4YS4A

Crystal structure of pf41 tandem 6-cys domains from plasmodium falciparum
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
351
structure length
258
Chain Sequence
MGKSHKCDFTKEKYLLSGEKEVSCEIDANPADDITFICPNLCFHTVNIAKNINQNKATMSIQDLLYGSVVYGNTLFISPYVRTNTPFYCFCNLDTVTIQKFLKINRFLKDDDELSIISKRGIMSVFVRSNNNVIKGCDFGNNNKNYFSHPISVAGVNNKVCKIQGKPGELVGFKCAFEENGKVEPPNCFDQVLHKNKVTDLKTLIPGYASYTNKHSSKYPYYLKIPHFVNEQYTIQCCSNNAQNEYTFELDIQPGESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Plasmodium falciparum Blood-Stage 6-Cys Protein Pf41 Reveals an Unexpected Intra-Domain Insertion Required for Pf12 Coordination.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
molecule keywords Merozoite surface protein P41
total genus 63
structure length 258
sequence length 351
ec nomenclature
pdb deposition date 2015-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ys4A02
2YMOA 2LOEA 4YS4A
chains in the Genus database with same CATH superfamily
4DTGH 2DWDB 3X1GA 4MDRA 1CLCA 1PS3A 2V8MA 5DFVD 4HP5A 5IMOB 2DL9A 2O6CA 1QO3B 1YQVL 2YPLB 4LSDA 5D7EA 4GS7C 1U8MB 4J6RL 1DVQA 2DQUH 2XQYK 4NXSA 1L7IL 5CP3H 3SBWC 4WKZB 4ZI8A 3M1CA 2QMJA 4A6YA 2ZOUA 2IAAC 2QPDB 2WO3B 1K2DB 3QIUC 4KHTL 4H13C 5ALBL 1QLFB 3RHWF 2CJ3A 4FFYL 3ULUH 5IJKA 1FGNL 3PPSA 3Q2LA 4ZPVB 5DVPA 4ZJ9A 4F7TA 1JHLL 4WUUA 4LVEA 5EG6C 2FGWH 5KYNA 1XR8B 1F42A 2EXTA 2WQ8A 3GTTA 2A99A 3ZKMC 1QBML 2PYED 1BEYH 2DZEA 3GKWH 2CNZA 2IPTL 3QJHA 3O45B 1HH9B 3Q43A 3L4UA 4L18A 4WEEA 4XNZC 3KWTA 3T4YA 2F74A 3LXAA 5F3BA 1XMEB 2YEZB 3MACH 2NQCA 2ZKYA 2OMWB 4KKBD 4MJHA 5JTWA 3P4NB 4NQEB 1OB1B 1QNZH 3PGDB 4Y1AE 3A47A 3M8OL 2SODB 1TITA 2X4PB 4FFZL 4KV5F 5F7NC 3KE0A 5DDHB 1PVHA 5DHDA 4JG0H 1FL5A 3FTXA 1NDTA 4NQCB 4ZW6A 1AHWA 1AJ7L 2PW2B 1ZS2A 2PYEA 2BY1A 4IOIB 3C08L 1X5LA 2NXYB 4XCFH 5GGVL 1NCJA 2ZT9C 3CHXA 1BQHA 3OC8A 3DMMB 3D2UA 1AXTH 4H0LC 3NJXA 1PZ5B 5E5MA 2GAZB 2VLKD 4M6OH 3QS3A 4NPYA 1KWGA 3SOBH 4P48A 7FABH 4XC1L 3HR5B 1UD6A 4YDIH 4MKTA 4X2UA 1OP5K 1CICB 1O9VA 2CM5A 4ES9A 3VVWA 5K39B 1DBML 4WVRA 4GW5B 4R6UA 4P2CG 3TN0D 3UJJL 3U2SA 1IQWH 4LDLB 5E9NA 1IEAB 4HOWA 4PLNC 4JJOA 5E4AA 3FMGH 4OCRL 4EN3C 1HINL 2X4TB 1N5AA 5E8PB 1J1XL 4GFTB 5FYKD 1CFNA 1BQRA 1L7IH 1J88A 3CE1A 1AZVA 2ITCB 3VXUA 3ZYIA 4M93B 3IJ9A 4N0CC 1NBVH 4UI2A 2XFGB 4AK1A 3EXJA 1C8PA 3X2QB 4GXUN 4CDGC 4W81A 5KAQG 1DSYA 3FULA 5BW7A 1FVEA 4LPCA 4ZW7A 1KTKE 1IAKA 1WD8A 3PRZA 5DJ0B 3JVGA 3C8HA 2APVA 1UD3A 2YSTA 3MNDA 3E3QC 1SY6A 1T6WA 2AXJA 2CUIA 2PO6B 2VTFA 1YEEL 4DCQB 1JRHL 4H26B 3P9MB 4TL4A 5ADOH 5E23A 5DS8A 2RJMA 4CW1A 4WFHE 3QUZA 3ABGA 1Q0YL 3MBXL 5JOFB 5AUMB 3GIVB 4Q4EA 5KVDH 1J8HA 4XMLH 4LAQL 1I8KB 1RZ8B 5TQ2H 2IPKA 2NYZA 3WSQH 5J6GB 3CDFA 4HXBH 4KROC 4FF9A 4UQ3A 1MCPL 1OAJA 2AXFA 5SWQB 2H8PA 4LEXL 4ZAKD 1GJWA 4IIZA 2VR8A 3MV8B 5CMAB 5B22A 5CSBA 3OZLA 2NY2D 1MJ7H 3H3BC 5FA4B 1LHZA 3WBDA 4A6YB 2HVBA 2DWXA 1B4LA 1U92B 3O0RL 1CUOA 2IH1A 4UILL 3LKOA 3ESVF 3SKOB 2VH5L 1MFDL 1GCFA 2VUYA 4PRPB 1JPSH 4UTBH 4EKJA 5DRZB 1FBIH 4AIOA 3VFVA 1U8LB 1XIWA 2CMRH 2CBMA 1WFUA 1LVEA 3N5AA 4AJYV 1T3FB 1SMAA 1ZJAA 3AQZA 1KYDA 1KYAA 5E8OB 5EO1A 4NC1E 1DVTA 1KTCA 3PHAA 3W81A 2ZCKL 3AM8A 1BX2A 1E5ZA 1U8KB 1IMHC 1WP6A 3MV01 3DOHA 4QRUB 1VPOH 1WZLA 5EZOL 4BZ1A 1PBYA 3L17A 3QWQB 4YDJB 5DJDA 1B4TA 5DCCA 3DURA 4C56A 1QSVA 3QYNA 1SOQA 4ETYA 2PPAA 1JF5A 1XF2A 1E0OB 3ROLA 1DLFH 4EIBA 3D18B 2W9EL 1AAJA 1I4FA 2KPWA 4JJ5A 1I8AA 4W9HC 1E5UI 2NNCA 2V5TA 5F9AC 1EEUA 1FAIL 2VERN 2B1AH 4X0NA 3LZQA 1O9WA 1QRNB 1UWFA 3VXRE 2EYSA 3C8KB 1CL7H 2OS7A 4UM8B 5CLZA 1ZV9A 3MGTB 2EO7A 1G4MA 3NJFA 1L9QA 2OL3B 5HJDA 4JFDD 2R2CA 1X5FA 2IWKA 3E6FB 1HKLL 1H5BA 1A7PL 2YXFA 2FL5A 5ABAA 5CEXA 1RPQA 1TTBA 2W91A 1P7KB 4Q14A 4HZAA 4GKZA 4W9DC 4XMZA 5C08D 1PG7X 4GOSA 4JQVC 3SJVD 1J05B 2ZSWA 3CH8A 3LOWA 4U0QB 1FL3B 1BIIB 3DNKA 5D1QE 2GEQA 3B2UC 4P99A 2D8KA 2OJ1A 1WAAF 1NIEA 4M62H 1LO3H 3JUZA 2XKSA 4XP4H 4IIQA 1T83A 1MAMH 1BZOA 1P4BL 3I02A 4G42B 4FXKA 4BKLB 4WI5A 2XZZA 1UM4L 2FT8A 2GJ6E 5CLWA 2RACA 4YUEH 3GLAA 1A0QL 3N43B 3RAJL 1EQWA 3TYGL 3FB7A 4AOFA 3IJEB 3P3UA 2XQ0A 3BIBX 2YR3A 4PY8J 4XHJD 1J8HE 3D12B 3NA4A 4FQQA 4N9GB 3O3UN 5D7IB 5AKVA 2X28A 2MNJB 2GTWB 1FH2A 3S3DB 2GW5A 1CE6A 2G3NA 5FF6B 2WP3O 4XODA 5A6LA 4RAVB 3D34A 1BD2A 3VXQA 4YDLC 2FO8A 5E9DD 2FX9H 2WCPA 1E3ZA 3Q06A 3VXPB 3ARXA 4N8VB 3CFCL 3INOA 3P9MA 2WB7A 4G6KH 1AGCB 4L8BB 4FQPA 1HJCA 5JYMA 1F6FB 4E2OA 5CXPA 5ISZE 4UOQA 3TF7C 1YVLA 5L2KA 2AW2A 3VFPA 2UYLA 3UYOD 5FUZH 1K3ZA 1TO4A 1BQHB 4ZXBD 1YPZA 5AZ2L 5C0CE 3W11C 4KKRA 1OO2A 2LFEA 4KU1A 1W72A 3IU4L 4KX7A 5E56A 3H4HA 4P2RB 1XGTA 2DM4A 5FYJH 1D5BB 3DX0A 3FTWA 3VW3L 2X4RA 2FGWL 1DEEA 32C2A 4FNSA 1OD7A 3BO8A 5EBWA 1CO1A 1YAZA 1J1OL 2GFBA 1M7UA 3BXNA 4KJWC 4KQ0A 4AQAB 3JV4B 3ZT7A 5JHLH 1QOKA 2HT3C 2J25A 2GI7A 1MVUA 4GPVA 4NZTH 3BLKA 43CAA 3BQUA 1SEBA 5KVFH 5L9DH 3FN0H 1MHHA 1IE4A 3WS6C 4JG1H 3FJTA 2ODIA 3OHXC 2VXVL 2ARJB 4L9LC 5HYQB 3KJ6L 4PJCA 2E7BA 4IJTA 2BS9A 2YKLH 3PWPD 4RGOH 1HHIA 1E4WH 4PCYA 4IGBD 2DBLH 1E4KA 4QLRA 5FM8A 1BBJA 5GQBA 1P4LA 2B1OA 3LV3B 3UTSE 2C4FT 3ZTNL 1X5AA 2BY3A 3RL1B 2XJLA 1G4RA 3OR6B 5E08L 1YEHH 1N3NB 3DX9B 4GW1A 5ICXB 1JHKL 3P4LA 2KLRA 2QPSA 1EEYB 4KRPC 5IBUG 5F44A 4DK3A 1SHXA 2NY3D 5I6KA 5AFAA 1E2WA 1IJ9A 3HI1B 1MWAL 4LESA 4R7NA 4RFOL 3IDNA 1NJ9A 2P5EA 4U1NB 1QRNE 3HNSH 3VXRB 2V5RA 2OCFD 3ATFA 4NHUB 2DYPB 3EJYC 3ABKB 1WAAE 3EYFB 3CCHA 3MNMA 3QG7L 5F9DC 3UG5A 2UWEE 1L6PA 1NMBH 5F97E 3SO3C 4WUUE 2AERT 2DMHA 2CR0A 4WFGD 3GWJA 4OAWB 1A9EB 1BD2D 2ZNWA 3J07A 5AKRA 4LCIH 4JRLA 4P2OC 4UTBL 3EUDA 1IKFH 2ZUQB 1EA9C 3DETD 4O5LH 1NLDH 4KXAA 1DBBH 3QJSB 2XWZA 4OD3H 3QB7C 1I82A 4Q9RH 5IF0B 3EFDH 1NC4D 4CN1A 2DLTA 4O4YL 2CLRB 5MEQB 1YCSA 3G08B 3RX7A 2A38A 2IPUG 1CF8H 1YEDA 4KZCA 5E5UB 1K6QL 1E8ZA 4UZGA 1BOGA 5CZRA 3U9PH 3S4SB 2NRDA 1F8TH 3BDXA 4N8CL 1S9VA 2W65A 4GG6B 4IBZA 3GFUA 3V4UL 4L5FH 2AJZB 3ALWA 3WN5A 1LO2H 2CALA 3NFPB 4QPEA 4ABQA 1FIGH 4WU7A 1FVDA 1PFOA 1FA4A 2XV2A 2D0GA 3FSZA 1VKXB 1AO7E 3U4EA 2O5NA 1YN6B 2PCXA 3DSFL 2HX7A 4E9QA 1S7RA 5F9OL 3KPLA 3IETB 1NIAA 2R4RL 5CD3A 2OCJA 1BWMA 4N4YB 3LZRA 3QIBD 1HYSC 2ORBH 2OK0L 4PJ8C 5EUOE 1OCWH 3WELA 1C5CH 3GS7A 1UOVA 2CKNA 2H6OA 2IH8A 4IJ3B 3QQXA 3S37X 4KZDL 1H15B 3NCJH 1AZNA 5C9JB 2R2EA 3NIDB 4LQFL 1KUMA 2NY1B 4GAGH 3VJ6A 4UV4H 4G3YH 3CN2A 4H8WL 4XN9A 1U2YA 5BOZG 1IGFH 2OSLB 1M71B 3KM1A 4B9ZA 3UZEC 1CDYA 4NBXB 1IAKB 2YEZA 4KTEH 5DJ0A 5C0IA 3V4PH 2YD2A 2CXGA 4B9CA 1VESA 2K3TA 4YGAB 2P1YA 1EXUA 3EHBC 1R3KA 2O5YH 2VUKA 4G82A 5AWNL 3T2PA 2YBGA 3PWPB 4NN6B 4PS3A 4QHLA 4XXCC 3D25A 2A2QT 3I3DA 5LCVA 2IPKB 3R4DA 1NCUA 4QF1B 3QI9C 5E51A 4DP9X 3V6BR 1P6FA 4N9GA 1CR9L 2W9EH 4HSAC 4BFIA 4FQXA 4QAMB 4AIZA 4OZGE 2CU9A 2MQ3A 1YDPB 5IESH 1T2QL 5DHVA 1ORQB 2YPLA 2I07B 4J3WA 4DEWA 3SPJA 5FKAB 5AVUB 3DPDA 2RGSA 2IPUK 3H9SB 4WI4A 3A21A 2ZCZA 4AKPA 1P2CA 3NABH 3ULVE 5TDNA 4MNQE 5CM1A 3WFHB 2N0KA 3C6LA 3QUMA 4XCCL 4FQJH 1A7PH 4U31A 1R17A 5KS9A 4L23A 2JQAA 4UT9H 5HDRA 2NSXA 4JKWA 1MHCA 2R4SH 3DHUA 2JIXA 5AZEH 5T33H 3GSUB 3GSOA 1A6ZB 2BNQE 1KCBA 4GIAA 4A38A 2XXGA 3BQUC 3II1A 2V2WB 5HI5D 2NY7L 3C9NA 1OGAA 5KBLA 1U9KA 1PNDA 4YUEL 4GSUA 4B9GA 5IB3B 2OMWA 2ZX6A 1RHHB 2RH0A 3M17A 5E2UL 5JO5A 2Z31D 4WFHD 2IH9A 1FC1A 4RISH 1ZANL 3P4OB 3CQFA 5SWSD 3GSRA 1N6QH 1YEDB 4KTYA 2EDYA 43CAB 4FQ2L 4HJJL 4L3EB 3AB0C 3S3BB 4NO0B 2F5BH 1SVZA 2CRYA 3EJSA 3K6IA 5F7DB 1HH6B 2OL3H 3T77B 5E08H 3PE9A 2WZ0A 4JCLA 5HGGS 3NYKA 2JKRM 1G7MA 1ZHNB 3A24A 1VA9A 3T5WA 4XNXH 5KSUA 1KXVC 3QORC 4QHUB 2XKUA 4LOUD 1MFAL 4TQPA 3HPLB 4WY7H 5EH1A 5HHXH 3FQRA 1S9XA 3HFFA 3WHE0 4JM2B 3X14A 4AGMA 4F7MA 3SJVB 5C08B 5FYKE 1NCGA 3OPZL 2NUTA 4HSCX 4QRSA 3QBTB 1NINA 2X6VA 2W8CA 2X9XA 3VXSB 1BEYL 4NCC2 2ATAA 3VFVB 3A6OA 4XPGL 1Q72L 2VERA 3HN8A 3BH9B 1M6UA 2J1WA 3L2MA 5IJVB 1E9PB 5EC2B 5EO1B 1XD0A 3ARBC 1QSFE 1ICTA 4Y4FA 3OKDB 3VB9A 2BFVH 4XXWC 1N4XL 3HVNA 3LIUA 4PJ5B 4MXVE 4IIQC 1QUNB 3GUFA 2EAEA 2I27N 4GH7B 4QWWD 3P69A 3SE4C 1K85A 1K72A 4J3SA 3EH3B 3GNMH 2PPCA 1X9UA 3S9DB 3BEVA 3WGUB 4Z7UF 5D8JL 1CFTB 4HETA 5T8IA 1AYOA 3WD5H 3WMPA 3WKYA 3IFNH 4WENB 2K78A 4E41A 3V6OA 4Z3FA 1DANU 4BSJA 4KY1L 3NDZE 2XXCB 2NY3C 2V2XA 3VA2C 4ERSL 1OAUL 2KMWA 1RK0A 4YS4A 4NT6B 4KPHH 5DLMH 3S4SA 1DJIA 1VCAA 5TTRA 1W6LA 1FFNB 1NFDE 5HVGB 4PJIF 4NOBA 4YNYA 3X12A 1ZGLB 5J4MA 1OOAA 2AFNA 3EBIA 3SPHA 4CKQA 2FIKB 1XGTB 4FNRA 3GSXB 4XVTL 2QSQA 4PLOB 5FV2A 4L4JA 4K5MA 4EIGB 1WFIA 2ZWZA 3MLZH 1OGPA 3MV8D 2I07A 2WKGA 3EOAB 4DP7X 3ULUF 3BLBA 3QDGD 5F7BA 2J43A 3RWHB 4F80A 5I16B 4MWFA 2NT0A 1KJ2H 3MROB 2NNFA 2YRBA 4AIEA 3MRKA 5K9JL 1DQQA 1UURA 3V9FA 2GJ6D 1NMAL 3JYBA 4OTXL 4S1DC 4YHYB 3O6LH 4GW4A 3DDGA 4YK4B 3LKSA 2TRHA 4OT1H 4YHIB 3O81A 1MW0A 1CGVA 4P3DA 4ZQKB 4BA8A 3SGDH 3T6QC 4NQUA 4W93A 5DD5L 4JFFE 4TRPH 3JT2A 1E9QB 3LN4A 4R3SA 4EKXA 2EEXA 5GJSL 3DXAB 3OMNB 4GUPA 1PAZA 3TF4A 4I3SL 4PRHB 3R18A 4N1HB 3DJ9A 2X3BA 3D51A 4N2FA 1LP9A 5F3FA 4BZYA 1F97A 4MAYC 3EH2A 4HJGA 5ESAB 4ANVA 3VXQB 2BVUA 3GXFA 3CC5A 5HI3C 3QW9A 2CKBL 3MJ7A 1FZKA 2YAPA 5FF6A 4AMKL 4XMLL 1UGNA 3N44F 2N7BA 1UQSA 2VDOB 3HS0A 3IMTA 4Y2NA 4BGDA 3CDGA 5HJ3B 3NFNB 1ZHLB 1UJ3B 5EC1B 2ZKXA 3QK0A 5LWYH 3I6KA 5DD0L 3ZHLA 1D9KA 5SX4H 3QAZC 4Y4FD 1WGOA 3U0TB 4N86A 4P04A 3ES6A 3DRTA 4K0OA 4X5XA 4HS6B 2X10A 2MKLC 4HHAB 3D4CA 4H88H 2JIXD 4XOBA 1HJBC 1DJGA 1CFSB 3QARA 1X9LA 3EHBB 1I31A 1RPKA 3Q48A 4QRPA 4G6FB 1IBZA 4L37A 4OGYH 1GOGA 3WUWA 1TZIB 4XI5D 5IT2L 4I48B 2OK0H 2KI6A 4G8GB 1QZ1A 5DJ2A 4MD4B 1T5WA 2N1TE 4GKZB 4ODHL 2WQXA 3G6DH 5EPMB 2XV6B 3ZBMA 2C1OA 1N59B 1UEYA 2YJQA 1YY8B 2FBOJ 2CLVA 5MEQA 4I89A 4XN8A 4ZX4A 1O6SB 2P4AB 3IB4A 1JI2A 2OMZA 3DMMD 1JP5A 2CO7A 2X5PA 1HL9A 4RMRA 4UIKL 1JGLL 1TQSA 3TS8A 2H7WA 4GRLA 4TNGA 3RGVA 4XZUB 3GXIA 3L4WA 2FT7A 1MUJA 1NTDA 1F1GA 3PWUA 1MNUL 5CEYB 2IVFC 4JS7A 2AP2A 4PJ5A 1YQ2A 3W9EA 1D5XA 4JM2F 3SQOL 3DKHA 2FEDC 2QQNH 1BYOA 2QPEB 5GJSH 2VT0A 5IBLC 5LGHH 5EDXA 3COOA 2OPCA 2PTTB 1JD9A 3FTSA 3HIZA 5FGBA 3T3PF 2GK2A 5I8EB 3O9WA 4WEUD 1U3HC 4ZOBA 4IJ3C 3IS1X 2HLEB 4MASA 1EWHA 4XXWA 4NP9A 3SGKC 4FLRA 4V33A 5IW3A 3WAKA 5DZNA 4GRWE 3QEGL 1WBYA 5D7LA 2DQDL 4LASH 1G7IA 1OHQA 1CFBA 1EGJA 2P5WB 1A65A 4IRZH 5BV7L 2I9TB 2D9QB 3HRZC 3UBXG 3V2AR 2NY6C 1W0WB 1ANUA 5AOKA 3D50A 3QFGA 1M2OA 2UVEA 3DBXA 2BCMA 3NSXA 1IFRA 3FFCB 1XGYH 3F6JA 1MRCH 4JHUA 4KRMB 4ZUWB 1AD0B 2QGCA 2YPLD 1CL7L 3O6FA 2HKAA 4FTVA 3V52L 1EBPA 3SE9H 1RU9L 2HT2C 4IDLA 4XPHL 1RUMH 4YHNB 1VAHA 1OV8A 4XN7A 1SFHA 3LEVL 3DIFA 3UPCA 1EDHA 3FFOA 3TZVC 3MRFA 1FH5L 3VXME 4N5UA 1N9PA 4EI6A 1MWOA 2K4AA 4N8PA 4AEHL 2O5XL 1LK3H 1ZPLA 2WUBL 1BJ1H 3C5ZD 1DP0A 1MI5B 1RV6X 6PCYA 4UNTA 2AS5M 1CFQB 2G3ZA 2DWSA 2ROXA 2Y1AA 5SWZA 2FVNA 4P2OA 4OBRA 4LKCB 2J8UF 3U2IA 5KVEL 3IETA 5CD3B 3BCDA 4MJ6A 4OUUA 1WZKA 4OFKA 5KZCD 1NGWB 35C8H 3CVHH 1A02N 1B4JL 5EU4A 3KBPA 1HIML 5TE6H 3IAQA 5KUKA 3IU4H 3RFZA 5E6IC 5AAWA 1N5YL 1MDAA 4ZFOB 4TOYH 2EDQA 1ZIAA 4PJ7F 3WKNA 1F3DJ 3EW3B 1RQ5A 2OMUA 3TCTA 5E7BA 1OLLA 3KPOA 3WJJC 3VJ6B 3T3MF 4AGLA 4G8FB 1G7JA 4Q6IC 5D1XE 3MV11 4JGJA 3V4PB 5I5JA 4XBGA 5C9JA 1F56A 5KSVB 3FO9B 5E9DA 2J55A 4PJ7A 2XT1B 4TULH 1RIHL 4MBOA 2IEPA 1A6VH 4MD4A 3VA6A 4M6AA 4IKJA 2ITDA 2UWEB 1TSRA 4WHCA 3AAZB 1FORL 4IGBA 2C9UA 2ED6A 2IPTH 2FSDA 3PWPA 2DEWX 2Z91B 1SF3A 2AV7A 1VJSA 2Z4TA 3UCQA 1OE3A 1TMQA 1KY6A 2VW6A 4XX1E 1Q9KB 1CFNB 1D7BA 3D0LB 4KVCH 1HH6A 3IDXH 3RB5A 4QGTA 4DGYH 1LGVA 1CURA 4L1BA 3GMPA 4HLZG 3ULUC 3THMH 4AH2B 1WA0X 2ESVE 3ZTEA 1O7VA 3T1FB 3VDAA 3QIWC 4FFVD 5D5MF 2FUQA 1ZK5A 2AQSA 3H2PA 5DI8B 1LE9A 1SYSA 3RVWC 5GGVH 4QRSB 3EJCA 4IMLB 2IIJA 3U7WL 5AZ2H 1IAOB 3RDTA 3WU1A 5T1DH 1OCCB 3MREA 3F7QA 4WTZG 3LEXB 2PTTA 2WKOF 1O7DC 4NKIH 4DKFH 4BSVA 1F90H 1OW0A 1A6WH 3SGEI 1E6JL 4HS6A 4D9QE 1NUDA 1J9QA 2WSPA 2Y6SD 3P11H 1J5CA 3T8XA 1WV7T 1LDPH 35C8L 4XPBL 1WAAA 1MHPH 1ZMYA 1IQDB 2B59A 1CDJA 3MAWA 3UACA 1ZVSB 2IAMB 1A6ZA 3WJMA 2VMFA 4KXZI 4Y7OC 1G7HB 4PUBH 1J86A 3WTSA 4K71B 1I9JL 3LD8B 4PJFB 5EIQA 3HN3A 3VVVA 1PIGA 3ZIMA 4BQBA 2WWMD 3S36H 1K5NB 2B77A 1AQKL 2HRPH 2MNWA 3V4UH 1XFPA 3QZMA 2W07A 4DN4H 2YD6A 1NKOA 4Z8FL 4KXCA 4OZIB 5I6NA 3WNJA 1A6VL 3SGKA 3OG6B 2B2XH 5I0XA 3CK0H 5FUOL 3J27A 5D7IA 4EDXB 2X1WL 2W9LA 4Y5VB 2D31B 2HFFA 1KN4L 3HE7C 2WV3A 2QKIC 2UY6B 3SPVB 3SODB 3NIFE 3CDZB 1TFHA 1HEHC 4WRLA 3PWPE 3RJOA 5CZVL 1KBPA 4P9HC 3MLXH 1ETJA 3PP4L 3LX9A 4UYQA 3BVNB 4G9FD 1T0OA 2BO0A 5CFAA 1DL7H 1YZZA 1AANA 2PF6A 3NCJL 3Q2WA 5JDSA 4IBUA 2JSFA 1RZ7L 1SOSA 2CDEA 3AS1A 4LARL 1AQ8A 3BZ4A 1OOWA 3FCSB 4NQSB 3PXHA 2OW7A 5E8PA 1FDLL 5KJ4A 5AOLA 2OMUB 5KVGH 5D1XA 3T65A 2VXUH 4DP2X 4ZMZA 5C6WH 1A7QL 1QLRB 1J87A 2EE3A 5GS2D 4HGWB 3O0LA 3FRPG 4I18C 4UOZA 3IBOA 4L8SC 1EHXA 1AZZC 1W72B 4DO6A 2LHAA 2G9KA 1DJSA 1KEMH 2BSTA 1SZNA 3NQKA 5G5DA 1IM9D 1JZHA 2IOOA 4OCWH 4ZMQA 3HI6H 3JWOC 4HUWB 3BAXA 4WF7A 1L0XA 3P9LA 2WXLA 5C2BL 5AB0A 2Y3NA 3HBZA 3ARYA 3L4VA 3ZZQA 5GS0D 2VRAA 1LD9A 4WO4D 3WIHA 3OSVA 3EBGA 2GSIA 4M5YH 4YDMA 3NIFB 2IANE 4ZBJA 3KYKH 4KNQA 3MRGA 1IZKA 4JQIL 3DOSB 1IFHL 5INDB 3ZZLA 5D2LF 1Q0EA 1E9OA 3GTVA 3HZMA 4HOXA 1XWVA 1REIA 4MCZA 2V7NB 5C7XL 1FN4A 1MHEB 3WENA 1G9NL 2K9UA 5AW3B 2GJ6A 3HS0C 3VFWB 5ACZB 4QXWA 3DMMA 2BMKA 2BVOB 1QFWM 4A1RA 4WU5A 3HBQA 2OYKA 3RY4A 4G7VL 3X14B 4RZCB 4HJ1A 3U6XA 2NY1C 4TSAH 3ARED 2GB2A 4WW2A 5DQ9A 1T22A 3FQXA 5IHWA 3K4ZA 3PWJB 4HV8A 4W9KC 3CSTA 2WIMA 3BGMB 3MROA 2EXSA 3QHFL 4PIRF 1ZTXL 2R0WL 3MUHL 4A68A 3T0XA 4DETA 5D7SL 3CCHB 1S8DB 4UM9A 3T8XB 2XACC 5HHOE 5JORA 1OTTC 1OT1A 1JBJA 1NDGA 5JNYB 1A3LH 2WYHA 3VXRA 4TTDC 4OSUH 2YD3A 2GCYA 3H7BB 3U46B 1JPTH 4OAWA 2N0MA 2J7LA 3WXVH 2RA1A 1U8KA 3TJEL 1J1PH 3RTQD 5HYJE 3F6LA 4PI2A 2EYTB 2H26B 1M2VB 2H4EA 3G6JE 1HHJA 5ILTL 1OP4A 3FTGB 1KCSL 3U9UB 1KEGL 1G7HA 3FHAA 3KEHA 4GBXD 4UF7C 3MYJA 3P2BA 4XN1A 4Y16A 1BZ9B 2EDJA 1FIEA 1E40A 3S3JA 3GRBA 4PJ5E 1BQKA 3WG7B 5HDBB 4NJAL 3I6KB 5DRWA 1INQA 2PWEA 1VF5C 3BD5A 1R5WA 3KPNB 5LJYH 4M48L 3UTPD 4YLCA 2ZX8A 1BPLB 4Z7UE 1PU0A 2QQLH 4TTDD 4JANB 3MV7B 5DYOB 4L2YA 5TK4A 4KOCA 2D7TL 3CHQA 1EZVX 3I6GB 5EA0L 2YFOA 4JHWL 2D7OA 3TN0A 3U4EB 5AYTA 5BVJB 3P02A 2AV1A 4ZRGA 4EEEA 5I30L 2AJXL 2HKFH 2YK1L 3E2HC 1QBLL 4G8GA 4N28A 3TO4C 5EEWA 2OMZB 4PJIE 3EGXB 5GXBB 4P5KB 2BDNL 2EH7L 1U92A 5HVFB 3DX7A 1NJ9B 4WUKL 4EO5A 1G9NC 3AY4C 4R4ND 5FA3A 2G2RA 1RZJH 4OZFA 3VTMA 2X7LB 2DB8A 4HPOH 1NOFA 1U95A 1ESOA 1XSKA 5H8DA 3RIFK 5KANI 5HSFA 3W9EB 4E9XA 1VFAB 4BUHA 2Z31A 4XGZB 5KUMA 4N3TA 4E41D 3KBHE 3IDXL 3N42F 4UU9B 1WFOA 5C1MB 2L7UA 2Y4SA 4BWWA 4HIIB 2QQQA 3GHEH 1R3KB 3IF1B 2BFVL 4OZGF 3IRPX 3WKML 4XNXL 1TJIH 5D7HA 2VDLH 3UABA 4P57B 1ZHLA 4APQD 1I1FA 2VLRB 4A66A 4E9TA 2WHVA 3W39A 3EOBA 3WI9A 5LBVA 4X5WB 4CW1B 4HLJA 3MRGB 4HUUB 2Q7YB 2W59A 1F4WL 2AQRA 2P48B 2YRLA 4H40A 4OV5A 3IEAA 3ULVL 4JFFA 5JPNB 4NI3A 2IMMA 3ORJA 3HEIB 1R5VB 9CGTA 3AG4B 4BZ1L 3G5WA 3LPPA 4OT1L 4XNMA 1ZRUA 1QKZH 2YD9A 3W37A 1GAFL 2NZ9D 2ZX5A 5F8RC 3W2DH 3FCGA 1IL1B 3ATAA 4NBYB 3V10A 3QDMB 4DK5A 2H1XA 4AM0A 4YN3A 5T5FH 4AXWB 4K73A 5GIRB 1P2CB 4HKXA 4QRQB 3BWSA 5CLTA 2Q6WA 1Y6KR 3KWVA 4Z95L 3CU7A 4ZFFA 5EIIB 1DVFC 2PP8A 2ARJA 3UZVB 5HYQA 4M7JH 5C07B 3QZPA 4P3WA 1J1OH 3GINA 4R9HA 2C9RA 3VM7A 2VDQH 1NEUA 3WEBA 1M9WA 4JL2A 4M7ZC 1A8ZA 3AQXA 2KS0A 2EYTA 2FX7H 3FSVA 1UZ6E 2PYEE 2A6JB 1E4XL 3FQUB 3AG1B 3FOMB 3OJMB 4PP1C 1OAUH 2LFGA 2VDNL 2M1KA 3GBDA 3CXHJ 1YNKL 4PLJC 3SHSA 5C0GB 2VAJA 4NZDA 4DP0X 1T1YA 3CK0L 5A6IA 5IEHB 3DX9A 4GW1B 5ICXA 3BKMH 1DDHB 1XF3A 2DIBA 2JQMA 4Y1AA 1SJHB 4F7PB 2NR6D 4MDJB 4KH2A 5A2BA 3V6ZA 3U7YL 5HDQH 3FQWA 3K2UL 2J6EL 3KLQA 3NBNA 1KGWA 5CJQH 1HSBB 3TJHD 1KGXA 3HAEG 4QYAA 1A4JB 4OCMC 3VI3F 4FA8A 2E9GA 4U1IA 4NHUA 1LWHA 1DLHB 2IXQA 1QSFA 3RZWA 1KIQB 3ILQD 4QNPF 4ELMF 1U3HA 4ANWA 1Y7VA 4YDKL 2ZE0A 3BPLC 4LLAA 5BVJA 5KSUB 2FHCA 4G9FA 3E6FA 1FSKB 1MAML 3FK3A 5D7SH 5HHNB 2RIKA 2IGFL 2XPZA 3S0PA 2AV1B 4LHUA 2XQBL 4TM9A 4PGDB 3TNNA 1R19A 3RVXC 2VDOL 1PSKH 2AV7B 3UTQB 3ZZ1A 4ZFOL 2WPGA 1A4AA 4MAUH 1AGBB 1FCGA 3EGXA 4AYEC 2QVFB 1MY7A 5CU9A 1TPXC 5AYUL 3M6DA 1LM8V 4AENA 5DHEA 3MLVH 3ULUD 2RCSL 1WHPA 4MX7B 1UB6A 2DLFL 4Y19E 4AEIH 4NQQA 2CUAA 3CFCH 3P54A 4IKKA 5ESQB 4U1KA 5C08E 3S97C 2HWZL 2NDGA 1JV5B 2F8OA 5E4IA 5FOJA 5B39A 1NFDF 2V9QA 5IB3A 2XZCH 4NQEE 1IAOA 5BUPA 1FNEB 2K6ZA 4WJG3 2A0LC 2ATKB 4ANKA 1N3NA 3U6XS 2QHRL 2WK2A 4YXLL 5F7YC 3U0PA 3L1FA 2LOEA 2YPVH 1OGAE 3K2IA 4FFYA 4Z0XA 4GUQA 4HCRA 2XWTA 1GGIH 5D1XD 5TJWK 3IFPB 5KBKA 1INQB 5JYLA 4JG5A 4N2NA 1SEQL 4A2DA 5B1JC 2X9ZA 1ZVSA 3ZTJG 4WFFD 5DVKA 3IYLW 3LH8A 4JMXA 3FQNA 2Z92A 1PZ2A 4JAMA 1OM3L 2E76C 3QIUA 3QO0A 4ONHB 2JJSA 2PPEA 4KMQA 1RZGA 4XNMB 3TM6A 4L8CA 3DX1A 3UPAA 5JW5A 4NZUL 3HKZA 2GFBB 1SXCA 4OZ4B 2YKLL 5HHMD 1JE6A 4JPWH 5DS2A 4YXKH 1A8JH 1DJYA 1XZ0B 3HLKA 3JV4A 3UAJC 1YEGH 1MXGA 3CFDA 5A16A 3RTLA 4DZ8B 1HHHB 2MOVA 1EZVY 1GXEA 4JW3A 4MCZB 3OAYK 1XB8A 2VMDA 1Z9SB 5IMLA 1VERA 2BRQA 4FFZH 3VI3E 2AMGA 5DK0B 4XVJL 5C6PB 5K9QG 2CCLA 1LEGA 1QFUH 4MXWL 1KDJA 3QCTH 4UT6A 5HHMB 3RY6A 2VLLA 4XO4A 2APBA 2FECL 2F5BL 2AI0H 3DRQA 3PAVA 4F27A 3D5OF 3ETSA 2R29A 1FHNA 3UAAA 4MDJA 4HLEA 4PG9A 3HG3A 2A9NL 3BOVA 3MODH 3QCVL 1NMBL 1YN6A 2VNCA 3LRMA 2IDFA 3C5JB 4KRPD 5BV7C 2W0PA 5LG1A 5FCUL 2E7CA 3E9UA 3IAPA 1EEQA 4H25A 4OGZA 4OV5B 1VIWA 2N7SA 4YBHA 5D1XB 4F9PC 3QQNA 4YSEA 4FABH 3RVTC 3X12B 1G9MC 1YECH 4PGEA 5G5DB 2PWFA 2X4OB 5J56B 5EUOA 1YYML 2J71A 1JVOA 2R2EB 3JZ7A 5T3XL 3OKKB 2P7TA 2VN5A 2DJ4A 2FEEI 3LPFA 2ED8A 4EI5C 2OR7A 1QI3A 4PI0A 4DP4X 3MV9A 3BWUC 3MLUH 2XV0A 4G8AC 5BPPA 2WUBH 1WJ3A 4NFCA 3BFOA 5C6TH 3CDCA 2EUZA 4J12A 5JIQA 2YOCA 1L7TL 2NY7H 4X5QA 1JZDC 3PJNA 1WFMA 3PV6A 2FQFA 5KVFE 3KLHC 1BLNA 4X80L 4GRLB 3K2MC 1D3CA 4Y19B 3LKQA 3V7MA 4BINA 2AEOA 1BFOB 3LNDA 3UFIA 2DTMH 2XETA 2CGRH 5I8KL 1DSWA 4XZUA 4BFJA 3MV7A 4HIJB 1W8EA 1MWAH 1UB6B 1LEIB 1D5XB 2OZ4L 3IT8D 3L9RA 1JGDB 2PYFA 4G6JH 5E1HB 2ZF9A 5CEYA 3TCLB 4B0MM 1YDPA 1NCAL 2AXGA 4H20L 3MA9H 1CFVH 4WW2B 4EI5D 2BHYA 4QXUL 4WKZA 4CC4A 3FU9A 4UAOC 4PYGA 4F8LA 3TO4A 3CZGA 4W4OC 5EC1A 1NPNA 2EDBA 1RUAH 4FLSA 1S8DA 4Z78A 2FWOA 3TBSB 3PHQA 5ABZA 3IVKB 2ADIA 3CC1A 2YAHA 2EDEA 1MHCB 3ARTA 3MOBL 2VKXA 4LHUG 5F0LB 4C83B 3A22A 4CVUA 1NH6A 2R9HD 1I8LA 3CSBA 3MRJB 5E03A 5BMFH 2ENQA 3VG0H 1WVZA 1RMFH 5JOPE 1QRNA 4R90L 3FT3A 3GLZA 4R7LA 1QR1A 4GUOA 2OLDA 1ZHKA 4HCRL 4DN4L 4HAGA 4D9RE 2KPNA 3MXWH 1RSFA 4JLRB 1NWOA 4X6DB 1HCYA 1BQHG 2GQHA 2Z31C 3FU7B 3L3IB 1X5ZA 4OF6A 4AVIA 3QR1A 1XXDC 1UA6L 1UB5B 4PGDA 2KZKA 4HQQL 2EIZB 4PY8I 3CSYA 4B41A 3AXIA 2JXMB 3MBWA 1KDIA 2QV4A 3OAYH 3HC3H 4DW2H 1SRDA 4P46D 5DHMC 5IFAH 3IJ8A 3D48R 2FYVA 1M7DA 1Y6MR 2L4OA 3BLPX 4G7SB 1JNLH 3SB3A 2V9RA 3U7WH 3MGAA 2QKSA 4GSRA 4U05A 3EDKA 2X4UA 3LTVA 4RX4D 2F5AL 4Z7WF 1EFXB 4PRAA 4RMBA 3ML8A 2I69A 4P5SA 1KELH 1M05A 3H85A 4EI5A 1A7QH 3LHAA 4D9RD 4F9LA 1ZVNA 4IRJA 4P5KA 4L3CA 4WO0A 4K07A 4R96A 5I5IA 3ZL4H 3FB8B 2Y7MA 3LIZL 4XN4A 4BFGA 3PNWA 4NCC1 4BHUA 5AB2A 1VGEL 3JTTB 1A9VA 4B3EA 4PUBL 1KV7A 4F15B 3MXVH 5CN1A 3M1OA 5CBEB 3QAZB 2BSSA 5C0CA 1SN5A 4ZFOA 2CO1A 1J48A 3HRPA 4BZ2H 1E9QA 3LN4B 1XXFC 5E8EA 1NWPA 5IB2B 4M43H 4OTXH 2ROYA 3GMNB 1VFAA 4ZFQA 2VLRD 1AYRA 3SDAA 4APQB 1AKJA 5L2KE 2Z92B 4JAMB 1XD1A 1UM5L 3O9WD 4TQEH 1N6QL 4NQCE 4G7YH 4HIPA 4K5OA 2BVPA 1QD0A 2EKJA 4O2CB 4N87A 5E5LA 2GY5A 3AAZA 3L3KB 4E41B 2HRLA 4JZNA 3FF7A 2NQDA 2EZ0D 2DIJA 3D30A 1LDSA 3LH2H 4IIQB 1RK0B 4TVPE 2J21A 2EDNA 3Q13A 4UUJB 3R1GL 4U3SA 3WEXA 3I9IA 3HHSB 3BSZL 2W95A 4PJXA 4OU3A 2ZOTA 4LLWB 2YPVL 4I48A 5SX5K 4U1GB 3JV6A 3UTSB 2GT9B 1VFBA 3MRLB 3KLLA 4P2OB 4F7MB 4J2QA 3E2HB 3TO4B 2VDMH 2EKSB 3OKNB 4Q9BA 5D1ZB 4LQ1A 3FHEA 1N7ML 3GMRA 4LCWE 1AHKA 5CCHE 4I5BB 2YD1A 2J8UB 3CFNA 3ZK0A 1G6RL 1KPRA 3QJZA 4X0KB 2ZNXA 1T04A 8PAZA 1RZJC 4PJHE 1FO0B 2JI1A 2WXPA 4RGMC 1ZWIB 2WWOA 3N91A 4LU5H 4E0RA 4K94C 1ZLDA 2RQEA 3BFWA 4YFDB 1DQLL 4Z76B 4DUVA 1HESA 2VMJA 3CZFA 3GJEB 4XAWH 1HH9A 4MHHI 3LZOA 4W6YB 4LDCA 5B39B 3ETBJ 5D1QD 1HNFA 3TXAA 1OK8A 3DO3A 2JCCB 2OL3L 3JWDC 1N12A 4GKSA 3O6KL 4XPAH 4HG4K 1JPTL 4HC1L 3ARFA 1SYVA 5FHAH 4LGRB 5B4MD 5J6HB 2PCYA 1CN4A 4WW1A 5DDHA 4FRWA 1AP2A 4NNPL 3VMNA 4TNFA 2EIZA 4NERA 4AL8L 3ES6B 4ELDA 1Q9LA 4MXVF 2YD5A 3DUUB 3KBFA 3MRMB 5DMYA 2D3NA 2DW5A 3TBBA 3CVBA 4ORGB 4PJCB 5L4FA 2BRRH 4HS8H 5L4MA 1S7WB 1VEMA 2KHAA 3MODL 3QCVH 2O6EA 4RGMB 5D7JA 1NAMB 1PCSA 3ECVA 1RZ8A 4HG4J 3QISA 2H8PB 2WZ5A 3ZR5A 3HOGA 4HIJA 2HTKD 3AREB 1H5BB 2CO2A 2FL5B 4RA3A 5GRJL 4UQIM 3IJYB 4G1MB 2HTLC 1II4E 1ETB1 4HJ0D 5EFIB 3HNSL 5BZDB 1E6OL 2Q3AA 3FPXA 5DJ2B 2XQYA 5I15H 1QASA 1L6XA 1JXKA 5GIRA 2H3XC 3NG5A 4LCYA 4I3SH 1RH8A 4Q97A 5LXVA 4ISVA 3BPOB 2FWOB 3MOAH 4IK7A 4U1LA 4D7PA 1UXLA 3KDMA 4AT6B 2NY0D 1HQ4A 3D4ZA 4UAHA 3B8YA 4YDZA 5TDPA 1LXMA 5BOPA 3ZE1B 4D0DA 1IU1A 3SDAB 2BZDA 4ZMOA 2JFCA 3WNOA 1TPXB 3CXDL 1YUHA 2A73A 5IROA 3SDYL 1K5WA 3BEWA 2E8YA 1LQSR 3IWUA 4LHUD 1I1AC 2R23A 2VN3A 2A1WL 2B5IC 2OMVB 2X4QA 3VXSE 3WY4A 5I75C 5EB9A 3CC5B 2ATKA 4X8XA 4O2CA 4L1TA 2GITB 3BAJA 2VXSL 5ACMA 3CAFA 2VITB 1O6TA 4E36A 4ZMAT 1FYTB 3QXAA 4W70A 1BQLH 1U3HD 1A6TA 1UJ3A 2NY6B 1E9OB 4DEUA 2ZONA 5IT2H 1KXVA 1M1XB 2XTJD 3PWVB 4U1IB 1MIEH 7FABL 3MUZ1 2E7MA 1NDMA 4JHVA 3CFTA 1MCKA 2YS4A 5KVDE 3ZRFC 3RIAK 3NIDF 1KULA 1UATA 3I9GH 2W9DH 2D7NA 4OF5A 2OX5B 3V0DA 3WN5B 3SPVA 2N56A 2DDQL 3MQIA 2P7TB 4BQ6A 4NO5B 2R56H 3DX8A 5IHZA 1MF2L 3C5SA 2R1XB 4MQSB 1BIIA 3QULA 3LNFA 4P23C 3SGDI 1GR7A 1QX1A 3NCWA 5DD6A 1NFKA 1GC1H 2ZKWA 3VDBA 2CDEB 4QUOA 5IV2B 5ESVB 5D2NE 3B2VH 3K5SA 4Y4HD 3P30L 1TQTA 1E4XH 3QQ3B 1S5IH 4JFFD 4GMSL 1Z9SA 3QCUL 4PJGB 1KTDA 1WEJL 4XHJC 5TF1H 3MX0B 2YLKA 1WSST 5CCGE 1ET8A 2CKBA 5D6CA 1YEEH 2APFA 2EICA 2R4RH 3EFFA 1I1AD 4Z95H 4EZJA 1AJ7H 2WXIA 2X40A 4PFEA 2H9GA 2AKRB 2A4ZA 3K71A 4KUCD 4K7PH 3UMNA 1SHSA 4QRAA 1U41A 4N8VA 2YC1B 1J0KA 3Q5TA 3HI5H 4M3JA 2Y2TA 4LSQL 4Y9EA 1FNEA 3IMWA 4WNQB 7PCYA 4UIMA 1KTBA 2QBWA 1KN4H 3LEXA 1EFQA 2XN9E 3AT9A 1MCPH 1QYGL 4P2YA 1JWMB 2BVEA 1K4DA 4FCAA 2YLHA 3GM0A 1NLBL 1A7BA 5J89A 2IG2H 4L3EA 5LXGH 1CGYA 3DV6A 5I6XB 3X1BA 2E7DA 4L1SA 2FK9A 2QEJA 3IDYC 5F9OH 1G7JB 3R4RA 1E43A 4MD5B 4YHMH 3MRQA 2EE2A 3ZQWA 2MSPA 4NNYA 5I28A 5AOJA 3A6BH 1T7ZA 1RUKL 2WBWB 3LNIA 2D2OA 3AREA 1A2YA 2K1MA 4M7LH 2WLIB 1DUZB 4OLEA 5IVXF 1YYLL 2LAAA 4ZMPA 4HS3A 1FL3A 2RFXA 5BZDA 5DLLA 2A9AA 1P1VA 4JY4B 5KSBB 3PWJA 1ZV5A 4DKEH 4KDVA 4A7QA 1DVFD 3T3ME 5EDSA 1JGVH 1SVCP 3MRDB 4M5TA 5MEND 4PH8A 4OF0A 4KTEL 1BFOA 2R0KH 3F84A 2XWBB 1DQMH 1EHNA 3CPUA 5AVSB 2F53A 2PR9A 1NGPH 1QABA 1ZDQA 5L7XL 5MENB 2DM7A 2F8VA 4YBQD 4GRLC 2YMTA 3QXUA 4GQPH 3LQMA 3QJFA 2DI9A 4QXVA 3IFOB 2FAUA 3RL1A 1I8MB 5DI8A 1KGYE 2HFTA 1XF1A 3VXTA 5IY5B 3N9GH 5JIDA 4KQ4L 1JGDA 2PYFB 3IF1A 3IK2A 3SDDC 1JL8A 3BN9C 4L4TB 5FUOH 1TQUA 4WNSA 1TCRA 1ZLWH 4JHBA 4HIIA 3P0VH 5ANMA 2VQ1A 5GPRA 2Q8AH 4F8QA 1UOWA 1AP2B 1QBMH 3VD3A 3HCVA 4MXQD 3V9EA 4LCCB 3WN5C 2VR6A 1VB9A 2OA9A 1CG9A 4Z9KB 2XQBH 1G6RA 2NY5C 3CN1A 5T1KD 1CZ8H 4YXHH 4G7QB 5FW8A 2BSTB 4CL7A 4ELMA 3D85A 2R1XA 3BWAA 1ILSA 4ZT1A 1LK2A 1PYWB 4JG0L 5EEVA 3FO9A 1FH5H 3LB6C 5D4IA 3B9KD 4JVPA 3MNWA 4FI7A 3TU6A 5LN4A 4KY2A 4ILDA 1NANI 4L48A 4F8OA 4TLKA 5D96B 1O9ZA 3MRKB 4YZWA 3BC9A 2YUVA 5HDWA 2P8MB 1XMWA 3W0WE 4NZUH 5AVQB 1KJ3H 1OCRB 1T5KA 4N85A 4UQ2B 3V0EA 2O61B 3QJVB 1KBGH 3N41B 3D0LA 4HJSA 2YGNA 3FXIC 3UZVA 5M95B 3GK8L 1E7VA 5FGCE 2QGEA 2A6JA 3K1KC 4G80B 1HIMH 4JQXA 5DJXA 5TE6L 4BFIB 5DHYB 4DEPC 4QYOB 1S3RA 1RCYA 4GP4B 4E9WA 1CD1B 3VDCA 4ANUA 4P49A 4QRTB 4NUGH 1QFWL 1T80A 2ZSVA 1FZKB 3NCYS 3SE8L 5E6SB 1EJ6A 4DESA 4P57A 5JPNC 1E4HA 3TFBA 2ZF8A 1PPIA 3MO1B 2ZG2A 3PQYD 3FCSA 4DKAA 1NOAA 5DEZA 1ZLSL 4UOW0 2W80C 3FS9A 4WWKC 3DVNA 1YEKH 2BSBA 4G6AD 5C0CB 5D8JH 1G9EA 2NY6D 4PBWD 5FHBH 1UTDA 5LBSA 5C0RL 1FLRH 1FYTD 4J4PC 2BNRE 1R24B 5FO8B 2EC8A 3J8F7 4P4KB 1S3KL 4ZOAA 3MLWH 2CLZB 3V0WH 3GDCA 2WKOA 3F12A 4YDLB 3P9LB 4R8WH 2E46A 4KKBC 3CVIL 3I3EA 3T8VA 2EC9T 4LHUB 2H6PB 5JQIB 3AMLA 5C0AB 4AI7A 1HAUA 2QADC 5DF0A 2CLVB 1G1YA 5HXMA 1CDBA 1A3RL 2IMNA 3KVDD 3SDAD 1AFVH 3F04A 3LZPA 3ARDC 5T1LA 3T77A 3BGAA 2NY0B 4J8RB 5CZKA 3Q6GL 3PQYE 1I3RB 3ARPA 2V7NA 1INDH 1VZIA 1UACL 1FNSL 1X4YA 4LE8A 5LNDA 3QFJD 3UAFA 3WFBL 4X80H 1DCLA 1QEXA 2X09A 1PNCA 4UOW1 5ICUA 3MRBB 3SJVA 3ZSSA 3TPKA 4M1DL 3MLRL 5DQ9B 2J8UA 2C4XA 3BUDA 3U0WL 4URKA 5F89B 4P23D 1KXQA 4F2EA 3OKNA 5D1ZA 2O72A 3MRHB 2GG1A 4XMKH 2XVKA 3EHBD 1BXXA 1OVZA 5I8EA 3A6BL 4XNUH 3V7AG 4KXZH 4J6RH 2Y36L 4ZFFB 2JIXB 1XEDA 1N68A 1GL4B 1QLRA 3F58H 3U46A 4Y4FB 5C3IA 4QXTB 2BY2A 4AMKH 3B7UX 1GGUA 3LRSB 1QP1A 3BUBA 3SQBA 3GJEA 2HUEA 1WPCA 3BVWA 3NSDA 5IQNA 5T1JA 1FNGA 4NUMA 2F08A 4BH8A 5JW5B 2CE6A 3ZDZE 3VG0L 1HHJB 4ALAL 2VM4A 5D1QB 3VRIA 3X1FA 4JZNB 5CUSH 5C0NC 2CM6A 2WGXA 3RKPA 1DN2A 3W9DA 2WNXA 1KB5A 3DXAD 3MRPB 4TPRH 1BMGA 4PRNA 4QXGL 2AVFA 3MRDA 4NWUL 1RZQA 1XB3A 4UUJA 4X7EC 2OR9H 4BA0A 5JIPA 4F15C 3HTLX 3CZKA 2YPKA 1KBWA 3D3VA 1FPTH 1D6EA 1KXHA 2CBQA 1NGQL 1FZJA 2UUDH 4MVBD 2HJLA 2HH0L 5D71L 5MERA 2VW4A 1MCFA 2GJ6B 4XNAA 4H8HA 4RFOH 1KTLB 3CXHK 5AW5B 4AYBA 3TO4D 4HD5A 2XVGA 2RALA 5JA8B 5D2LE 4I85A 1MY5A 4KFZC 5JW4M 4P2OD 4C47A 1D5RA 4UIKH 5BVPH 3UTSD 3QJRB 1KBKA 4PG9B 1RSYA 5DMJB 1B88A 3ZMEA 4ABWA 3ABLB 1WQVT 3BHBB 4CDHA 4GG6E 1GZHC 1YNLL 4LSUL 2OSXA 5LNGA 4PJGA 3FB5B 4Z7QE 2XG5B 5B21A 5F7MC 2CA3A 3UIZA 1I53A 2J44A 3C8DA 5IJDC 4KNUA 4WHYG 1OPGH 1E42A 2F0CA 4BCXA 1AI1L 1JDCA 3UAJA 2P5WA 1PLAA 4NFDA 1NUNB 1LP9B 5CWSB 4M7KL 5FDYA 3RBSA 5K9OB 2CRZA 1OB1A 2GITA 3L3JA 4HOZA 1FFPA 1F8TL 3TBTB 2HFGL 4M48H 2GTQA 4JZOA 5C0DA 1LO5B 4N8VG 4PJ5D 4FNTA 4OVVA 1BV8A 4ZNEE 5ENWB 4FYRA 4KK9D 4XMPL 4O2FB 2VDNH 3FKUS 4PRHE 2O5ZH 1TQBC 1T7WA 5JXEA 3DUUA 3MRMA 3UDWC 3GMQA 3F85A 4V1DB 3D4GA 4LFHG 4HEME 2YXVA 5IMLB 1UUNA 1JZEA 1BREA 3WOVA 3D69B 2G9HB 3DGCR 4NN7C 4F7EA 5FECB 3H9ZA 1A5FH 2APWA 4XPTH 4JY6A 4TPRL 3MCG1 1RU9H 1B3IA 2ZUXA 2QGBA 4FQJL 3F62A 1DVZA 1W6WA 3CZSA 4PJ8A 4RMWA 5JPMA 2AK4A 1YN7A 4L3AA 3EOAA 3BKYL 3FN0L 4N0FB 5BRZB 4U2YA 4FKEA 1CXLA 1U8MA 1A3LL 4JM2D 2XG4A 1HQRB 1D2PA 2ICEB 4MDIA 1UOLA 2CK0H 1WC7B 2O5XH 3JQOB 4IRZL 3L1OH 4JY4A 3GKWL 2CO6A 5K39A 2Y2YA 1J8HD 2W88A 3DV4B 2B8OT 5K1JA 3ZDZF 1B6DA 3BZEA 2C9XA 5F9WC 1KPVA 4CVWA 5IVZB 3HB3B 5E0QA 4TULL 1U2CA 3NEXA 4NO0D 3VAEA 4Z7NE 5SWSB 1QACA 1IQDA 5FS5A 1INEH 2Z31B 3B9DA 4HHGA 3LRSA 3MTRA 1EAQA 4IBSA 1BZ7A 3DX6A 2DQFA 4GIPD 1FNGB 2BM3A 3GXUB 4QRFA 4HIHB 3BXNB 2ITDB 5DJCA 3MRPA 3QGVA 4KI5D 5IW6A 1OSYA 1CJYA 2IWFA 3BAEH 4GRWB 2C34A 2UZXB 1XEUA 3B43A 1ITCA 5JOFA 2HAZA 4EUPH 3QEHA 5ES4B 4AV5A 3O2DA 3QDJE 2DYRB 1N8ZA 3TC9A 5E99L 3VXUD 1AMYA 3UTTD 2W92A 2XTJC 1P69B 1I3RA 1KJ2A 2A9NH 3W5MA 2IF7A 3EZJB 2IXQB 3DUSA 4Q89A 4BUGA 3US0A 5D93C 4E9VA 4D8OA 5FM5O 3ENEA 4OCSH 4GQ9L 1OGSA 4DKFL 4Y2LA 2AXFB 4JM2C 4WTXA 5FA4A 1CQKA 3T04D 1ES0A 2C3VB 4G1EB 3GXTA 2F2HA 3QULB 1A7RH 2UV3A 4OZHA 4GKLA 2CK2A 2HCZX 1DYZA 5FW6A 4E9YA 4ZZFA 2FX7L 1UD2A 1QFPA 1LO2L 2DJMA 2BWDA 3IDGB 4N2KA 3T6WA 2X4TA 3T4AB 4P3DB 2RD0A 4J28A 1N8OE 1OE1A 1MFNA 2X6MA 3P4MA 4GRLD 2YXMA 5E8DH 4MRBA 4XNQA 4ENED 1MSPA 5I1KL 1WK0A 3HW7A 1TJIL 3UAEA 4B95C 4PP1D 1G7LB 2CO4A 3CBKB 4OGXL 1ZHKB 5DC4B 2VLLB 5BW7C 3I2CL 5HHQA 3QJOA 3QDGA 1SLUA 3L3KA 4LLMB 5K9KB 3ZT6A 3UTZB 1O7DE 3VSUA 1TJHL 3I9PA 2BK8A 5C3LD 1H6EA 1GGBL 2B2XL 2X42A 3CV5A 3GBLA 4HJ0C 4J23A 3CHOA 5F1SA 5FYJU 3P0YH 1R0AL 1AR1D 2XYBA 2NY1D 4DCQA 5CBAA 1B2WL 5DUPL 5I8CB 3WS3A 2D03H 2XLLA 4RDQF 3FT9A 4QI3A 3DOSA 2EO1A 3CGTA 5C09B 4YSQA 5DGQA 2E3VA 3D05A 4GRMB 4PJXB 4UM8A 1TETL 4Y5VA 2ZKHH 3CLFL 2X4OA 3MRQB 3O0RH 1G5AA 4LVNB 1WRFA 3HZYB 4RGNC 4U7KA 5D5MA 2G4GA 2VSKB 3B6SA 4WSJA 2ZQKA 3VUAA 3EJQA 3QZNA 2NY2C 3DWTA 2OW6A 4RQQB 3TLRA 5GZND 3P11L 4EOWL 2OI9C 3SBQA 3IM1A 3QORB 2XG4B 5TF1L 4X50A 1AD0A 2RCSH 4FHJA 1IGCL 1SXSA 3QA3B 5F7FA 3SE6A 1UWGL 5KSBA 3IGUA 3IN2A 1I1AA 4P3CH 4LNRB 3KAAA 5KYUB 1JIBA 4KTDL 4QHMB 3OL2A 3BKML 4YSTA 4UQ2A 3GB7B 5CJXC 1OANA 3AY4A 4BWUA 3NJKA 1TXKA 1MUJB 3V5HB 4MX7A 5ERWB 4EQ2A 1TUPA 4ENZA 1MI5A 1SBSL 1IBGL 3NZ8B 2BSRB 3S3PA 5JLZB 1JZ5A 1T83C 3FB6A 1G9HA 1BDYA 1E28A 4J1UA 3GSNL 3LS5L 5A7EA 5FYKH 4FMKA 3FTGA 5IEKB 2JCCA 4YSOA 4Y8AA 2G4EA 3V6FA 1TCRB 1BD2B 2EDKA 1PJWA 4I9WE 3FTZA 4PP2B 1BBDH 4KJYA 5C8JA 3VD4A 3ABZA 5DMGC 4W1TA 2OTUB 4J6IA 1MJJB 3F2LA 1QNIA 4UT9A 1PD1A 4H0IA 1FL6A 1S7WA 1KIUB 3WIFA 4KROB 3GZPA 2XX0A 1JD7A 3HZMB 5SWSE 1MJ7L 4XHQA 2XXMB 4QTHB 3NCBB 3VGHA 3HG1E 2EYRB 4GP5B 4XB3A 4A04A 1FAKT 3IGFA 3FT3B 2NY3B 5D1ZC 1L9RA 4X9FA 1CE1H 1Z0MA 1CQYA 2WCSA 3I6GA 1CIUA 5FUCC 4S1RH 4IKLA 5D55A 5L8LB 1UB5A 4FI8A 2MPAL 3H7LA 4N1EA 1SEBB 4AQ8A 2HMID 3QUMB 3RURA 2R8SL 1GKOA 1YAIA 5HDBF 3BIAX 4JREB 4IGBB 2BINA 4ZO7A 2WXOA 3ZIYA 3UL4A 1LYQA 3MUGA 2HKHH 4MCNA 3SGJA 4F5CA 1QSEA 1ZWIA 5EUKB 1C16A 3C60B 3QFDA 3DYPA 3N06B 5D6DC 1AGDA 3GI8L 2O4EA 2GCYB 5GHWH 4K9JA 4A7TA 3L95B 4MBRA 1F4YL 1LO0H 4K9EC 4E9LA 2F68X 4Y5XA 2HLFD 2ZUQC 5TFSH 3HMXL 4M1GH 2DI8A 3W5NA 1XHHA 3Q9QA 1ZGLM 4EQ3A 2VAAB 1C1EL 1OGAD 4HIHA 4HIXH 4MLIA 1VFUA 1ZLWK 3WS3B 1BVNP 3KWWA 1AGCA 2NX5E 3QDAA 4HUMB 2ADIB 4Z3HA 3DO7B 4PSPA 4LVNC 1FCCA 1IEBB 2H1LM 1W15A 2NXZC 3HI1A 3MJ8B 4OLUL 2WUCH 4Z78B 2ADJB 1GW6A 1UA7A 1D5IL 3VCLB 1Y6NR 3QZLA 4PHXA 4H25B 4FKHA 4LCVA 2Q7YA 1MRCL 4YQXH 5JXED 1JF1A 6FABH 5GGRA 3VRLF 1SNRA 3NAAH 5JPNA 2AJYL 1KLUB 1AKJB 1IC0A 1ZVHA 1B0WA 1E5AA 1QI4A 1U8QA 3FT2A 1B3JA 2JMRA 2FBRA 4P2QD 3DYMA 4YFLI 1KFAL 5E9DB 3GO1L 2C8NA 2BVQA 3D1MC 4K3EL 2LU7A 4KK6C 3NTCL 3TBTA 1ID5I 2AF2A 3RYMA 2WZAA 1CLVA 4E9RA 1NGZA 3LSOB 2VZTA 2DICA 4H8WH 3BDBA 4U6HB 3OKLA 1INEL 4AXWA 1ONQA 3BQUB 4JFHD 1X5GA 3PV6B 4FI6A 4I7ZC 2HRHA 4JFEA 5FXCH 4WW2F 3CN0A 1IGJB 1WWAX 3VYOA 3O6KH 4XPAL 1KYUA 3MA9L 2F18A 4XTRC 4GMTH 4UM9D 5DO2C 1BYPA 4JDVB 5I1IL 2H2SC 4QGYA 2AJZA 1FZJB 1KJ3L 3QR2A 5E24E 4JFWA 1ZSHA 3BPNB 4LKXA 3N41F 3L9EA 2PWHA 1MWAB 1M3IA 2QVTA 4OJFL 2DIEA 1FWXA 3S5ZA 1IIIA 2XWXA 1CFTA 1A6PA 4ZD3L 5H94B 5B1JA 4HMEA 1CL7I 5C70A 3HNVH 2EVJA 3BVNA 5TQ0H 5E6YA 2JB5L 1KLGB 2QSCH 1I1FB 2VLRA 5I24A 3OHMB 3T65B 4BFBD 1QRND 1IT9H 4K3DL 3OX8A 4HCRH 4LCIL 2VXQL 5EORH 2HG5A 4C59B 3PWVA 3ZY7A 3IWVA 4LZKA 1DANT 5FDWA 3AG3B 1T5XB 2MCPH 4F1ZA 3M8OH 1UVQA 3KS0J 4ZOCA 5KJ7E 2VZVA 3A67H 4O4YH 2WLIA 3HE7D 1QEWA 4AEFA 1NBCA 1YYCA 3TGXA 4CGUB 5GS0C 4NI6A 4M9OA 2J2ZA 2QL1A 25C8H 3B2UD 4FJYA 4QY8A 2GJPA 2JNZA 5AW0B 5I9QB 3FQTB 1NQBA 4TUOB 3VGAC 2NUPA 2ZOLB 4KDTC 1P9MA 3NN8B 3UBGA 4ACTA 5I73C 1IM9A 2YEQA 1AVAA 4MD0B 2FJUB 1SHMA 1BFTA 2ISDA 3MDJA 4WTQA 1P5UB 1DR9A 3G5ZA 3SOBL 1KXQE 3H9SE 4N0UE 1D6EB 4PJ8B 4E5XB 1OQXA 4K23L 1BIHA 5DYOA 4M3KB 4CVZA 4ZW8A 4XOEA 3TEXA 5EU6E 3DVIA 2JKNA 1AFVL 2V7HA 4GSDH 2OSYA 2AKRA 2P47B 4JFDE 5I17A 4F33A 1BAFL 4JL1A 5E94A 2ENJA 3V0JA 2K9FB 3TYFB 3WIHL 3CPLA 1QA9A 4M7JL 1AR1C 3V6FB 2R0LL 3C6EA 3MRCA 4N0UA 4XX1G 4Z7UB 3H9SA 3MV7D 1CXFA 4HC1A 3IN0A 1B90A 4AUUA 1KENL 1V5JA 4N2CA 3HBPA 4AJWA 2F58H 5J3HC 3SKNA 3MLWL 5EO9A 3V0WL 2QT6A 1P7QD 2QADD 2EVIA 4EUPA 2HJKB 1KACB 4HHAA 3S8WA 4FA7B 5HD8D 1OZUA 2NOYA 2FHFA 3CLEL 4UQ3B 2AGJL 1GZHA 4IGBC 2B14A 3GPSA 3TA4D 4E9SA 5L6YL 2E27H 3PDOB 4S0TD 4RFNB 4C55A 1NC4A 4I0CC 5HHNA 3ZT5A 5AVZB 3UYPA 2Q0ZX 4JGUA 2UWEF 4AMXA 3QEGH 1ECZA 5IKCA 4I9WD 4PTUB 3EBHA 3V9CA 4XRCB 1SY6L 2RTTA 3RTQB 1J5OH 1QPPA 5J6HA 3L7FB 4BEIA 3FUKA 2CO7B 5INDA 2J6WA 4U0RB 4NKOA 1XDTT 2LVCA 2VLRE 5DC2A 5L2KD 1A7NH 5FWQA 1TZHB 4PB9H 1DL7L 1P7QA 1J10A 1F45A 1MJ8H 2V4LA 4NAJA 3TN0B 3VFWA 5ACZA 3WHXA 1BZ8A 5DJXB 1BP3B 4AWJC 1YEJL 1IKOP 4NO5A 5FFLA 1CICD 1MFDH 2VLJE 4P23A 4AQZA 5JIKA 3LY6A 2MPVA 2YFNA 4JKLA 3ZO0A 4Y5XC 4KZDH 3DRQB 4X4ZA 1SVBA 1ZDSA 2Z35A 2WLLA 1EXHA 3KPMB 3RKDD 5F88A 1L3NA 2GABA 4U7SA 4GAGL 2C5DC 3QA3A 3FFCE 4HAFA 4C8XA 2EE6A 3WNNA 4WFED 5D7LD 4YSPA 2WXFA 1UH3A 1A1MB 2R56L 3BE1H 5TDPB 2DL2A 3T6XA 5KSAC 1X5MA 3U1PA 4D9LL 1W0YT 3DX7B 1KTDB 2NXYD 2ZZUT 4ISVB 3RILA 2ZP8A 2ODHA 4IU3B 4OLYL 4ZTOL 1CYWA 5I1EH 3S35H 1TQCB 5GGRB 1NSNL 5IWLC 1QUNA 3AUVA 3O6LL 4OF8A 4C56D 1CCZA 2DMKA 4WO4B 1M7IA 2ARWA 2RAMA 2IQ9L 3BYYA 4NQED 3B5HA 4L8DB 1NAKH 5TQ2L 5CSGA 4GO9A 4UU9A 4L2LA 3BSZH 3I75B 2EABA 3CLEH 3D39A 4AEIL 2WYZA 1BECA 3RUGA 4BQ9A 3W39B 5GGUA 3M7OA 4MJ2A 4KUCF 2PYEB 4NT6A 2P8MA 5DTFA 4CSZA 1XT5A 2KC0A 2ALWA 2K6YA 2E9JA 4ODXB 3SN6N 2NX5A 4EDWL 1F00I 4G59C 1ZT7B 2A74A 5GS1C 5AAMC 5C0JA 1V3MA 3OTTA 5ANME 3OPZH 3BSZA 1A6UH 2G3MA 5JQHC 2C7UA 2O5ZL 4FQHA 3L8QA 4PS4L 1IILE 3GHBH 1JMZA 4OI9A 4YSDA 4FXGC 1GSKA 2XKNB 1A7NL 3A4DA 3GXDA 1MCCA 2H0FA 3WTTA 1NCWL 1D5ZB 1GJIA 1OM3H 3MC0A 3QIUD 5DJAB 1B2YA 2OM5A 1OSEA 1BGXH 1PX4A 3NQIA 1RI8A 3C6SB 5GISH 1MCLA 2FD6L 1OK0A 1QSED 4AENB 2W38A 2X3AA 4ZQKA 3RWCA 2AC0A 3Q7JA 3NOIA 5ERWA 3ZUCA 1AOZA 2QVIA 4GXVL 5J11B 1U3ZA 4R97B 1MQKL 2OTWB 4M5SA 3FRUA 2G75A 1VFOA 1IGTA 1IAIH 2CHDA 2EDXA 1PTZA 3UMTA 3VTAA 4HJEA 2CIIB 3HG1D 3DJSA 4UMGA 2ENPA 3MR9B 4LRNH 3TV3L 2FLMA 3F64A 4P2QA 4U1HB 4Y2OB 5DLML 5IEHA 4A6YL 5EN3A 1MJJA 4XNYH 5JHDA 1QTPA 1A14H 5IW1A 2BIPA 5CNHA 4ANXA 4XPFL 2EDOA 5ELIA 1UKQA 1ZT4A 1MPAH 4OCSL 4W9CC 1URIA 3RGVD 4E42A 1SDAB 3CX2A 4QJ5B 4WFFE 4O9HH 5I0WA 4YLQT 3F7YA 3S5YA 1KJ2L 1TT6A 1GS7A 3P2TA 1J8RA 4AH2A 5HHVH 3HKFA 4M00A 4IOSA 1DBJL 4KK8C 4NNYB 4KX9A 1S5IL 5JR1L 2NCEA 2DQDH 2YMXL 1U3NA 3QRLA 2FDBP 1JHLH 2ZXWB 1RZJL 1U0QA 5BMFL 1D2OA 3BT2L 5J9PB 1XGPB 1J1PL 4PJFE 5IV2A 3ZTCC 3KLHD 2EQDA 1ID2A 3N85H 4HPHA 2Z8WC 2NW2A 4A2HA 2P5EB 3SBPA 1CVRA 3FT0A 1U21A 1KCSH 4KUZL 4LSTH 1CFMA 3N1PC 4OLXH 2LLNA 4Z3TA 1U8LA 1XIWB 1H6FA 5JXAL 4BK8A 1RJYB 1CFVL 2ZP0T 1OD9A 5F0PB 2JK5B 2PABA 2CKBB 1ODUA 4MB3A 3DJRA 4MAYD 1DVFA 4O02A 3L3JB 1SN2A 1TJGH 3NRQA 5GISL 4K8RC 2BSRA 3L6FA 5JLZA 1HE8A 1MW1A 1UYWL 5CWSA 4D0CA 2EEAA 4EF3A 4KBPA 1E3FA 4P4KC 4F92B 4TV3A 3LNHA 4NHCH 4RGOL 4ZK8A 1ADQH 2H45A 5F21B 5C0BE 3QQDA 2F8IA 1DDHA 1XF3B 1PKOA 2MEJB 4Z7VA 3E1ZA 5KTEH 4O58L 4O2FA 4LCCA 1DVUA 3STZA 3KH4A 3GKZA 2XPYA 3CSFA 3SDAC 5GGUB 5C0DB 4EIUA 5FYJL 3Q6FB 4OCWL 3T0AA 3CSGA 4N68A 5JMRA 3CJJA 3WEXB 3VGBA 1JYNA 4ODHH 4L4VB 1FLTX 5MEOB 1NGXA 2OQJB 4FQHB 4XNYL 4IKNA 2G5BB 3BWAB 3GDBA 3OF6A 1NMAH 2VISB 4OD2B 5CGYC 4BCZA 4CSSA 4DKEL 1JGEA 1N5YH 4PRAB 5AKTA 1JUFA 1RZGB 3BP5A 1UG9A 1MLBA 3TJPA 1J9RA 4RRPM 1V05A 3DIVA 1YEKL 3QH3B 4N3UA 4NXKA 3U4KA 3CIAA 1MFCL 5I1DB 1HL4A 1OWRM 3HG1B 1OP5H 4TSBH 3AS2A 3IFLL 4DP8X 3H55A 3NUKA 1BMZA 4YPGA 4F24A 1L0PA 2CJTA 1MI5D 3C5ZB 4WV1C 5I6LA 4BK4A 3OKLB 2CJUH 1JVLA 2CDFB 1R4XA 3WIIL 1Z9OA 4LCWB 2X70B 1QSEB 5EUKA 5IREA 3TEYA 3ZN6A 3BH8B 3JTSA 3BT2H 3PWLB 2GTWA 2EVFA 4PJEA 4HKJA 5D72H 1Z1WA 4DSYA 3TWCH 4QWWC 4IW4C 1OP3H 4P3CL 2FIRT 4Y4HA 5EBLB 4R0LC 2OSLA 4OQTL 3NT0A 1OCOB 1JV5A 5DT1H 1CD1A 3VXTB 4N2BA 2CIIA 3BUTA 5GGSA 3Q8FA 3RUGF 4AEEA 4LIQE 2HVKB 4QYOA 4YVNA 1T1XB 4NUJB 3OAWA 2VAAA 2OXHA 1D5MB 5EU3B 1NAMH 5BS0A 3ROLB 2G0KA 2EIMB 4WW1B 1JI1A 3TBSA 4I77H 3CQQA 4BM7A 1T5XA 1OTUC 3Q1SH 1CG9B 4AZ8A 4E42B 1R9FA 3V4PL 2HG5B 5ALCL 1TEFA 5JW4R 3OAUL 2G9HA 3QWRA 3U7AA 4JNXA 3OHXB 1L9TA 1ADWA 2GUOB 2R7EB 3FUMA 3O2VH 4CGTA 3TNMB 1Q0XH 4X6DE 2DWTA 5FO2A 3WO3B 3LB6D 4XBEL 1TG8A 1Y0LB 2X0VA 4H1LA 4KQ3H 3UC2A 4JDTL 4Y4KB 2BVQB 3O4LD 4ONOA 1NCDH 4TUOA 4L1LA 2MMXA 3GSQA 1J0ZA 3HZKA 1U4FA 4AG4H 4TVPD 4NYLB 3KM2A 3SDCC 5L88L 3T4AA 3SPGA 3QRBA 3BIKA 1FIGL 3VH8B 4B53A 3V0HA 3AABA 1IVTA 4GXFA 4F20A 1Q9KA 1EX0A 3OKOA 5IOKA 3IFLH 1P4LB 5GRVL 3T1FA 4JO1L 3RWDB 3EF7A 4QOKD 4H1LG 5DJYB 3GMPB 5SX4I 4J3OC 4BELD 4Y16D 2AK4E 1SYSB 4ZX6A 3BPCB 4NQDB 2N4IA 4WGWB 1OAYH 3TCLA 3MRRA 3RDTB 1ZLSH 4NRYB 4G8GD 1GYWA 3ZDXF 4Z5RB 3NGBB 3ARFB 1A6UL 3FB8A 3S34H 1PJ9A 2G0LA 4LQFH 4WK0B 2D7MA 1M42A 3A4FA 4P5MA 4ZDHA 3F65A 1LL1A 4OCXL 1A6TB 5E6IA 5AAWC 1NCCL 3UO8B 1KFAH 1YEFL 5HVHC 5L2KB 3REWA 1MFVA 1SJMA 1T66D 5TK2A 2ATPB 5E2UH 3CBRA 1ZA6B 1G6RH 1X5YA 5JW4Q 2G60H 1UT9A 3L1OL 2B39A 4A7UA 3VXNB 3IDUA 3EDEA 5DUJA 4PJDA 1UT1A 5BUGA 2JTYA 2QQKH 1JF6A 5E8NA 2EDLA 5T33L 1H9DA 2JXMA 2HT3D 4XCYB 3EJZC 4GY4A 5E2VL 5F2FA 5EULV 4AUJA 3FQTA 1C5BH 2EDRA 3LN5A 5BRZE 3ARGA 5KYUA 4LAJH 4YAQA 4U3SB 2CRMA 3UBFA 1RLWA 1QWNA 3NFSL 4L29A 1DZBA 2DWEB 2XN9D 1EO7A 3G3LA 3JSSA 2P8LB 3L7FA 3NPSC 4GG6A 1XBRA 2J8OA 1E9PA 3UG4A 4PJEB 2QADB 1P7QB 2IOIA 4UZUA 3UO1L 5IHUH 4YBLB 1YRKA 4ODVH 4P59L 2C3HA 4M8QB 3TVMD 4Y16C 1G7LA 4YE0A 3QQ9C 4OIAA 2HJLB 4N6RA 5JPMB 4TOYL 2DQCH 2Z0BA 1MEXL 3QJQB 4MNQD 4QHNB 1NEPA 1ZTMA 1X4ZA 3QWOA 1IUZA 2VDQL 4Z7VB 4HHWA 4YSCA 1MCQA 1IX2A 1YECL 3KPRB 1H3UA 4PJ8D 2FATH 4OR1A 4LP4A 1Q8MA 5BRQA 2MCMA 1B0IA 3SDCD 4LXFA 5DQDL 3D52A 3SKNB 5GS0L 2FO1A 4YFEA 5CKAA 2DYPA 3ARUA 5IB2A 4E68A 3DV6B 2HZHA 1NEZB 4WGVB 3ZU8A 4NN5B 2ZAGA 1CXIA 1ROWA 2NMSA 4RISL 4ALAH 3EYQC 4K94L 1ZGLA 2PPFA 2C3GA 2GUOA 2R7EA 3B2VL 4P2RE 2BP8B 1JTPA 4KY1H 4DNLA 4AKOA 1JJUA 2V17H 2BJML 4U1HA 4X6DA 4Y2OA 3LRGA 1BG1A 1JWSA 3O41A 2CCWA 5IOPB 4NM4H 3BN9D 4HS3B 2WSKA 2JVUA 1PX8A 2D4DA 1YSOA 3DVFA 4FQ1H 2ZUYA 4X4MA 4JZJC 3CD4A 1GHFH 2QR0A 3LZFH 4WWKB 4B9YA 4PGCA 3ZTNH 3M1BB 2MRYA 2Q1EA 1ED3B 5TDOB 3TIEA 4F91B 2XUWA 2AITA 1GGCH 4P0DA 4WHYH 2W60B 4AX3A 4Q6KA 5AZUA 1S9VB 2W65B 1BOYA 2WVVA 3WL9A 4RMTA 3FO2A 2BMKB 4JPIB 1E67A 4PSRA 3VGEA 1I1YB 3VX0A 3GQFA 3VXSD 4EBQL 2WBJA 4Z1PA 3L95A 3EYQD 1PLCA 4LLWA 1KTLA 5DUPH 3RIFF 4NX0A 1YG9A 4ELKB 1R3LA 3VRLE 1YY9D 4MDIB 5TH2B 3VWKA 3VD1A 2QTEA 3RDTC 5GGSY 1GYUA 4UB0H 4X4XA 3FCTA 4WNQA 2JE8A 4W9ZA 1D5MA 5EU3A 1J0IA 2CUMA 2XRAL 3LHPH 1A21A 3EG9A 4L8SA 5F7WC 4GSDL 4UM9B 1A1NA 4ZSOE 4NQXA 5DYFA 3LVTA 5F7EL 2I85A 4ZZKA 3RVTD 2DQHL 4X5PA 3BQUD 2BHUA 3IFNL 2GHZA 3C9NB 2JKWA 2UXTA 4NZTL 3WUWB 1M2VA 4XE0A 1WGVA 43C9B 2BP3A 2GSGB 2XNAB 3KPSA 5KYXA 3ECBA 5E8DL 4L8DA 1JMXA 1DBAH 2OTPA 2BS71 3OJDA 1JN6A 4MMZC 2JCCF 4R7VA 4P2QB 4MMXB 5ABDE 4NYLA 3RU8L 3GM8A 1AKJD 2KERA 4PR5A 2B20A 2P8LA 1LE5A 4FG6D 4PGBA 3UOAB 4DGIL 3GMLB 4JRWA 1H6UA 1ONQB 2X2HA 1W0VB 4YAQB 2JJVA 3JUYA 4ODXA 1QMUA 3NACL 4XMWA 1B0RA 5DJ8B 2OZ4A 4M6MH 5D4QA 3MUUA 4HH9B 3QPKA 3MLYH 1I1CA 1RJCA 4G6ML 2G5BA 5C0BA 1K9TA 5LWYL 4OKDA 1EUUA 4Z7WA 1ZLVH 1LMKA 4OCLC 4NAMA 5IHZB 2L7QA 4QHUA 4Z7OF 3H9SD 1P4BH 3B3IB 1TLKA 3TBVB 5FLVA 2I24N 3T0WA 1MXDA 4UANA 2UUDK 2W0FA 1ES0B 2C3VA 4JFHE 4P9ML 2WQVA 4CC1A 5ANMB 1ZLUK 4IBWA 1RK7A 3BWZA 3TL5A 4F58L 4XMVA 3FQXB 4PYHA 5C07E 5J1AB 3BUYB 3FF8A 1X4XA 3MJ8A 4OCYH 4KHXL 4J3OF 4N0YH 4P46C 5DWPA 5IG7A 1YUHB 2ZYHA 3PGCA 3IU3B 3EFDL 1JHTA 3BAIA 3KCWA 2PCPA 1XR8A 1ZXKA 3MPCA 4AG4L 4DGWC 5D2LB 3AS0A 4ELMB 1JGVL 1IC7H 4ZX5A 3DPBB 3H3PH 1GMIA 1WISA 3BZFB 5LHDA 3W3BA 1FRGH 1Y18B 5CO1A 4OLYH 4XR8C 3KPRE 4K5NA 1F58H 3FAWA 2ZIDA 2JI2A 4H8WC 3HFML 4JPKL 5E7FA 5EOCH 3JV5A 4FTVB 1E5CA 1BVNT 2QDWA 2X87A 2WLHA 3BD3A 3MUY1 4PBXA 1TU2A 2I60H 1WF5A 3DK0A 3QXAB 3RQ3A 5GZOD 5IK3A 4DEPB 3G5ZB 1N64L 4PS4H 4KQ4H 3DTXB 1W72H 5I82A 5KVGE 1IB5A 3UTPE 4MD0A 4D3CL 1HCZA 4HUUA 2OP4L 5FYLH 3CG8A 3QIBB 4M62L 1QATA 2J6EH 4LF3B 1JV2B 5T5NG 2Q20A 3SE9L 5IMOA 2VN4A 1J7VR 3P9WB 3GRWH 5TH2A 1L7TH 4XVOA 2ZYSA 5IHBA 3C6LC 3O9WC 3BZ5A 4KJPC 4K7FB 4OGAC 3FCTB 1T7YA 1AE6L 3QNXA 1BQSA 1V55B 3OKMB 4GXVH 3D85D 4XMUA 5EU4B 2COQA 3T2NH 8FABA 4Y5VC 2AJYH 2W1NA 3L7EB 2QSTA 4TQEL 4X9IA 1K8DA 5K93A 5IFHL 2I25N 1QLFA 4OQTA 3OX8B 2AQPA 3AXLB 4H7VA 3BH9A 5JHAA 5E4EC 4OLWH 1U93A 4CKVX 5DVMA 1XIWC 4Y8DC 4ZUVA 5D6CB 4BFEA 5KVEH 4HX1B 2YN5A 3OXSA 4ES8A 2O5YL 1RFDL 2AJ3A 3PPEA 3MX0A 2N59A 4YSRA 1KN2L 5JHDD 4GP8B 3RLSA 3OLIA 4ATWA 4HJJH 3SQBB 1J8SA 3VD7A 3MSPA 2R1YA 4ZO8A 4P05A 4XP9H 1KB3A 4LLUB 3UYPB 2HYMA 5IEKA 2VLKE 4LEOA 3S8FB 2GK0B 3QDJB 4MYWB 2P45B 5HJ3A 4ADIA 2XIDA 3VWKC 4H44C 1NUGA 1PLBA 4K3JL 4KJYB 4L3EE 4FX5A 4U1MA 3S2AA 1BLNB 3QUYB 3H0TB 2PW2A 4H8UA 5DUMH 1KB5H 4IOIA 1SUHA 2DYPD 4FMFA 3KWUA 4GRWH 4N2EA 5C09D 4QRPB 1NLDL 4W9GC 3RUGE 3U48A 5E4EB 3K6OA 1BA9A 3Q2NA 1CFSA 3PU7A 5CGYD 5GSRB 2NNAA 2J3SA 3HUJF 1AR1B 4MMZA 1GZQA 1QSZA 3U4BL 4AIXA 4WW2C 3ZMNA 1A2YB 4KHTH 3HC3L 5CZXD 1Z0NA 4OCRH 3TA3D 2VDRH 1VACB 3HR5A 1YY8A 2Q76B 4X6EB 3QUML 4WSKA 5GRVK 4P5TD 3B8SA 4XNBA 2MCPL 5EPMA 3H1ZA 1MCWW 5I1HH 5B1CA 2JKLA 5ESVA 3MUGB 2Y25A 5H2BA 4AW4A 4QRRD 2ZX9A 5B3JE 3CFEA 4M6OL 1KBBA 1AE6H 1AS8A 4QHMA 5C07A 2J5LC 2K6WA 5DGRA 1JHKH 1BEXA 1T4WA 2A83A 5FAAA 2G5RA 5EF0A 5DXWA 3WD5L 1I8IA 5DHYA 2JLPA 3LN9A 2PCPB 4HPYL 4K2UL 4A37A 1H3VA 2YSSB 1V8HA 3D39D 2Q3ZA 2Y9RT 3DPBA 3EYOA 3K72B 5B8CA 1I7TA 2VJ8A 5GGSB 4QHNA 3FU7A 3P4NA 1L9MA 3IMRA 4ZAKC 1T20A 3K80A 5KYYA 2KYIA 3N44B 4P2RD 2OMTA 4G6MH 3FHQA 4M7LT 1KPUB 4NRYA 4HK0B 2DH2A 3QHZL 3ZRCC 3DC0A 3OGCA 4LCUA 3RVXD 1IGYA 3U0PB 15C8L 3GBNL 1ND0B 3MO1A 5DMGD 4ZXBB 1U6AL 2GC7C 4N2GA 2OSWA 3FUIA 1G6RB 4JFXA 1TYRA 3BMVA 3MLRH 3KJ4B 4K8RH 3WIHH 4OFDA 5AD0A 3BESR 5ICYA 3ZTJH 3B7TA 4NN6C 5GJTL 3RPKA 1E27A 3EYVB 2GJJA 3KPSE 3DBXB 5DK2B 4H1LH 1KB5L 3RG1C 3GT6A 2NLJB 2WIIB 3TPUB 5AVYB 3RRQA 2VJ0A 5A40E 2VLME 3F7LA 3KPMA 3SDDD 5E6RB 2IC2A 3R06A 2YGOA 3IE9A 5GHWL 3EJTA 4PJXF 3FONB 1MELA 1O6SA 1HHHA 5D7KD 2HX8A 3SE4A 1EHKB 5DEFB 2E27L 1QVOA 4H0GA 4M7ZB 4PVMA 4QTIH 1KGCD 1USZA 4LEXH 2WNGA 4J8RA 1C16B 3MRFB 4XO8A 5LBSL 3V7AE 1A4BA 5LGJB 1QW8A 4PJHB 4L9LA 1IGJA 1TTRA 4NLHA 3FH7A 2E7LA 5ESQA 3SDXF 2AABL 1DLFL 2EEFA 4A7VA 4A2LA 4YJZL 4ZUUA 5HDBE 4PRDB 1L9NA 1WH0A 4QRTA 1OCWL 4DO4A 1J12A 2BOBA 3TYFA 3A4AA 1D5IH 2HTLD 1MQ8A 3G6AB 1LD9B 2NNRA 2CGRL 3CZUB 3REVA 4HXBL 5F89A 4N0UB 4Z7UA 3B2DC 4JFDB 3ZE0F 4MB1A 1WBXB 2CSPA 2H5UA 5I26A 2ZCKH 4HUVA 3QWRD 1DBKH 1JK8A 5TE4H 4OFQA 2ADYA 3OF6D 3AY2A 3K4AA 1U36A 2WWKT 4LOEA 5J12C 4OLVL 1Z3GH 4U2ZA 3AWGA 2A77L 2VMEA 3GIVA 4HFWA 3EIFA 4U3XA 4P9MH 1PW3A 4XN2A 2NXYC 4CADA 3UYRH 1NCDL 2FLBT 4PWKA 1G0DA 2PNDA 1Q94A 5JUEH 3GIZL 4LF3A 3DUSB 4M5YL 3OJVC 2GKIA 3MBEB 2Q76A 4X6EA 5K1NA 1PZBA 1Q9WB 4P2RA 4D