4YS4A

Crystal structure of pf41 tandem 6-cys domains from plasmodium falciparum
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
351
structure length
258
Chain Sequence
MGKSHKCDFTKEKYLLSGEKEVSCEIDANPADDITFICPNLCFHTVNIAKNINQNKATMSIQDLLYGSVVYGNTLFISPYVRTNTPFYCFCNLDTVTIQKFLKINRFLKDDDELSIISKRGIMSVFVRSNNNVIKGCDFGNNNKNYFSHPISVAGVNNKVCKIQGKPGELVGFKCAFEENGKVEPPNCFDQVLHKNKVTDLKTLIPGYASYTNKHSSKYPYYLKIPHFVNEQYTIQCCSNNAQNEYTFELDIQPGESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merozoite surface protein P41
publication title The Structure of Plasmodium falciparum Blood-Stage 6-Cys Protein Pf41 Reveals an Unexpected Intra-Domain Insertion Required for Pf12 Coordination.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 63
structure length 258
sequence length 351
ec nomenclature
pdb deposition date 2015-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ys4A02
2YMOA 2LOEA 4YS4A
chains in the Genus database with same CATH superfamily
4PJ9C 2HT3D 2XWRA 4ODHL 5B38B 2YMTA 2K6WA 2CAKA 1ZT1A 1BEYH 1T7ZA 2IWGA 2O5NA 2NY2D 4LCVA 4OZ4A 5DJZA 2E7BA 4BGLA 1EVUA 4CU6A 2L8AA 3MA9H 5JUEL 5BQDA 4JG0L 3VFRA 3RRQA 1DJXA 4PGBB 4D0CA 4UIKL 2BNQE 3FHAA 3RPBA 2GFBA 4MCMA 1HQ4A 3BP4A 3NN8A 4H4NA 4WI4A 2PWDA 2H2SD 3KPQA 2Y36H 3SOBL 2RHEA 4PJDE 3QHZH 4L4VE 1URIA 3EJYD 2FX8H 3HN8A 5E5MB 5C0AA 1AOZA 2XKNA 5E8EA 3IRZA 1OAYL 1QUNA 5ECGA 3EYOB 1DVYA 4GAJH 1PZ3A 5CWSA 4H20H 2CRIA 4KOCA 1JWSA 4Q9QL 2OTWA 3DSFL 5EU6E 3S4SA 1XGRB 4OIIL 5HHNA 3WMQA 5GS3A 5I1GL 3DIFB 3LDBB 3S3PA 1FH5H 2CGYA 4JREC 4QY8A 2MPAL 4OFDA 3WHE0 2YUZA 3HW7A 2DH2A 5I71C 4IBVA 1RXLA 4WCYL 4IRJA 5CF3A 2FJGA 3F6JA 3QI9D 5H37G 1D5BA 4XVSH 4LEXL 1UOLA 1IQWH 2BZCA 3WFEH 4KDWA 1F4YH 1KCRH 2W9EL 4A7TA 5C07B 1X5GA 1X7QA 3M7OA 5DYFA 4D3CL 2F8OA 2JJWA 2PCXA 1BQHG 5D71L 1I53A 4G1EA 2MHAA 1G7JA 2XN9B 4Y2DA 2OTPA 3QUYD 1AGFB 3GMPB 4QMEA 3ZDXE 5AYUH 2OCFD 4K23H 4OFYD 4N2NA 4JK0D 4PJBE 3N04A 4R4BA 4S1RH 1G7IA 2VDPB 1G9NC 4N2LA 3TCXA 5D8JL 4KUCD 2DMGA 3HS0C 1FNHA 1Q8MA 3QZNA 5D1QB 4HLEA 3V5HA 4NN7B 4FG0A 4Y5XA 1EWHA 3QDJE 4LFHD 4JFFA 3JBG7 2O5YH 2H8PA 3BAEH 4R4FH 4ZODA 3TH3T 12E8L 3A22A 2C4FU 1LXMA 3SDXA 5JPNB 5L8JB 2BNQD 3CZFB 4OI7A 5EEZA 2DM4A 2RD0A 5C7XH 4YBQD 2KH2B 4NUGH 1GGBH 3N42F 2CA4A 4XO5A 4M8QA 4Z3IA 3UBXA 1HK6A 1RULH 2V6HA 3N41F 4L4TA 4AYGA 2FIRT 1WVZA 4L4VD 1KG0A 2FSEB 2NYYC 2LT9A 1XF3A 2AEQL 43CAB 1NBVL 1UT2A 1HILB 1KACB 4MXWH 4NC2B 4NM4H 4XC3L 2E5EA 5DQ9A 3W9DA 2VXTH 5SWSE 4G8IA 3WO4B 5JIMA 2ZPKH 2BLFA 5C3TA 3O4LB 4EDWL 3GSXB 1T5WA 4JFVA 1S3RA 1J9SA 1VERA 4UNTA 1OB1B 4TTGA 1T04B 3D0LB 4PB9L 4BFFA 2J25A 3CPUA 5G4OA 5K9QI 3SKNB 3VH8B 2FQDA 3FT2B 5D7KE 3QB7C 3LKRA 4BFNA 1NL0H 2WANA 3PRZA 4UIMA 4UAOB 3T4AA 5I6MA 2P44B 4ZTPH 4Y5VA 2A6JB 5LB1A 2ZP0T 5J4MA 4JFOA 3A0OA 1KGJA 5JOFB 5JW4R 2L4OA 4RGOH 4WW2B 4R5XA 1B9KA 3O6ML 4P2OB 4YDLB 1MFEL 1J1PH 2HFGL 2ZP9A 4EKJA 1VFUA 5IIEA 3MNVA 1SM3L 2RH0A 4Y4KA 2JKTM 2CGZA 1OCOB 2CNZA 4JY6B 4ANWA 3RTQC 2W88A 4ZT1A 4RGNC 2B08A 4IKKA 2LFGA 3AXHA 3LZFH 1UJTA 3HVNA 4F7CA 2YPVA 1OAKL 1YEGH 4LGPB 1K2DB 1OT2A 2EIDA 5KN5A 4HUNB 2F1BA 4JHZA 4BSWA 2V2XA 3MV8B 3IDYC 2CH8A 4KNSA 5CP3H 2GSIA 2M1KA 2J6EA 5EF0A 3EFOA 5ESVB 4ZUVB 2EDHA 3QDJD 2Y25A 1TLKA 3D25A 3T0WA 2I9TA 1KZYA 1OVZA 2DYPD 3TZVD 1H6EA 2R39A 2VLKA 4JFSA 3TYFA 4YXKH 3L3OA 4F7PA 4OR1A 4Y5YC 3QXAA 5AOZA 2ZAGA 5I8OL 5JR1H 3TNNA 4BHUA 1UB5B 4JG9A 1RZJC 5DVPA 1F3RB 1CE1L 1UWGL 3J7HA 3L7FA 4QT5B 1M9SA 2WQXA 2ADJB 2BS71 5C07E 4EI5A 1KB5L 4E0RA 2EDBA 2V17H 1CPUA 3KNBA 1J9QA 4WNQB 2V37A 2HKHL 4IRSB 1IC1A 2JCWA 3ENEA 3P69A 4I18C 4ODUA 2XN9E 3VYPA 2VLKD 1CFVH 2D7OA 2E27H 5G4MA 3CFUA 43C9A 5I17B 4XBMA 5FGBC 2FATH 3JTTB 4AENB 3WMSA 5EC2B 4RETB 1RIHH 4WEMB 2ZP8A 3E2HC 4QTFA 4YDKL 5TPWH 1PAMA 5D7KD 3QH3A 2P1YA 4YHNB 5D1QE 3HUJB 2ZOTA 4HEMA 2DQHH 4RZCB 1NBYB 4FABH 1JZFA 1QQDA 1X3DA 2C7FA 3WTWA 2XICA 3HN5A 1LO3L 4RFOL 4TQEL 3I2CL 1NCWL 2DJ4A 2HJFA 1L7TL 2J12B 4JDZA 4NZFA 4GO6B 3T0BA 1SLVA 3GXPA 5F7FA 2VDLH 3RI5F 4LHUB 2LOEA 3P3TA 4OLXH 1V27A 1HINH 5F7DA 3C6LC 4NZRH 4Z77A 1T80A 4L9DA 2ZUYA 3FU8A 3ZJAA 1T7XA 2XU9A 4LEOA 4GRLC 3BUPA 1UEMA 5KSVB 4BFIA 3GLEA 1LDPH 1F0LA 1S9XA 1HXYA 4W9FC 2YOAA 1NEZA 4YEEA 4X4YB 3HE6B 3MOBL 5CEXB 3P54A 4DQAA 2LLLA 3MFFA 4RMBA 2IALA 4JZNB 2ZZUT 1ORSB 2W9LA 3EZ8A 4XCEB 3A24A 3F58L 3V4VH 1XGUB 1AP2A 2CRMA 1YVLA 1BZ9A 2ZX8A 1O6SB 1VEMA 2DH3A 5AVWB 1DQDH 2LAAA 1U3JA 1WHPA 3SE8H 4DGIL 2IGLA 1HIML 3TYGL 3VSTA 3VFMB 3VJ6B 3QZOA 3WKML 5E2JA 2FWOA 1TVHA 5E00B 4GG6B 1OALA 4U1IA 3EFDH 3TP4A 2FX7H 3KW7A 2N01B 1R5WB 3SDAB 1QNZH 3RWCA 3ZMNA 5H94A 4H8WH 2XRAH 4XP4L 2DBLL 2QR0B 1RY7B 5DD0H 5GGRB 2ZE0A 4F2EA 1CGVA 4ODWB 1KN2L 4WEBH 1MFMA 4M3JA 3STLA 3GI9L 5IB1B 3UAJC 1QSZA 4XO9A 1G7MB 2AJXL 5ANHA 4LSRL 5F9WC 4U0RC 4PW4A 2OP4H 3MV8E 1I9JL 3MCLH 4TVPE 3D09A 5F96H 3U0WH 2VXVL 3L1FA 4KDVA 4RWHA 4J8RA 5JIHA 3NFPB 1X4ZA 2D3NA 5D1QD 5LO7A 5B8CA 5F89B 1Q4NX 1PSKH 1PX3A 2VAAA 1Y18A 2XFXA 5HYSB 4AL8C 3BEVB 5TF1L 1FFTB 1NINA 3QWOA 3LTVA 4MB5A 4JRFA 4AK1A 1QEWA 3OX8B 5DUML 1TG8A 1XH3B 2QTEA 4XMXA 4Y19A 4ZOAA 3D30A 1OAUL 4MXVE 4U1SB 3VWJA 5AB9A 4AV4A 1GYUA 1CFMA 1NWOA 1J0IA 1KLGB 4HIEB 3K6FA 2FNBA 2DD8L 2GK2A 1KYUA 4M1CC 3SYOA 2WUCH 1HHHB 2WBJC 1JSYA 2R7EB 3OAUL 1A47A 4WWPA 4FI6A 1WZAA 1I7ZB 3VFGL 4OM1L 3II2A 3GZKA 3ZUNC 1NFDA 3LZPA 2R0LL 3LVTA 4Z78B 1G4MA 1D5XB 5F1KC 4APXB 5CILH 3O4LD 4Y19D 4XNQA 1UKTA 5BJTA 3TS8A 2O5XH 2ZG3A 1Z1WA 5LBGA 4R2GB 5JIQA 4XTRD 4FJ6A 4OV5A 3C5ZB 1E27A 4IKLA 3RJQB 3HUJE 4KHXH 4O58H 1LTXA 4DKEH 1BD2B 3MROA 1CICB 5F7HA 5KANI 4N2DA 3IGLA 2VZ3A 3LXBA 1BQLH 3N1MC 2E7LC 3QEUB 4WSGA 4A6YL 2FJFB 1URLA 5CP3A 4P2OD 2QADB 4NBXB 3CLFL 2HB0A 2QDWA 4MD4B 3BAJA 3OWEA 5L9DL 2PPFA 4PW9A 3BKJL 4LEEA 4OCRL 1BZDA 4NQVA 4DQOL 4B6ZA 2AJZB 3D6GA 1OAXL 2D7PA 3ASNB 1F41A 3K46A 1M1XB 4I4WA 5E6RB 1MFAL 1QA9B 3B2UC 1G9NL 3GRWL 1KCVL 5FOBB 2LR4A 1KLFA 5DK2A 1WA1X 1UA3A 3L8QA 5KYXA 3MV8D 1M53A 1GS8A 4TNVK 3ZE0B 1DBKH 3MVSA 2EH8L 2Y7SA 4P99A 3QEQA 2BY3A 1IC5L 4JCWA 3AQZA 5I23A 2JQAA 1G7LB 1MHHB 3AG4B 4U1MA 5JPMC 4KKCD 4XCNB 4N3UA 5HHQA 3DHMA 3UEQA 3CFDB 3QXWA 4FYTA 4GKOA 3C8KA 2A38A 4OD3H 5CHNB 3FTVA 4KUCF 4I0PA 4Q6IB 3RIFK 1QLEL 2Q8BL 1IKFH 1D2OA 5DSCA 3GC3A 1L9NA 5ALBL 5CD3A 5BZZA 3W38A 1LL1A 4AQ1A 1AE6H 4YX2H 1IGML 5BVPL 4KMTL 5DHVB 3FU5A 2VJ0A 1CFTA 4ALAH 2IWKA 4WWOA 4GG6E 2NR6A 2WPGA 5AOLA 1OK0A 1FJ1B 1N9PA 1S7VB 2VITB 2WO2B 3B9DA 1CFNA 1BQHB 1RFDH 2OTUA 3FZUD 5GGSY 3L13A 1G84A 5T1DL 1FUNA 3OKMB 2P5PA 3BJ91 3OKDA 1MJ7H 5DMKB 3VXMB 1TZ8A 4F2FA 3DETD 5DA4A 2PPEA 4J23A 3BVTA 5I0DA 5TDPB 2OXGB 3D85A 4M5YH 2ZX5A 5LG6A 4UYQA 4OZFH 3D4CA 5IQOA 4WIQA 4XNYL 5BQ7B 3S7GA 2W0FB 4CGTA 4HUVB 4OZHA 4JQIH 3FTUA 1ZA3A 1Z7JA 3FQWB 4DP0X 1H8NA 4ZD3H 1JHTA 5I16A 2RB8A 5J1SC 5TGBB 2P42B 4QYOB 2AC0A 4YGAB 2W59A 1CT8B 1GOHA 3AACA 3BQVA 3D06A 1I8IB 5E70A 3DOHA 4KY2A 4HPYH 4YR6B 1PYWA 2XWEA 4XHJC 3HI6L 1W0VA 1ZA6A 2VCOA 3OR7A 2ERJB 1ZVYA 3O6KL 1NOFA 4LHUD 4W9ZA 2DWTA 5EU3A 3V4VA 1CDGA 2OX5B 3FT3A 4JO4H 5K59E 5JW5B 4X0KB 5LWYL 3CVIL 3OF6D 5EO0A 4F8NA 1BAGA 3LHAA 2VLME 3EYQC 3MV11 3TBYA 1Z9SB 1NGPH 4HGKC 3ZTJG 4NZDA 2GSGA 3ORJA 1EDHA 1JF6A 1WISA 1CBVH 4NI6A 3HC4H 2FHBA 3HE6D 3CVCA 1UXMA 3TJHD 4PJFE 1QACA 2NNFA 4YN3A 2QGCA 3QHFH 4HZLB 1Q9KA 3FTYA 3NCBB 2AQRA 4NQQA 3FH8A 4ACTA 1RJLA 5C0JB 4LBEB 5BS0A 5C0CB 1IBHA 4YLQT 3T0EA 5AVYB 1JF5A 1T4WA 3BKYH 1G1OA 5J6HA 1IX2A 1BD2E 1IVLA 4XODA 5D6DA 4HK3J 5IVOA 1OW0A 4GSXA 1KF9B 5A40E 4KJYA 2GJPA 3AW5A 3GTVA 3IJEB 1VFMA 2OMBA 1RK1B 3QIWC 4OCMC 1H3PL 1RZGA 4NP9A 4EJ1C 5A6IA 1BM3L 5IEHA 5CJOL 1GVIA 3BQUB 4ZFGH 4BQ6A 1NCAH 4JAMB 4PAZA 3FCUB 1N12A 5BS0D 1B4LA 5KVEL 2VXQL 3ME0B 3G6JA 3QRGL 5BXFA 4J3OG 2NT1A 3MV7A 1UJ3A 4HP5A 4KQ0A 2PWHA 4OCYL 5DHDA 3MOQA 1GGIL 2VDRB 3G5YA 3QUXB 1VFBA 3RWIA 4JO2L 2JB6B 3L3JB 2XWCA 3FSZA 4FL4B 1C7SA 1V3MA 2WO4A 3ZE0E 1MRFH 1DQTA 5L6YH 1E6OL 4IMLA 2Q8AL 4BV1A 2E4FA 3DROB 5DEZA 1T20A 3VXRA 1ONQB 2HFFB 3MYZA 1D5MB 1RZQA 3ECVA 4Z7UB 1K8IB 5DD5H 5T33H 8FABB 1MZZA 3D2TA 4OGQC 4GUPB 1FP5A 5E2UH 4G8EA 1J8HA 4RDQF 3ULUD 3L4TA 9CGTA 2Y1AA 2V2TB 1TQUA 4IW4C 3A67H 1J0YA 2YD1A 3Q6GL 1Q9WB 4FHKA 4W9DC 3MRKB 2VLMD 4ZDHA 5TDNB 1A6AA 5GS0H 4N24A 3VXUA 4LOUD 4N2MA 1SRDA 5LN4A 1VACB 4NZJA 5TH2A 4QHKI 1FLRH 3VXME 1FPTL 3KS0H 3TJPA 1BJMA 2DLIA 2W07A 4F7MB 4CJ1A 3Q8CA 2WJ7A 1NM9A 4MA3B 2TSAA 3NCJH 1MNUL 4UM9D 3T8XA 4FG6D 5GZNA 4U3SA 4ZTOL 1PU0A 2EIZB 3LAFA 5L88H 5ETUA 3VFUB 2BXZA 1FYHB 3GMRA 4JM4H 1A6WH 4N8VA 4AM0A 3F05A 4FA7B 2JQZA 3KM1A 1CICD 1EHKB 1QFPA 3AT0A 4NKDB 1SXBA 3PGDB 4PRPB 3QJRB 2GI0A 1I8MB 4B96A 2QADD 4FNUA 4OLUL 3V0VA 1CMOA 4GRMB 3K72B 2EDOA 4DAGH 3HAEH 2UZYA 3BZ4A 2OMWA 1RUPH 1U3HC 2X1OA 4RAUA 2M2DA 3CBJB 1A2YA 1S2EA 2QEJA 1A1MB 1KUMA 2BHUA 5C0GB 4U4BA 4U1JA 4UQ2A 3ZO9A 5CEZE 3N3EA 1DUYA 3QDMB 3TESA 2VN7A 2Z31A 2OLDA 4TNFA 2XX0A 2JMRA 2OR9H 5EORL 3S2CA 1FORH 3DX8B 5AW6B 4QRTA 3O6FC 3TBTB 2A9BA 1S4IA 1BFTA 2DI9A 2VISA 1F58H 1WITA 5A1AA 2OBGA 1N59A 3MXWH 2GY5A 1R5IA 4XXDA 4AGNA 4UM8B 4HJGB 5C0CE 3BKML 2XVLA 3L5XL 5LXGL 1IBYA 3CFCH 1CVRA 4F91B 1A6TA 4W6YB 2P8LB 3AMLA 3O2DL 3QIUC 2E74C 2PO6A 2V3FA 2Z31D 3E6HA 3NK4A 3BJLA 3NG5A 3QJUB 4OZFA 3RZCC 5EO1A 1SN5A 2WXLA 3IETA 1KDJA 1RL1A 1N18A 3HNTH 4BE5A 2VIRB 4JQIA 2BVYA 5LNEA 4OAWB 5FX3A 3HNVL 5KBNC 2IAAC 3LEXA 4FFTA 2XV2A 3BI9X 3N55A 4H1LG 1RUQH 3HMWL 1F1DA 5E8DL 4EO5A 1ZV5A 4NN6C 2DMKA 2BHZA 2WQAA 2NY2C 2Y5EA 3FU7B 3ZRSA 4G3YH 4ANKA 3CDCA 3P4NA 1F4AA 4H5SA 4BINA 5LDUA 4D94A 3ZDZF 3T2QA 5HP5A 4H25B 3KWTA 4P3DA 4G82A 1HU8A 3MLUH 4LU5L 1LEIA 4BFEA 3QQDA 2EYSB 5CP7B 2ZSVB 4YHLL 4JDTL 2H2SC 1NBQA 3HG1A 1FO0L 4D0BB 4PM1A 6TAAA 1J05A 1HHGA 2R23A 3BZFA 4Z7UE 2WXKA 5HGHB 3FB7A 1HKLH 2D7NA 1IJNA 4YBHA 1N6UA 3VFWB 4OGXH 1CVSC 1AQKH 1P5UB 3CHRA 3FQYA 3JVGA 5E99H 3HZMA 4OCXL 3JWNH 4U1HB 5D7IB 1TT6A 1K4DA 3MMEA 4KRNA 4WKZA 4X4XB 4BZYA 2B77A 2VUYA 3K6OA 3Q5YA 4I89A 3D69A 2IF7A 1UUSA 3AQDA 3FRPG 4HK0A 3HG1D 2QKIC 4X5LA 4DP1X 4QNPE 1JZDC 2EXTA 5CEZD 4G71B 5D1ZB 4BH8B 1M7XA 3PJSA 1QAWA 1T6BX 2D2CC 4E68A 1AXSA 4MCYB 4P2QB 3HN3A 2CJUH 3HNSL 2CR0A 1UACH 2Z7YA 1EERB 3M17A 3MNWB 2E9GA 4GAGH 1Z9NA 3FB6A 3PHQB 5E8OB 4JMNA 3E9TA 3HZVB 3MLZL 3GFUA 3T6WA 1J11A 3ARBB 1XL4A 4MA1C 4PRHB 1SPDA 5JHAA 1XBRA 1AANA 3BCDA 3LKQB 4KDTC 4YHML 4PRPE 3PIQB 2DIEA 2X10A 1NGXA 3MV9A 4IRJC 3RU8L 3Q6FB 1ACYH 2MCPH 3LKPB 3FMGH 1WCQA 4HGMA 3TN0B 5B39A 1DEEB 1YEEL 4NC0B 5DO2D 1T5KA 5D2LB 3X3FL 4DVRH 3WLBB 4PTTB 2F74A 1LO5A 4KK6D 4KX8A 5E0FA 2CDEB 3JTBA 5LKNA 5CGYC 4QTIH 3QUXD 4Y2DC 4LCYB 4JHVA 4X83A 5AALA 3QDME 5C2BH 2OJ1A 4NJAL 1W0WB 2FHCA 1JPTH 2HT4D 5I1HH 4POYA 4UNIA 4KJPD 2NY5C 4WRLA 1A02N 4HXAH 1H0DB 4EUPG 3QUKA 4K94C 5KVMC 3MOAL 5SX4I 4HIJA 3WSQH 5DRZB 4YBQC 5C92A 3VXOB 3GM0A 5BVJA 2ZUTA 3S98A 2XN1A 1J5OH 4PS3A 1J0ZA 1UUNA 1A3LH 4WK4B 4H88H 4Y5XC 5A16B 1EBPA 1UYWH 2PW1A 3IMRA 1RD6A 2OSLB 1CUOA 1YEJH 4DIXA 3CQQA 2EDLA 5EU4A 3SN6N 4JN1L 1Y1UA 4P57B 5IJKA 5GSVA 2ZCLH 3QUHA 1BPVA 4K9EH 1GS6X 4FQXA 1ZE3H 3KCPA 4K8RH 3EJZD 4W4NA 4BFRA 1ZGLA 1OT4A 4PGDB 4Y89A 3KBEA 3C12A 1P0SE 1I1AB 3LQAL 2WTRB 5GS0D 3N1QC 4ZFZB 2W38A 1CLZL 4UZSA 4JS7A 4ZO9A 4JANA 4YHIA 4IRZH 2OK0L 4NSKA 2HX8A 1T03H 3WIFB 5G5DB 1EHAA 3H53A 2A9CA 5HYEA 1EJOH 1BBJB 2ADFH 4DFIA 1QBMH 3HAEA 1FLTX 4RGMB 5F70A 3DC0A 1NUFA 4Z0BH 2R2EA 4CNIB 5JTWA 2H6UA 4Z76B 2AQ3A 3KPTA 5ID0A 5DK0A 5ITFB 1JZEA 2YMOA 1RUKL 5IEKA 1JV2A 1S9WB 4JFZH 3T4AC 1YECH 1A7NL 2AJSH 2WUBL 3OKNA 1IGIL 4PRPD 4Z6AT 4Y5VC 3N0PB 3QUZB 4AEHL 4BXVA 1JPFB 4EN3B 4LARH 4WI0A 4OQ1A 4NNPL 4GXVL 4HBQA 1BG9A 2UZIL 3OB8A 5FKPA 1KXHA 3WIHL 1MH5A 1JZHA 4BE6A 1ASOA 4JRYB 2JELH 1IT9H 1GPOL 1KYAA 5D7IE 3BKCH 5EWIL 4N2KA 3KLHD 3EO9H 1TFHA 1KTCA 1IGYA 1CFBA 3OXSA 3I9AA 4IM8A 1R3LB 1M2VB 5CU9A 3JQOB 3DO7B 3MNDA 4Y4KC 4ZAKA 1NCBH 2CRZA 3RVVC 5IFHL 5KAQG 2WLMA 2YPLA 3QDMD 5KYWB 4EZKA 4GJTB 2AEPL 4P2QE 3DX7A 5F6HI 1GYWA 5DQDH 3T65B 2AITA 3GUTB 1PCXA 4GT0A 4Z3EA 2NLJB 1B88A 5L0QB 4AWJC 5I6XB 3WUWG 2PCPA 2H47C 4X6CA 3UP6A 1JI2A 3G5ZB 4F33B 4XPBH 5EF2A 5IHLB 1FAIH 5AZEL 3AU1A 3Q2LA 1JGEA 5I5IA 1H5BB 1CGXA 3Q1SH 1GA2A 2LLGA 4PRHE 4NI3A 4J3XA 5JW4M 1KJ3H 4AC2A 5F71A 3VCLA 3KGSA 1S9YA 1SY6H 2ZCHH 3G6JF 3MRLA 3G9VA 4RFEB 2BNUA 1PJ9A 3B6SA 4QRQB 4TVSa 4LK4A 3L3OC 4WNSA 2Y1YA 3QG6A 1TMCB 4N2FA 4M6NH 5AUMA 1AFVL 1ID5I 1HE8A 2PABA 4AQ8C 1YYLL 5AL0A 2X7LB 3UEZA 2KDYA 4ZW7A 2LFEA 3K4DA 3DGDA 1XF2B 5D2LE 4WI2A 2A9NL 2BC4B 4XI5D 3U7WL 2CXGA 1D6EB 3IDJB 5D72L 3VXNA 4M5ZL 3SPCA 1KCBA 3UBXI 4XPGL 2XHNA 4QHKJ 5IHUL 5DEGB 4QLRA 5GISL 5AZUA 3B7YA 1KEGH 3TURA 1M71A 1QRNB 5DHYB 1KIQB 5I26A 3HHSB 3FK3A 1HX0A 2R29H 1P5VB 3O2WL 5DJCA 2R0ZH 3AT9A 3PDOA 1DVFA 2VUOA 4U1NA 1XF5A 2FO4B 4D0DB 5IKCA 1SOSA 2JXMA 1NGWB 2FB4H 3EFFB 4G8GD 4LKXA 1MG3C 2DJUA 3WD5L 2J8UA 2ZKMX 3EOYG 4ZQTA 4AUJA 2CNYA 3EHBB 3QDGE 3UBHA 1YN6B 1BLNA 2J4WL 2VMJA 2XQYK 4L8SA 3VUAA 3TWCL 3LIUA 4NFDA 1E7VA 2BSBA 4S0SD 3CFBA 2WNXA 3QXDA 2VXUH 3L3IB 4IKNA 5CBAA 4MJ5B 2WLZA 3DGGB 3MUHL 4TNEA 4M3KB 3NIFB 3GZPA 1QX1A 3O3AA 2H32H 5FKAB 3VNYA 4UT9L 1BZ8A 1PW3A 3LRMA 4FZEL 4AIXA 3FBQA 1Q9LB 3DTUB 4L1LA 4CL7A 1GSMA 4CMMB 4Z7VA 4KTYA 1H15A 1AZNA 3PXLA 4G9DB 3MRIB 2FVNA 4YPJA 2FIKB 3ARBD 1XCTA 4KZDL 3DO3A 1IM3B 3DV4B 4G6ML 4AMKH 2BSEA 4KXCA 5KVFE 4UDUB 3M8OL 3WE6A 1WE5A 3FQXB 1QSFD 1A5FH 1AR1C 3S97C 4R7VA 2H1XA 1DQIA 3ZRCC 1RZFL 1LLAA 3Q13A 4JRYE 1F90L 3D9AH 3ALPA 4P2RD 4LL9A 5EDSA 2ZF8A 1XGZA 1BQRA 2E9JA 3L6FA 4Q52A 4OF6A 4X8JA 3ZVVA 4TMPA 2C3HA 2IPUK 3TBVA 1IRAY 5IFAH 3QULB 2CLZA 4F7TA 2IH3A 2MQ3A 3F5WA 3RGVA 2WAQA 3EO0A 1GOGA 4BHUI 5F7MC 4I3SL 5FUOL 4HF5L 4DKTA 3P4OA 5L2KE 1J8KA 4LCWA 4AV5A 4P59H 1MPAH 3TT1L 2A4ZA 2BMKA 2NNAA 1GZPB 4MAYA 4E9XA 4E5XA 5I1JL 5JW4Q 2PCFA 4RA0C 4J3TA 2P5WD 4LOEA 1C5DB 5JXAL 2NY3B 1JWUB 3ZTNL 5FDWB 1TZHA 1YNTA 1ILUA 3IDMA 4YDVB 5J13C 1KZQA 3ABLB 2H0JA 4IRZA 3EDFA 1OM3L 3GF8A 5B8CC 2XN2A 3V6OC 3AQYA 4N0YL 5AOIA 3SYQA 1FCCA 2GTZA 5I6OA 1O0VA 3TM6A 1EAQA 2ZCKL 4NYLA 4K8RD 3V5DA 5HBBA 3FF7A 4HC1H 5HI5D 4JL1A 3B1TA 2H6PB 3GSQB 4UINH 5EZOL 3VWJC 4NDMB 1I1AD 1OY3B 3BX7C 4I87A 2CE6A 1HH6B 5DC4B 1F8TL 4C56A 5HHOB 1TR7A 3L95A 3P4MA 1EGJH 3I02A 4PSRA 4YGVB 5EZPA 2JI2A 4H1LB 4F8PA 1JZ8A 4ABUA 1AHMA 1H6UA 4FXGC 1T7WA 2UUDK 4YC2B 4BFGA 3TBSB 3IDNA 1JK9B 4LPVA 1RIUH 3AADB 1CGWA 3E80A 3JWDH 4OIAA 4BUHA 1BBDH 4CC0A 5ACZB 2WZ5A 2XWBB 4GFTB 4HWEH 4YXHH 4HGWB 1UKSA 1DQLL 4OCWL 5AG8A 2ZKYA 4P4KA 3PGCA 4ACPA 1QRNE 2GJ6A 3P73B 1L0YA 2A99A 4LHQB 3QEGL 3PAZA 3HBQA 4J8QA 1FZOB 1A6ZA 2PTVA 2VLLA 3BIBX 3GMMA 4XVTL 4YDIH 4XNXL 1DBAL 1A4JA 3QUZD 3UC2A 2WVVB 4EN3D 5MP6L 2XA3A 4K5PA 5DC0A 2Y7QA 3OKEA 4L3EB 3O45B 2WWKO 5BMFL 2OR7A 5DUPH 1U2YA 3B8SA 1MCPL 1VGKB 3LRGA 4OFIA 5LGYA 2CO1A 1YJDH 5JYMA 1ZGLP 3KG5A 3ULSB 4J28A 4JZJB 1JV5A 4NS0A 1W8EA 1DBML 4NFCA 4QJ4B 1S8DB 5I1AA 3HC3L 4KKCC 4I3GA 3B9KA 3MAWA 3PABB 5EO9A 2ZX9A 3CSBA 2ZWKA 4K94L 1NPNA 5AZ2L 5EEXA 3NIFE 4FQLL 4QXGL 1SY6A 4ZMQA 1UHVA 5MI0B 5A2JH 1OP5K 3O4OB 5AYQA 3O3DB 1MFUA 2ADGB 5K1VA 4O9HL 5EBWA 4KVNH 3RX5A 1HH9A 4K7FB 1GYVA 1H3GA 2BRRH 3L3KA 2H1LM 3H42H 3MGOB 5JA8B 2ZOKB 4M6MH 2RACA 3IMWA 1RP9A 3WFCH 4ANVA 2DM3A 2PF6A 3AY4A 3CIAA 5K9KB 1J8RA 1SVZA 3TH4T 2WQWA 4KKBD 2DIAA 3IPFA 3CFKB 4OJCA 2FT6A 3FZUC 4QXUL 4FMKA 4C57C 3B7TA 4YSCA 3QZLA 4YAQB 4I0PC 2AQ1A 3WTVA 2DEYX 1RQ5A 1JGUL 3ECWA 3NFNA 1RZIB 1TJGL 2YPKA 4WFHE 4ELMB 5GS1B 3DETC 4AQ1C 5IOKA 1KFGA 1HZKA 4XCYA 4F1ZA 3C5SA 5IVXF 2YBRA 2R29A 1ED3A 1JJUA 2C9UA 2VSCA 5ABAA 5SX5H 1T66C 5T1KA 4ORGA 3GKWH 1U8MA 3BHBA 3ZKND 1AZCA 3CH1A 1ZHBB 3OPZH 3BT2L 1VADA 5IGXL 3GXMA 4HEPG 1TEGA 3BEWA 1QO3A 4OSUL 5DGQA 2VN6A 4OU3A 1XZ0A 1ZANH 4IMKA 3PF2A 4Z9KB 5HGDB 1OE2A 3SE9L 1WSST 2D4FA 2J57A 2KLTA 1YC7A 4EUPB 4JFXB 5ES4B 5D7JB 3J2PA 2P80D 3RJDA 5HVFB 4OGYL 1I1RA 5FYLL 2BY2A 5I1IL 1A65A 1WTGT 5DVMA 1LE5A 1AO7D 4Z7OB 1WBYB 4MD0A 5DFWH 1WS7A 3LXCA 2WK2A 4FYSA 4M93B 1IE4A 1OZUA 4QOKD 6PCYA 4NKOA 2AI0H 8PAZA 3ZTCC 4CVZB 3U4EB 3PL6B 3WN5A 4KUZH 3N43B 2HT2C 3TJHC 1IC4H 6FABH 2YK1H 4PWFA 4XZUB 1KXQA 5KYYA 4OFQA 1S7TB 2YPVL 4HWBH 1IEAB 1Q94A 2I7SA 4N3TA 4OJAA 3SDCB 5HHOE 1KELL 3OAZK 2YGVA 5AAWA 4A39A 4HIXH 3UO1L 2R4SH 5F0MB 2EXSA 2GPZA 5FCSH 2ZUVA 3CZKA 4YQXH 4ONHB 2OA9A 2J6EL 4X80L 4UV7L 5F6HJ 4JCMA 3VRIA 2PXYA 1JYWA 5IWLC 3O9WB 2OXHA 1TTGA 1PCSA 3MNZA 4XE0A 4LLVB 2EUVA 2FDBP 4PJXA 4LCCB 4LLUB 1JPEA 5DVKA 3PAUA 2DN7A 1IM3D 4H8WC 4RRPG 3DHPA 3SDDA 4A66A 4JBSA 4M9PA 3JV0A 1C5CH 2B59A 1OARH 2Q76B 3S2AA 5D6DC 2VC2B 5J1AA 4EZMA 4L3EE 1OW0C 4B7IA 2Y5TA 5FM5M 3FCSA 3W56A 1BEYL 1U8NA 4AJVA 2BH0A 4YVNA 3U30B 15C8H 4NPKA 2V2WA 4X50A 3MA9L 5GGTH 5MEPB 1G0DA 2KI6A 2LQRA 2BZ7A 4GW1A 3ZTEA 5IW1B 1OAJA 3UO8B 3RZWA 1A7BA 3FQNB 1UJ3C 3I9PA 5CD5D 1KDIA 4HC1A 3OKLB 3D87B 5DVNA 2ZJSH 1KGUA 3RY6A 5C71A 5T3ZE 3FO9A 3F7RA 1FFRA 2IH9A 3FN0H 5IREA 3FB8A 3QHZL 4HCRL 4XB3A 1UB6A 3FRUB 2NY3D 2K9UA 4XVUD 3VFPB 4B9PA 2FX8L 3QQ9C 4P48A 3WUWB 1GJUA 1EGJA 1ZIAA 3NSYA 1R17A 4GRWB 4GAJL 2BSSA 1URZA 2GJJA 3EJJX 4FQHA 5TE6H 1XF4B 4GRWH 4H20L 4M6OH 1M6UA 4HKXB 3KDMB 2P47B 2WBXA 2IANA 5DT1L 1MAMH 3MRHA 1NFIA 3GRBA 1A64A 4BKLA 2QFPA 4K3JH 1J0HA 2VR9A 5B1JA 4AK2A 4DUWA 1RZ8B 2DQEH 1D5RA 5B1CA 3SD5A 4ELME 1B3JA 1DFXA 1OGAE 4JE4B 5T1MB 3PUCA 1AD9B 3NPZB 1C1EH 5G55A 3HA0A 1RPKA 1N5YH 5HHOD 4KK9D 3S5LA 2HLFD 1E3XA 5C08B 1ADWA 4XVSL 3CN1A 4HJTA 4PJDA 4LVOB 1F4YL 1KCRL 1ASPA 1KNOA 2XTSA 3SZ6A 2Y9RT 1SGKA 1AGBA 2HX9A 5ICXB 2K3HA 5HHVL 2OMUB 4QRPB 4RMWA 4ZUSB 4NFBA 3LPPA 2XACC 3U46B 2PYEA 2HKFL 1JBJA 5FECA 5L8LB 2BFVH 5INCB 3MA7B 4WU5A 4PJAB 2ICWA 1PZUB 1EEYA 1U8LB 3FCBA 4Z7OE 4F57H 4PR5A 1I3GL 4S1RL 5EU5A 2GITB 1B0GA 1IGJA 4XWOD 1BVNT 1TU2B 4L3ED 4BH7B 5E1AB 4OY9A 3QQXA 3ARGA 2W65B 2F68X 2KZKA 4DT2A 3TNMB 4F80A 2K6YA 4MNQB 2O30A 3VQ2C 2BS8A 1LK3H 3MRQB 4AZ8B 4R4FL 1TQBB 1AH1A 1AY1H 2GYSA 3IFLH 4QRUA 1TPXC 1XL6A 1KPVA 4LL4A 1FF5A 5BRZB 5D7EA 3M7FB 1QFUH 2CUAA 3ESVF 4WEEA 1FL3B 2VWEE 3C9NA 3OAWA 4PRBB 4F15B 5C7XL 1NCGA 4NUGL 4ZSOA 2IGFH 2R1WB 4YH6A 2D03H 3JV4A 3ZY7A 4AGMA 1TF4A 1VZGA 2Z31C 5GGRY 4ALAC 3RWHA 2J56A 4NM4L 3SBQA 3V4UH 5J89A 2VXTL 2W9DH 4JZOB 4GEJA 3CZEA 1MCLA 4KMLB 4AYEC 2ZPKL 3UTSA 3VA6A 3BIKA 4HHAA 4YEFA 4JM2A 5LGJB 1P1ZA 3RVUC 5F7EL 4D9LH 1JK8B 3DX9B 3Q06A 3ZZQA 1RKRA 3UTQB 4PGEB 3FQ4A 3O41B 2AVFA 1AKJB 4FFVD 4AEEA 1NL0L 4HU2A 2J1YA 1E4KA 3SQBA 3FULA 2YS4A 3LS5L 4X9FA 3P11H 4C55A 3QO1A 1OGSA 1R33A 2DEXX 1S9KC 3MX0B 3QZBA 4X9GA 4CAGA 2EE2A 4YSUA 4RGOL 1OAZL 1O5DT 2PMZA 2VSMB 2W81C 1W72B 3U2SB 1J1PL 1PFCA 2PCYA 5GGVH 2VLRA 4JRXA 2WLKA 4G6KH 2EC9T 5SWSA 1K8DA 5JDSB 1NKRA 1U8OA 3NJJA 2P26A 3LZFL 3PY9A 1U8HB 2BVQB 2F1AA 1JNNH 2LHAA 1J87A 1FRGH 4LKCB 4JUTA 4QRRB 3H7BB 3CHQA 1D9KB 2ALWA 4IOIA 3MI6A 2FLBT 3DUHA 1WLHA 3BIAX 4XOCA 5B38A 2FR4B 3E38A 1BDYA 4XPFH 3O0LA 1ZHNA 3BLPX 2GY7B 4NPYB 4ZMTA 2Y1ZA 1LWJA 1S7SA 3L5JA 3ZL2A 1ETJA 3HKFA 1YHPA 5F93C 2XQBH 5AYTA 3S35H 5FK9A 5FUCC 1OCCB 3JVGC 1JHKL 3PL6D 3WJMA 1K4CA 1Z3GH 2B4CH 2XZQH 4YDNA 4G6JL 5F9AC 3ZHDA 4ODTH 4FQIL 4M8VA 3B2DC 4RZKA 3U4KA 3D3VA 4QWWD 2VRAA 4DGVH 4R7NB 4AQOA 2WYHA 4I9WE 3RWGB 4XPAL 4EZJA 5C08E 4WI9A 1LEGB 3RNQB 3ZT5A 5I0XA 2MTPA 3SEPA 4MDIA 4DO5A 3RGBA 2BVTA 1WFUA 4PEEA 3KPNA 2Z8WC 5E5MA 2MCMA 3EYOA 1EEZB 3O9WD 3KJ6L 3VFOA 5IROD 4QRPE 5HGAB 4H0IA 2GIYA 2OQJB 2JTDA 1A7QH 1WBXB 5C0RH 2E27L 1XGQB 3D3VD 3MRGB 4P23D 3FAWA 4WW1B 3OD3A 1DCLA 5KVDH 1JF1B 5EBLA 4PJAE 5GZOD 1XR8A 4IBUA 4KK6C 3AREA 4MQ7B 3VRLE 1LD9B 2VT0A 3O3BA 4JHUA 2XV6B 2HT4C 2HX7A 2IDFA 2ARJA 2NYZA 4M61A 4FABL 3QUMH 4RISH 2OI9B 4RVBA 4X7SH 3MCKB 4EI6B 2WMPA 2NDGA 1IFRA 3CSTA 3E8VA 1HYRC 1XT5A 4UU9B 2Q87A 5BRZE 1GGYA 2UWEB 3QO0A 3B5GA 2CUHA 3AS2A 3GYRA 3HMXH 4NOFA 5DYOB 4BK5A 4NGHH 5KJ7E 2OULB 2R1YB 2B5IB 4GP4B 2Q1EA 3SYPA 5IQ9A 2VDLL 2B16A 3H3KA 4YDMA 3UYPB 4OLXL 2FZ3B 3BP5A 2DQIH 2K8QA 3UYPA 2VDKH 4LCUA 4NZRL 3GSOB 1WT5C 1VKXB 4LIQE 4X5WB 3EJZC 3LPWA 5EEVA 1T1ZA 2PN5A 3ARSA 2EXYD 3V6BR 2VYRE 5GS0C 5GIRB 3V2AR 5TE4H 2R56L 3Q44A 3LEYL 3LNGA 1HHJB 3I9IA 3X1BA 4G7SB 5CFAA 3BUYB 3LNFA 2UVEA 1OTSD 5EZJB 3V4VL 5T1LD 5IJKC 2CBTA 1MSPA 1SJXA 2EE3A 1DQDL 4FQXC 2G9HA 2M26A 3PWVA 3V0JA 3WI9A 3EGDB 5CNHA 1TTCA 3BH9B 4A68A 2MMXA 1JNHA 1QSEB 3EBHA 4OGZA 3EFDL 4WSJA 2F61A 1YMMB 4HIPA 2H26B 4IKIA 4XGZB 2FX7L 1HILA 2Q3ZA 2Q7YA 1QNZL 3UP1A 3LZNA 4FXKB 5FA4B 4QRPD 4ZUUB 5SWQB 1L9MA 2XRAL 1HL5A 3N0AA 4B7LA 3TTSA 3Q48A 1T04A 3LKSA 1E5CA 3ZQ9A 4Q97A 4HXBH 3VH8A 3FT2A 2HRPH 3BZEA 1F1GA 4E36A 4A2HA 3DOSA 3MCLL 4ICXA 5F96L 3BE1H 1HT6A 1U8JB 5I1EL 4EIZC 3HR5B 1NEUA 2P8MB 1SYSA 4KOBA 2EYTB 3EYVB 5F2FA 1PSKL 3BVUA 2NZIA 4MNQD 4HOMA 4F93B 2CO3A 3OLDA 3UPRA 2AXWA 3KYNA 3MLVH 4RWYH 4J3SA 4Y4FA 4Z7QB 1MCBA 1H3TA 5AVUB 4UOJA 2V33A 3NJIA 1DBJL 1ET5A 3Q7JA 4NHUA 2C34A 2E7MA 5CJXA 3WIIL 4NQCD 4PBXA 5I1CL 3N1FC 2GUOB 4PJXF 3EG9A 5F9JA 1Z0MA 2F53B 3TL5A 5DJAB 1FBIH 1BXAA 1K2DA 3G08B 5I75C 1KCUL 2A5UA 2B8OT 1EFXB 5I5RA 4IJ3B 4O2EA 5EEYA 2JK5B 4XAWL 3IJSA 2ODHA 1KCLA 2NY1C 1OF0A 3Q3GB 2QV4A 3M07A 3PNWA 4M43L 2ZWNA 3F65A 3BDXA 3KE0A 3MREB 5E6SB 3KH4A 2DLHA 4A7VA 3C6SA 4HWUA 1KEML 2Y4SA 3DBXB 4LASH 4AC4A 4XOBA 1EAPA 1KJVA 2Y07H 3GGWB 4O4YH 4PP1D 4GPVA 3GO1H 1V7NH 4KHXL 1AJ7L 3MFGB 3T0AA 4FC3E 5LQBH 2HYMA 4ODSH 2E56A 3V52H 3STBA 1ZTXE 2PNDA 3TIEB 3BXNB 2CKBH 1UB5A 4HETA 3T4YA 1BQLL 2VKXA 35C8L 4QT5A 2Z65C 3LXAA 4EDXB 2YRPA 3FT9A 4XNMB 2W1NA 1WWWX 1N4XH 4HV8B 5AWNH 4NQSB 4P9HL 3S3SA 4J4PA 2UWEE 5LCVH 1DBBL 2BX5A 4WU7B 4LNRB 1P84K 4XBPB 3ZGIA 3QJVB 3JWNC 5I74B 3BVXA 4URKA 1I8KA 3MLTB 3AVEA 1B3IA 3HB3D 4AENA 4QRRD 1QOKA 5KJRH 1ES0B 4GKZB 2H0FA 1D9KD 1EZLA 3ZHKA 4AGLA 1TZIA 3LMJL 5I1DB 1ZHKA 2J3SA 1AHKA 4K3DL 3TO4B 5DMYA 1JYVA 4QO1A 3QFDA 4EE2A 2CO7B 4RZCA 4LLQB 1PG7W 1X4YA 1DVFC 3OMAB 3MXVH 1CXEA 1AMYA 3J27A 4N0FA 1J5HA 1GH7A 2J1ZA 4PLNC 1T4KB 4HKZA 3GUFA 4OD3L 5EOQL 2YLKA 1NQBA 3D05A 4L8SC 3BFWA 1IKFL 2Q7AA 1N8ZA 2F54E 3WBDA 3T1FA 4QHNA 3DVGB 1AE6L 5H8DA 2AZUA 4YX2L 3DKHA 5K9OA 1C16B 2X44D 3VXSD 1CR9H 1A6PA 3G5VA 2UY7B 3NSXA 1QSEE 4QD2E 1CK0L 2Q0ZX 1A9BA 5HHME 1YMME 3QW9A 4IEFA 1BXXA 2WSKA 1DVXA 3QUMA 4X8GA 1RFDL 3IDXH 2NUPB 1OEZW 1KXVC 3MRJA 5BNXD 4LSPH 3Q43A 4QRAA 2IG2H 4X7EC 2K78A 3F83A 3GQFA 2ZYIA 3BSGA 3HMXA 4JZNA 5DJ0B 5AW8B 1ORSA 5F7NC 3FT4B 4M5YL 4NB7A 4N0CD 1SF5A 2IPKA 3AZUA 4ANXA 2CUMA 1CE6B 1HTYA 2Y2YA 4JQIL 1IC0A 4L0ZA 3UTZB 4XRCB 2Y2WA 2FO1A 3ERXA 2CBOA 2Y23A 5T8IA 1FNLA 4ZD3L 2E9BA 5DLMH 5D7SH 4B60A 4AJWA 4Z7QE 3A4AA 5HYJB 5D93B 1A4KA 3EGXA 5IJCC 2F8XC 1R0AL 2ZXEB 3ZDXF 1BX2B 3SDAA 1XZWA 1ZCRA 3W37A 4PJIB 3GSNL 3OGCB 5AVXB 5GGRA 2QR0A 4A37A 5JW3L 3HC0A 3LKOA 4JO4L 3D0VB 2F53E 2W91A 3MRRA 4K9EC 4JLRA 1GCFA 1ZE3C 3D39B 4K8RC 1NC4B 2QBWA 4JM2F 3B34A 2BHYA 5EN2B 3SE8L 3MLPA 2X4PA 3S35X 1NGPL 3VXQB 4LMQI 3KLLA 4MMXB 4P5SA 1U8IB 1M7IB 1SMDA 3HC4L 5DJXB 3MRFB 4Z3HA 5DRXB 1SHXA 3BEVA 5HDWA 3IFPB 4RDBA 1JFQH 3VSVA 1U2HA 3L3DB 3LD8B 3IB4A 4I0KA 2V3DA 3BKYL 4E9VA 4XP5H 5DVLA 2JLLA 1J7VR 3VI3B 4HPOL 4WGWB 3DRTB 4PREB 3L81A 3HZ3A 4TUUA 4Y1AA 1MWAH 3KLDA 3BAIA 1LWHA 3AROA 2BFGA 2HJKB 2R7EA 2YWYA 2FEJA 3KPMA 1MJ8L 4GAYB 4NKIL 5FXCH 3N43F 2IWEA 1YMMD 2FGZA 3NFSH 1DN0A 3HG5A 2BERA 3MJ9A 5HD8D 3IFOB 2YD3A 4NQED 1I1FA 4NAJA 1F6LL 1IGTA 4Z78A 4APXA 2EEFA 2CKNA 3QJFA 4MAUH 1I7TA 4LVHB 4PJFA 4L2YA 3A4FA 2AXHA 4P4KC 4JKLA 4JGJA 1M7DA 2OZ4L 5ICYB 3I6KA 4BQBA 2CDFB 1YEHH 5L6YL 2GTQA 4QR7A 5HPOA 1GL4B 2AXFB 4NO5A 5CLZA 2WP3O 4QRSA 5K9QG 2EO9A 1IZJA 5BOJA 1A3RH 1KIRA 3GTNA 3QEUA 1HSBA 2JVUA 4WJG3 5T33L 1K5NA 1NANH 2XC8A 3HLAB 3SKOB 2YFNA 5E2UL 3IF1B 5TFSH 2JCCB 1EPFA 1T22B 4HT1H 1Y1DA 3WDIA 4M1GH 4PY8I 3DRQB 3B9KC 4CSSA 3SHSA 3CUPB 3A67L 5D9SA 4KKBC 4X5XB 5HY9A 4CU7A 1ILSA 4FFWD 1SXSA 1CI5A 1FL6A 4ODHH 4J7RA 3NT0A 1KJ2A 2Q9OA 3FO0H 5C9JA 3O8XB 2JI1A 2CKBA 2FBJH 2CLRB 1ZLVK 1CL7H 1F1AA 2Z35B 4JO3L 1SDDB 4PJ5B 2LLNA 5JUEH 1KY6A 1NIAA 1AMXA 2XNAA 3R7QA 4UAHA 3K1KC 4L29B 1PZ5B 5LCVA 2YQ3A 1WBZA 4XCNA 4UIKH 3MRBB 4YWGL 3NCJL 3AY4C 3CFDA 4XMLH 2NX5B 4AG4L 5GRJH 1H9DA 5CSZB 4GRWF 2EZ0C 1JS4A 1GW6A 1Q38A 5KOVC 2NRDA 3AU0A 1I8UA 4NQTA 5MENB 5JW4N 1I3RB 2ETWA 2HA1A 2VXSL 3ILPA 1OAYH 3Q2VA 2VDOH 5HYJE 4G5ZH 1DFBH 4RSVA 1I3UA 4OZGA 3VB9A 4X6BA 1MCRA 1Z0NA 5HDBB 1X9RA 4PJIE 2VITA 4DAGL 3KL0A 5EBGA 4Q9QH 3QZMA 3DSFH 3HI1B 1R24B 3RVXC 4GKSB 4CW1B 4JRWA 1WFOA 4LVNC 1RUPL 1D2PA 3G04B 4LSSL 2WQVA 5DMKA 2YLHA 4FNRA 3VXMA 4L3CB 3D39E 3WFHA 4WZ9A 1BIIA 2OXGA 4I8DA 2MPAH 3DWTA 3Q1EA 4Q2ZA 1DDTA 2Q3XA 4ZK8A 1HSAA 4WCYH 4DFHA 5BQ7A 3WO3B 3L4CA 4UQEA 1G7HA 4LEXH 3TWYA 1YLBB 1FORL 4IBZA 3I9GH 3VDBA 1T0PB 3OB0H 3ETBF 4ZFFA 4M8RA 3NZ8B 1F58L 1L6ZA 2NQ3A 5HYIA 2J5WA 2VZSA 3UIZA 4D3CH 2NSMA 3IXAA 2QGEA 1KV7A 1ZV9A 5D71H 1CT8A 5FLVA 5I30L 5GRYA 1GR7A 4AQEB 4O02B 3GXDA 2X4TB 4XN8A 4TNWK 3VI3E 1JPSH 3WN5C 5BZDA 1NJ9B 5BO1H 3WNMA 2IXQB 4FTDA 4GAFB 5JO5B 5JW5A 2UXFA 4X0KA 1IEBA 4FFYH 3HNTL 3L45A 5D8JH 4O51B 1ZJBA 3IJ8A 4L8BB 3APDA 3WU1A 4KKRA 1JVKA 1IBGH 3R0MA 2WB7A 2WZPA 2PW2A 3TEUA 3LQZA 5CSBA 2GUYA 5C0JA 3R4DA 4LBEA 5C0CA 5J57B 4TYUA 5EA0H 1I1YA 2UXTA 1CF1A 5D4QA 4GFXA 3SDDC 3SPIA 1BV8A 4R97B 5CD5C 3CSPA 4KNUA 3ZRFC 1TVBB 4TUOB 1KOAA 1M7UA 1WUZA 2ORBL 3C87A 3WAKA 5IF0B 4U7SA 5GRVK 2BRQA 3RKDD 1NBVH 4FHBD 1HKLL 3KS0J 4W93A 4UV4H 4MMZC 3BQUA 2NY4D 3B1UA 1AQKL 2JCCE 3V7MA 1HE7A 1ZXQA 2P7TB 4MDRA 2P5EB 2QVKA 2O61B 4JGNA 3UTTD 2VKWA 1R3IL 1J9RA 1U41A 3MBEB 1NC4D 3RY6C 2QT6A 4YL4A 1IAIM 1MWAA 3KH3A 3KPSD 3UJIL 1I3VA 4PJ5E 2AFNA 4PY7A 4OTXL 5DD3L 3DVIA 3FUMA 1UACL 2A9DA 2I9LA 1WA0X 4KK9C 2ZSWA 4HUUA 2HLFC 3C09C 1U8PB 1QFWL 4KXDA 3SY0B 5FB8A 4JPWH 1SM3H 4UUJA 1NIEA 2NX5E 8FABA 5IFJB 1JN6B 4WKXA 3JWDC 3BWAA 3NCFB 4UOQA 2AEOA 4ENZA 5B1JC 1N6QH 1CLVA 4FCHA 5MENE 4ZW6A 1NC2D 2WVUA 2G60L 1OAKH 1SMAA 4FLSA 4JMXA 4N86A 4S11A 2E8YA 2R2BB 3HE7D 3M1OA 2OSXA 2F8IA 1ACYL 1LHZA 3EOBB 2MCPL 5EIIA 3MRKA 3PPEA 4LP5A 3BGMA 3DTXB 1G4RA 4PCYA 4RLDA 4N9GB 3GMQB 1ODUA 4XWOC 4DVRL 1RIVH 4MNGA 5I8KH 4B5EA 3B7SA 5C09D 3KYKL 1YJDC 2IH1B 4N8PA 4F7MA 4GIAA 1UFUA 4QTIL 2FSDA 2GSMB 1P69B 4DPRA 1OP3H 2Z3FA 1B0RB 1S46A 2EDKA 1GZQA 4IQHA 5F88A 2D8KA 3VFUA 4HXAL 3SGKA 2X5PA 3WSQL 1UWGH 3L9BA 2ITEA 4AEFA 2X6AA 3C60D 2YRLA 3PGDA 1KB5H 1UADC 1R5VA 3NSDA 1J5OL 1MUJB 2HKHH 3B9VA 4H88L 2BDNL 5H35B 2HTLC 3ARGC 1UYWL 5D1XE 1YEJL 2XWJA 3MPCA 2F9BT 4QTHB 5KANG 4BCXA 5C97A 2DWDA 3FQUB 4NLHA 4XXWA 3X12A 2NY6B 5IESL 1NMCC 4K9EL 5PCYA 1MCJA 3P1VA 4PGCB 1U3ZA 3BLBA 4WLCA 4YDKH 2VRQA 1SOQA 3OWRA 5AKSA 3W2DL 3OVUB 3ARPA 3US0A 4XO4A 4YOKA 4RCAA 4F3FA 4NNYB 4UTAL 3L4YA 4ISVA 1UM4L 1KIPB 3NPSB 4WTQA 3TH2T 4PJ5D 2VSDA 1E6JH 1ZY9A 3Q2NA 3V95A 4B9YA 4CBPA 4NHCH 3SO3B 2VDMB 3L17A 2ADFL 3HLKA 4MX7B 1LO3H 1NEPA 2PTTB 1QBML 3CH8A 4ICWA 3I2CH 4OD2B 3K6DA 3T3MB 1L7TH 2OL3H 4ZO7A 3JVFC 4G6AD 2NX5D 4JM2C 1AS8A 1HEZB 4NZUH 3SJVD 5FIEA 1L0QA 2F8VA 4AXWB 2ZUXA 3RA7L 1EHXA 4EIGB 1YYMH 5C0IB 1QKZH 1QHQA 5KS9B 4LARL 3ZYZA 1G43A 5F1NA 4A38A 2VIRA 1PFOA 4EIUA 3CN2A 2JELL 1IT9L 3BKCL 4WV1B 2IAMA 3MOBH 3EO9L 3ARFA 2A83B 1X5AA 2P5EE 2ZONA 2CQVA 3NMEA 4M93C 1YMHB 1WTLA 2PYFB 4U4IA 2BPBA 3FT1A 3IGAB 3JUYA 5E5RB 3UYOD 1UD2A 4DGYH 3BMVA 4GQRA 4L37B 1FG2A 4AJYV 2HMID 3QZWG 1WCBA 4RNRA 2EE0A 3WKMH 1QI3A 2ADYA 1A1NB 4FFYA 5SWZA 2VR6A 4PJGA 4QWWC 2A6DB 5KW9H 3A3YB 1N0LB 3WEMA 2NZ1A 1I7UA 2ROXA 4D0BA 3NA9H 3X11B 2WJ5A 3STZA 2B7DT 4M3HA 1MY5A 3DHJA 3WL9B 2ICWI 3MHZA 3CPLB 3PDGA 4N0UA 4XP4H 4Z7WB 3I3EA 1KJ3L 4PJ9B 2BNRD 5KBDA 5EU7E 4RFNC 5DO8A 1XCQB 2ZCHL 2R2HA 3P0GB 4P23C 4PY8J 3K6SB 2BVOB 1CDUA 2VW7A 2ZXCA 4BEIA 4M6NL 2VXVH 5GZOC 4E41B 2V7NB 4DK6A 5D1ZA 4YIQB 3R8QA 4FKKA 2HJLB 1BF2A 2ITCB 1ROWA 4K5LA 4P2QA 5TF1H 5IMMB 1R47A 5LNGA 1FFPB 5J9PB 5FCUL 1IAKB 1JZ7A 1WHOA 3U30C 2G3XA 2FWLB 3PHQA 4J3BA 2DOCA 3HZVA 3KPLA 2K7PA 1N2RB 2DD8H 1CDYA 1M1SA 1XB8A 3NGBC 3ARWA 3GSRA 1U33A 2CCLA 3AREC 3GSUA 3OAUH 5KOMC 3FNKA 3K8MA 1DSFL 2R0ZL 3WY4A 4ZMVA 4M7ZC 5HI4D 4ZPVB 1PGRB 4TQ8A 3TA3A 1O6VA 2WXOA 1CFQB 2IEPA 3KBFA 3TN0A 1BWWA 4F5CE 1DEEA 2EAEA 2EXYC 1JZGA 2OMVB 1MW1A 3GMOB 3NCXA 4JREB 2P5ED 3UADA 4BK5C 1ULVA 5I71B 5GRUL 4W68A 4PJ7B 4GI6A 1AQ8A 3MBED 1G94A 5LAXB 4ZPTA 2XWZA 2VXUL 2WLIA 2VABB 4RBPH 1J48A 1PX8A 1F6AB 4E9QA 1CF8H 1H0DA 4A6YB 4WDIB 5C0FA 3NZSA 1HYSC 5ERWB 1M6OB 3CLFH 4MXQC 3X1FA 5JMRA 3K2IA 3IMTA 4X6FA 2ZWSA 2C7UB 2IBBA 4PG2A 1BOYA 4XR8C 5AEAA 2OSLA 3LKNA 3DV6B 1L5GB 3BP7B 2AK4B 4DETA 4DQOH 4OZGF 5K93A 3VB8A 1T6WA 4P57A 1OSZB 4B9GA 4YDJA 3QDGA 4RQQA 3ECUA 4AMKL 3HS0B 4GW4A 1FVEB 1OOWA 1QP1A 1XGYL 4WO4A 3RVWD 3SKMA 2ZNXA 4TSCL 3W81A 4AYSA 4HISA 5KS9E 4G59C 3BWUF 5AB0A 1QABA 1DN2A 1PQZB 5LNDA 3ZZ1A 2WTRA 2Z8SA 2EDFA 3NESA 4FFZH 4ZFZA 3D9AL 3KWUA 2EH8H 4DVBB 1XDTT 5ENWB 1KB5A 2F08A 2X1PA 4PJ8A 1TCRB 3DX6A 4GO8A 5IFAL 2ZUQC 1JXJA 1F45A 4WHYH 5G4NA 1X5FA 5G5DA 5I6LA 1SNRA 4J12A 4EIBA 1JUFA 1ZT7B 2J20A 1E5AA 3G6AA 1Q0EA 4ZX5A 5IMLB 5DRWA 3RWFB 2VQTA 1QLEH 1HNGA 4NCC2 1U3NA 4Y7MA 4CMHC 2WCSA 3AMKA 3UZVA 1IGMH 1A6UH 4PMFA 2EUZA 5ITFA 2DY2A 1BOGA 4F15C 1NICA 2BOBB 2BXYA 2F19L 2P49B 4XH2B 2A7BA 1JPFA 4OF3A 4NUJA 4CU8A 1YY9D 1FFNA 4GO9A 5DS8A 1T1YA 4NZ8A 3K5RA 4XOAA 4XNUH 3SD2A 4JFHE 1PZCA 4Z7WE 5F9DC 2AK1L 3PP4L 3BVNB 1AYRA 3F7KA 4Y4FC 3VI4A 4KV5E 3H0TA 3CFJB 2NY6D 2OL3A 3Q9QA 4HC1L 3GHPA 1HHKA 4JFTA 3GLAA 4PJCF 4UINL 4DP9X 5C2UB 1IC7L 1IQDB 1GOFA 2WOYA 3DO7A 2H2PC 3FYIB 1BPLB 4E41E 5L2KA 4LAJH 2QSCL 5TDOB 3ZE2E 2AQPA 2R1XA 1WC7A 2H7WA 5KYWA 1D7FA 2KZBA 2YKLL 4PP1C 4OH2A 4ZXBA 3U9UB 2DKSA 4PP2B 2HFTA 3BAYA 4LPUA 4UQAA 4PHXA 1JI1A 1HCFX 3N91A 3T3PB 4DPBX 5E08H 3H4HA 3RTQB 2WLLB 1RIUL 4FNPA 3LZRA 2IVFC 4OB5H 4ZQKA 4RGNB 3SPVA 1BYNA 1LWRA 3LB6D 4YXHL 4HWEL 1H5BA 3HPJA 4PJEA 4MJID 4FQJH 2YEZA 3O6KH 4HS6B 3NDZE 3FKUS 1JERA 3CVIH 3IDYB 3BLKA 4Q58C 5LWYH 1HEJC 2C9XA 4YDIL 1XMEB 1ZRUA 3TFKC 2V7HA 3CNKA 3ZL1A 2UYLB 1FNAA 3HB3C 4HKJA 4FQ2L 5FF6B 3GHEH 3PWJB 1J9CT 2VERN 2X7LA 4JFEA 5DUPL 4X5PA 1YJDL 3QORA 3C08H 1VZHA 4H8UA 3OC5A 5HGGS 4PJ7E 1INEL 4PQXA 1BF5A 1I85A 1NLDL 2WLHA 5D6CA 2B4CC 5DEGA 4HG4K 2VR8A 1N19A 1NTDA 2I32A 1P9MA 1TTBA 4WI5A 1MI5A 5C70A 3KZ8A 2W94A 3PWUA 4LQ1A 1SEQL 1P84J 1QRNA 3IE9A 4Z0XB 1BREA 3G5XA 1WIPA 1H3PH 1UVQB 2GG1A 3BRGC 4I18B 2X4NB 4JFDA 1CTNA 1H3XA 2WTOA 2ZYHA 3CV5A 4HDIA 4KVNL 5CJOH 5EN3A 2H45A 4JJOA 4B5ZA 2BRRL 3I50L 3H42L 3FFCE 3WJJA 4OQTH 3PWNA 4M6ML 3VDAA 2VXQH 3PWPB 2AK4E 3EFFA 3RB7A 3WFCL 1EHNA 5LAPA 3E2HB 1ZSHA 2Y3AA 1W2KT 1YN6A 5JHDE 5GSRA 1GIGL 3DA0A 2HSIA 3QXTA 3ETSA 4YLBA 5IJVB 3CZSA 3NIGE 2KERA 2G5BB 4XMUA 3CXFA 3WFDL 1GZHA 3W57A 1G87A 4FNSA 4JFDD 3SCMA 3TXAA 2QTVA 3W39B 3UDWA 1U30A 2Q8AH 4HCGA 3WS6A 4V2CB 5HDQL 2AQNA 3K8LA 2JF1A 5JXEA 5FA3A 4B41A 4A04A 4ZS6D 2VR7A 2BP0A 1QTPA 1Z5YD 2WXQA 5T3XE 5CR8A 3GTTA 2Z7UA 3C6LB 4G9DA 4I5BA 2MQGA 1EAOA 3VNZA 2AS5M 1JXDA 1NFAA 4LPTA 5ACMA 3DIVA 5KVGH 3SCMD 2YAPA 3I6GB 4KROC 3GSWA 1Q0XH 3Q6GH 4GRLB 5JLZB 4UDUA 3CFEB 1UZ8B 3NRPA 5E6IA 3BP6B 3RKPA 1JGVL 3VFNA 1DQJA 4KZ0A 1O7VA 1HOEA 4YZFF 4AW4A 5I15L 4LSTL 5IK3A 1FPTH 2BJML 1E9OA 1YPZE 3BYTA 1CURA 2YN5A 4ELDA 2A9MH 2CCVA 1MNUH 3OC8A 3GIVB 4RAVA 4AQZA 1IC4L 4PJHF 4ZTOH 5IB5B 2GTWB 2WIMA 1JPGA 3ELAT 2Z4QB 4DO6A 3D08A 4NWUH 4RX4A 3S88L 4GSDL 3NP4A 2Q6WB 1C12B 2R4SL 3A4EA 2DDQL 3OKKB 1C5DA 4LOVA 3R0NA 4W70A 1DE4B 4YQXL 5FLUA 5LGKA 4FFZA 3S5ZA 3T3PE 1FN4B 2WBKA 1U92A 3S3BB 4QYAA 4RGNE 5IW6A 4KNQA 2YAHA 4NBYB 3RL1B 2DLTA 2DLFL 3HCVB 4IOSD 5F9WB 4U0RB 2ICWJ 4KKAC 4RX4D 1SJEA 1X5HA 4X9BA 4S1QL 5DEFB 3X1NA 4XP6H 1C5CL 3AG3B 1OARL 2GABA 2ZYSA 4XPTL 1JRHL 1PDKB 3QXVA 4NDMA 2BVEA 3KWWB 2EDJA 4K7PH 2DQUH 1HH6A 5EORH 4GQZA 2E47A 2WM0A 4YGVA 4XN9A 2VQ1B 4Q9BA 3QJSB 4GXUM 2J8HA 3P9LB 4PJGF 1JK9A 1NDMB 3BKMH 1OXYA 3FU6A 4DESA 5LXGH 1MHEA 1QFHA 2WXJA 3VSQA 2XSKA 2WBJB 1SHSA 3CXDH 4Y1TA 1PBYA 4HGWA 5DZLA 3EKCA 5FYJH 2YSSA 3O2DH 3SKJH 1CG9A 4JN2B 2ZJSL 1CLOL 2NYYD 3QZWB 1U8KA 1OGPA 3KM2A 2WO3B 1LDSA 2F5BL 4F7EB 5CSGA 3SGDH 2R4RL 2GJZB 5KVEE 2Y7LA 3GMNB 2WGNB 3HNVH 3Q2CA 3UCQA 2MOGA 4OVVA 4QHUB 4FFWC 3PWPE 5ICZA 1IIKA 2APTA 2WSDA 3CDGB 2ESVB 4OJFL 3O45A 3DI2B 3HMWH 5E8DH 5GRWA 1TETH 2FQEA 3K91A 4PWKA 4YNYB 1MAML 4HOXA 1TMQA 3OB0K 3S4SG 3S8FB 1Y0LB 3TF7C 3U25A 3RUGF 3VD4A 2HFEB 3PE9A 4U1LB 3FRPA 1C1EL 5JNYA 1JGDB 1NIBA 4K3GA 1F42A 5JDJA 1FO0B 5JOPE 4I3RL 3CLEL 2Z9TA 1RV6X 2YUXA 2O6FA 3KVPA 3O3DA 1ERNA 2ADGA 3GXTA 4OF0A 1UD6A 5DDHB 3RAJH 4K7FA 4S1SH 4PRDA 1NCTA 4YE0A 4LFHG 4ETQA 3ASWA 3MRPB 1EX0A 4JJHA 1GYCA 4Q14A 1VIWA 2XY2A 4QHMB 5KSUA 5IQMA 5KWYC 1MCDA 2BFVL 4AH2A 2OW7A 1VFAB 2D7TL 4YAQA 4D8PB 2GIXA 4A67A 5JQHC 4V2BA 1RZIA 1OGAA 1SJHA 2EYRA 4JE0A 1DVQA 5JPMB 1KBKA 4DK5A 3BFOA 5TK2A 4MAZA 4LDLB 5A7EA 3KVQA 3WDJA 3V6FB 1AOHA 1ZS2A 1LK3L 1GGUA 2XG4B 4OQTA 1ZHBA 3R06A 2J73A 1AY1L 3WGVB 3IFLL 2HG5B 5CJBA 4RMQA 1AGEA 1S7UB 4KITB 1IL1A 3BWUC 5EEUA 3QBTB 2IDCA 3AAZA 2IGFL 4YHMH 4JFXA 2QQKL 5D7JA 2QELA 3TPKA 4DEPC 2D03L 2VL5A 3SO5A 5CGMA 5KZCD 4AYBA 4Q8BA 3V4UL 4L2LA 2HWZL 3B7UX 1YEEH 3N42B 2DW5A 3KJ4C 3QNXB 3BPCB 1W9XA 3N41B 4MVBC 3V9CA 1NOAA 1G1CA 3ZGHA 1AGDA 4D9LL 2FRGP 4P0DA 4CVZA 2PPDA 1NBZB 4NJAH 3DDFA 4BRJA 2K6ZA 3E3QC 1PPIA 1UCBL 5GJSH 1IEAA 3MOAH 5E7BA 2YWZA 3DSNB 1K9TA 2YMXL 1GXEA 1T2QL 4TVPL 1B6UA 5F8QC 1SEBA 1ZS8A 2FE0A 1AG6A 4JPSA 3K81A 3GLZA 4BSVB 1BMWA 5GGVL 2A2QT 3RKDC 1BZ7A 1SOKA 4HIIB 4G6FB 5H2BA 4JN1H 2W0KA 4G6KL 3WTYA 2J71A 2NY4C 3ET9F 4P5TA 3HC2A 1YEWA 2P28B 3FQ2A 2AV7A 2AJ3B 1JNNL 4ZBJA 5C0EB 2OM5A 1DUZA 1M4KA 3LQAH 3VI4F 4U3XA 3FO1B 4XAKD 2UX6A 5E2VL 3HRZA 1F3JB 1LQBC 2OK0H 4PUBH 2ESVE 4UILH 1DYZA 4ODXB 2JFCA 4XPFL 3ZOAA 2DL2A 1SUHA 3CFMA 4BUGA 4ZS7L 1AZUA 3GEFA 3ARQA 3S35L 3ZDYF 4Q0XL 1K72A 5FO9A 1SBSL 1OCZB 3U36B 2XZQL 4JEGB 3OTTA 1XBDA 1I9EA 1FNEB 1MJUH 2JH2A 3ZKXC 1IBDA 2Q2EB 1WS8A 3L4XA 5DRNB 5MEOA 4DGVL 1MZYA 3QIWB 4R5TA 3QFJB 1XIWA 2ZIDA 2X6VA 1HOCA 3ARUA 4PJEF 1IKNA 1IGIH 4AEHH 5A2FA 2ZWZA 4R26H 1T21A 2WVTA 3VFPA 1E8XA 4NNPH 1GAFL 1UXWA 4O2FA 1GPOH 3F12B 1SXAA 5F1OB 5EWIH 1AIFB 3HE7C 5DJ2A 4YHPA 4EKXA 4TUJA 2VLJA 4HKXA 5C0RL 2I85A 4Y16A 3UAJD 4HWZA 2APFA 1FNGA 1ACZA 2FGWL 4F2MB 4WWNA 3B3IB 1RZ8A 4NQXB 5IFHH 3V9FA 4PVNA 1H8SA 3LHPH 5I76B 1FSKC 1V3KA 5TE7H 3LSOB 4X4KA 4YHOL 4EMZA 1NCJA 5FO8B 4AIZA 2AKRB 4LVHC 4YE4L 2APSA 3Q05A 1BGXL 2H5UA 2AEPH 3WTXA 4J1UB 3JYBA 2AQTA 3L3GB 1XWVA 5EF3A 3MV01 5C08A 4JO8A 4RISL 3FJTA 2ZG1A 4N90E 2P24B 4NJ9L 5E8NB 3X13A 2NUTB 3C60C 3U2IA 1WFJA 3VE0B 3ES6B 2NTSP 2HLEB 4V1DB 3F7PC 1Z66A 1CDHA 4K55A 4GXFA 3VXPB 4LRNH 4NGHL 3GJEA 3PP3K 3CHOA 1FVCB 4ILDA 1KB9K 4DKDC 4GY4A 1DSYA 2XT1B 2DQIL 2QJDA 4GT7A 1BQ5A 4P4RB 3C5JA 3LNEA 4B0MM 3MA7A 4ES9A 4PJAA 1U8LA 3SGKC 4S0TD 2FL5A 2X0VA 3HOGA 1DQQB 1QPKA 4AJ0A 4OFPA 3FB5A 5HHPA 4BH7A 1TU2A 2P9RA 5E1AA 1JNLH 1NEZG 3TNMA 4X5RA 3MLYL 4M5ZH 4WTWA 2WZ0A 1WZKA 1WD9A 1P4IH 4Z7AA 3CSGA 2CCWA 5B4MC 4GEIA 5IHUH 1JIBA 3W0WE 3LYRA 4IU2B 4UYPA 1GSKA 2AJUL 1MIEH 1IFHL 4IOFD 3WEOA 5BRZA 1S6NA 5I5JA 3EOAB 5C8JA 1FL3A 4G43B 3E8UL 1L9SA 4G6AC 5DR5H 4ZYKA 2YD5A 4HAFA 3V4PH 3ZBMA 2FJHA 3E1F1 3POHA 1SYVA 4WHTB 4AIEA 5AW4B 1GY2A 1QLFB 3HJEA 3KBHE 5ESAB 3DPBA 1U3HB 1PY4A 2XFGB 4H26A 1KLUB 4AYID 1TTRA 1LE9A 3THMH 1ZTMA 3O6LH 3FONB 3JYCA 3H6AA 2Y06H 4I9XA 3MRNA 4K7PX 3TWCH 2G75B 1G7QB 4M7LL 5E9AA 4WF7A 5LGJA 1BFOA 3NACL 3DX9A 3VRJB 1I7RB 5ISZD 4JQXA 3RL2B 3WAJA 1AKJA 5J6GB 5HJGA 5AW3B 2BW5A 5CZXD 3QCTH 5I28A 4ZOBA 3HBGA 3KXFB 2NNRA 4FZEH 2HMIC 1E9PB 3LRKA 3MJ9L 3H4FA 1B9ZA 4NRZB 1JYNA 3WEXB 3MLVL 3UZEA 4RWYL 4GBXD 1W72A 3F7VB 2IAMC 3VD0A 3QIUB 3QRBA 3ARFC 5DHMC 4LPYA 4WEUD 1TSHA 3HG0A 1JAEA 4MZ2A 5LGHH 3RZCB 1XR9B 4Y2OA 2X87A 2QVMA 4MWFB 2WWKT 3R18A 4WUUB 2D9CA 4BQ9A 1FE8L 3LV3B 1MJJB 3IKCB 1ZWIB 3UTOA 3E6FB 1MCQA 4LKCA 4NP4H 2Y5QA 3IRPX 3BPNC 3H7BA 5D5MA 2KS0A 5IHZB 2N7BA 2BP8B 4NO3B 2ZOOA 2ADIB 4NN6B 2FR4A 2NY2B 3IBOA 3FTSA 4N85A 3QC5X 3B37A 2C1PA 2IFFH 5J11C 4F2ME 2EDMA 4F37F 4I85A 4HF5H 4LASL 2V8LA 4CDGC 3EJQA 2AJVH 2B1HL 2FEDC 3LH9A 1JL8A 1OE1A 2CDGA 1CL7I 2IGTA 3GO1L 4KPHL 5HVHC 2B20A 1KJ2L 1S9VA 2MTAA 5E9DA 2ENQA 4ODSL 3VVVA 5LQBL 3ZTNH 4L18A 4L1DA 4OZ4B 5DJZB 2CKBL 5HYFA 1G6RH 4N6RA 2GCYB 4UANA 1QW9A 1QWNA 4V1DE 4D0CB 4R0LA 3SE4A 5LCVL 3MRMA 1HQ4B 3BP4B 5HI3C 5E6YA 3VTAA 2ZCKH 1ACCA 3KPQB 3OHMB 2QKIB 1XGQA 5I8CA 2DQ6A 5DZ9A 5EZOH 2A74C 1HKFA 1JF1A 1YSOA 4OCSL 4AUYA 5C0AB 4AYFB 2XKNB 4FEMA 1RVFL 3C8DA 5E8EB 2OMNA 1T89C 1AR2A 2EECA 4MQ7A 2XPZA 5AVVB 5CWSB 4PN6A 3ZN6A 1I1CA 1H3WM 1KC5L 2VH5H 2CBPA 3TA3C 2OTWB 2K1MA 4JVPA 4KJQD 3S4SB 3MXVL 4F37K 3MCKA 3WGUB 5HHNB 4MA1B 3ARTA 1VESA 2EIBA 3CDYA 1I8AA 5HXMA 3DUUA 3IVKA 4QY8B 2WXHA 2IC2A 3OZLA 4TLUA 4PRIA 5DYOA 5AAMA 4V11A 4IRJB 2FJGB 5DFTA 3BW9B 3QFJD 1D5BB 1UXSA 2DZEA 2HTKD 2EADA 4XVTH 4OF7A 4XNXH 3RFZA 2AXJA 4QHLA 1X7QB 4HUXA 3L7EA 5BMFH 1BMZA 4L5FE 4PRAA 2D0GA 1MCPH 2QLYA 2BS9A 4G1EB 3O11B 4LSPL 1G7JB 2W0PA 2X4UA 4K4KA 4NT6B 4Y2DB 1HHJA 4PG2C 1CYXA 4G7QB 3H2WA 5K5YA 1OTTD 4GW5A 3DYOA 4L8DA 4BWTA 4Z18A 3BUYA 4GIPD 1ROCA 1TYJA 3K71A 1HJCA 5EZJA 4MQTB 4F27A 4PRNA 5AZ2H 2XLLA 1G7IB 1KT2A 4QXGH 3IT8D 4TRPL 4R5VA 1AZRA 4LHUG 4MKMA 2Z1KA 4WO4C 3KXFE 3V5HB 4Y5XB 4U6TA 3MKKA 2F54A 2VTFA 1NAMH 2YXMA 3ML9A 1QW8A 1V55B 4JFFB 2V4LA 2XIIA 5CAYB 5D7SL 1JE6A 5FM5O 2DQMA 4RH4A 5KZCB 1QSEA 4PLKD 4PJ8C 2R0KL 4HEPA 3NBNA 4JHAH 4YSDA 4GP5B 4Z1PA 3V4LA 3O3EA 4FXKA 2CGRH 4ZUUA 5CUSH 4WUUE 3FDWA 1E4HA 2J55A 5D1ZI 5SWQA 5IHHA 1WAEA 2YD0A 3ESOA 4M8QB 2BCKA 2CMRH 1JGUH 1TJGH 3HPLA 3GXNA 3P77A 4UNVA 1MXGA 1KG0B 3OPUA 1NSNL 2HN7B 2WQ8A 2ZXBA 2QVTA 4P9MH 2DI8A 5DQ9B 1FZMA 1MY7A 1MFVA 3V4PA 4G8IB 3SYCA 5DCCA 2DBJA 1XGPB 3OSVA 3UPCA 4F58L 5HVWA 1T5WB 1N70A 4LAQH 3BT2H 3HHMA 5K9JL 1F6FB 2CK0H 1N26A 1YEFH 32C2A 4G80B 3V0WL 2L7QA 4FX5A 4M4RA 1NIFA 2G5UA 4OSUH 3LIZH 1GW0A 1T3FA 3T4AB 4UIMB 1F13A 3BUTA 5DHXB 4Y5VB 3UMNA 1RMFH 4XP5L 2AXGA 1ITBB 1LEKA 4JFOB 1ZLWK 1ZK5A 4MLSA 2OMZB 1IM9D 4MZIA 5AOKA 2Z64C 1XFPA 3EJPA 3IFNH 4WY7H 2WKOF 1DVSA 1ZD6A 3RWJA 1GKEA 2A4EA 4ZXBC 5DJ6A 2EIKB 2DL9A 5IIEB 3L9RB 1KPUA 3D8MA 3NFSL 3IS1X 4P04A 1JZIA 4Y4KB 1HJBC 3A6BL 4MGXA 3AB0C 4MHHI 3CSYA 1G6VK 2VMCA 1PKOA 3L1OL 3Q3GA 5CLXA 2VDNB 3UERA 5I19H 4DZ8B 3C5XA 4MAUL 5FYKH 2OCCB 1J5IA 4F7CB 4LF3A 5C0AE 2QHLA 4KXZH 3WHE1 3FOLB 1UD8A 5KN5B 4ADIA 1KELH 4LLYA 4BSWB 1E2VA 4HUKB 3KXFD 3TV8A 2DKMA 5I18L 1DJSA 3APCA 1JDDA 4X80H 4J6RH 4UV7H 1A3RL 3D25B 3U0TB 2I9TB 2X9ZA 2WKGA 4HV8A 3T09A 4NQSA 4DP7X 2VW4A 3QIUD 4PBDA 3GWJA 2VLKB 2LU3A 3QORC 3TYFB 3RZCD 3L3OB 4XBPA 3QXAB 4M1GL 1I85C 3TNNB 4H8VA 1KCKA 1T5XA 4WGKA 5BOZG 3L7FB 4HD5A 4DTGL 3MJ7A 1BFVH 1P9MC 2G2RA 1DO5A 4N25A 4PWHA 1ES0A 2QHRH 3KNBB 3FO0L 1HDMA 2FBJL 4FQPA 4NENA 4CGUB 1CL7L 1G6RA 3OHXA 3OKOA 4HS3B 3WHXB 4ODUB 2ZOUA 1NCCL 2CO7A 3NZHH 4U1KA 1XAUA 4PGJA 4LSUL 4NO0A 43C9B 1ITCA 1UCTA 4GKNA 5IOPA 2F15A 1IMHC 4TLKA 4XMLL 4ZS6C 5GRJL 1KYOJ 3F00A 5ADPH 1X6NA 3DJSA 2K7QA 4N8VG 2Q10A 1IAOA 4HCRH 4I2XE 4Y9BA 1GZHC 1C16A 1ZVSA 1QQDB 3SCMC 2VDOL 2UXGA 1HWHB 2BSTA 2UY7A 4G5ZL 1A9VA 3UDWC 1DFBL 1OLLA 4XVOA 3IWVA 2XDHA 3VGGA 4MB3A 1NMAH 2VQUA 5C0BA 1U42A 4JDZB 5DT1H 1OQOA 4XB7A 3X3GL 2D3LA 5PAZA 2D2OA 1MFBH 1R3JA 1TQWA 2VERA 5F7DB 7FABL 4Z77B 3PJLA 1WAPA 5F3FA 2EVFA 1QHOA 3ZYOA 5C0AD 3ZPDA 2OJEB 2IADA 2ODIA 3TO2B 1KWGA 1PTZA 4LEOB 1FGNH 4BFIB 5E6IC 1CE6A 2IMMA 5EUOF 1NEZB 2V0AA 4XRCA 3I9GL 4L48A 2VO5A 1X9QA 1YCSA 2Y7NA 2IALB 4B97A 3VGAC 1RI8A 1EK3A 1RURH 4QIRA 3IGUA 4KO5A 4PB0H 5HHVH 1AP2B 3KR3L 3T77A 1BZ9B 2ATPA 2YQ2A 4MMYA 4D9RD 3NUKA 5FYLE 1AR1B 2F7QA 2N56A 4CN4A 1JPSL 2HKFH 1FCGA 4IRJD 4X6EB 5BO1L 2C3WA 2ZXWB 3OJDB 3CXHJ 4OZFG 2K70A 3D0VA 1TVHB 5CKAA 3BESR 1I3GH 1KPRA 4FFYL 5EN2A 3WENA 1NAMA 3VXQA 1IBGL 2WINA 5CGYD 3MLWL 3RWCB 4YO0B 1MCWW 5H94B 1MCIA 1MRCH 4Y2DD 5AENA 3MRFA 3WFZA 3GBLA 3X2QB 1WA2X 3VMPA 3STLB 4ONGH 3WLWC 4DWHA 3KLAA 3L3DA 5EA0L 1P4LA 3ECBA 4OD1H 1G0YR 5BZWB 5J13B 4J3VA 1PX4A 2XWDA 4LPXA 5B8CB 2VAAB 2XFXB 2HUEA 1Y18B 3D4ZA 4JFFD 2JKRM 2XVKA 5F9OL 3QWOB 3ZDZB 5KTEL 2IWFA 3DVNA 5E2TL 1Z9MA 1QEWB 3MTRA 4GAYA 2WHVA 2F6AA 4UV4L 2VLKE 2EEAA 1TZAA 5D5MF 4Y19B 4QGYA 4H0HB 3VWJB 4F9PA 3PAYA 2MWCA 5J8OA 5F7EH 3BH8A 3LIZA 3BN9C 2VE6B 4L4TD 3BPLC 3LS5H 3WKYA 2E76C 4FXGB 4Z3GA 2J6WA 3QPXH 3RQ3A 5ICYA 1MIML 3KWVA 1MG2C 4HH8A 5DQJA 5DD6B 1TSRA 4U6VH 1KXTA 3TBWA 1OAZH 4E9YA 4XNQB 4KK5C 5I5MA 5BJTB 3X17A 4DO4A 2NZ9D 2VR4A 4QXTB 4ELKB 4OLYH 1RPUA 2PPAA 4JPWL 1U0QA 2FECI 1X6LA 3P4LA 4DUXA 1AXIB 4POZD 4OV5B 1VAHA 1E27B 1N6QL 3OR6A 2FWUA 3KPRA 1W0YT 5ITBL 5FYLD 4JO1L 5F6IC 4ZUTA 4MNHA 4ADGA 3U0PA 3DRQA 4JQVC 2GAZB 3CC5A 4X5XA 3ZIYA 5E1QA 4X99A 1QG3A 1UWEL 5L4FA 3O8XA 5E7FA 4MKTA 1UG9A 1BLIA 5BUGA 2F2HA 2CLRA 4NQVB 2QPUA 4GSUA 4Y4KD 5CEYA 2Z35A 1SDDA 1RIVL 3RVVD 4NXKA 5I8KL 3ZR6A 1JHKH 4FNLL 4I4WB 3SE3A 4G6JH 3ALWA 3MRBA 4FQIH 5FHBL 5KJ4A 3LEVH 3F7LA 4Z3TA 2J21A 4JNXA 2Z1PA 4RMRA 2ZX7A 1KLFB 4W9EC 5DK2B 3RBSA 2FT8A 4LXFA 3NCYP 2X2HA 4XPAH 5KYXB 3IMUA 1PS3A 3FCTA 4MSWA 1BIHA 1XB3A 2AAVA 1L4IA 4L9LA 2XA8L 5MENA 2KZWA 5E4IA 3OQ3B 3QEQB 2X2IA 3BUQA 1PLGH 1OGTA 4K15A 4U1MB 1VRSA 3JZ7A 5HHQB 3TPUA 3KJ6H 4C54A 3D12B 4AM0Q 4ZRGA 3C8KB 3ROLA 2XZAL 1A4BA 4I0PB 5AKVA 5DSCB 1VJSA 3D0AA 5CD3B 1V54B 3BRDA 4P5KA 1PY9A 4PD4K 4AQ1B 3GNMH 5A2CA 4Z5RA 1OP9A 4PIRF 3QCUL 5DK3A 4CSPA 3GSVB 3BO8A 3W3BA 4J5VA 4MA8L 4MCZA 3IJHA 3MR9A 1YEIH 3UACA 1QWUA 4HCRA 4EI5D 5F21B 4DPAX 2A6KB 2NTFA 3UJTL 1CFNB 1EBAA 5C86A 2OTUB 4NEHB 2EQDA 4FADA 4NQDA 1J1OL 1FZKA 1E6JL 4XNZC 4IHOA 3HZYB 4OKVA 4NHCL 2DQGL 4PBWD 3HAEG 3B5TA 1Z9OA 1HS6A 2OL3L 2VDLB 2ARWA 4H8HA 5M7QA 5D1XA 4NZUL 5D7LA 1ZLEA 3PREA 2X89A 1MEXL 4PVBA 2O93L 3QEHA 1ZA3B 3V6OE 2XWTA 4PWIA 1YYML