4YRBA

Mouse tdh mutant r180k with nad+ bound
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
303
structure length
206
Chain Sequence
PPRVLITGGLGQLGVGLANLLRKRFGKDNVILSDIRKPPAHVFHSGPFVYANILDYKSLREIVVNHRISWLFHYSALLSAVGEANVSLARDVNITGLHNVLDVAAEYNVRLFVPSTIPRTIYGVSKVHTELMGEYYYYRYGLDFRCLRYPGIIMMYISDCLRATLEVMEAPAERLSMRTYNISAMDSNARKDWGWKHDFDLPELVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-threonine 3-dehydrogenase, mitochondrial
publication title Structural insights on mouse l-threonine dehydrogenase: A regulatory role of Arg180 in catalysis
pubmed doi rcsb
source organism Mus musculus
total genus 60
structure length 206
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2015-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yrbA00
5ITWA 4OQZA 3C7DB 4WASA 4Y6RA 4AJOA 4ONEA 2I3AA 5EJ2A 3BMNA 3WR5A 4PZCA 2HDHA 4R5HA 1P9LA 2FPPA 3ZHYA 4GVLA 3JD4A 3WNQA 2P9GA 3K2BA 1EUDA 1Y8QB 3KVOA 3H2SA 3HB4X 4KQWA 5TLSA 3D3EA 2DUWA 1R0KA 3AOEC 4BVAA 1VLLA 2GZ1A 2JD2A 4FDAA 3M1AA 1I2BA 3BMCA 3DBLB 3CTMA 3HUDA 3ZH2A 7ADHA 4PVCA 3UHAA 4YJDA 1GD1O 5ILOA 2AE2A 3RFVA 1G1AA 1PGQA 1P45A 1O8CA 4CL8A 3JTMA 4HADA 3RAJA 4OOEA 3LLVA 2VUTA 5B12A 1NR7A 4NDNE 4E13A 2P4HX 4ND5A 1YL5A 1E6UA 4IY1A 4X54A 3WGYA 1TI7A 4RPHA 2WJPA 5K6AC 2J6IA 4LSMA 4PIVA 4ALNA 4TRNA 3D5QA 1CEQA 3WLEA 4OGWA 1PJ4A 3ZWNA 1PZHA 2LDBA 4AJKA 4BNZA 3B70A 1DIHA 2ZB4A 1LLQA 3RBVA 3O4RA 3KYCA 2BFAA 4I08A 4DIBA 3K8ZA 1ZW1A 2JD1A 1XIVA 1H94A 4ND3A 5JDIC 1H9AA 2PD6A 2OL4A 2V6BA 3MCVA 1K2WA 4J7XA 5MGBA 3L07A 5EN4A 2G82A 3PIIA 3RROA 4D45A 5L45A 1P1IA 5JYEA 1E7WA 3FNFA 3EDMA 3QVOA 1Z6ZA 3KLMX 3NEPX 4AJJA 3MTGA 1M76A 3OH8A 5KKCA 4NPCA 3TF5A 5DF1A 2FHSA 3H4VA 2A94A 3GFBA 4RDIA 4L74A 4FW8A 1Z74A 3WGOA 3B1KA 2Q4EA 2AQKA 4XRRA 2JFFA 3PHHA 1EZ4A 1ADCA 2JAPA 3ZU4A 4RJTA 5T6BA 2NQTA 5DP1A 4WLOA 1KVSA 3WWYA 4G81A 4B7CA 3GPIA 3G1TA 4YCAA 1S7CA 4ZD6A 1DLIA 3DB2A 5TX7A 3ENKA 5JCJA 4IIVA 4R1NA 1DHTA 3I9JA 4NQZA 3RBXA 5FWNA 4P8RA 3HDYA 5JSFA 3GFGA 3Q1LA 4OHUA 4FFMA 1XEAA 1IPFA 1PJBA 1A5ZA 1E1KA 3RC7A 1AXGA 3UF0A 1QMGA 1T4DA 2BH9A 3A06A 3GC6A 1ZCJA 5T8KA 1PZGA 4UVIA 1C0LA 2EP7A 1I3LA 1Y5RA 5HTOA 2NM0A 3K31A 4UAGA 5JO0A 3E9QA 1E0DA 3ZV5A 4B3JA 1O6ZA 1ZFNA 3ON5A 3V8BA 5JAZA 4K28A 1ADFA 4N5NA 1DC4A 1AXEA 2J8ZA 4D0SA 4LRTB 3L6EA 1X15A 1D8AA 3ZHXA 1UUFA 1YL6A 2X9GA 3ETGA 4JJIA 4P4LA 3H8VA 5IZ4A 3D4PA 4BGUA 3F4BA 5G2OA 4I5FA 1KETA 4PLTA 2AEFA 3DBVO 3U4CA 1SB8A 1Y5MA 1N7GA 1UXIA 2VHXA 4BNJA 4ALLA 3DAPA 1GDHA 1LC0A 4RF5A 2VWGA 2NTNA 1SC6A 3SVTA 1EFLA 3L4BC 1GUFA 2FSSA 3PYXA 2UUOA 3K96A 1KVRA 1Z7BA 3HDJA 1LX6A 4XGKA 5THKA 4NJMB 4Z3KA 5CG2A 2IZ1A 2GN9A 1NPYA 4ALJA 2GZ3A 5L7WA 2PH5A 4RVFA 1PR9A 4KUGA 2B69A 4OYRA 1NHWA 5FYDA 1U5CA 3RUAA 3B1JA 1ORRA 3VTFA 4NZ9A 4J1NA 4QXMA 3HFGA 1SEPA 4NU6A 4J90A 4TRJA 1QG6A 1YQXA 2NQ8A 2QZZA 2GLXA 2WWRA 2DTXA 5DT9A 3PQEA 1MA0A 4XGNA 3TDKA 3IS3A 2IXBA 1ZXBA 2R2GA 2YV3A 4BO0A 2PR2A 4JGBA 2YYYA 1R6DA 3KHUA 5IJZA 3S2FA 4MVJP 3ONEA 2C59A 4EW6A 3H9UA 4YJGB 1R4MB 3GRKA 3KETA 3L77A 6ADHA 2NVWA 3UKOA 3RVDA 3ICCA 3AOGA 5IN5A 4UEOA 1U28A 4KMSA 3ETEA 1Q0HA 3AUUA 4ITUA 1WW8A 3FWZA 4WLUA 5JY6A 5BSEA 2PD4A 1QKIA 1PWZA 4Z3DA 2W90A 4OIMA 3AFMA 5L3ZA 3INRA 4P4NA 5TC4A 3RKUA 3WSWA 1DB3A 1DOHA 4XYLA 3IOYA 1ZXLA 3GNTA 4KUEA 1R66A 3WQSB 4URFA 4L75A 1KEUA 2D5CA 5JAMA 5TJHA 5COQA 3ZWBA 3FNHA 3ZU2A 1I10A 2R6JA 3TZ6A 3ANNA 3I9NA 2IODA 4FFOA 1CJCA 1C0KA 4RZIA 8LDHA 3R0IA 3AI1A 2RHCA 1ZMTA 3W8FA 4CLRA 3TZQA 3ZU3A 3ZNQA 1Y6JA 3S55A 4BNGA 4XQEA 4UUNA 1KC1A 4YQYA 3UICA 1LTHR 4S3MA 4WUVA 4PLZA 1EVIA 1GCUA 5T67A 4BO3A 3WYBA 1BDMA 1WVGA 3NT2A 2P91A 4J91A 2GO1A 4RF2A 2XXJA 4RVUA 3RC1A 2B83A 1C1DB 4WLEA 1X7GA 5CEFA 1T24A 1I32A 1LDMA 4IJUA 3RFXA 2HUNA 5CG1A 3ZWMA 4OJNA 5CFZA 2VRCD 3OQ6A 4L0QA 5I9MA 1EK6A 4RO0A 2QW8A 3X2EA 2I76A 2FP4A 4CMIA 3CIFA 4UVHA 1H6DA 4M54A 1J6UA 1WMBA 3HFSA 2EEZA 2V6FA 3UN1A 4DIOA 1BXGB 4FB5A 3UGKA 2ZB3A 4ZVVA 1FK8A 3FF4A 1TT7A 2NV6A 3WGZA 4EYEA 3UH1A 3MJCA 3BMQA 4EITA 1EUZA 1KVQA 1YDEA 4RLHA 4BO8A 1PJQA 4BS9A 2I5PO 3CZRA 9LDTA 1BGVA 4N7RA 1YO6A 1J4AA 4AJIA 1MLDA 3S2EA 1PGPA 4DA9A 2A92A 3ZWCA 1JVBA 2Z1MA 1P0FA 3TSCA 1EQUA 2EJVA 3AOEA 5B4TA 3C1AA 4C7JA 1N9GB 3KUXA 3HQ4O 4WJZA 1JWAB 4IMPA 3ZNNA 2WYVA 2BFOA 3ZI0A 4E3ZA 1KY4A 4XYGA 3R1IA 2O3UA 3H7AA 4W82A 5I8WA 4FGSA 5COBA 3DONA 2FR1A 5G4LA 5KJCA 1ZK1A 2DVMA 4RPJA 4DC1A 4XIJA 1B7GO 3JQ9C 3STHA 2HK9A 3AFNA 3BTVA 1SNYA 3ADOA 3TRIA 4CV0A 4U7WA 4XQ9A 3PPIA 4EGFA 5K6AA 4FOOA 4B3IA 2Q2VA 2X5JO 4XYEA 5EERA 3C1TA 1PR3A 1E5LA 4IDBA 2NVUA 5CDUA 2VNSA 1U7TA 2Y99A 2P4QA 1X1TA 2EERA 3A28A 1RYEA 4AJNA 4IS3A 2I66A 4KZPA 2VWPA 1H9BA 3QWIA 1ZJZA 4DMMA 3FR8A 3PIDA 4RDHA 4YAIA 2YHIA 3VPSA 4QQRA 2Z5LA 1V0JA 1ZK0A 2VZ9A 1M67A 2RIRA 5DOZA 2PTGA 1PU2A 4FCCA 4EDFA 4LCEA 1ZK3A 4R16A 4CQMA 9LDBA 1B8VA 1PS0A 1A7AA 1QYXA 3DTTA 2CF5A 4DUPA 2P9EA 2IRWA 2CDCA 5DBIA 1GU7A 2B0JA 4NK5A 1ZO8A 1RM0A 1EFKA 1WPQA 2YFQA 1YRLA 1N5DA 1B3RA 1E3IA 2OP1A 2B36A 2YHUA 2IDZA 4O0LA 1C0PA 4OXNA 1H6BA 4JBGA 1JLLA 3ROMA 1U3TA 4JQCA 2Q1UA 1QV7A 1Q7CA 2YW9A 3RJ9A 5FI3A 5JAIA 1UXKA 1X7DA 4XB2A 4JXKA 4MVJA 4OKIA 2IYPA 4IDCA 3UAGA 4EUEA 1MG0A 1YONA 2E82A 3P7MA 2QYTA 2X6TA 3F46A 2X0JA 3FPLA 4HNGA 4HBGA 2WDZA 2D4AA 2Y67A 4RVDA 5AXDA 3CPSA 3ZW9A 1LBEA 5L7YA 5G0UA 3H9EO 2D3TA 4R1UA 4IZHA 1B26A 1WLYA 1XG5A 2PA3A 2GN4A 2ZQZA 2X4GA 5A06A 4BMVA 4Y6SA 4DGSA 3OA2A 3RUEA 5I7FA 4E33A 4PGFA 1I33A 3RFTA 4TROA 4UUPA 2WEKA 4IBOA 4YVFA 5THQA 4R9SA 1OMOA 1RWBA 3QIVA 3Q11A 1GADO 1OZAA 4WCFC 4E5PA 5H83A 3WMWA 1G0OA 2I9PA 3FD8A 4PFJA 3NTQA 1GZ6A 3KOUA 3R3SA 4J16A 5KVQA 2GDZA 1HKUA 2DKNA 2XAAA 2QRJA 3C8MA 3NTRA 4TMFA 1I3KA 3P2YA 2V6GA 2HMVA 4JP2A 5U1PA 4Y8VA 3S8MA 3I9LA 1K6IA 2JL1A 1B14A 4XYBA 1PL8A 4R4JA 1R0SA 3F9IA 5TF4A 1BVUA 1HL3A 3L4BA 2GERA 1M2WA 3U9LA 4RV9A 2AW5A 2CMDA 4BNTA 2X58A 1SPXA 4W7IA 4CR8A 4GX1A 2ZYDA 3LK7A 5CPFA 5TS3A 2CD9A 4ID9A 1YOVA 3KEOA 4NU5A 5JCXA 4CLOB 4YT8A 5KJ6A 3NT4A 3NT5A 3RC2A 4TVBA 2DUUA 3CZMA 2P5UA 3GNSA 3SXPA 2CDAA 4CUZA 3D7LA 4NHEA 1WAMA 3EZYA 1PJ2A 5A3JA 3GQVA 5DDIP 3DZFA 3TN7A 1Q7BA 3QVSA 5KCZA 3FTNA 1GUYA 4R69A 1WP4A 1A72A 3ZHBA 5CDTA 3DHNA 1E1LA 1IY8A 4TZKA 1UR5A 4L76A 1HYHA 5DBFA 4BB6A 4DREA 1UAYA 2ZTUA 3WOHA 1JWBB 3DXFA 3JQGB 3PP8A 4BNFA 4FFPA 3TZKA 2OXIA 5G4KA 2VTDA 3D4NA 5TNXA 3RUHA 1I36A 3I52A 4F45A 1KEPA 2C29D 1O89A 4D44A 3AU8A 4BV9A 1Y81A 3NDIA 1FDVA 1SO8A 3BMOB 5A9SA 3BXXA 3LF1A 3TPCA 3Q9UA 4DL9A 3O03A 3AUSA 3I9MA 3O26A 5G0WA 4FC6A 2ZCUA 2VT2A 3EGOA 3I4CA 1PGJA 2O3JA 3JQAD 1ISMA 3M6IA 3KLPX 2H9IA 4PLVA 2UAGA 1DRWA 2BGMA 4LSWA 5CEJA 5I7VA 3DBRA 1K6XA 4INAA 1ENPA 5AXBA 3PJGA 3WBFA 4B4VA 1FJHA 2GCGA 1R15A 2BGLA 3E48A 4ZJUA 1IZ9A 3GZNB 1NAIA 4Y9DA 5DCUA 3C85A 3GHHA 3I9OA 3P19A 1TEHA 2X9VA 1T1SA 3L9XA 5JDCC 2EKQA 3RSHA 4MKRA 2RAFA 5HWSA 4IINA 1T2FA 4GAEA 1NP3A 4HFJA 4FQ8A 1HSZA 1HDXA 5L4LA 4CMBA 1PQWA 4D3FA 5COAA 1I01A 5DBGA 1U9JA 5JY1A 1Y1PA 3NYWA 1BW9B 1TT5A 1U3VA 4UVDA 1GV0A 3JQFC 3LC2O 3NGXA 2AE1A 4Y67A 1ENOA 2JFGA 1BTOA 3K9QO 3PI7A 3C3XA 3VTZA 3KYDA 4EEZA 4HKTA 1SBYA 1BVRA 5JFOA 4WOKA 3GH3A 1BWSA 4CM7A 3WYEA 1DIRA 2DTDA 3KEQA 1B0AA 3VH3A 1PJ3A 3GG9A 4LGVA 2JHFA 3QWAA 3VZQA 3FCOA 3FSRA 4CM5A 3LT2A 3T4XA 5JXWA 2DPHA 3L6DA 3OBBA 4QT0A 2O3RA 1E3SA 4ZQEA 1B15A 3PEFA 3QLJA 3GEDA 3JQ8B 4R41A 3WMXA 4JROA 2DFDA 3INGA 2EKLA 2HK7A 4BIIA 5B4UA 2H5LA 5L95A 3WQRA 3DBHA 4MKZA 3VVBA 1R37A 2X0RA 1E7QA 3PLNA 4YJHA 4CMAA 4PVDA 1YXMA 3JD3A 1M66A 4TVOA 1PZFA 1E1MA 2EW2A 2VN8A 4KP7A 4R68A 1X13A 1V6AA 5A02A 2EXXA 1A4IA 4M1QA 1B2LA 3DMTC 5U9CA 2VYND 3PHJA 3CKYA 2GSDA 2VHWA 1DC3A 3DAFA 2HMWA 4RF3A 4IQ0A 3VOSA 4HFMA 1JDJA 3I3OA 4R1SA 4WLNA 1A7KA 1P33A 1H93A 1Z7EA 1OAAA 3UXYA 1ID1A 2O48X 3ASVA 4Z0TA 3DMYA 4KTTE 3UCFA 4D7AA 5AOVA 5BSFA 2VHVA 3RD5A 1P31A 2ZTMA 1ZIDA 1HT0A 2D5AA 1EDZA 3L0DA 4ZA2A 1GUZA 1ISFA 3C7CB 4PG7A 4CM9A 5A4DA 5TT0A 5EQFA 1GQQA 3EMKA 4B4UA 2ILTA 2C07A 1HF3A 1E7MA 3SJUA 2GYYA 3LQFA 2O3SA 4U6QA 2Y1GA 2XOXA 5IDWA 3QVTA 1HLPA 5TT1A 1NWHA 2OFPA 4A27A 2ZYAA 1XR3A 3H9GA 3L9WA 3ZWAA 2PGJA 3INTA 3WFJA 1SB9A 3D64A 1YL7A 2BFMA 3OJOA 3OSUA 1W73A 3OQ1A 1X1EA 1P1RA 4CMHA 1WZEA 1LLCA 3LT0A 4OO3A 3E9MA 4DXHA 4BNIA 1KERA 4YRBA 5GZ1A 1OBFO 4W9NA 3BYZA 4R54A 5T5QA 2FRDA 3ABIA 3PJDA 1M75A 3ANMA 1J0XO 3C1OA 3JYLA 1EVZA 4E2YA 2BGKA 1IE3A 1KVTA 2IZZA 3HN7A 4RCVA 3S2IA 3WGTA 1V3TA 2VYVA 2YDYA 2PK3A 1KIFA 3QWFA 1VM6A 1KYQA 1ULUA 1PS8A 1LSJA 2EP5A 3BTOA 3ANLA 4ZRNA 2J5QA 3ONFA 4BNNA 5AQ1A 5JE8A 2C7GA 2E37A 4Q3DA 1U2GA 4CM1A 1UZMA 3AW9A 2W2KB 4J7UA 1AE1A 1H2HA 1ADBA 1U3UA 2ZTLA 1KBZA 4JN6B 5L4NA 5HBRA 4HX5A 4WCFA 1ZSYA 3RWBA 4XJSA 3RQSA 1TVEA 1MFZA 5KIAA 1VE9A 4XEHA 1BDBA 3WX0A 3CSDA 3SC6A 1UJMA 1WDKA 2J3HA 2NTVA 3DZHA 2OP0A 4XZ3A 4L9RA 5T64A 4B4OA 1X14A 4RQTA 4E5YA 3GHYA 2R00C 4U0KA 3FBTA 4K6FA 4QO8A 2W2LD 4FR5A 1ZJYA 1YJQA 1ISIA 4YDRA 4R5MA 3F1LA 1H5QA 2Q1SA 1NQAO 4A10A 2QRLA 4M89A 4DPMA 3WYCA 4UULA 3DHYA 3LYLA 1EEHA 3AM5A 4S1VA 5IDXA 4CMCA 1ML3A 3RCBA 3VPHA 3AY3A 1ULSA 4J9UE 5IN4A 1VSVA 2PV7A 2YQ4A 1PGOA 1VL0A 2ZQYA 4FBGA 3VZPA 4AJ2A 2PNFA 4DRYA 2AHRA 2E6UX 4GSKA 4CM4B 3OQBA 1GZ3A 1IYZA 1LLUA 3U4HA 2VWHA 1FDTA 4RPKA 2Y05A 3JV7A 3Q9NA 5DZSA 4MVJI 5GY7A 1HTBA 4MVJE 4MVJF 4YYZA 3O38A 1JKIA 2GR9A 4BHTA 1UAGA 2JJYA 2C2YA 1MX3A 4IQ8A 4WEOA 4GX0A 2OO5A 5BQFA 1XCBA 3TL2A 3GDFA 1K0UA 3L4SO 3OJLA 3JQAB 2X1HA 3VZRA 3EHEA 1N8KA 3K5PA 3N7UA 3GRPA 1DHRA 1VJ0A 2W4QA 5ER9A 4PRLA 3JYQA 1CQJA 2NU6A 1RYDA 3QP9A 5A05A 3U4IA 1ZK2A 3QHAA 2OUIA 5TIIA 2SCUA 2FMUA 4Z9FA 4K26A 3AK4A 1DDOA 5IXSA 1LDEA 3DZKA 1JN0A 5IFLA 3FN4A 3KM0A 3PGXA 1I3NA 1F06A 1JVSA 3W1VA 1DC5A 4IJVA 2GN6A 1UDAA 4BKRA 5I8ZA 1ZNQO 3GGPA 5JC1A 3JSAA 1O9BA 1Y8RB 4C4OA 1GR0A 4WKGA 3MWDB 1PZEA 3BTUA 3D1LA 4DYDA 4AJEA 4IXWA 4CMKA 3GGOA 5JO9A 2RHRA 3ZNPA 5IXYA 2FPIA 5JDCA 4QTZA 3D4OA 2ZJ0A 3R3JA 3DTYA 3I4FA 1RM3A 3QVWA 1JW9B 1GYPA 5CHEA 3V2UA 5L40A 2WM3A 2OBNA 4NIMA 5ES3A 2J5RA 2B4TO 4ILKA 1ISJA 2CDBA 3OJEA 4Z6KA 1SOWA 2Q50A 4XQGA 5F1OA 1HE3A 1MV8A 1CQIA 4J4BA 4WK6A 3JQFA 3A4VA 2GASA 3PHGA 3GDGA 1I3MA 1XU9A 2PKQO 1BXZA 5F21A 2HSDA 1LA2A 1NFQA 1HETA 3EC7A 3CINA 4TKLA 4Q3NA 3K30A 2AG8A 4MPDA 3PZBA 2VZ0A 3LVFO 3QY9A 4YBZA 4ALKA 5CDYA 3KB6A 2ZB8A 4IXTA 2D0IA 4IS2A 1AGNA 1GQ2A 2B5WA 1M6HA 3DZBA 3GUYA 3ZWPA 4A5OA 4WLFA 3H5AA 1LRJA 2V65A 2D8AA 2XF8A 3JYPA 1BXKA 1UXGA 1A9ZA 2JKVA 1U5AA 3F4LA 2NU7A 2YJZA 3QQPA 4O1MA 1VKOA 3TOXA 4M8SA 1W8DA 4ZICA 4G2NA 3FBGA 1M6WA 3LZ6A 2X0IA 4I5DA 1NBOA 2YHIB 5AVOA 5BSGA 2WE8A 5B1YA 5C3MA 1UP7A 1ZMOA 2GRAA 4M86A 4PLGA 3MJEA 1WNTA 5A9TA 2IZ0A 1V3UA 5CEEA 3UFXA 2VOEA 4U0JA 4I5EA 1NQ5A 4BL5A 3DFUA 2NSDA 1P1KA 3DMTA 1FF9A 1TXGA 2O4CA 4MIYA 1E1NA 2UVDA 1AHIA 2JAHA 3E9NA 3I23A 2VUUA 3I5MA 1IHXA 5FEUA 1R12A 2HMUA 1QSGA 1DO8A 2Q2WA 1ZUD1 4YPOA 2H63A 4UEKA 3DQPA 3JCZA 4AJLA 2C5AA 1GY8A 3IUSA 2JD0A 2VZ8A 4NBUA 4I1IA 2DBRA 4W7HA 1WDMA 4XJTA 1ADGA 1SZJG 2V6MA 3F1KA 4GQAA 2HRZA 4QSMA 5JLAA 5JNLA 1BRMA 1I24A 3HE3A 2HO5A 5EMHA 1BSVA 2OBYA 4AG3A 5C7IO 3GVCA 2J5KA 2Q2QA 2Y1CA 4XD2A 1MC5A 3ZCXA 5IF3A 3PJEA 3WTCA 1QYVA 3K92A 1Q1NA 1PJCA 4EJ6A 3Q3CA 2DT5A 3RI3A 1O5IA 3G49A 5KOIA 4ZU3A 4BKUA 1ZSVA 3B1FA 1UP4A 4E12A 1T2DA 3NV9A 1GFSA 3I6IA 4K1LA 4L73A 4DIFA 4TSKA 4D42A 1P0CA 3ETDA 3V5NA 4BNKA 2X23A 5L51A 4H3VA 2G17A 4NJMA 3WLFA 2V7PA 4AJHA 5BR7A 3SX2A 4CQLB 1GYRA 3HDQA 5C37A 5I7SA 1UXHA 4NG5A 1NM5A 3VVCA 2GN8A 2AA3A 4IMRA 3QW2A 3DO5A 4WCDA 3ZWOA 2IXAA 2UUPA 1PS9A 4BNXA 1NX6A 3PYLA 1LQUA 3SEFA 1I2ZA 2AQ8A 5CPBA 1P44A 3FTPA 3GNQA 3ITKA 3CE6A 3QV1A 4NBRA 1T2AA 2O3TA 2RH8A 4U6SA 2VRBA 4LISA 4OM8A 5JMPA 4WOJA 4CV1A 4A7PA 1LNQA 3PLRA 4DBVO 1ZH8A 2YZ7A 3JD2A 1DC6A 3G1UA 3N58A 1YVEI 5BSHA 3WWZA 1MUUA 1HDYA 2PKRA 5MDHA 1YBMA 3OEWA 4CLEA 5JDIA 4CM8A 1J49A 2Y68A 3W8DA 5A9RA 4YJGA 1R4MA 5TQVA 3H2ZA 4CR6A 2WYWA 4J3FA 1CF2O 1U4SA 4BNLA 3AUAA 5EQDA 5EIOA 4GLLA 4FFNA 4NMHA 4R1TA 2I6TA 3EAGA 2PLAA 1G6KA 3SC4A 3VHRA 3D3WA 2B4RO 2QRKA 3TQHA 1PJTA 3E8XA 3KBOA 3ORFA 1NYTA 2I67A 2LDXA 2JCVA 3DR3A 4I9HA 5JCJD 5L53A 4E31A 2VHYA 4LMRA 5J23A 2PKQP 5TJ9A 4GLOA 1D1TA 3IKTA 5G4KB 4YAKA 4WE3A 4KUHA 2IEDA 4CL3A 4IQGA 1FDSA 2WE7A 5A9SB 3S1LA 3PXXA 4XA8A 3U49A 2O3QA 3PTZA 4F6CA 1Q2XA 4YA6A 1UDBA 2OMEA 3V1UA 2QYSA 3CMMA 1XLTA 5IZCC 1EK5A 1F17A 2EF1A 2GNAA 5GZ3A 4CODB 4R3WA 3IJPA 1PTJA 1KC3A 1HDCA 1AUPA 1ONOA 2C82A 4IIUA 4EBFA 4CJXA 2P68A 3GZ4A 1YS4A 5BNFA 3ZW8A 1C1DA 1MGOA 2Y1OA 4YQZA 1KVUA 2NADA 3AI3A 2QX7A 3GN1A 2XPCA 1CERA 1GYQA 3CUKA 4XKJA 3KTDA 5EINA 4BB5A 4BNUA 3WBBA 4YACA 3O8QA 2IE0A 1YKFA 1ZK4A 2X0NA 3WDSA 3VH1A 4BKOA 1KS9A 1YB5A 1MFPA 1C0IA 3U0BA 1LLDA 2PY6A 3F47A 4GMGA 4O6VA 2DFVA 3JQBC 1NTOA 1XQ6A 4XR4A 2RH4A 3EVTA 2CZCA 1N1GA 2HRBA 4HFRA 4TQGA 3PFFA 2NACA 3QVXA 5A5FA 3HN2A 4IGEA 4B79A 1P1JA 2FR0A 5JC8A 1N9GA 4YWJA 3VH4A 1ENZA 1V35A 4MO2A 3HWRA 3RJ5A 3MWEB 4O59O 3P5SA 1LSUA 2D2IA 4MIOA 5F1KA 3E5RA 1XDWA 4D41A 3ZV4A 1VI2A 3IP1A 4ZQBA 3G0OA 3H3FA 4J43A 4MP6A 1I8TA 5DP2A 4A0SA 5BNTA 4NJOA 4KQXA 2I65A 4DQXA 2Y0CA 5KVCA 4J9VA 3W4JA 5C7LO 2DU8A 2FZWA 4YAGA 3ITDA 1LRKA 1ISGA 1LQTA 2C5EA 2Y1DA 1O95A 3ZDFA 4BO5A 2VUSA 3FPCA 4MVJM 3QWHA 4PLPA 3BA1A 3X2FA 4PLYA 3VKVA 3ENNA 4BMNA 2AG5A 2F00A 1L7EA 3BHIA 3FI9A 1VJTA 1I30A 1GPDG 4YB8A 4JCOA 3WJ7A 3OA0A 2FOIA 4A2CA 4MINA 5F5LA 3Q2IA 5KTKA 3BHJA 1NFRA 4TWRA 3JQ6A 4MIEA 1Q7GA 1UZLA 3OP4A 4FPXA 3D5TA 4N54A 1OFGA 1C1XB 5T8KC 3NDJA 4QFCA 1LSSA 4M49A 3GEMA 3AY6A 4TRRA 2O7SA 1ZSNA 3PRJA 3SLKA 3H65A 4KOAA 2ET6A 4IJWA 1H0KA 3MTJA 1XKQA 3EW7A 3JQ7B 3E18A 4B8WA 2Y93A 3WQQA 4D79A 1YWGO 3HZZA 1HE4A 4ND4A 5G0SA 1HZJA 3GLQA 1X0VA 5L9AA 3ST7A 3GAFA 3QRWA 3HHPA 4BO9A 3BMNB 2CY0A 4WNIA 2QQ5A 4B4WA 1HWYA 2DC1A 5LDHA 2PZKA 1MC4A 3MOIA 1LJ8A 3C24A 3H6KA 1CETA 4YT5A 2YV1A 4UUMA 4CM3A 2EG9A 4DPLA 5KKAA 4GVXA 2G5CA 2BD0A 4OH1A 2ZKLA 4PLFA 1CDOA 3RKRA 4ZN6A 4P38A 2Q3EA 4MP3A 3BMCB 3RUDA 3S2GA 2YDXA 5I9LA 4ZQGA 3LC7O 2JHGA 2BKAA 4FN4A 4OXYA 1XU7A 2OOSA 5HM8A 2JFHA 1CIVA 3MJTA 3LC1O 4GWGA 5AXCA 4BNYA 3V2HA 4P22A 1QRRA 4OSOA 2E48A 3RIHA 3DFZA 3E6AA 3I1JA 4NFHA 1R0LA 2NLOA 4MKXA 3T7EA 3ZGYA 1K3TA 2IEBA 1G0NA 4L4RA 1OOEA 2CUKA 3WB9A 4XDZA 2B35A 3KYCB 3PWKA 4J2OA 3VH2A 2DM6A 4ALIA 4D3SA 3EK2A 4IM7A 4Z9YA 4PG8A 3QWBA 4IDAA 1LI4A 3K2EA 3PJFA 3KSZO 3ROKA 1HEUA 1P74A 3MJ4A 2CVZA 2O23A 2YFHA 1HLDA 3ROQA 4L4SA 4RGBA 4BKQA 4YRDA 2Y1FA 3CMCO 2NVBA 2D1YA 6LDHA 1CRWG 2HMSA 3L6OO 4A26A 4HV4A 3JQ9A 2ZTVA 4CUKA 3PDUA 1W0CA 3OF2A 4LCJA 1E7YA 4QUKA 1F8GA 3WFIA 3GMDA 2AXQA 2A35A 1HXHA 2B37A 2WSBA 5DOVA 1AN9A 1JTVA 1GAEO 3LLSA 1JAYA 2HMTA 4Q9NA 3WJAA 2GUGA 1E3WA 4K6CA 5KJFA 2EHDA 4IUYA 4CQMD 4HFNA 4I9UA 3JQEA 1Z45A 4JIGA 4XIYA 4RF4A 3GAZA 1HDRA 1YQGA 4GKBA 1BMDA 2Q49A 5L7TA 1QYWA 3T7CA 3OFSA 1R4NA 3BMOA 1E3EA 3DAGA 2X8LA 3LSYA 2FPGA 2J3IA 3PHLA 1PL6A 2VTEA 1DRVA 1HYGA 2I3GA 4UVGA 5KNLA 1LUAA 2VNAA 4D43A 4F46A 3WGGA 4O5OA 4NBVA 1V8BA 1SAYA 2WTBA 2O2SA 3VPGA 3OIFA 2BMAA 4MVJD 4NH4A 1A27A 4DQVA 4N5MA 3KZVA 2EJWA 2DPGA 5A03A 1DIGA 2J3KA 4EJMA 3GZNA 1D3AA 2A9FA 1NVTA 3NX4A 1PL7A 2VRCA 1B8UA 3H5RA 3UCEA 4DLLA 3E03A 1K6JA 1VRWA 1SOVA 4ZQHA 4OKNA 1QYDA 5IZCA 1LSOA 2ZYGA 3ASUA 1MXHA 3T4EA 3ZV6A 4Q3AA 4DWVA 4DC0A 1XWFA 1BW9A 1NQTA 1VJ1A 2G1UA 5CAEA 4BO6A 3QJ5A 4RLSA 1FXSA 3JD1A 4BNVA 5KVVA 3VZSA 4OQYA 1FDWA 1DPGA 1UXJA 3F5QA 2WYUA 3HJAA 3V1YA 2NNLD 4J6FA 2QHXA 1QORA 1TLTA 3RUCA 3PGJA 1H6AA 2WD8A 1F12A 2VHZA 4BMSA 3UOGA 2BRUA 4GH5A 1T26A 4DYVA 3E1KA 2ZATA 4U8GA 3JQDA 1EE9A 3GY0A 1H2BA 2H1SA 2EIHA 4WPGA 3JQBA 3JQ8A 3V2GA 4WGGA 1DLJA 3A1NA 4KDEA 2BHLA 2Y1EA 4HNHA 1EE2A 3U3XA 3GR6A 1U8XX 3JYOA 1P1FA 3HSKA 3DOCA 5H82A 3OMLA 5ENVA 3VAZA 4E0BA 2Q46A 1I2CA 1NQOA 1PWXA 1UZNA 1HZZA 4AJPA 3EZLA 3GVHA 4KTVE 1GZ4A 4E5KA 3IUPA 2G0TA 3HG7A 4UUOA 5T57A 2PZLA 3SBOA 3TWOA 3ZZNA 1DFHA 2WD7A 3F5SA 4QEDA 1MG5A 5F3RA 5G0TA 2HCTA 3TFOA 5DCWA 1DJNA 3VPFA 1DFIA 1RM5A 2IYOA 2PZJA 3LT4A 5JS6A 3NJ4A 2C54A 3ADPA 2HQ1A 2HK8A 3PWSA 4M55A 1ZKMA 1LU9A 5CDGA 4NNJA 1ZZEA 3AU9A 3IC5A 4CLRB 3G79A 4J2HA 1CYDA 1U2DA 3ZWYA 3BTSA 4HUJA 3GDOA 4NK4A 4ZGWA 1XSEA 1PIWA 1Y9EA 3QE3A 2YY7A 3IL2A 1T2EA 4NFYA 2QG4A 4WECA 3DEYX 4YJFA 1NASA 1T25A 4QO7A 4BO7A 3LF2A 3KV3O 1DAPA 1R16A 1XQ1A 1YDWA 4I8XA 1PJSA 2GZ2A 2BFPA 3WGQA 3KXDA 5TGDA 1UP6A 4FS3A 3DWFA 1EBFA 4AVYA 4RVGA 4YAEA 4HXYA 5LCXA 1H6CA 2AMFA 3PZRA 3ROPA 1LC3A 4UEJA 1Y8QA 4E5NA 2EW8A 2EWMA 3UVEA 4AICA 3PQFA 1JKJA 4EUFA 4DTIA 1Z73A 1DEHA 2AEMA 4CMIB 3WSVA 5K0ZA 4A73A 4ZHSA 3GEGA 3GUCA 3DBLA 4IGFA 2FSVA 4P4GA 3FR7A 4H16A 4GKVA 3HADA 4L8VA 4Q39A 4DLBA 1DSSG 2CF6A 3BMQB 5H81A 3PK0A 4FD3A 7MDHA 5JMWA 2G76A 4LW8A 1WXDA 2Q99A 3RC9A 4Z0PA 2QZ9A 2X5KO 3IDSA 3ONDA 4FFLA 1ZVMA 3W6UA 4LN1A 5EESA 4XGIA 1Y9AA 2E4AA 4IDGA 4II2A 2PH3A 4B7UA 4JX8A 4YAJA 2CVOA 1JKFA 1BG6A 3VC7A 4E30A 1QP8A 2DLDA 2X7HA 3ZV3A 1JA9A 3MZ0A 3BHMA 4J1QA 2EGGA 1AHHA 3WGHA 3M1LA 2W2KA 1K5HA 3U5TA 4Z0HO 1NVGA 1GPJA 1LDYA 1PQUA 3HNPA 4FOSA 2C0CA 1WMAA 2VOJA 3MOGA 4R01A 4BNMA 2OGUA 2W8ZA 5F5NA 1L7DA 3AI2A 4F6LA 4ESOA 1PSDA 1XHLA 4MOWA 1ZBQA 2VWQA 2NU8A 5A5EA 3JYNA 4U5QA 5AXAA 4RL6A 1P1HA 3VDQA 4JBIA 1QV6A 3ZNOA 3ZWXA 2GPTA 2NVUB 1QLJA 3GVPA 4FJ0A 1T4BA 1E3JA 2DAPA 4EEXA 4XCVA 3IIEA 1OI7A 3NJ8A 3W4IA 1V3VA 3PHIA 1WWKA 2BI8A 4D3DA 4G65A 4CM8B 5JYDA 1RM4A 5BT9A 4HP8A 5A1TA 1LEHA 2DBVO 3KSDO 3OM9A 4IDFA 3RU9A 1ONNA 4W99A 2ZJ1A 3WGIA 1ARZA 4GMFA 1E92A 2WMDA 3MJSA 4CQMB 2O50A 3AM4A 3D3WB 3TJRA 5HRUA 4I5GA 4H15A 2P2SA 5JBIA 4J4TA 1VSUA 1WZIA 4CM4A 1PGNA 1UDCA 2ZK7A 5C7OO 2AQIA 5A3VA 4CM9D 4PZDA 4WNCA 1KEVA 5HS6A 4B3HA 1DFGA 4IDDA 2ZCVA 2NUAA 1DBVO 3BIOA 3ZN2A 3P2OA 4RQUA 3NRCA 3GG2A 4OSPA 1KEWA 4LK3A 4BKPA 3EYWA 5EPOA 3GVXA 1IUKA 2UV8A 3IP3A 4AFNA 1YE3A 4Y6PA 3RUFA 4PG5A 2UDPA 1B8PA 1V9LA 1XELA 1X7HA 1J5PA 1ENYA 1S6YA 3IMFA 3JQAA 2A4KA 4IZIA 1B3BA 2ZIZA 4FFRA 2FN7A 3GVIA 2RCYA 4A03A 1DIBA 4Q3BA 2POQX 5DULA 3RUIA 5IAAA 3COSA 1I5RA 3I9KA 2X86A 5ER6A 3AM3A 4B8ZA 4AJ1A 1ZEMA 1YBVA 2VT3A 2BI7A 2UYYA 3VDRA 1E6EA 4GI2A 4FC7A 4B7XA 4DQUA 1U1IA 3UUWA 3NGLA 4PLHA 2X22A 1Y8RA 5G0VA 3O8QB 1Q0QA 5DN9A 3C7AA 2JCYA 3ZU5A 1PJLA 5K9ZA 1E6WA 2VYVD 4JK3A 2PD3A 1YBAA 3WTBA 4CMEC 1XYGA 4RVHA 4E2XA 1W6UA 4G5HA 1I0ZA 3DZGA 2Q1WA 1GQYA 4CM6A 4CV2A 4OAQA 3GGGA 1JQBA 4BV8A 4UREA 4BO2A 3NAQA 4OMUA 4UVEA 4YTEA 1SMKA 2B5VA 1EVJA 2D59A 5DNAA 4BQPA 2C20A 3H5NA 5LDGA 4N18A 3NUGA 3VPXA 3PVZA 4ZRMA 5LC1A 4BNHA 1W4ZA 2DTEA 4PG4A 3CH6A 3Q6IA 1KY5A 3Q2KA 4K9DA 5C5IA 1LDNA 4NBWA 1HDGO 1YOVB 3W8EA 1X0XA 1PEDA 1P3DA 4QECA 4TKMA 5JPIA 4E2ZA 3WIDA 1FDUA 1MB4A 2BLLA 1Z82A 3BZUA 4GGPA 3U4DA 4BO4A 5GMOA 4DMLA 1B16A 2FR8A 1IL0A 3FHLA 2GD1O 3ICPA 4FJ1A 3RBZA 4EJ0A 3R6DA 2AQHA 3ULKA 3OIDA 5BNIA 1RPNA 3DDNA 5AYVA 4JJFA 4CV3A 4IJKA 3AUTA 4Q3CA 3NTOA 4PZEA 1A4UA 5TSDA 1VL6A 3LT1A 2DQ4A 5IDQA 4MJLA 2VYNA 3AJRA 4AJ4A 1VL8A 1EDOA 1XA0A 2R00A 1QYCA 4RORA 4OL9A 4KWHA 4CLHA 4LVCA 2GF2A 3DOOA 1KOLA 4DBZA 1O0SA 3I6QA 3TNLA 3TZCA 3K73O 1DIAA 4YT2A 4XYMA 1YJ8A 1OC2A 1DRUA 2TMDA 2TMGA 8ADHA 1NFFA 4PLCA 4XWYA 5FF9A 2ZB7A 2XXBA 3OJFA 1F8FA 2FWMX 4E21A 2HJSA 1JAXA 1IULA 1O94A 3TL3A 4GSLA 2HU2A 4XR9A 2HAEA 2NU9A 4EI2A 3WIEA 1Q0LA 3CEAA 3QSGA 3KSUA 3DBRB 5HS4A 2PWZA 3IQDB 4W9NC 4BGIA 4E4YA 5KVSA 3WICA 3U62A 1SCUA 4CMGA 4JLWA 3DC2A 1GTMA 1HRDA 3WNVA 1YQDA 2BELA 4XX0A 2O4UX 3E82A 1GV1A 1PX0A 2Q1TA 4XB1A 1GCOA 3OIGA 5FI5A 4E32A 3H9JA 4CMJA 4RPLA 3RU7A 5U4QA 4YXFA 3GA0A 4Z9XA 4NFSA 5A04A 4MDHA 2VQ3A 2NTJA 2VCYA 1BXGA 4WLVA 1VPDA 2Q4BA 4PN3A 1E7SA 2B4QA 1TT5B 3LU1A 1LDGA 3A14A 3TOZA 4NI5A 4BO1A 1U7HA 2JCXA 4E6PA 2DBZA 4ND2A 3PQDA 3KYDB 2YQ5A 5B37A 4XRGA 1VKNA 4ALMA 4DLAA 5JW6A 5JAQA 2HLPA 1GEGA 1SEVA 2FY8A 2CNBA 2J3JA 2OZPA 4LMPA 1NPDA 3FRJA 4HY3A 1UH5A 3OJ0A 4XQCA 1LXCA 3DZJA 2Y66A 2P5YA 3B6ZA 3Q0EA 2EKPA 2OORA 5L4SA 2NWQA 1IOLA 5I7EA 4CQLA 1GEEA 5ENDA 3D0OA 3W6ZA 5HA5A 3N74A 2H6EA 4ND1A 4PCVA 3G3EA 3OICA 4AL4A 4W4TA 2Z95A 4KWIA 1LRLA 3GMSA 2PZMA 1YH3A 3U09A 4BQRA 3PDJA 4H7PA 3WXBA 3DBHB 3UW3A 1EUCA 4MP8A 3G17A 4YJHB 2EV9A 3B20A 1NXQA 4ZQFA 3ZHZA 4BOYA 4NBTA 4Y98A 3GF4A 5B4VA 3FNGA 3NKLA 4ROSA 4JBHA 2CFCA 4J0EA 4E2WA 5ICSA 5ILGA 2EGHA 1N1EA 1D4FA 3GOHA 2OHXA 2W2LA 2FZEA 4GBJA 4RPGA 1TA4A 3M2TA 5EL0A 1N92A 3JD0A 4O63O 2P9CA 3AWDA 1NNUA 4GX5A 2PFGA 3BAZA 3DHEA 1N2SA 1LDBA 4L4XA 4KDFA 3SLGA 4CPDA 3H9QA 1U3WA 4FSHA 1ZEJA 2Y0DA 5I9NA 3M2PA 1P77A 3KRTA 2CSUA 4M87A 1E3WB 1BHSA 3F6YA 4DPKA 4CR7A 2F1KA 3PFWO 1HE2A 4J4HA 3FWNA 3WG9A 4J0FA 1C3VA 4N5LA 4LVUA 3PWZA 1MP0A 3AY7A 1JU9A 1NPTO 2RBEA 4FJ2A 4CLDA 2DBQA 4OXKA 1HDOA 1DJQA 1NWCA 1QLHA 2X9NA 1A9YA 4GPD1 1E5QA 1EBUA 1HSOA 1R4NB 4D0RA 3O9ZA 2Y0EA 5CDSA 5GZ6A 5IG2A 3E5MA 2PGDA 2I99A 5KWEA 4GGOA 4PG6A 1YB1A 2HKIA 3F3SA 4IDEA 1CWUA 1YGYA 3DZIA 3UCXA 1T1RA 1PQPA 3OETA 1MXFA 3OHSX 3LDHA 4PRKA 1IZ0A 1A71A 1EQ2A 4J49A 4JJGA 3EY4A 1QR6A 4C7KA 3MEQA 1E3LA 4J7CA 2BF7A 1DAOA 3TZHA 1HYEA 1OC4A 3KO8A 3QA9A 3GN2A 4II3A 1EVYA 1IB6A 2CVQA 3NDRA 1VC2A 4QX6A 2YUTA 3V1TC 4MVJG 4EZBA 1ONPA 3I83A 4CLXA 4E5MA 1T2CA 4BGEA 2Q45A 4IPTA 1HDZA 3GPDG 3HB5X 4R3NA 3IAHA 1NVMB 4OOFA 3W4KA 4WEQA 2Z1NA 4HWKA 3WS7A 2W98A 4GWKA 3DOJA 3HDHA 5F1PA 5TRTA 1NHGA 1IHYA 1D1SA 1QXSA 4YT4A 4NR0A 4WCFB 3GK3A 3A9WA 1K89A 5IDYA 4MVJH 1IPEA 5ICMA 4TRMA 4CMEA 4R51A 2E49A 1ISHA 4CLOA 4RVSA 1HE5A 5DCYA 2X5OA 4JP3A 2C7VA 1DXYA 4J1TA 4W6ZA 4XDYA 1NR1A 3FNEA 3CXRA 4J1SA 4RZHA 3VKUA 1TB4A 1NAHA 4EUHA 2C2XA 5KJ1A 4CUJA 2O2YA 4F3YA 2QIOA 1RKXA 3EVNA 4BGVA 1GL3A 1E7RA 1FMCA 4BUCA 1D7OA 3ZWWA 4JNKA 4FIZA 3PYMA 3ZWVA 4BNWA 5KJEA 3OECA 1C14A 3JQGA 4TZTA 4PLWA 3SJ7A 4QFDA 3TFQA 3KYBA 2WD7B 3H3JA 2AEJA 1E77A 3GT0A 4R9RA 4YR9A 3EUWA 1RJWA 1Y7TA 3DL2A 1N7HA 5FFFA 5ITVA 5CP8A 5ADHA 1U8FO 4GX2A 4D46A 4DVJA 1C1XA 4GL4A 3JQCA 3K6JA 3OEYA 1U4OA 1YB4A 4LRSB 2GGSA 1WDLA 3IJRA 3RASA 4Q3EA 2PGLA 4FGWA 1F0YA 1L1FA 1Z75A 3IKVA 3MJVA 2YV2A 3JQ7A 4I9NA 2HJRA 2O7QA 4YRAA 1EMDA 4YJFB 1F14A 1XGKA 4YEDA
chains in the Genus database with same CATH superfamily
3F96A 4MDYA 4BATA 2FZVA 3HCEA 3C7DB 4P08A 4ONEA 5ALVA 1ZJ6A 3BMNA 3EE6A 3ZEAA 3BFJA 1KY2A 1YR9A 5D6NA 1SUBA 3OLXA 3WNQA 1R4AA 1SJ9A 1LFAA 1R3UA 1EUDA 1TEVA 1XK7A 2A3RA 1T0BA 2ZUCA 3C14C 3H2GA 4JLMA 4MW5A 4D4JA 5DNCA 1NI4A 5CA1F 4EKNB 1JKJB 2JIZA 2QTZA 1J5EB 1NXPA 3BHNA 5JU6A 4BVAA 5CXQA 3W8NA 1T9HA 1W34A 1TVKB 3AESA 4FILA 1BEUB 2WSSA 1SPBS 1M1YA 1JT9A 1GD1O 4O4JB 2N9UA 2EW1A 2OKGA 3RFVA 1IOZA 3GU3A 4KE6A 1NM5C 1PGQA 4IFTA 4ETMA 1XN1A 3KQTA 3MSXA 3OQNA 4CL8A 3JTMA 4HADA 1JDZA 5B12A 2VUTA 2F8SA 2V8OA 3WWPA 4CRWB 4E13A 4HSEA 4X54A 1E6UA 1OWLA 2VIIA 3E70C 4IY1A 5E7QA 2ICAA 1XO1A 4QUIA 4JL8A 5FAKA 1M2OB 2R0QC 1VG9B 3DQZA 3TYXA 2ZYVX 3COWA 2WJPA 3KAKA 3BRQA 3U3ZA 2E6KA 5K6AC 4ALNA 4TRNA 3FX2A 1CEQA 3WLEA 2AR9A 4OGWA 2FDCA 3CNHA 5CT8A 5KYYA 3RSLA 4POOA 1R9NA 1J8QA 4EY7A 1XXHA 2X76A 1DIHA 3C5VA 3MJFA 4C1BA 2BFAA 5DH9A 3RABA 1CR0A 1BD4A 5GJCA 2G6BA 3UK2A 3WP0A 1HQCA 5ULLA 2WTAA 3W1EA 1X39A 2WZBA 3UMVA 2PD6A 1K75A 3FDXA 1HPLA 2R7KA 4Y30A 1SUWA 2G1AA 1DBIA 3L07A 1XXLA 2I7VA 1WP9A 3V6LA 3RROA 5L45A 4YCCA 3N0XA 3FMGA 5IBCA 4PX2A 3QE4A 3L4EA 4NNOA 3AEUB 1LCIA 3NHUA 2GTHA 3KLMX 1EGHA 1E2FA 3NEPX 3QVOA 3T1TA 2GBPA 4EGAA 1AG9A 3L8ZA 5DF1A 3H6GA 2AX3A 4U9HS 2FHSA 4D9EA 1OTHA 3H4VA 1ZR2A 4QNNA 5EJFA 3YASA 2FEMA 2ROQA 4RH0A 4RDIA 3FUXA 2PH7A 1C3EA 1Z74A 3OQIB 4QU8A 3K9FC 3DLIA 2Q4EA 1N57A 1WULS 4XRRA 4RY8A 3K8OE 3ENVA 1Q1BA 2FN4A 2OGSA 2NQTA 4Y6QA 1V3QE 3NIWA 3E7WA 5AOBA 2F3PA 3EFHA 3GPIA 3H7IA 1OHHA 4YCAA 5FI1B 2WG2A 3ENKA 4Q21A 4IIVA 5JCJA 3W5BA 1WXHA 4NQZA 5FWNA 1L4LA 1WETA 5JVDF 3LWDA 1SD2A 2IE8A 4EA9A 1JIUA 3HDYA 4P8RA 4Y0NA 5BXQC 5JSFA 4QPJC 3UPUA 2JLRA 4RCZA 5ALOA 5IUJC 4YRFA 1CNEA 1XEAA 1IPFA 1TPYA 1BS2A 4BN0A 3UF0A 1ZAYA 1AD2A 2BH9A 2ZWOA 2QUZA 3L18A 3SEZA 5T8KA 2EZUA 2ZE6A 1Y5RA 4KO8A 4DV1B 5BW4A 2NM0A 1NZJA 4JU9A 1E0DA 3ZV5A 4RIHA 4B9AA 1O6ZA 1GAWA 2FN9A 4WK4B 1VLJA 4CGYA 2BE7A 5JAZA 1QH8A 1W9HA 3M6WA 1M8KA 5LP6A 1PP4A 2Z9CA 5BWLA 1AXEA 1G17A 2WUVA 1OGYA 2PUDA 1D8AA 3ZHXA 2X9GA 3Q88A 3PKJA 3H8VA 1Z2CA 4ZV7A 1NTRA 3TGWA 5B7GA 2BEJA 4BGUA 4J16C 1W88B 4FMCF 5G2OA 1T36B 1HX7A 2A6PA 1EM8B 1KETA 2IYVA 2MJLA 3D02A 4PLTA 3DBVO 2K2WA 5LLSA 3U4CA 4PZUA 1J5XA 2VHXA 2ZSIA 4HDNB 2OZVA 3OTGA 521PA 1PWEA 2PGIA 4Z4QA 2C99A 2X15A 1WU7A 1LC0A 4RF5A 2PBLA 1KJJA 2NTNA 2JVJA 1GG8A 1UBSB 1YRQA 3MC1A 1EFLA 4L9AA 2FSSA 2OVBA 4K9LA 4DWWA 5IJ9B 2YXDA 5JARA 3JASB 3O75A 2ZS7A 1KVRA 3ZQUA 1Z7BA 1LX6A 1X86B 3PXAA 3RVMA 3HKBA 3HU3A 3ACCA 4V0LA 2Y1LA 1RCUA 1KIMA 1VSTA 3PE3A 2HZ7A 4V1CA 2GPWA 1LGYA 2C42A 1NPYA 2GZ3A 5HJ2A 1LBHA 2Q07A 2PH5A 4CKCB 4YV7A 3LPNA 4IJQA 4U3JA 5L7WA 4ND8B 5CNMA 5T4BA 1WO8A 2EFJA 2P2YA 1WB4A 2B69A 4MQ6A 4Q5IA 1NHWA 3FA2A 5E6SB 1KMHB 5CNKA 2GXAA 1ORRA 4I50F 1KI1A 5JAUA 5IT9A 3GPLA 1W2GA 4W5TA 2XNDD 2MU1A 4AZWA 2A9JA 2O6LA 3HUEA 1Y1LA 2A14A 4D9FA 4HJXA 5CA0B 2HO4A 4I5IA 1JEJA 2GLXA 4TT8A 3SOZA 3PQEA 2O14A 4ZCIA 1MA0A 4F5EA 4WKCA 3CEMA 2IXBA 2PR2A 2YYYA 1R6DA 3KHUA 3PGLA 1ZWLA 4ARSA 5IJZA 1EVQA 4FFBB 2AG1A 3ONEA 1SQ5A 2ODBA 3GD7A 2CBGA 2LXNA 2DHDA 3S4YA 5KWVA 5GWXA 3C7KA 4YJGB 3PR1A 1R4MB 6REQB 1KQOA 2GX6A 3PJRA 1ITZA 1KPHA 3RVDA 3ZHCA 5EZYA 3WRYA 2XB2A 1O0CA 5JCOA 4GICA 1U28A 3IAS1 4AB1A 1DWUA 1Q0HA 4ITUA 5IANA 3NV7A 4M8LA 1Z25A 4BJ6A 4QBIA 1PWZA 1IWPB 3A1CA 1JHOA 2A0XA 2N1MA 2WZQA 4LJ6A 5FWXB 5CLGA 1XNHA 3AHIA 4WUTA 2AKAB 2GMWA 3IOYA 1UEXC 4R2IA 3A3YA 1X2EA 4N4AA 2VNJA 4OHWA 4URFA 1KEUA 3RVQA 4D4MA 2PVSA 4BZXA 4IIJA 5COQA 3ZWBA 3ZU2A 1QHSA 2QZ4A 1AQ6A 2AN4A 3MTAA 2F64A 4HDQB 5BR8B 2EJBA 1AURA 1AKTA 1MF7A 1QDLB 2IODA 2WIDA 3I9NA 3LWNA 4JITA 4XD7D 1WHTA 2G9NA 4TGLA 5G53C 2AFRA 3QKSB 3R0IA 4HQLA 1GVNB 4J0DA 4CLRA 4MUNA 4ZVPA 3MLAA 3AB8A 3R77A 3TZQA 3O1IC 3ZNQA 3S55A 2QN6A 1ZONA 4MA0A 3V4LA 5BWNA 1SHKA 2XQGA 3UICA 3UT0A 5JSZB 4S3MA 3AUKA 4PLZA 1EVIA 3PD1A 5HX7A 2P11A 5T67A 5JZ9A 2O2IA 2XF2A 3P9YA 2P91A 2XVYA 2GO1A 4RVUA 4M1EA 3HR8A 2QAJA 2QPOA 3HCAA 1C1DB 1X7GA 2HRQA 3I0MA 3QFFA 3VNQA 1IBMB 4JH0A 2XDQB 5CG1A 3ZWMA 2AI2A 2P9HA 4OJNA 3HWSA 1HOXA 3MMNA 5DISB 3A1VA 4L0QA 5I9MA 4DMHA 3TG2A 2F8MA 3LCJA 5CDFE 1EE1A 3E7FA 4XUEA 1P1CA 5K3OA 2G5TA 2P3OA 1GAJA 2QW8A 2REQB 2VP0A 3CNQS 4MEJA 3RYFA 1D5WA 3X2EA 2QN9A 4PYNA 4BFVA 1QCZA 2TRSB 2ZRCA 4KAFA 4CMIA 3CIFA 1H5NA 1H6DA 2PCJA 4M54A 4WK0B 3HFSA 2EEZA 3UN1A 4H1WA 4D8TA 4FB5A 2ZB3A 3QXSA 3D2LA 4TLEA 3EPLA 3DPUA 1VPTA 3AZQA 2NV6A 5KYKA 3WGZA 3D1VA 3HB9A 5ABPA 1RZRD 1ACJA 3MJCA 4C5BA 4YXWD 5MFZA 3PHCA 1CZRA 4TMVA 4RLHA 4F3NA 1MB9A 1JKMA 1PJQA 2ERCA 4G9EA 4MUYA 4XXHA 3RK1A 5K0GA 1NW3A 3FOFC 4YLGA 1D2CA 4I9GA 4QWMA 4TKUA 1ML4A 1QU2A 1M2GA 1MLDA 4IG4A 3S2EA 1PGPA 3CJRA 2QE6A 1WQ1R 5K8TA 1M5RA 3PS9A 3L8CA 1JVBA 2Z1MA 1SXIA 4FYYA 1Y6RA 1JIVA 1Y3BE 4DSUA 2R1TA 1D6JA 1JWAB 4QBGB 4CF7A 3ZNNA 5CB0A 4HK4A 3IPXA 1ZM7A 2Z3VA 2OCLA 4MRAA 4WA7A 5AKYA 4F96A 5KYTA 5AKLA 5FTNA 2AN9A 2AKEA 3R1IA 2VH2A 4W82A 4FGSA 4YCDA 1OVGA 2FR1A 3IALA 5KJCA 1PD1A 1ZK1A 2DVMA 1R6AA 1GDTA 3M33A 5K5EA 4DC1A 1B7GO 1E9AA 3STHA 1LI5A 1FFWA 3ZE1B 2V0NA 3TRIA 2ADOA 4LWZA 2AUNA 1JDNA 4YQFA 4RDXA 3AB7A 3TSWA 4XQ9A 1O9HA 1RD4A 3NHMA 5HIIA 1BX0A 4EHLA 1EWTA 3FLEA 3EQ7A 2X5JO 4IP0A 4XYEA 1A8PA 5BVHB 4IXNA 1WM1A 1XD8A 5JXIA 1A5SB 3UT6A 3QZUA 3CVWA 3Q40A 3KFXA 1UBFA 4Y2XA 2Y99A 4UBOA 1T8WA 1X1TA 2VLIA 2WMNB 2PLNA 4IS3A 2I66A 1Z7GA 4KZPA 2UZAA 4N8DA 4O33A 2PSFA 4S1TA 5DIFA 1H9BA 3KOZA 3UMJA 2Q4TA 4PSCA 3LUJA 4NBSA 5FBQB 821PA 2RHHA 2NPOA 2JH3A 2OXTA 3A3PA 1ECPA 3CUYA 3WRWA 5K0NA 3TOCA 2Z5LA 4JFRA 5DXFA 4QGSA 1NL3A 1ZK0A 4I6JA 3AR9A 5DOZA 1PU2A 2QN1A 1RMTA 4EGSA 1QDEA 1FBTA 1ZK3A 1W6RA 2FJUA 3L7JA 4LCEA 1B8VA 1XLVA 1YC2A 2X40A 4LQDA 4N12A 3AV3A 2HIMA 3OZSA 5EHZA 3SC2A 1NJFA 1PEYA 4PX5A 2BW0A 2WR8A 4TQ9A 4LYEA 5DBIA 5BV1A 5CBPA 4RKEA 2B0JA 4QHSA 1IIBA 2ZRFA 3ROEA 3TVTA 1ZO8A 3TD2A 1QGED 1VDMA 2YZGA 1WPQA 3IDFA 2YFQA 2V45A 1DJOA 1B3RA 3E3AA 3U19A 1J00A 1GQFA 4OXNA 4MZXA 2CHFA 3ZGLA 3OJXA 3UGQA 1O96A 3KQUA 3L0IB 3DDUA 5LPNA 4WN3A 5C52B 4OHVA 1Q7CA 3DEKA 3RJ9A 5FUMA 5JAIA 1E32A 2BVNA 3UH0A 4E07A 2YJ5A 2B3TA 4FLMA 4OKIA 2IYPA 1TM2A 4ZANA 3FTFA 1Z8FA 1O77A 3G6KA 2QRZA 3H2IA 1YONA 1N3IA 2MSNA 2ZJ7A 3JZFA 4F85A 3FPLA 1GTG1 1CE8B 2Q3CA 1RWQA 2D4AA 2Y67A 2NO5A 3LUAA 5HJ5A 5SV2A 1UPAA 1TEXA 5L7YA 5G0UA 4R1UA 4TVKA 1OH6A 4LKRA 1FQKA 1Q74A 3AEXA 5DXJA 4IKEA 4KZKA 2OV8A 2PUJA 2PA3A 4OGKA 3M3DA 3TRHA 4EW2A 5ANRB 4AKHA 2HIHA 3C1UA 1X9IA 1CFZA 3JU3A 4AN0A 2QN8A 5FBLB 5J4KA 3HFRA 2MT9A 2E1RA 3LCRA 2W5UA 1P4HA 2WSIA 4UUPA 4KRFA 1QFJA 1TMKA 5THQA 3F6PA 3EFEA 1OMOA 2GO7A 3QIVA 4ZU1X 4C88A 4ND7A 4G0WA 1ZIPA 2GM9A 4TPKA 1PQ4A 2RJOA 1ZVVA 3I58A 1P5HA 3LNCA 5H83A 4E5PA 4EENA 2ST1A 3U3JA 1NLYA 3WIOA 5ICEA 5JCPA 2R1UA 1LLFA 3NANA 5A7HA 1KZ6A 1HKUA 2UZIR 4FMPA 3C4JA 5H3HA 3NTRA 1BGWA 5EGNA 3WFZA 2G1KA 2VXCA 1UPUA 3P2YA 1V2GA 1ECJA 4DDHA 5C51B 2F2TA 1Z28A 3GCDA 2ATVA 4ID3A 4TYYA 3HEBA 3A2LA 4EG1A 1B14A 4UU1A 3F9IA 4EPWA 2B1RA 1HL3A 2FUG1 1R0ZA 1P5FA 3QLVC 2GEKA 1PT7A 3D0RA 5IJWA 5JBNA 2BP7A 3M4JA 4N1AA 4BLQA 2J32A 4ZEWA 3MK31 4BNTA 3LTEA 2WJAA 3DLAA 1UIRA 2P0YA 4N3AA 5TS3A 1GG9A 2XSZD 1EDDA 3SEQA 4YT8A 1QIEA 3MQFA 3RC2A 3EZ7A 3LQ2A 2GOYA 3GNSA 3RS3A 4EW1A 3LQYA 1IN8A 3OZVA 1P17A 1JV2B 3DLHA 3WP1B 3T3GA 2LP4Y 2XBLA 5EXTA 1PJ2A 5EHIA 3WMGA 3O74A 1VPEA 5K0SA 5DDIP 1Q7BA 4NC9A 5KCZA 1OZHA 2IUEA 2FWPA 1GUYA 2QZPA 4R69A 1V95A 5DW0A 1MZVA 1T8TA 4WFIA 1I5OA 4UHKA 3PNOA 4G85A 4ER5A 2H54A 3U1VA 5DTJA 2R4TA 1GQSA 1GNRA 3HZHA 3O8BA 1ILWA 1HI9A 1UR5A 3MT0A 4L76A 4BB6A 4DLKA 2MIIA 2OO5C 1IM5A 3L41A 5AKJA 3SYRA 3AVUA 1TZJA 2W8BA 1H3EA 3JQGB 4NABA 5AJXA 4YRNA 2QK4A 4FFPA 3TZKA 3F6EX 1Y4AE 2RD2A 2OXIA 1WDTA 3AEQA 3FYUA 1E4VA 2Z8ZA 1NF9A 3DKPA 4KIGA 1F38A 3RUHA 3O82A 3I52A 3HI6A 5IXJA 5A3RA 1KJWA 1O89A 5G1OA 4BMYA 4CCYB 3NDIA 1FDVA 3PQCA 3VSAA 4F56A 1U7UA 4GP6A 3JVEA 4IO0A 1XDUA 1AKMA 1YHNA 2NAFA 4L8LA 3C98A 2QUHA 4GC9A 3B5EA 3P0IA 3TTYA 2CDNA 2NGRA 4EFMA 5JZVA 3UMYA 4EG4A 1KAEA 1DVRA 4FC6A 4RSHA 2FTKE 2H5EA 3R40A 2VT2A 3EGOA 1NXWA 3I4CA 1PGJA 1F2TA 3JQAD 5DU2A 3KLPX 2H9IA 4OY3A 1H42A 2I29A 2GJ4A 4PLVA 1DRWA 4G0XA 1O1YA 1U0LA 4LHXA 4YRJA 2EWVA 1GNPA 3RREA 3DBRA 4DXDA 2FSVC 2GCGA 4OK3A 4RA6B 2VJAA 1JJVA 1IZ9A 4HDKB 4ZVQA 1PJRA 2AFIE 2QW1A 3R74A 1RAFA 5C18A 3C85A 5JJBA 3AVXA 3U44A 4AMGA 5DYIA 1JEOA 2EKQA 4A36A 1A4XA 4M36A 1YTLA 4HFJA 4GAEA 4XWAA 1F9EA 1IBCA 1HSZA 1HDXA 1QCCA 1TIBA 2WF9A 2VF8A 5L4LA 1US8A 1JLKA 5EJAA 1PQWA 3LRXA 4D9IA 1QPZA 1Z4OA 4F4IA 4NE2A 2V7EA 5KOHB 2YIDA 2XMCA 3EZFA 1U9JA 1MO3A 2GJSA 5LBTA 3NYWA 1LZKA 1U3VA 5CAEB 1DXOA 2V4UA 2JI8A 5DXAA 1A5AB 4X97A 4CV0A 3VTZA 1Z4JA 2XIJA 4NLLA 4EEZA 4BUJA 1KBQA 3KU1A 3LPMA 4HLCA 2ECPA 4QTXA 1S2OA 2EZ8A 5TEVA 5C1IA 2H0AA 1QE0A 4WOKA 3GH3A 4TWIA 4YLEA 1JR3A 4J29A 3TIIA 4Y7DA 1KDPA 3DO8A 3C74A 4QHYA 4B45A 1DIRA 5FJIA 1G8AA 3OPXA 4B81A 3VH3A 5I4IA 3TTVA 5IABA 2BYTA 3P0FA 1PJ3A 4M0LA 2QL6A 4NZYA 3GG9A 1RRCA 2FGKA 2VT6A 3VZQA 1I13A 4UXJA 2H18A 2Z5VA 3FCOA 3FSRA 4RKWA 4GR4A 1JQ5A 1S5PA 5JXWA 3OBBA 3T38A 1V47A 4Z4HA 1VA5A 2HPZA 2XD4A 2ZG6A 3MT7A 5EWJA 4Q4HA 2HWWA 4R41A 4S1OA 5CT4A 4ZIRB 2WFZA 1TGVA 2DFDA 3ZV7A 2CVPA 4X1OA 2FRVA 4NICA 3EPPA 4FHEA 5BWOA 3PNQA 2QQ0A 1RRVA 2H5LA 4V24A 5DGCA 3BXPA 4MKZA 1WCWA 1E2LA 4O2AA 4BP1A 3GYGA 1ZRNA 4FBLA 4YJHA 1RE1A 2IJGX 1OX6A 3BH6A 1YXMA 4LX8A 4QREA 2O0KA 2OLKA 2EW2A 1E1MA 1T3GA 2BBSA 2R87A 3DE4X 2RHDA 3H75A 3M70A 1DUVG 4IAOA 4PTYA 2B1JA 2P2ZA 5A02A 4UFOA 5L3VA 5JS8A 1M73E 1THGA 1B2LA 3EXIB 4H0FA 4MWOA 4N0QA 2JPDA 3PHJA 5ALXA 4LWQA 1DC3A 2QJFA 4LE0A 1KK1A 4IQ0A 1KI7A 1H1LB 3DS8A 4MR7B 3HLYA 3IB3A 1T8YA 4AIIA 3BDVA 3GPBA 1N2ZA 1OT5A 5BSTA 4E3WA 1MAAA 5BN3B 4NPHA 5JCOC 1SC3A 1H93A 3M6UA 1OAAA 2KLBA 2A67A 1RJEA 1ID1A 1FRFS 2O48X 1TYCA 4XSHA 3FIUA 4Z0TA 2GWRA 3U13A 3UCFA 4P53A 4I6GA 2WM2A 4QXQA 3ZBQA 1PUXA 3TLEA 4Q7QA 4OX9Y 5AOVA 4ZOEA 1EGAA 3ZZTA 2ZTMA 1ZIDA 3WO1A 3L0DA 4RFSA 4PG7A 5D86A 1P2TA 3WB0A 5TT0A 4CM9A 4Y2GA 5HUHA 3DAYA 3WK5A 3BB1A 4K5QA 4WBXC 3E3OA 2JVKA 4NMLA 1SXJC 2XD9A 1E7MA 3AFOA 2AFHB 4OMCA 5D3ZA 3ZXSA 3U4QB 2HIAA 2O3SA 3DM5A 3ITEA 5AJHA 5FTKA 3HVRA 1HV8A 3QVTA 5IDWA 1XQYA 1WZCA 2QZSA 4F06A 5GJBA 2IY7A 2VYCA 3DE6X 1XR3A 3B5JA 2OMKA 3HY3A 4DBLC 1SOUA 3KK0A 3PA6A 4ZMBA 3G0GA 3T3EA 1OXSC 2I6QA 2OC4A 1XD9A 4KL8S 5KYXA 5G02A 3ND8A 4DCOA 4I7EA 1SB9A 2EP8A 3D64A 2BFMA 3ZDQA 4EVIA 3MGKA 4HQ0A 1GRRA 4WZAB 2O2XA 1BJTA 1W73A 2RK6A 2GJ9A 3HI4A 1X1EA 1P1RA 2WP8J 2P5TB 1LLCA 3LT0A 1W47A 1YCGA 1NJ1A 2IP2A 3Q98A 4B74A 3F90A 1OBFO 3LPCA 5T5QA 1AQJA 1Y3HA 4RTSA 4TMZA 3PEWA 1M75A 2A5YB 3ANMA 1RIFA 1Z16A 3DYIA 3O7MA 5HIAA 4KIWA 4TTTS 3RVJA 2AN1A 5EXDA 5DRYA 4M0EA 3EUAA 2QD1A 3NVAA 2R7AA 4YY3B 1IE3A 2JCSA 5CXSA 4MMYB 2QLFA 2YYZA 4RCVA 5KNBA 1C0EA 1V3TA 2PK3A 1E9DA 4KQHA 3RADC 2I6SA 1DDGA 2BGUA 3OF5A 3GLFB 2CE2X 1PS8A 4V2UA 1KFCB 5FUXA 4ASUD 1BU8A 3SSNA 1SZDA 1UBLS 1Y1SA 2AJTA 2Q6LA 4DUYB 3AHGA 3LPDA 4BQFA 2C7GA 1WHSA 3HKCA 3A2KA 2RGNC 4NAUA 1GM5A 3HO1A 2LKCA 4UM9B 7ABPA 1UZMA 2HJWA 4XLLA 2MINB 2TMYA 1AE1A 1ADBA 2DJ5A 1QV9A 4HWSA 4X84A 5KU7A 3W79A 5CM9C 2H1FA 1KYTA 2HDOA 1QP7A 3Q0IA 4B71A 4DAOA 3VSDA 1PEAA 3VC3A 4WCFA 3CZCA 2I2AA 2CK3A 1OLXA 1K06A 1QO0D 2W0MA 3GROA 5KYUA 3FZYA 2VKQA 4XEHA 1BDBA 2HMAA 1Z0IA 3K6SB 4IJ6A 5DN6D 1YK0A 1WDKA 3HUFA 4CVNA 3E22A 4XZ3A 4TS4A 3F67A 2PL9A 2RGDA 4L9RA 5T64A 4B4OA 4F9GA 4RNDB 1ZN2A 4KFTA 5LQAA 3GHYA 4U0KA 1E63A 2A7QA 4JP5A 5T41A 3BT7A 2M1ZA 3BFPA 4QO8A 2XOKD 4XFDA 2II6A 1T5LA 2VFAA 4UHFA 2XNKA 5KX5A 4RV5A 1U2PA 4FU0A 5JYCA 5J2UA 4Z54A 3WYCA 3DHYA 1EEHA 1LPSA 5IDXA 4S1VA 4CMCA 3U31A 2ORED 5FWDA 4B80A 3L1VA 3AY3A 1QOZA 1VSVA 2DR0A 1FYEA 1VL0A 1F3OA 2PV7A 4IKOA 5AI4A 4AMYA 2PNFA 5AKEA 3Q6MA 1ZUIA 4F4UA 1XZPA 1XLTC 3MYRA 4ZYLA 2ZR0A 2CLHB 5AK6A 1FDTA 3ISVA 1T6XA 2TYSB 1YQUA 5BN4B 3FSGD 3TIVA 3LZCA 4JJ8A 1G4HA 5GY7A 4BBAA 5LWQA 4MVJE 4E1BA 4F0JA 4CG2A 3FSEA 3O38A 4NU0A 2QGNA 4DV5B 1CUCA 3BC1A 1FFXB 2VJMA 5CMLA 2JIRA 1E79A 3DNFA 3MWFA 2A7XA 5AW7A 1SCAA 3RK4A 3O4HA 4P2GA 2MYUA 2OEPA 3MA0A 2R6CA 3TL2A 2GAIA 4CCWA 5FTJA 2QM8A 4KXXA 1GG5A 1K0UA 3L4SO 1B0ZA 1FDIA 1KZGB 1TTQB 4HMOA 4I1SA 3TO5A 3EHEA 3NORA 4CTKA 2EFCB 4D4IA 1GKLA 2AWNA 4Q1VA 4G8CA 2WKQA 1VI6A 2W4QA 1PE0A 1Z3IX 2G9VA 2PX4A 2ZJ6A 5ER9A 5HKLA 5J5VA 3AQ4A 5LNK6 2QN7A 3RUPA 4LF6B 1K2VN 2X14A 4L15A 1N1DA 3P20A 5A05A 4DY4A 2FMUA 1YA6A 3QXXA 1Z0FA 4K26A 4RA9B 1Q91A 1D2NA 3F3KA 3QMMA 1KQPA 1PT5A 2B6HA 2M6RA 3KM0A 2PZGA 1AGXA 3W1VA 4JT9A 2F8LA 3ZQKA 5FOSA 5DNUA 5I8ZA 1UT5A 5JC1A 3PCTA 1O9BA 2ZT6A 2ATIA 1Y8RB 4QJIA 3ADBA 1AK2A 4RJ2A 2X7JA 2XYVA 3NBFA 3NZEA 5ADUS 1RHMA 5FOQA 5HF9A 4DNFA 3G0DA 4IXWA 4O4JA 4CMKA 4ZFNA 4YCMA 2JFNA 4N49A 2CLIB 2RGXA 4BTLA 3O92A 4MQ5A 2E3JA 3WKBA 5JDCA 2PX0A 1PFQA 2QTRA 3CCBA 3DTYA 4I4LA 2GFIA 5AVWA 3JWEA 4FX5A 2OGWA 1RM3A 3QVWA 3IQZA 3PL1A 1GYPA 1V7PC 3EBPA 3PC7A 4Q0MA 3D2AA 4UEQA 4CG1A 4GC5A 2WM3A 4YUYA 1M2OA 4NIMA 5L40A 4E03A 4ILKA 4RK5A 4WXYB 4RHXA 5C4IA 4XQGA 4ZO6A 3O3OB 1QIMA 4WZZA 3JQFA 4Y6LA 1C7RA 2EKBA 3C5HA 3GDGA 3KQSA 1I3MA 1XU9A 3T5GA 1BXZA 3CGGA 3PT5A 5FV4A 1HETA 1SD1A 3EC7A 1J90A 4TKLA 2WIJA 3K30A 2P2LA 1IHOA 1SHUX 1WQ3A 2P79A 4OPMA 5ALNA 4YRPA 1T3HA 4AX4A 3GJ8A 2EYUA 3G23A 5T4EA 1SBZA 2KE5A 3ML1A 5CXUA 5JSYA 4CWAA 4GOLD 1K7FB 4FE7A 4IXTA 4LQLA 4U6NA 1ZM3A 4MEAA 1Y8ZA 3GDWA 5J5AA 1M6HA 5KTNA 3GUYA 1H4SA 1AF7A 2O06A 3D6VA 3H5AA 1OXUA 3UAZA 3L49A 2D8AA 2XF8A 1QVVA 4A8JB 3JYPA 3HSSA 3U4MA 1JYFA 1QTRA 3DPIA 1UXGA 1U0TA 3AHJA 2WPDD 3KB8A 3PDCA 2WF7A 2QGFA 4BP8A 1YJBA 2YJZA 3NM4A 2ZT8A 3HRKA 3QEAZ 4KXFB 1NE7A 3RAPR 2C7PA 3PVCA 3THRA 3TOXA 4MUXA 3R6LA 4G2NA 4LYFA 1RJGA 3BEDA 2YY6A 2X0IA 3G0CA 3OQIA 3FYSA 3EPKA 3UFBA 4B32A 1HG1A 1NW7A 2I87A 2WYHA 3LQ4A 3PF8A 4YAWA 1KZYC 1YU9A 5B1YA 5C3MA 1NOJA 4PLGA 2GRAA 4UNNA 1TK9A 3QU7A 2R44A 4LDQA 4JXXA 1IJKA 1W4BA 3OMXA 4PBTA 2VOEA 4K7JA 4DVGA 4U0JA 2EBFX 5LMCA 1QG0A 3EOZA 4BL5A 2BGWA 3T9EA 2DWUA 2PSSA 3QXGA 2W93A 2ONYA 2IOYA 1FF9A 2WKPA 4LZPA 4DILA 2P6RA 3ZDYB 1KHTA 2QM0A 4MIYA 4LXXA 1Y9ZA 2W71A 4BLRA 2V9ZA 2UVDA 3B52X 1JFSA 1UADA 2FE4A 6CHYA 3JAKB 2EWWA 4AYWA 1AHIA 2JAHA 3I5MA 1F6DA 1TFUA 4NULA 4W9MC 1G20B 2HMUA 3E58A 3GBVA 4FR2A 4H7HA 3VZDA 5M34A 2WBLC 5BSRA 3UJ8A 3TW6A 2NXWA 5GPBA 4YPOA 1GO2A 2DF8A 4YJ2B 3SD7A 3DQPA 1ZL0A 4PQFA 2JNWA 2WAOA 4IXDA 3CUTA 4AJLA 2AF3C 2EX0A 4TXLA 3RRJA 1VMIA 1NUPA 1UMCB 3EF0A 5C8YB 1MW9X 2DBRA 2QI9C 5AJZA 4WY8A 1JIQA 2Q3LA 4ZAVA 1R9MA 1X2BA 1ADGA 1SZJG 1WDMA 1XFDA 3F1KA 4GQAA 5K1ZA 3GT4A 3CR7A 2ZT7A 4RH3A 4Y0VA 3I61A 3HE3A 2QRMA 2BEWB 1OIXA 1E8MA 2NXCA 1OXKB 4XD2A 3WYAA 2UYOA 3A05A 2JK1A 4GKKB 2V6IA 3LDGA 1W88A 1KH1A 1T36A 3I37X 3BA6A 1EM8A 1LS1A 4II7A 2X0FA 2HWXA 2EGUA 4RZ2A 5LMUB 2LWIA 3BWEA 1N3YA 3OCUA 1FLNA 2INGX 2PG3A 2DT5A 2EFEB 2PWAA 3Q3CA 4KQ2A 3K0CA 1DQPA 1E3TA 3PGKA 2IEGA 2VDNB 4KSBA 4ZU3A 4I36A 3B1FA 2QPTA 2WKSA 3NV9A 1K6EA 4EY6A 2Q7XA 4TSKA 3EVDA 1P0CA 3ETDA 3K20A 1T1JA 2HK6A 3D8NA 4N6GA 1Z5ZA 1VIAA 2WWWA 5BRNA 3V5NA 4BP3A 5EY5B 4BECA 4BQQA 2G36A 4H3VA 2P6PA 5BR7A 4S1WA 3CJTA 5CGZA 3M6AA 3HDQA 4PPFA 1KSFX 3QBTA 1TYAE 4QFMA 2WK1A 4NG5A 1V7CA 3VVCA 1N0UA 1U0GA 1U7PA 3DDCA 4K2AA 4KU4A 4ND8A 4CKCA 3OUTA 2AA3A 3ZWOA 5LZ5A 3DO5A 4DCMA 4W8GA 2IXAA 4HNRA 1KMHA 5J2TA 4TLMB 4HS4A 1GAXA 1AQLA 1RPTA 2GFQA 2AQ8A 2VP9A 5CPBA 2BZ1A 1P44A 3SEFA 1VGVA 2XWSA 2BTQA 2BTEA 2YZNA 3IHTA 3KNZA 3QV1A 3RRBA 1UDXA 2OENG 2ONCA 1C30A 4LHYA 4WOJA 4G0ZA 4CKEA 3H2YA 4NJEA 4A7PA 4OKSA 4S1NA 3EIOA 2C9ZA 3JD2A 4MULA 1DC6A 1XVAA 2X1VA 5JRDS 4QG7A 5JZMA 2XCLA 1T0IA 3PXBA 1SKYE 1TC2A 1UMBA 4KBGA 1MUUA 1QGZA 4CQNA 3E23A 4KAAA 4CF5A 4FFBA 3WIBA 2HJGA 2PL3A 3FKSA 1WKVA 3MRXA 1Y3CE 4CM8A 4JJ4A 1GU0A 1JMYA 4YJGA 1R4MA 5TQVA 2WPNA 1N9ZA 4J3FA 4CR6A 4B3BA 2PUBA 1BXRB 1M2EA 2XGGA 2BM0A 2WWFA 1SCNE 3KKLA 3MXTA 1CIPA 1U0HC 3PSHA 1N6OA 5EQDA 4GLLA 2YXPX 1G1MA 1KXJA 4R1TA 3ZX4A 3EAGA 3TGPA 3OQOA 4OQLA 2P6UA 2FQQA 4MMZB 2V7QD 1CR6A 2WAAA 5DTMA 5HOQA 2BMJA 2B4RO 3OX2A 3SHOA 1O6FA 1PJTA 3SS8A 2VJKA 1NYTA 2I67A 5K3FB 3DR3A 3BB3A 1KGDA 3GLHB 5KU1A 4NXMB 2OAGA 3JRWA 2BGRA 2ZJOA 3O95A 1WCIB 4US1R 5EA2A 3UWKA 4BBZA 1D1TA 4MUBA 5G4KB 1V25A 4OHZA 4YAKA 1IXZA 1KP9A 4DV0B 1JQ3A 1M33A 3BSWA 4EPVA 4K6HA 1SCJA 1WS6A 3PC4A 2IS1A 3GI1A 1FDSA 4IQGA 2AN5A 3QKSA 5F5XA 4WJLA 3U49A 4PO9A 1BHO1 4HSGA 2QZJA 4W1QA 3UHOA 3AL2A 1PUJA 1Q2XA 4YA6A 5DM2A 4I3HA 4PR0A 4HXFB 1SHLA 1W2HA 1ZCAA 5DMXA 2BSXA 2QYSA 1BS1A 4RKFA 1EK5A 1M1YE 1JMKC 5D5QA 1V39A 2EF1A 3FCYA 5GZ3A 1TUBB 3V46A 5JSZA 1YR3A 2BFEA 1NLFA 1KC3A 1P18A 1HDCA 1AUPA 1PTJA 3AIIA 1PUIA 2WINI 3HCRA 3FPKA 2HN9A 5D7BA 3MELA 5AVSA 2Q6VA 5EHXA 5AD1A 1C1DA 1LTQA 1PT8A 4HZGA 4V0RA 4YO8A 3T41A 2OBXA 4JWKA 4RENA 3UAVA 1Y8AA 2C5BA 1DAEA 3NBKA 2RK3A 4XKJA 2CHVA 2JZCA 3LWZA 3QYAA 3KTDA 1S8FA 5D84A 2REQA 5F52A 4BB5A 2ZLBA 1TCCA 2OB1A 2GILA 1YKFA 4D8YA 1UBEA 4ZOQI 1WV0A 2FW8A 1R5NA 3FHOA 4GZMA 3AF3A 2FMXA 1U0JA 2WIAA 3Q7EA 4X95A 3EARA 5CM8B 5KPDA 4P82A 3U0BA 4WFKA 4GMGA 1I4LD 4PIMA 3RYIB 1XMJA 4KLAA 2WFLB 1JRLA 2ASVA 3WE7A 3JQBC 1XQ6A 1MQAA 4XR4A 1W19A 1B8NA 3OQHA 1KI3A 5BSMA 2G28A 1YB7A 2CZCA 4YYEA 1VBNA 4Y2RA 5I5EA 2Z4RA 4LRUA 4WXPA 1HFEL 1Y6QA 2J0EA 3PRKE 5AVJA 1N1GA 4DJ5X 1QRTA 4F38A 4GP7A 4HFRA 3QVXA 3ESDA 2QT0A 1WABA 5A5FA 3V1MA 5JZOA 1CY7A 2PL1A 3CRW1 3DW1X 2RBGA 3M0EA 3AVTA 5LZ2A 1V35A 2P78A 4MO2A 1BAPA 3A3KA 3FB1A 3NC1C 1Y33E 3OZUA 3P26A 1RXWA 4G09A 2H2HA 3B9QA 3PA8A 4TKVB 1OZ0A 5ARBA 3MWEB 1VBMA 4JQSA 2N75A 4UCFA 4GEKA 2ZWPA 4EKDA 3ZCPA 4GSYA 4RD1A 3CRMA 1ODJA 3UMBA 3A6LA 1YQQA 3OSZA 2QSUA 3ZV4A 4MV3A 1YZUA 1QR2A 3BILA 4JI7B 2BHNA 4NJOA 1UT8A 1KEKA 2I65A 3FBWA 5DWQA 3NJRA 4DQXA 1FJXA 2IPOA 5LDDC 4Z1MA 1PYDA 1USUA 2DQZA 5FNVF 3RIXA 4P3YA 1Q3KA 2DU8A 4DSOA 5KQGA 2ZXEA 5MFPA 2IT1A 2JIOA 4DLRA 4UOEA 2IGTA 4YAGA 1Z0JA 5BVHA 3OQVA 4B6FA 3G0IA 4UOQA 1XKTA 1O95A 4MRMB 1N5JA 4C2TA 1WNFA 3FPCA 1WY7A 4O2BA 5H3LA 1QGAA 3OT5A 2SKDA 5E8RA 2GDJA 1SA0A 4C2AA 1HNXB 4ZOAA 3X2FA 2X6RA 2I7XA 5BPHA 4ARVA 1HT2E 3BHIA 3FPEA 1H23A 1GFZA 4YASA 3AF1A 4LX0A 5GQSA 4YB8A 2YWDA 1OH8A 1RLJA 1ZUNB 4KO4S 4L5IA 1OXTA 2F3SA 3AERA 4MINA 4A2CA 121PA 1MQ8B 3PD0A 3BHJA 4ZI7B 5CB6A 3KTFA 1R6VA 1NJ2A 1YGPA 4Z7OB 1AA6A 3HO6A 3OP4A 5T8KC 5L3QA 3PG5A 4N54A 4X8LA 3NDJA 2GPAA 1VHJA 2I6XA 3TCNA 3LUPA 1XNGA 3BCSA 4UHDA 3CCFA 4X00A 4RACA 1PFGA 3H65A 2IYXA 1G7TA 1W75A 3VYTB 3UIEA 5LP6C 3MCTA 1KK0A 3L5KA 4RIIA 1QPGA 3P9KA 2FEPA 2O9JA 1XKQA 1QHHB 3JQ7B 4M22A 5DK6A 2Y93A 3FWHA 1AS0A 4WXEA 5B2FA 5F76A 3UJ7A 1SRQA 4DNQA 1CUHA 2D0DA 1HE4A 4JY7A 4J8PA 4EMSA 4LQCA 2Q5HA 3TMAA 2X77A 3ST7A 1GSIA 4AY2A 3GAFA 1U6JA 4MS3B 4LHVA 4EF5A 4ZHQB 2CY0A 5TY0A 2QQ5A 1HWYA 1V1MB 1G41A 1BFUA 3DC7A 4M37A 1NJGA 3D1JA 2PMDA 2WTNA 3MOIA 5DHPA 3C24A 4MDEA 3O3CA 4Q37A 4YONB 2H4YA 2Q1XA 1IQ0A 2QE7D 4GVXA 4RVNA 2BD0A 2BSAA 2E4ZA 2X41A 1AOXA 1SOMA 3H5VA 2ZKLA 4DV7B 2FH5B 2FPOA 3AJAA 4WX2B 4NH0A 3EZ2A 4EQZA 4L50A 4ZN6A 2FW0A 1UJBA 2QTWB 4GMXA 2CW5A 1K7XB 2Z8YM 3KSRA 1SVKA 2VDUE 2YDXA 3AXTA 1T13A 3EWSA 2P0EA 1Z0DA 4ZVNA 4TQAA 2BKAA 3OIUA 3LYAA 1FS6A 1V45E 3CE9A 4FN4A 2BKXA 4OXYA 4C07A 4BGDA 3WNCA 4ESVA 1JBQA 2AXNA 3LX5A 3FCCA 3MJTA 4NDAA 1OA1A 4PAOA 1AUQA 1YS7A 3EIWA 4UCWA 2XUAA 4KBYA 4R7GA 5B58T 4BNYA 5IVPA 1QRRA 3UQZA 3K2IA 2P9BA 2R25B 3MWJA 3DFZA 4KO1S 5GGXA 3TW0A 1JNXX 1N4DA 2I1QA 2NLOA 3QFSA 4OG2A 2XUDA 3U26A 3IMKA 4K9MA 1E2HA 5FP0A 2ZSHA 4L4RA 2HA7A 1CJMA 1Z8HA 2CUKA 2EHJA 2VJQA 3WB9A 4S05A 3CW8X 3F2IA 1VE5A 1JR2A 3B6KA 3GLRA 5C53B 1XP8A 2ZWAA 4ALIA 1RKUA 4IM7A 4Z9YA 3NHRA 1X1QA 3QWBA 4BZWA