2XF8A 4RCVA 5T5QA 5K6AC 1H6CA 1DRVA 4J91A 1F14A 1BRMA 3ROMA 3VH3A 1LSSA 5A3JA 5A9SA 4ALMA 3LT0A 4AJ4A 1XR3A 5HWSA 3C85A 1PGNA 3OSUA 3V2UA 3KEQA 1PL6A 3KYDB 2WEKA 4I9NA 5A03A 5BSGA 1LUAA 5A04A 4ZRNA 5BR7A 2YYYA 4LW8A 4YQYA 4MOWA 4O5OA 1VKNA 3HQ4O 3B1KA 1LLQA 3BMQA 1BXKA 1RM4A 3D1LA 1PGQA 1W73A 5KKAA 1F17A 2G17A 3PLRA 3PI7A 3WJ7A 2BLLA 1QV6A 4PVCA 4EYEA 4XQGA 2YHUA 1JN0A 5CDUA 1ZKMA 1ARZA 4WNIA 2CDCA 4E5MA 1JA9A 2WD7A 1CEQA 3R3JA 3JQAA 4ALLA 3G1UA 5KCZA 4CM3A 2O3RA 2CDBA 4WUVA 2QIOA 4BKUA 3PQFA 5A02A 1O5IA 4BKPA 4D41A 3RBVA 3MOGA 1VL6A 3WYEA 3ITDA 1RWBA 1YVEI 2EV9A 4XDZA 4FB5A 1GEGA 2PKQP 2DFVA 3T7CA 2YJZA 3IOYA 2RHCA 1U9JA 3HWRA 5DOVA 1DPGA 5T8KC 4BNIA 1ZNQO 4OH1A 3DXFA 4MVJH 2LDBA 4F6CA 3BMCB 4FFPA 4DLLA 1E5QA 3DL2A 3N7UA 2Y99A 2QX7A 3VH2A 1KYQA 4E2WA 3PFFA 3WFIA 2V6FA 3ORFA 2QRJA 2BHLA 2X0RA 2IRWA 1U3UA 4GKVA 3MJTA 4PLGA 4YACA 2D5CA 5KKCA 1N1EA 3TOZA 1A27A 3ZV6A 3RSHA 4GQAA 5JC1A 4YAIA 3Q11A 1LQTA 1I36A 2J5RA 2W2LD 2EGHA 3PZBA 3I83A 1NPTO 1YGYA 3WGHA 4BV8A 3NRCA 4O59O 2HMWA 4R41A 3RFVA 4ND4A 4YPOA 1IL0A 4OQZA 4UUOA 4BUCA 3K73O 4B79A 3ZW8A 1H94A 2X7HA 3WBBA 5KVCA 4P22A 4PRLA 3CZMA 3WQSB 3U09A 2VYVD 3KHUA 4CV1A 1P1FA 3C7CB 2D1YA 2Q49A 3MJCA 3S2IA 5I7EA 4XRGA 4YXFA 3GEDA 2VWPA 1ZMOA 4GLOA 3TQHA 1BW9A 4CODB 1YWGO 1HE2A 2O3QA 1GTMA 4K1LA 1FJHA 1B2LA 3U3XA 4B4VA 4ZRMA 1NVTA 5ES3A 4F3YA 2UVDA 3DZBA 2O7QA 1ULUA 5AVOA 1H6DA 4XR4A 1ZBQA 5BNFA 4RF4A 4FFOA 1FDSA 4ID9A 3AM5A 4WLVA 3F5QA 4J6FA 1ZEJA 4E32A 3BA1A 3MEQA 3KB6A 1YJQA 1A4IA 2PD4A 4XGNA 1QLHA 1ZVMA 3ENNA 3PYMA 2R00A 4GX2A 2HKIA 4TRMA 2IDZA 2X0IA 3T7EA 3DBHB 1RJWA 2D0IA 1KOLA 4YT5A 3RCBA 4ZICA 1NPDA 4A5OA 4CMGA 3WGIA 4RPKA 1I3KA 2UDPA 2AQIA 2C20A 3TRIA 1EUZA 5AXBA 2VT3A 3RJ5A 3SC4A 2PWZA 1BGVA 2X1HA 1GUFA 2V6GA 1PEDA 3RUEA 3HN2A 2NM0A 3GGGA 3NT4A 4P4NA 5THQA 2ZYGA 3CZRA 2IXBA 5A9SB 2XOXA 3HZZA 4IY1A 4RL6A 1DJQA 2HSDA 4MIOA 1T2DA 1CETA 3L9XA 4CQLA 4WLEA 1OAAA 1WMBA 3EC7A 1C3VA 4NQZA 4E2YA 3GFBA 4FN4A 4B3JA 2A92A 4MVJE 1DBVO 5CG2A 2GN9A 3QWIA 1O0SA 4B4UA 1A4UA 1IZ0A 1WAMA 4WPGA 5T67A 4W6ZA 3GPIA 4BO8A 1LDEA 2BI7A 3EY4A 3VZQA 4D0RA 1EK5A 4J1NA 4WNCA 2CVZA 3OF2A 3BMQB 3CUKA 3QVTA 4HFMA 4KWHA 4NH4A 5C7IO 2NLOA 2ZB8A 1C1DA 1TT7A 5DBFA 3O9ZA 5EMHA 3WQQA 4WLNA 3T4XA 4UEJA 3B6ZA 4BQRA 3RROA 1P45A 3AOGA 3FWZA 5IFLA 3M1AA 4ALNA 1U7TA 5CPBA 2H6EA 4YVFA 1I2BA 1XDWA 4FDAA 3FNHA 1P1JA 2WD7B 5TT1A 3JQAB 2Z5LA 3C7DB 1ZJZA 4IJVA 1LLCA 3D4OA 1YQDA 1VKOA 2GD1O 2H63A 4ALKA 4EITA 4PG4A 3MTGA 1B8UA 4RLSA 1T2AA 1ZK3A 4MVJF 4PLHA 3IUSA 3NUGA 1EDOA 1SC6A 3AUTA 4JJIA 1QMGA 9LDBA 2NNLD 4M54A 4PLZA 2FZWA 1PJSA 3HJAA 1M2WA 4L74A 3DR3A 4FFNA 1U2DA 2OMEA 3AJRA 3TF5A 4AJIA 2Q3EA 3RUCA 3GVCA 3S2GA 2AQKA 2AMFA 3QWAA 3JCZA 1ZH8A 3OM9A 3UKOA 4CLXA 1KY5A 1UZNA 4CQMA 5KWEA 4UVIA 1GY8A 1ONNA 2IXAA 2X4GA 4U8GA 5EQFA 4IPTA 3GAFA 3EW7A 4XQ9A 3R0IA 3PDJA 1QYVA 4KQXA 4CMHA 1ORRA 1N7GA 4ZHSA 2YQ4A 1GR0A 1FDWA 2JCVA 2NVUA 4FOSA 4E12A 1ISMA 1NBOA 2HJSA 4CMCA 1E7WA 2DBQA 4N5MA 1ADCA 2ZCUA 2ZB7A 1C0PA 2FPPA 1SOWA 3RFTA 3IQDB 3VH4A 4EJMA 2PK3A 2PH5A 1EFKA 4E31A 4EJ0A 1AN9A 1GV0A 5IZ4A 4CM7A 3E9MA 4BO5A 4CMEA 7ADHA 3PIIA 1QG6A 4KDFA 4NFHA 3X2EA 1P74A 2HCTA 3DMTA 4BB6A 2EW2A 3NGLA 3OJEA 3WNQA 3RC1A 3Q9UA 1L1FA 4YEDA 5A1TA 4PG6A 3NTRA 5B4VA 2DVMA 1NQTA 1UDAA 3C8MA 1BW9B 1MXFA 4R51A 3B1FA 1EEHA 1X0XA 5TT0A 3L4BA 3RC2A 1GAEO 5G4KB 1WMAA 3TJRA 3W8FA 2OGUA 2X0NA 4JP2A 4RLHA 4OXKA 4CR7A 1PZEA 3F47A 1FMCA 5L9AA 3QY9A 1FF9A 1OC4A 1RM3A 3I3OA 1IOLA 3ABIA 3PQEA 3QV1A 2DM6A 1B8VA 3D64A 1O9BA 3F1LA 5HA5A 4BQPA 5EL0A 4J4BA 4II3A 4YQZA 4RF3A 5ER6A 2IZ0A 3SJ7A 1LDNA 4IDFA 3EK2A 4LRSB 2EJVA 3GR6A 3R6DA 2B83A 2WWRA 4DWVA 4Y9DA 5JAIA 1H0KA 2Q50A 5DP2A 5TS3A 2DQ4A 2YFHA 3JQ6A 3DEYX 2ZTLA 1UUFA 2Q45A 3LK7A 5ICSA 4RGBA 2P4HX 5LDGA 3ONDA 1MFZA 1UDCA 5THKA 4TSKA 2QRLA 5JE8A 4UVGA 4CM4A 3DHEA 3ASUA 4CQLB 1E7QA 4EUHA 1KS9A 2V7PA 2OOSA 3JQ7A 4OM8A 5L45A 3DOCA 2PLAA 1HL3A 1PGPA 3UFXA 3TPCA 3VHRA 3VOSA 3FNGA 4ZA2A 1GZ3A 1I5RA 4CM8A 1H5QA 4EGFA 4TQGA 3ZU5A 1JWAB 3DTYA 1LEHA 1Q7BA 1M66A 4LK3A 1HEUA 1A9ZA 1RM0A 4R68A 1I2ZA 3D3WA 4FQ8A 2YZ7A 2OXIA 3IKTA 3Q6IA 3RI3A 1E1MA 1ZUD1 1LXCA 3Q9NA 4XR9A 2R00C 4EI2A 4PG5A 1C1DB 1DC5A 1PZGA 2UUOA 1VRWA 3H3JA 4DMMA 1LSUA 4KOAA 5B37A 5DNAA 3HUDA 3JD0A 5AQ1A 4RJTA 4R54A 3M2TA 3VAZA 2W2LA 3Q0EA 5DOZA 1OBFO 3TWOA 5FF9A 4PIVA 3RUIA 4D44A 5TSDA 1ENOA 2JKVA 5G2OA 1XHLA 1GYQA 3ZDFA 1V3UA 4QO8A 1R37A 3R1IA 4AJJA 3ZWYA 2ZIZA 1U7HA 2DBRA 1PS0A 4DIBA 4G5HA 4BMNA 4I8XA 2EP7A 1P1KA 2NUAA 4CLEA 2VYVA 4BO7A 2J3HA 1NWHA 5A3VA 1P1IA 1PJQA 3F5SA 3GVXA 4XYMA 2DTEA 4IZHA 5IAAA 4XYLA 4YWJA 2X6TA 1AGNA 3MWDB 3U4IA 3WNVA 2EW8A 4EEZA 1HRDA 3O8QA 4J16A 1WP4A 4ILKA 4CQMB 4Z0HO 4GBJA 4A7PA 1UXKA 4BOYA 1B14A 4EBFA 3C7AA 2FHSA 2C29D 4PFJA 4J0FA 3ANLA 5JY6A 4KTVE 5GZ1A 2P9CA 4YT8A 2NVUB 3ANMA 1YBVA 1MG5A 1UXHA 2C54A 5B4TA 3GAZA 1ADGA 2BFAA 1G1AA 2D4AA 3VPFA 3VH1A 1GUZA 3V2GA 1LU9A 3OBBA 1QSGA 3LZ6A 4GLLA 3WXBA 3I6IA 4L9RA 1ZSNA 3OJLA 1CRWG 2A9FA 1QR6A 2W8ZA 4A2CA 2X5OA 4JXKA 4JCOA 4QUKA 2HMSA 1GZ4A 5C7OO 3WB9A 3I23A 4DIOA 4L75A 3RFXA 2BFPA 4TMFA 2D59A 5L4LA 3CH6A 5IZCA 3RC9A 2VYND 2FWMX 3ZWMA 3DBRA 2C07A 4XB2A 1Q7GA 3IJRA 4B7UA 4ZQGA 1HDOA 1QXSA 3P19A 2YUTA 1XEAA 5IDYA 3U4DA 1IYZA 4OXNA 3NKLA 4UREA 5HS4A 3RQSA 1PR3A 2AE1A 1XU7A 3WGOA 1I01A 5CDSA 5CG1A 3U49A 1UXGA 4J0EA 2GR9A 3DFUA 3WFJA 1LSOA 5ITVA 2HU2A 2RCYA 5KIAA 1BXGA 1LNQA 3PXXA 4EUFA 2I5PO 3V5NA 1UH5A 5FYDA 1M76A 3AWDA 2OFPA 4D3FA 4OKIA 5JPIA 3FNFA 4BKOA 3UUWA 4GWKA 4DQXA 5GMOA 3DMTC 5ILGA 3KVOA 1ZCJA 3K5PA 3VZPA 2DC1A 2TMGA 4GX1A 1NFRA 3ST7A 2AG8A 2BKAA 3WQRA 3WSWA 2JCYA 4CMBA 4D3SA 4U0JA 2OO5A 3DAPA 1NTOA 4CM4B 5JDIC 2NTNA 3JQ7B 4CV2A 3L4BC 1E6EA 1YQXA 5F21A 1JQBA 1RYEA 3D5TA 3PTZA 4H16A 1XQ6A 1ZK0A 2BGKA 1DOHA 1PL8A 4G2NA 5I9MA 1EDZA 4NI5A 4CM8B 4MVJM 4J4HA 3LT4A 1CQJA 2O3SA 4NJOA 2BMAA 1ZSYA 5CDTA 1ONOA 1R66A 1ID1A 3SEFA 4TRJA 5KJCA 4B3HA 3MJEA 4MDHA 3DDNA 4J1SA 1EFLA 5HM8A 1NFQA 3D3WB 5KJ1A 2PKRA 4U7WA 3AY3A 1WW8A 1XA0A 3H9EO 3KYCA 3UAGA 4YJHA 1N92A 3B1JA 3MJVA 3QVOA 3TZ6A 4CMIA 4TROA 1I24A 3JQDA 2Y1GA 1VC2A 5T57A 3ETDA 2ZCVA 4OSPA 4HFRA 4GAEA 3NDRA 1GFSA 1B3BA 2ZK7A 1YJ8A 3WYBA 1MUUA 3E5MA 3WTBA 1NP3A 2Y1EA 4G81A 2ET6A 4NBVA 1E3SA 2AE2A 2TMDA 4ALJA 3PWSA 3RAJA 3ADOA 1FDTA 2W4QA 2YDXA 4E5KA 1HYEA 1MV8A 3ZNQA 3U9LA 3GN2A 3C1AA 3AI1A 3F9IA 3FCOA 2YV2A 1UP4A 1I10A 2PZMA 1E5LA 2OUIA 5TIIA 1F8FA 1Q0QA 4CR6A 3UH1A 4LVUA 3ZW9A 2DBZA 2GGSA 2WTBA 4CUKA 4DXHA 1NQAO 4Q9NA 4S3MA 5F5LA 3KO8A 2CMDA 5JO9A 1YL7A 3AK4A 2NADA 2BELA 4ONEA 3EYWA 3TL3A 3PYXA 4B4WA 4G65A 4WCDA 1NFFA 3RASA 3JQBA 4NMHA 5DP1A 2F1KA 2BF7A 1PWXA 3ULKA 4PGFA 1ISJA 2XAAA 1TLTA 2XPCA 1NYTA 2C2XA 3GZNA
chains in the Genus database with same CATH superfamily
1U7DA 2Y1DA 4C03A 1F20A 2G5CA 1Z88A 2PQ2A 1RPTA 3GX1A 3IS3A 3SG0A 5JIBA 1JIIA 4IKOA 4RHFA 4WGGA 2Q1YA 3MAGA 3LLSA 5J23A 5KI6A 3BIFA 5BQFA 3RS7A 3WMFA 4EGSA 8MHTA 2RIRA 4WECA 3SZLA 1PT6A 4G3XA 1WHSA 3BH6A 4HB0A 4KIJA 2BFOA 3GJYA 4N7RA 4P1ZA 2J0SA 5G0VA 4AMZA 4YRLA 5AICA 4CLHA 5CBPB 1U9IC 1L5MA 1UKEA 2SHKA 4LDQA 4OXQA 5U9CA 2CFTA 1D7OA 3W8NA 3GVHA 4DDHA 1K89A 3K8ZA 2I0FA 1IAVA 4XWGA 3ICQB 1ZNZA 4IS3A 4L3VA 3WK4A 4FLEA 1HEIA 2FPWA 1RLIA 2EW1A 3FA2A 2NTVA 4F3CA 1L3IA 1YZTA 1ZUIA 2W37A 2NU8A 5FOVA 2O8CA 1YZQA 4GI3A 1YFKA 1A82A 4JB3A 4U2DA 4UTXA 2P7HA 1P17A 1M6HA 1KQPA 3CR3C 4HQFA 4LGMA 4M8NE 3TR0A 3NEAA 4NARA 1ZQ1A 3HKDA 4BBAA 1DX9A 1LTQA 2WINI 3KWLA 4MVYA 2JA2A 1W4LA 3CLVA 4OP2A 4I4IA 4BPRA 4ARCA 4X44A 1K86A 4UHBA 3T3DA 4GPD1 3C3CA 1J0BA 4XVUA 2FSUA 4PC6A 3EWIA 2BZ1A 4E03A 2XCOA 3RVSA 1V45E 1IFXA 2JRLA 2ZTMA 5ERXA 3CNBA 1PFVA 1U5AA 2I3AA 3ORHA 5JH7B 1PU2A 2E9SA 3V80A 4RD2A 1J00A 3I04M 4NK4A 2EX4A 4DHEA 4Z6KA 1JHMA 1QBGA 3AY6A 3EGXB 4KQHA 4UQPA 4E88A 1U6KA 1B8PA 1U0SY 2HWUA 2IY8A 3ESCA 4GG1A 4OLJA 4QT0A 5EERA 4A15A 4KAFA 4OY3A 5LZ7A 1XMOB 1T9CA 4Q1EA 2C2YA 1XPJA 3OPVA 4MKRA 3ESYA 4IIHA 1OW3B 4XGIA 3RANA 4BTVA 3NC1C 3LXXA 1XKTA 4B45A 3E15A 4BMZA 2QVBA 3R5SA 1DIAA 3TIIA 1QKKA 2BR5A 3ZVRA 1A1VA 4J7CA 3ZBQA 4ER6A 2H1FA 3NHYA 4QLBA 1L7DA 5L6MB 1BHQ1 2QHXA 4ARBA 4OKSA 1YAHA 1U63A 4YAKA 3C5VA 4IF6A 4ZQCB 4PVDA 3N6RA 3WNBA 3GEHA 3PNLA 2Y6UA 2QN8A 4PYOA 4WBSA 1P0MA 1QHXA 4MWBA 3CPJB 4O6VA 4MAMA 4X6LA 1SVKA 3HU3A 1TCBA 2HUPA 3JZIA 3WIVA 4F9GA 5ESRA 3PGJA 5LQNA 3PDWA 3ZZ1A 1KBZA 1W5FA 1LPNA 5C1DA 4CFYA 3GPCA 1E7SA 3BH0A 3QX8A 3PDUA 2CBZA 2O7VA 4Z4CA 4EVIA 2IEAA 4JI2B 4M7OA 5K4AA 1P6XA 2PRSA 1EG7A 3ME5A 2G9NA 2OO3A 4IINA 2EKLA 5DFAA 3D5QA 4PANA 1W4RA 5IBCA 1UOPA 1W94A 3CF6R 3GLHB 5EJIA 1D6MA 1GGKA 2QU8A 4OP1A 1P72A 4UMDA 4YJHB 2WF7A 3FOBA 4HGZA 3ZHUA 1Z0KA 1TTHA 3Q72A 1Z8DA 1MVLA 2QVLA 2CJPA 2J3MA 2RJNA 4NPHA 2XBMA 3F6CA 3MWEB 3VTFA 3EIQA 3BCHA 4HL6A 4CUZA 1TA0A 2AMYA 3FZYA 3S2YA 4ND6A 3VR5H 4FFLA 4KGDA 3EVTA 4OQMA 3QBTA 1CSEE 1YB4A 1JHQA 3DTVA 2C4HA 5E2BA 3D3KA 1Z75A 3ZHZA 2XHEA 4UZFA 4F1KA 1L4UA 1JWLA 2MR5A 1UBJS 3ETCA 1K4MA 1R4AA 2P79A 4Q19A 5BSHA 3ZGLA 5BW8A 1VFNA 5FV7A 1XZFA 2IEYA 3E1SA 4Q4AB 5FX2A 2AHRA 3V42A 1I8TA 2Q5LA 2SCUA 4RPCA 3ORQA 5JUWA 3QXCA 1WA5A 4MKXA 4RQTA 5TGZA 1S9DA 3KYBA 2OVFA 5IW8A 4HG2A 3B2QA 1C30B 3FTNA 1NUAA 3COVA 1NNEA 1BJTA 2G25A 2XWJI 2QX8A 1FRFS 3NTLA 5DI9A 5DWQA 3KJQA 1M8GA 4JP1A 2JD0A 5TMDA 2IXGA 2WM8A 1QRSA 4R3UC 2NACA 3NZEA 1YVUA 4L0QA 4CCYB 3CY6A 3UW3A 3KK0A 3K8OE 4GM4A 4HDKB 4DV2B 3GUYA 1LWOA 4HGPA 5JQGA 2O48X 4DCOA 1XZAA 2VYNA 4LHXA 3T5MA 4BFSA 1SVIA 2A4KA 4UE2A 4ARZA 1XP5A 2WUFA 1QYXA 1EKXA 3B6EA 1JSRA 3BF7A 2P9EA 4NBNA 3IERA 2WJZB 3OAAA 4GKJB 5LNK1 1I7DA 1XP8A 1BQ3A 2QTAA 1O08A 1IEVA 3F3MA 4DMRA 4HTFA 2H4WA 5KVVA 1H22A 1U3CA 5TPWA 1UPCA 2I2XB 1DJOA 5JAPA 4BFXA 2WZQA 4NWIA 4QQRA 4UVEA 3PNPA 4MH0R 2C7RA 1KZ4A 2XKBA 3QITA 4W63A 1IXYA 2DPGA 1X0VA 3VMFA 3DAYA 3RSOA 2PNFA 5CFPA 4ARIA 5BMVF 5FUQA 3PA8A 3L8DA 1NXXA 3ODPA 4IAOA 1X80B 2H29A 2RONA 4JUFA 4TKUB 2B4AA 2XWSA 3VNUA 5EXTA 5GPBA 1CR1A 1ESEA 3HNRA 1WUKS 2D00A 1E5DA 1T24A 4KR2A 5ICFA 4AD8A 2E1PA 2OBMA 2WWFA 1O95A 1W5AA 3AR5A 3RREA 2FFRA 5FBRB 5A5FA 1BD4A 3GGCA 1G3QA 4D9IA 2IUYA 1PUIA 2OV3A 2ZI7A 3AFGA 3E18A 2RGAA 1TQ4A 3LY5A 2DBYA 3IUBA 1QO7A 3GB9A 4EKDA 3QVVA 3B85A 4JBHA 2WJWA 4BNTA 3F7TA 2F67A 1JDPA 3PDHA 4IDHA 3UMRA 4KUEA 2B7LA 1TZCA 4A03A 4IGKA 3K6JA 1XWIA 1ZC3A 1D0VA 4JKIA 3DVAB 1EHYA 1YBAA 2VTEA 2HC9A 4WK6A 1WQ4A 2PTHA 5JC8A 5JLJA 1Z3IX 2C5BA 2QI9F 1Y9EA 3A3YA 3WYCA 3TFOA 5FLXA 1QO0A 2ZZMA 3CYFA 4KXLA 1M1YB 5BXQC 3ZWNA 1S4MA 1V4NA 4I7EA 4JI6B 3JXEA 1JHOA 1XQVA 2FEMA 3DULA 3OJWA 4QRIA 5BR8B 1AN0A 2C8VA 2XYPA 1OX5A 3GG9A 2BI4A 2Y71A 1FVXA 4RSGA 3NX4A 4QBIA 2FE1A 1NPYA 5JDCC 3SX0A 3HK2A 1VG1A 4LSMA 2JFBA 4CYMA 2WA2A 1D03A 3MWGA 5F1OA 5HFJA 1XLUA 1KO8A 1QIEA 2NZ8A 3GFFA 3LCRA 3FZEA 1Q0ZA 3FB1A 5C37A 5I7WA 4PLYA 2X40A 2XDYA 1ELOA 1HETA 1ZNWA 2B0JA 3W5UA 4B3CA 2COEA 1V25A 1SHLA 1UL1X 2XUJA 2EJBA 2XIJA 3VC2A 5J4HA 1TL7C 1N8TA 4ITRC 1E2DA 4JGGA 3BRCA 3RYHB 1CQIA 2CVOA 3VHXA 3CR7A 3LQ4A 2J33A 7REQB 2IYQA 4QPCA 1QRAA 3KZCA 2JGDB 1SCQA 4NS1A 2WZBA 3PC8A 1LD3A 1OWPA 1Z5NA 4IEFB 4BJ5A 2GJKA 4R98A 4ZI3A 3UC5A 3ABZA 1YQWA 2A1UB 1E6MA 2F90A 2OBBA 2X8JA 4GQBA 3GROA 4NK5A 2EEZA 4NNPA 5NULA 2ZROA 3GGOA 3KAQA 3WE7A 5MF6A 5GADl 3B6KA 2CV2A 4B3RB 3OHSX 2O5RA 3OUZA 3JVDA 4ZQBA 5FBZA 3R9XA 1JR6A 1JI0A 2GPAA 1J23A 4IUCS 1G4HA 1UJMA 2D2VA 3OZSA 5TQ0A 4I4TB 5DMHA 2Z6UA 3VDQA 3EFEA 4BCCA 2DLDA 3PICA 5CJPA 2UU9B 4JZYA 4Y67A 2PKYX 3ZGYA 5LZ4A 4KR3A 2Z2YA 3VQTA 2QG6A 5JV5A 4NENB 2ZUSA 3O1IC 1N5RA 3C2QA 2PZKA 4Y6SA 4QOHA 5FA6A 1CJMA 1L5RA 2Q21A 3F6BX 3CSDA 3O3NB 1MDFA 2I4NA 2MR6A 3WAJA 4BZXA 1WV1A 2E6UX 3W2GA 4NNJA 3SLKA 5DEIA 4OL0A 1ZLYA 1EEXB 1PQUA 2GK4A 1ZI8A 4JVNA 3B51X 4ISBA 4PGHA 4PYKA 4YX9A 2HR1A 2OB1A 3SBXA 1Y9ZA 2A94A 1M6VA 1VJTA 2FRDC 3H7AA 5HCNA 4DA9A 4PU0A 5JZSA 5B12A 1FFYA 3A9CA 1QVRA 5ALTA 1KJIA 3QKSA 3PRYA 5IPFA 3VAYA 2GETA 2OSBA 3L0PA 3S2FA 1NX6A 3T15A 1F5SA 2FDCA 1T0JB 3LNTA 1S7CA 1KZYC 2NYUA 2XX3A 2YHIA 3NJ8A 1VZ3A 1W34A 3W9YA 2JFGA 4M53A 3WGLA 4NCBA 1SULA 1SZJG 4NE2A 4C20A 1CJSA 5LMCA 2INGX 4L2IB 4M9XA 5KYWA 3EC1A 3DD1A 3MMSA 1OD6A 3AHHA 2VDWA 2WQZA 3HE3A 4D43A 1YMUA 3QWBA 1CUXA 4CFSA 2GILA 3RIGA 2HQBA 1R8YA 4F86A 4Z2AA 4Y2UA 1Q3TA 5LR6A 1A9TA 2Q4EA 3L8ZA 3J81k 3UJBA 1E6KA 3Q10A 3QM1A 3G8BA 1MLDA 3I9NA 1YV9A 1GEEA 5CB4F 3ZS8A 4R1SA 1TAHA 4MDEA 1NR1A 1D4OA 4NOKA 5ITWA 4MEAA 2QL7A 2RHMA 2V7GA 3GT0A 4X7MA 4WXEA 1TAQA 1YS7A 4I50A 5A0TA 4HGOA 2E4ZA 3W6ZA 1K7FB 2O2XA 3L6DA 3WP0A 2B94A 3C8DA 2GHIA 3I8SA 4A10A 3EARA 2AF3C 5KSWB 2QUKA 3IBYA 2EAUA 1W4BA 4QAJA 3E82A 4ZYUA 3LPAA 3L0OA 2AG0A 3M6IA 4MRPA 4QXPA 4MCHA 2YN0A 1WBBA 3ADDA 1T35A 1KKMA 2PJZA 3PQ8A 4TUYF 4G4SP 2P2GA 2F8MA 1F6DA 1Z22A 3QKTA 2CXSA 1PG5A 1M2NA 2ICAA 2I2AA 2PKQO 3IILA 3L92A 3LUAA 4XD7D 2ONJA 2QMQA 3UJ6A 2QD1A 3ZHCA 5B1YA 3H9GA 4MV5A 3ZCPA 3N6XA 1BIFA 3DS8A 5FHRA 3ZU6A 1T6BY 1KJZA 2EJCA 2R8ZA 1YZYA 4ZTBA 1O0BA 5TJHA 3R5TA 2CLCX 3F8WA 2Z5FA 3WB1A 4DGQA 2CXTA 3W7VA 1KIMA 2PSHA 2XXBA 3LCCA 3Q7IA 3BJEA 4FFBB 3V1YA 2P6PA 3Q0IA 3G3EA 3H5RA 1QWOA 2BRUC 1MNQA 1GD1O 2A86A 3F5MA 3OZAA 4IEIA 1L5NA 4EB0A 1V6AA 2Z1MA 1QGUB 1MP0A 1G0OA 3D6MA 3E3NA 1CUJA 1P44A 4FYVA 2N1BA 4FOPA 1EA7A 2CD9A 2IF0A 1E7RA 1Q3KA 4MVJG 1SIWA 3AWIA 2IZZA 1Q6ZA 4B7CA 2BKEA 2OCYC 3GGDA 4LY0A 2P2LA 4MI6A 1UBUS 4LJLA 5ALXA 2QG4A 5EZSA 5K2OA 4Y2XA 3GH3A 2WDPA 1K5DA 1SUPA 3KLOA 3FCSB 3JZAA 3EOZA 2FSVA 1ZN7A 4MP6A 4R4JA 1YFJA 2WM2A 2JK1A 2JZNA 4AJNA 2IEZA 4TTPA 3VU8A 3PS9A 3EMKA 3ZBTA 2UZ3A 4YDHB 2J4FA 4G37A 2C4WA 2QT9A 3OC0A 2NZ2A 4E21A 1QZ3A 2DTDA 3G2PA 3JV7A 1N6RA 3KSRA 2OYRA 4DIEA 5FBVB 4ETWA 5IJ0A 4LFAB 1MJFA 3HB5X 4D56A 3WXMA 3M4JA 5CLJA 3W8DA 5AW7A 1WPRA 3PNSA 2GJ8A 4REQB 3LBYA 4E4YA 1N5OX 3PJFA 1KSJA 1PTJA 5GM2A 3AYZB 2XVYA 3RVLA 2VK8A 2GK3A 2R9VA 5AM5A 3EEOA 1H4TA 2JL1A 4MKZA 1HNNA 1T0PA 4ZQEA 4D6PA 4UXIA 3JYLA 2ONYA 2FPLA 2J3KA 4RE6A 2PKCA 1ZUWA 3I05A 4Y1EA 2HJRA 3VOAA 2C9DA 3PP8A 1A8HA 1VLLA 2QDKA 4YN3A 5G4LA 3MYYA 4BO3A 5AYVA 1DV1A 1IJKA 1MZPA 2RGUA 3TBHA 1J07A 4ZDIA 3UXEA 3P52A 5D5QA 1KQNA 4D6YA 1MJNA 2O2GA 2ZBDA 1RKBA 4AY4A 2H1LA 2GBIA 4M7RA 1ADYA 5COAA 4YP1A 4D45A 1V1MA 2ID8A 2P9HA 3NTXA 3W5HA 4U7HA 1XEWX 4C7VA 1W4ZA 4P3PA 5C9ZA 3AR9A 4DIDA 3AFIA 3PJDA 1QOPB 2X5XA 5FDFA 4NY1A 3O95A 3BIJA 3RTGA 3QIVA 1HNXB 1T9AA 1RD4A 4MQFA 2B2CA 2W6QA 4OJMX 2GT1A 1QH8A 5M29A 2IU4A 3NV9A 3IEIA 3SVZA 4P38A 3KQNA 1NTRA 2A9KA 3O3MB 2OBFA 4HRXA 4RUKA 1JG4A 1GYRA 4QQ8A 3PF8A 3RGWS 2IF2A 3NVDA 4GOJA 3MCTA 3FYUA 4FGUA 4B71A 1IBLB 4HYYA 2PFGA 1L1EA 1S8OA 2FY8A 3EDMA 1HFKA 1UJBA 1NF8A 3HVHA 2F9MA 2JGAA 3CRRA 4NZ9A 5B1SA 1IMOA 3LYUA 1JG7A 2WFMA 2I8AA 1JFLA 2OECA 1A88A 3MRVA 4IR7A 2CT8A 1YC2A 5SY4A 4LC0A 3EVAA 4W6QA 3O31A 2G77B 4R1UA 3TAHA 2FYTA 1D1PA 3FZGA 3OTHA 5EHNA 2X5NA 1EFVA 1RRVA 4UUQA 4EYGA 2GXAA 1EVZA 4DV5B 4IEEA 1DG9A 4JQSA 2XQKA 4OHUA 7GPBA 1E69A 3K8YA 4CKEB 3FMFA 4F84A 4LJ9A 3LA6A 2WICA 3ORSA 3QLJA 4Y2HA 2F00A 2TMYA 4NE7A 1IK4A 2P0AA 1E4EB 2CL5A 4DA7A 1PL7A 2VXYA 1SZPA 3GUCA 3ZCXA 5BNIA 2BONA 4XM2A 4V0QA 3FGOA 4I3FA 4QJ3A 1C14A 2WF5A 1CS4C 1RQ2A 4FFRA 4BNZA 3EPHA 5TS2A 4W7HA 1P33A 3TQTA 2IZ6A 3CZAA 2A7XA 4LRTB 2WIAA 3GRFA 4PLCA 3FNBA 1G8PA 3LBHA 1YOBA 3B1WA 1MAWA 3AKYA 3FGPA 3O94A 4M9SA 4BNVA 4EO4A 4FE7A 3TTYA 5IC5A 4UHDA 1ZGCA 3MFQA 3AEZA 4W7IA 1S3GA 1Y6JA 1ZJYA 3ZN2A 5HUQA 1DQPA 4EYKA 3BULA 2F62A 3BWEA 4M38A 1EFAA 1QCDA 3PVSA 5E4FA 5JBNA 4LNUB 1QPBA 1AGYA 3ZDAA 1KE1A 3EUWA 5AHWA 1K0UA 1VSUA 3L0BA 1LK7A 3OH8A 3D6AA 4GOKA 4ZHQB 3FAZA 1H9AA 2HIAA 2XQIA 3TR6A 3FDZA 3PFWO 4OBBA 5ELXA 3DUFA 4IDNA 5EIAA 1CIJA 3T95A 3U2QA 3D3JA 1PSWA 1E1KA 1MC5A 2Q4TA 1VLZA 4YI3A 1E1NA 3WLMA 1YGPA 1W25A 4OIMA 4CCSA 1EVIA 1V8DA 2VHZA 4F6RB 5CR9A 3L05A 2IITA 2QLJA 5D7NA 4RCYA 5C7YA 2NTYC 2HBQA 3A6JA 2WVAA 3CLSD 1LZKA 4JS0A 2GO7A 3TLCA 3C4VA 2M9MA 4TN5A 2QY9A 3P9ZA 4O4IB 4QEDA 4EQ6A 3BYZA 4WBNB 1U81A 3K96A 3FRHA 3UEOA 3FN4A 4W5QA 3STUA 4K6OA 1M7BA 1TQDA 1AKWA 2HJWA 4MINA 1SWVA 3JY6A 3UJ7A 4AZTA 4BZZA 5CA1A 1JKJB 2A0FA 1R6DA 3U7GA 1H8ED 1ZEMA 1XZ8A 1IRIA 2RGYA 2GESA 2WYHA 2QLTA 3M8KA 4FILA 4K9SA 1J0EA 3TD6A 2V1UA 4UCWA 4WZZA 1MO4A 3GPDG 4C4ZA 4HJXA 4RQUA 4V0RA 1SKUA 3I39X 4AF8A 1XTTA 4IUDS 2R4QA 4HRVA 3AXTA 2F1JA 1T2NA 5CU7A 5CYPA 1E1LA 2C59A 5T4HA 2X8WA 3LVRE 3I2FA 3LY7A 1UAYA 1M72A 3E7PA 4Q1DA 2H8KA 3UVEA 2JCXA 3HFGA 4C0BA 5IDXA 2RGRA 3RUPA 3HJHA 1UQTA 2JLAA 3OY7A 4BP3A 1EXDA 1UXIA 2V0CA 1U8EA 1X7DA 4QYIA 3FMPB 4CUJA 3E8XA 1V1RA 1DXYA 2NIPA 4TYNA 2CFRA 3HDHA 4FBGA 4PYMA 3RUHA 2CMGA 1C9NA 2AB0A 1H4VB 2HYDA 4AECA 2VF5X 2BYTA 3WRXA 1N9KA 4YJDA 1JT2A 4COOA 3VKGA 1T36B 3IB6A 4A26A 3O8QB 1P1RA 2KSQA 5JAQA 3I09A 2YXDA 3T34A 3GLGB 1UF9A 1YZLA 2NU7B 1P6QA 3C3XA 5DE3A 4RK0A 2IC5A 1TX4B 2ECOA 3RU9A 3U37A 4C08A 1RKXA 4HC4A 4X94A 1XEWY 1EHCA 5FNVB 2RAPA 3FHOA 4Q7EA 1HYHA 1X7GA 2EWWA 1N57A 3GJ4A 2MT9A 2GO1A 4PHTA 1ZJ4A 1P0FA 4L57A 4PPGA 4D9CA 2BZGA 3UJAA 5KWVA 1TM1E 2BISA 3H2ZA 3CH7A 1IU9A 1AKQA 1YDGA 2BF4A 2FG5A 4QUEA 5G1OA 3G17A 1JB9A 1KSHA 2GCIA 2QTLA 5DLEA 2P9YA 4P4SA 4QOJA 4KYUA 5HCUA 4DR6B 2Y0CA 2I6TA 2ZBRA 4V1CB 1JT9A 3ND5A 2GM9A 3NO4A 5KVSA 4TL7A 1XSEA 3MOSA 1MJGM 4RLQA 4ZREA 3TI7A 2V7WA 4DC0A 1YR2A 1G19A 4M55A 1Z6XA 4PG7A 5GJCA 1MOQA 4CM1A 4LS3A 1J5PA 3LRTA 5DBGA 3RD5A 3O84A 3R4CA 2ZSDA 3FVRA 3VPSA 4EVRA 7YASA 1SBTA 3HLKA 3IXMA 1DFIA 1DIGA 2FR1A 2IYPA 3LF2A 1J39A 1OC2A 3GRYA 4XD7A 3AI3A 5COBA 1P77A 2Q46A 1T8RA 2YUIA 4AJLA 4F06A 1LVGA 4Z1OA 3NBQA 2VS1A 5DK6A 3I34X 3PPWA 4E22A 2D2FA 2A9OA 1KHTA 4ZZ3A 1G2IA 2ORVA 4WA7A 1K27A 3WIBA 3IEXA 4IWNA 5JXJA 3DMRA 1K8RA 3U60B 4Q1BA 2DUMA 4HYEA 1G9XA 3GDOA 2HV9A 5SZKB 5C8DA 5PGMA 5CVTA 1D2RA 3PHLA 1V71A 2WV9A 3CO5A 5A6SA 2F6RA 2EL9A 3KJIA 5HJEA 4XB6B 1FSSA 5DYIA 5F35A 4QZVA 3HH8A 5FLYA 3UMFA 1YR9A 2VJOA 2C2HA 4PF1A 4DLKA 3RVJA 2QAJA 1H1LA 1O4WA 3L0YA 2JBAB 1JDTA 2C1EA 2IZ5A 3LI2A 2DWCA 4C0AC 3C6MA 3KXIA 4EJSB 4ZFNA 2KW5A 4X3PA 5H7XA 2CVHA 1X77A 1PQPA 4JQCA 3V8MA 3N8KA 4A8JA 2RCNA 3Q15C 1BCSB 3SICE 4M60A 3OQNA 2QN7A 1DCMA 5BSFA 4W5NA 1SZDA 3EXFB 1IN8A 1OI7A 3D6UA 2A58A 3IALA 3M81A 3MTIA 4MXDA 2PGLA 3RC8A 2WIKA 5DNCA 3ET4A 2WB4A 2N42A 3H5IA 5HF5A 1UPFA 2H2FA 4FEEA 2VTBB 4TN1A 3VKUA 1IN4A 4OJQA 3SQNA 3ZK8A 4P0PB 4Z3DA 5I5GA 1LJUA 2C7VA 1L3BA 2WVJA 2WHEA 1ZRSA 1FYEA 1UPUA 4L9AA 4Z8XA 4CV3A 2P6NA 3RSSA 5BOSA 3GCWA 3LXUX 5EJ4A 1J2YA 1L7EA 3CT6A 2VCYA 4XUDA 4ZU6X 2OWEA 2WTXA 1DAOA 4MPTA 1ZR4A 1G2OA 4DM3A 2PGXA 1XYGA 3EFBA 3KVNA 1FDIA 3GDFA 3RTBA 5KNCH 2PFSA 1GPMA 1NNSA 4H3SA 4EKEA 2K2WA 1Y3DE 3KTAB 1YF3A 4MS4A 5B7GA 3KQTA 1N4AA 1MPXA 3LYAA 4KUGA 4GI2A 2HU8A 5B3LA 2WD9A 3ACDA 3ENQA 2D74A 2OHFA 2VLBA 1X1SA 3NHWA 2ZJOA 2GZAA 3GP5A 3PFCA 4Z0TA 3L6UA 3BK2A 1QE0A 1BE0A 4QXAA 4WH0A 1Y5MA 3KDSE 1QRUA 1PJCA 4GLBA 1DCKA 4EJSC 4ER7A 1DS6A 2P2DA 3JZFA 5B3JC 5I8PA 5IULC 5JECA 4OQYA 2ZXFA 1MXHA 5ENVA 1KTVA 1IJBA 5KTMA 2H2DA 2PMBA 3AP2A 2V5AA 5IAKA 1JZSA 4FXPA 3V00A 3FVVA 4GPBA 2G82A 4D0GA 1CU1A 1UMDB 3CKYA 1F06A 1SEPA 3DBLA 1GPLA 3GCGA 1YS4A 2FPSA 5HF9A 3T5TA 3VSDA 1IXZA 4AY6A 2HA3A 4IX9A 2NVBA 5DHPA 2J9RA 2WFAA 2WNHA 2FSFA 5FOXA 4CIVA 2ZULA 2OHHA 5KJEA 2B30A 1T8TA 1GHTA 2ZJ7A 3QLEA 4OB8A 1P1CA 2OO5C 5GV7A 3VU3A 2G1KA 2ODWA 1TIBA 1UBRS 3PFNA 3L4SO 2Q8NA 4RH3A 3O8DA 1QP8A 5JNTA 1XNHA 4PR3A 1G60A 4RFLA 3AL0C 1JQEA 2Y05A 1R9GA 3I2GA 4J0IA 4MR8B 4Q01A 3ZLBA 2QENA 2YCLA 3R5JA 4U5XA 1MOSA 3S1AA 2CSUA 3V48A 1T4BA 2P6UA 1CQWA 3KXLA 3N2GA 3JYHA 3DHYA 2VOJA 4NTZA 3JSAA 2PL5A 3PIRA 1GPAA 3BG5A 2Q1WA 4B82A 5K0SA 1LRLA 2HN9A 3HKBB 2X9GA 2N3ZA 3E5NA 4Y0VA 4YRPA 2HF8A 2ZTVA 3MVEA 2Q5QA 3OPMA 3HWWA 3V7YA 1PCXA 3NONA 1IULA 1K7YA 2B5WA 2QQ0A 2V7QD 2Z4SA 4RF5A 2B69A 3EIXA 4DDWA 2W2QA 4KQ1A 1SB9A 4HLQB 4US0R 3VVCA 1TLLA 3BTVA 4J07A 1KK2A 4I9UA 1AUVA 1D1TA 1UBSB 1Z2PX 4FP9A 3B60A 1KDVA 1RC1A 1WLYA 3NXSA 3NG1A 3I2HA 5JZVA 5B53A 4P32A 2NXEA 4RA9B 3VPAA 2DP4E 5LA6F 3TL6A 4ZEXA 4D5EA 2OMKA 1NUPA 2G8LA 2OKGA 2X58A 2CJYA 2OGWA 1H2AS 4FYHA 4B47A 4EFNA 5EY5B 4O4LA 3RTDA 3L7JA 3BCSA 1Y6FA 2AWNA 4GVLA 5K9ZA 1MRNA 2JC3A 2XUPA 4IF4A 4IIEA 1N75A 3MZ0A 1CRPA 3OG9A 1P2GA 4HDMA 4BV2A 3T94A 1GQSA 1RXCA 4KJZA 3WK7A 2GZSA 1KVSA 1NN5A 4AZVA 2VF2A 3GLQA 1LDMA 4QO7A 3GAAA 1P31A 4PRZA 3OIWA 1GPKA 1RHUA 1XELA 5DHFA 1RXYA 4WZAA 5FFMA 5JBIA 5KPDA 1CWUA 1LQUA 1QLJA 1SEVA 3IKVA 1TM4E 3OLYA 2PUBA 5EWMB 5ESXA 4WNAA 4D3DA 2O8DA 1XVLA 4KFRA 4LIPD 3TRFA 4B87A 3N5KA 1VYUA 3HJTA 1OT3A 1XHEA 2ONKA 5G02A 4MR7B 3KSZO 3DHVA 1ZM2A 3TOSA 1B3RA 3A9UA 3QU7A 4XW2A 1MZVA 4KWEA 3A10A 4YRAA 1NNI1 3WB2A 1E9EA 1RLOA 1UANA 2HEGA 1KO7A 2QTZA 2AG5A 1JQ3A 3GF4A 3TX6A 1FZTA 1LSJA 1HT0A 3SR0A 3RW9A 1JLSA 3WWPA 4Q93A 1KI1A 2OBYA 1CJBA 3INTA 1QB8A 5IJWA 5IXJA 1OROA 2LVBA 1H8EA 4NESA 1GPJA 1IB6A 1XOIA 1X2EA 2WJPA 3EW9A 4MW7A 2WG2A 4N0MA 3GNTA 2I7VA 3GLGE 5TE9A 2CXNA 3WLFA 3U44B 5LQSA 1B6TA 3P2MA 4YBZA 3OOWA 5A5GA 4D8YA 1YO6A 1E3JA 4AO7A 4Q9IA 2J07A 3WKEA 2C3UA 2V7TA 3Q3IA 1CQXA 2W2KA 3BE6A 3P5SA 4AY3A 1IUOA 1Y3FE 3CN7A 3EWSA 2BE7A 2IPOA 5E2AA 1ULZA 3TE7A 2Q9AA 4YT2A 3GRZA 3QYJA 3RPEA 3VDNB 1JVBA 1USWA 1FFEA 4AG3A 3KLMX 4B7ZA 5JAZA 1NF9A 5BN5B 4OD0A 1WXFA 2FFJA 3GHHA 1FUUA 2CZCA 3D0QA 4GNRA 1HSOA 1ZGBA 4TMZA 4WEOA 3V1UA 5P21A 2IOQA 2WTAA 2J3EA 4ALIA 2D8AA 3VV3A 1B6SA 2YN4A 1A3CA 2NXNA 3HCCA 3WRYC 2YJNA 3ZWWA 3LUDA 4EZIA 1HE4A 2Z83A 1OLSB 3TZHA 5C3UA 5K8TA 3HR4A 2BM1A 4BC0A 2F3QA 3KLNA 2Y1OA 2NXCA 4CGYA 1SQ5A 3L84A 2HWXA 3ORRA 1SXIA 2GHRA 4C0QC 4W99A 3O0TA 2I3GA 5BT9A 2Y9MB 1GN9A 2YWGA 5JSZA 2IPMA 2G0TA 3A70A 3H2GA 4HF7A 5H4GA 1NYQA 1QU2A 1C4XA 3RNLA 1W5SA 4RFSB 3TR5A 3GXOA 3H17A 5AW4A 3L7AA 1NR7A 4M22A 4LYEA 4YDRA 5LL6P 3EC2A 4E13A 2A5YB 3G2JA 5A9RA 4JI0B 2QTWB 3NHLA 1N8NA 2OQIA 4BEWA 3ONFA 4PHFA 3ITKA 1B4DA 1GA4A 2ZITA 1LVHA 2X6RA 2BZSA 1VKZA 1PQ4A 2PWBA 1JEQB 1E92A 121PA 1YONA 1L7OA 2AN5A 4OHMA 1O94D 2VDQB 2NWQA 1D07A 1MABA 3U1BA 4PIMA 1L5YA 1KC3A 1DZIA 3ETGA 4IZ6A 4XIGS 1OKKD 3TL2A 1NJ2A 1O97D 4DV7B 2Q07A 3NHPA 4HWOA 4IFTA 3EEQA 3TINA 2HRRA 1VHTA 5E6SB 1CFZA 2XNKA 3F0TA 4KBGA 2BKXA 3HCRA 1G18A 1G6HA 2R2GA 2GQ0A 2ZTSA 1EIZA 1P2SA 1YU9A 3HP7A 4PS1A 3OQ1A 3U16A 3FB4A 2C77A 3VO9A 4JI7B 1BS2A 1DJPA 3AO0B 4G26A 3ILHA 4YRDA 3WWDA 3EQ6A 4Y9RA 5JWHA 1BVRA 1ZXBA 4I14A 4YH1A 2PMDA 4WXHA 1VL0A 5LLDA 3V8BA 2PGAA 2IT1A 4I1OA 4QFBA 3KQHA 5H4HA 2VUHB 2RK6A 3JQEA 1Z73A 4UNPA 2HQRA 2RH8A 5TNXA 4BP9A 2OA0A 1KMHA 1UMKA 4BKQA 2ZBQA 4CDMA 2QMOA 5AK4A 4JOQA 1T9BA 1DEKA 1I1HA 1WB5A 2RG7A 1G8YA 2GEDA 2Y76A 3C0KA 2GPNA 3AF4A 1WUHS 3KXDA 2XCQA 3WRVA 1Q7EA 3FW1A 1TKRA 1DEHA 5ERGB 1VMKA 3PPVA 4L5BA 3V2HA 4FI3F 2YW9A 1DWQA 1ZAKA 4KREA 2OFXA 3EG5A 4KVFA 1RYBA 3BFXA 2OP1A 1O2DA 1T2UA 1V1JA 1WOMA 1WZEA 2NNWB 2R8BA 4L27A 4ZYVA 2AD1A 5AK0A 1RQPA 1Y4ZA 3EMBA 3L6OO 2FU5C 5A7GA 1WF3A 3VYTB 1SXJB 4Z9BA 2D5BA 4FMDF 1CUAA 2YV1A 3DLAA 5K8VA 2GBPA 4MRAA 3MHTA 3TOXA 4GBED 2DH5A 1PL0A 1P73A 3DHNA 3HSKA 1KH2A 4MLDA 8AT1A 2D06A 1XQ9A 3BF8A 2QRKA 3QNMA 3M9XA 4G5XA 4C7JA 5B6IA 2W0SA 1Q5PA 2H3EA 4Q7QA 1GQOA 1IBSA 2DPLA 3OHMA 1IUNA 3GLVA 3A1DA 1DRWA 1IE3A 4MIEA 5ADUS 3E3OA 4X8OA 3ZDYB 5M3BA 3CCFA 2ANCA 2FQ1A 5GONA 5B1EA 2B20A 4LZZA 3H5NA 4YJFB 1PYDA 3O03A 1I4EB 2JGKA 4IIUA 5FEUA 1N5JA 1RXWA 5CNMA 2X6QA 4OHCA 1N6HA 2B2NA 2I6QA 1NSFA 3FCUB 3OETA 2FV8A 1Z5ZA 4LOAA 5DPMA 2W9XA 1XAHA 3TB4A 1A7AA 2Y1KA 2JJMA 1TECE 3EZNA 3KQYA 5CEJA 2VHQA 3N9IA 1ICIA 2FN9A 2MWMA 4NZYA 1XROA 4URVR 1XL1A 4LF8B 1EFPB 1HT1E 1Z4PX 2V65A 2JIMA 3LYHA 4RULA 1E59A 2KQUA 3EHEA 1TTTA 4OREX 4RMIA 2BTQB 3LV8A 1PK8A 3OMWA 1E4OA 4L85A 4WFKA 4AG6A 4ER0A 2IDMA 1MTOA 1R4MA 1R8SA 4R2IA 3TBFA 3B5EA 1T34A 2JS7A 3OOHA 4LYFA 4RJLA 3GN1A 1PF7E 3MAAC 4IXMA 1SXJC 4QBHA 4DTIA 5BV0A 4EPVA 3HYRA 4JJGA 1KFKB 3VVLA 2I67A 1NE7A 3O2QB 4FJ0A 3KR9A 4RJ2A 3TH5A 4GUDA 4CF4A 5CFLA 1TT5A 1SHKA 4QTTB 5ULLA 2B61A 3EPJA 2GD0A 2RGXA 1VRCA 3JALA 3USZA 1XFAA 3QF4B 3JQAD 5BWNA 2XITA 3EIUA 2P90A 2IYVA 4OL9A 1DKMA 3C6YA 3ELYA 3LF1A 4LV5B 1OPXA 5DF1A 4ZMSA 1WW2A 3QOWA 3V9AA 2E89A 4GWGA 1SPXA 1SOVA 4EYQA 5JAMA 1L5KA 3EXIB 3OVMA 2ORED 3P4UA 4F5DA 2M6LA 2FG7C 3FDFA 3CX8A 1TM7E 2OHIA 4C6RA 5CB8A 1VGVA 5HKLA 3OF3A 1NQ5A 4UM7A 5HOQA 4RX1A 4OIFA 3GXBA 1RI1A 4D9KA 1T2CA 5F3DA 4H0FA 6NULA 4EHDA 1A2KC 3AVTA 1FDUA 4CEHA 3VR6D 1M1XB 4DSTA 1AZWA 1BEUB 4R9VA 4KZPA 3ZNPA 2CLFB 1Y8QB 2O7NA 2V7QA 2LIPA 3G9XA 2FETA 4RIHA 5CCBA 1W87A 1C0KA 2PX8A 5KYVA 4DLNA 1TJ4A 4B43A 3WWCA 3EQ2A 2N46A 4UUMA 4C7KA 3VKHA 1CK4A 2BR4A 3EEYA 1QX3A 2QJOA 1H23A 1YUBA 2AR0A 4IIJA 3BB3A 2VIIA 3PITA 4GLFA 4ZCSA 3SGLA 3AOEC 1QIKA 3I4FA 3QZUA 3ZE1B 2RHTA 4XGKA 4ZDJA 4R9NA 2QW8A 3AUSA 3MGBA 4QSHA 1NNLA 3NV7A 4JKYA 4L7QA 4EFLA 2WNIA 4ZYWA 1ZCFA 4OX9B 1OYYA 5J4LA 2P2SA 3L7MA 3OZEA 1KI4A 1RJDA 3Q41A 4XUEA 3KZVA 3THWA 1UIRA 1P8JA 3H5OA 1P80A 4PC3A 4L0CA 2P91A 4LOIA 3O5AA 1UBTS 3ZHYA 2PBRA 1XMSA 1AQIA 3THXA 3U3RA 4YYZA 2DU8A 4A16A 3ANXA 3V2IA 4U4AA 4A5SA 4RVFA 4CIWA 5BR1A 3OP4A 1I6LA 2Q2VA 4XIJA 4XD2A 5ALUA 2NUPA 2Z6AA 3M6LA 1G3MA 3EH1A 1PRYA 1R6BX 1K97A 2IIBA 1UXJA 2VQSA 1QC5B 2B8JA 2JAHA 4B8WA 1EVQA 2OG1A 3MJFA 3P2KA 1RADA 4RD3A 1AHHA 3UQZA 3E1KA 1PW7A 3PR3A 4TWBA 2HA2A 1E6UA 1VXRA 1ONBA 4X1KA 5BQOA 1T3GA 521PA 3S2EA 5A1JA 5CK4A 5CITA 4D26A 2O8FA 4X7BA 1WF6A 3T99A 4Y7DA 3V4FA 3N59A 1GXSB 3N8HA 3NT2A 2JJ2D 3FE2A 4LTNA 4OI1A 1ZFNA 3WIDA 1QM5A 4I5EA 4J0HA 3P9QA 4LCJA 3KYDA 3CBQA 4Q3EA 3R3HA 5T8KA 4YIHA 5HNKA 2GARA 2YNMD 3D8TA 1OPRA 2D0OB 2ECQA 4U2FA 5GOZA 3SJZA 3SFZA 1AB6A 1KJNA 2C2KA 2QTRA 3TNYA 1KI8A 4X90A 4MPDA 4M0PA 3AETB 2R8XA 4NZNA 1WWKA 1L4GA 2BEWA 4LPSA 1AGXA 1J0CA 5AHOA 4A0GA 3N2YA 1VI6A 2ZE5A 1Q83A 5MFZA 3NKVA 3I5AA 2XRYA 4WJLA 3RRJA 4YCJA 2GPTA 1NAIA 4HFNA 1F2UB 4MW4A 1IHOA 4XM0A 4OHRA 1ZXLA 3I9JA 4DLSA 5BSWA 1OJ7A 2OHOA 1VPEA 1GWNA 2FMHA 1GG8A 5C3MA 5B6JA 1T2FA 3U5ZB 2R4TA 1OAOA 3JQFC 3NH6A 4MKGA 4MVJP 3SS8A 3UMVA 1J97A 3M0EA 4KQWA 2JI8A 4B34A 3QVSA 4RLFA 1GCOA 4KHZA 4RPHA 1W1UA 1YK1A 1ETHA 4C76A 3BZUA 5MGNA 3QBDA 3V33A 4RNCA 3RAPR 5FR2A 4IXWA 3RUAA 3SCZA 1G59A 1KF0A 4RKYA 4IMPA 2PIDA 1Z5PA 2C8JA 2G0AA 3TJZA 3X44A 1JBEA 5KQSA 5HQ3A 1MAUA 2VXBA 4FSHA 4W8OA 1CERA 2ZR7A 1B0UA 5F1KA 1C7FA 4KDRA 1DX6A 2BUBA 4R01A 5GM1A 1RE0A 1XD2B 1DDGA 5KJ6A 3TX2A 2WP8J 4YR7A 1A97A 4BECA 4CWAA 1PR5A 1QYCA 5MDHA 3A3PA 1E6CA 3T6KA 2ZM5A 2WT9A 2WDZA 3GRRA 3DT6A 3PA6A 3DZGA 4ML3A