4YS4A

Crystal structure of pf41 tandem 6-cys domains from plasmodium falciparum
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
351
structure length
258
Chain Sequence
MGKSHKCDFTKEKYLLSGEKEVSCEIDANPADDITFICPNLCFHTVNIAKNINQNKATMSIQDLLYGSVVYGNTLFISPYVRTNTPFYCFCNLDTVTIQKFLKINRFLKDDDELSIISKRGIMSVFVRSNNNVIKGCDFGNNNKNYFSHPISVAGVNNKVCKIQGKPGELVGFKCAFEENGKVEPPNCFDQVLHKNKVTDLKTLIPGYASYTNKHSSKYPYYLKIPHFVNEQYTIQCCSNNAQNEYTFELDIQPGESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Plasmodium falciparum Blood-Stage 6-Cys Protein Pf41 Reveals an Unexpected Intra-Domain Insertion Required for Pf12 Coordination.
pubmed doi rcsb
molecule keywords Merozoite surface protein P41
molecule tags Immune system
source organism Plasmodium falciparum
total genus 63
structure length 258
sequence length 351
ec nomenclature
pdb deposition date 2015-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ys4A02
2YMOA 4YS4A 2LOEA
chains in the Genus database with same CATH superfamily
3QZWA 2OXGA 4JM2F 4UB0H 1PZDA 1XZ0A 1T1XB 3O8XA 4BFNA 1G5AA 1NIAA 4AQ8A 4OLUH 2CPUA 1YEWA 1P69B 2AJSH 2WIIA 4HJ1A 3RAJH 5EIQA 5FYKH 3BDYH 2ESVD 3VFGH 5BNXD 3V0VB 2A74C 4KX7A 1FGNL 1NA8A 4P06A 2KL6A 1BQHA 5DC0A 1XBDA 1K8IA 1O9VA 2WN3A 5EZOH 1NOLA 3R4RA 5MP6H 3BH8A 2X38A 3CSYB 2VN5A 5DDHB 4OZ4B 3IFLH 1WZAA 1OLLA 2ITCB 5FECB 2B5IC 4P59H 4MD5B 3ECBB 1SYSA 1NCNA 4QMEA 4ABQA 3D3VB 4PJ7E 3IE9A 1HH6B 3OKKB 4DEPB 4OT1H 2Y7OA 2H2SD 1ITBB 1ZT7A 1FO0H 3OKNA 3ES6B 3HLAA 3MCKA 3FQ2A 5F7FA 3B2UD 4JQXC 1X5HA 3EJZD 5EEYA 3DBXB 2EYTB 4JS7A 3WLWD 2WWMD 3DIVA 3GK8L 2P5ED 2OV0A 1NCBH 3EDEA 3MCLL 4WKZA 2J8UA 1N0XL 4EJ1C 2VAJA 5ALCL 1X9UA 1A47A 1EZUA 4JREB 4NO2B 4AEHH 4ZW7A 4A2LA 1FYTA 4KO6A 3MA7B 4UT9H 2VIRB 1UG9A 4LF3A 4RX4D 2YD1A 4AT6B 1UD8A 3ZGIA 2G5UA 4K94C 1XF1A 2Y5QA 4L29A 4X9GA 3F8UB 3JYCA 4P05A 3UYPA 4X7EC 4NRXB 2O26U 2C7FA 1MCCA 4HEME 2Q7NA 3HKZA 4N8PA 1U91B 4WHYH 3UPRB 1ZA3A 2WGXA 4R7DA 4EUPH 1WD8A 2AXFB 1XXDC 1GKOA 1UXWB 1XXFC 3B9DA 4JCMA 2YKLL 1LILA 1LP9A 2Z7WA 2XTJC 1LTXA 1N12A 4K23L 3QJVB 5DHYA 5HDOA 1QI3A 4LPTA 3VFOB 1QEXA 3NZHH 1CU4H 5D1XB 1ETB1 1RZJH 1XCTB 4TLUA 2VLRA 3QUYC 4Y9CA 4FLSA 5ENWB 3QUXB 4RAVA 4WNQA 2WJ5A 2FO8A 1O6VA 1TZIA 4TMPA 5SWSB 5J6GB 1B2WH 1DR9A 2ZOUA 3AGVA 1CGUA 3H2WA 2QQKH 3BRGC 2ZXGA 1B6UA 2QTEA 5I1GL 4MQXC 5A7EA 3NCYP 2N3JA 1QTPA 4FTVA 3S4SA 4NN6B 2VZTA 2EUZA 3WFCL 5D7LD 2Z3FA 4FQIH 1CGTA 4Y4HB 4DN3H 4K94H 3DTXA 1IGML 4AQ1A 1FV1B 4NKMA 2WM0A 3UTSE 2V0AA 1KCUH 2ZX9A 1YY8A 5CBAA 5D4HA 2R1WA 1UOVA 1U95A 5BQ7B 1AO7E 1LMIA 4L1DA 3V5KA 5DJ2A 4N5UA 3Q0HA 4QRUA 2VSMB 5FV2A 1FPTL 1WHPA 4ODUB 4PVLA 4Y5XA 5BQDA 1K3IA 1X5XA 1MW2A 1J9TA 3I3DA 4EIGB 5D7IE 2XFXB 4WWNA 1TJHH 1UWXH 5C07E 3O3BA 4HJSA 4R26L 2X1OA 4OLZL 4WI6A 1MJ8H 2F74B 3I9PA 3T8MA 4F7EB 4TQHA 3BP6A 3RGVD 2Q7YA 3S3PA 3M7OA 3EYFA 3BIAX 3MU3A 4OD1H 3NYKA 2BNRD 1XSJA 2QGBA 2X89D 4I4WA 3NT0A 3U36B 4GB9A 2J25A 1EZVY 2QT6A 2LLNA 4NQVB 1NIEA 1ZKAA 1ZLUK 2YC1A 2OZ4H 3IFPB 2ZCHH 4TSAL 2DL9A 2CLRA 4KKLD 2GCYA 1FNGB 1MNUH 5AKRA 4F7CB 2WBJC 2X4NB 4FLQA 3UBGA 3FTSA 4ES8A 2MPAL 5CKGA 4F37K 2KPWA 4WWKD 5E00A 1MLCB 3PWNA 3UTZB 1A3QA 1XF5A 4HIJA 1LEGA 1B0RA 2QVTA 2MNWA 4IJ3B 5I8EB 2H8PB 3FHAA 1OAUL 1YMMA 3AS1A 3V0JA 2RR3A 2AQNA 3MLSL 1CF1A 5ESQA 3MLYL 4M8QA 1XGUA 3U1SH 3PREA 4NRZA 3B2VL 2IANE 2X44D 5AZ2L 5KTEL 2OR9H 4LL1A 3II3A 5GISL 1IT9L 1RFDL 2WXLA 4HWEL 5C0AA 3SQBB 2CRMA 5EUKB 2VMCA 4BINA 2V2XB 3PP4L 2XKNA 1MLBB 2CDFA 5HYQA 4OCWL 5CR8A 4N1CA 1F11B 5FO9A 3FN0H 3ZL4H 1KB5B 4KUCF 3EADA 3IKKA 5BW7A 3FF7A 4AWJC 4KKCC 5EIIA 4HIHB 4XP6H 2AK4B 2F54D 2G5RA 4P99A 3IT8D 5TF1H 4AM0Q 3FOLB 3QULB 4MMXB 4IRJC 2L0DA 1W8EA 1GAFH 4KKBD 1JYXA 5I76B 1ZOXA 4CADA 1HWGB 3WN6A 2BCKB 3RVXD 1OSZA 4N2KA 4GAFB 1BEYH 1FYHB 4GKLA 3WSQH 4TNEA 1TQWA 1F4WL 4MAZA 5A1AA 1P7QB 1QR1A 3CHSA 1KGYE 1QWHA 3FAXA 4FXGB 4OM0H 1VAHA 4E68A 1TSHA 4JFQB 1X7QA 2B9AA 5AL8A 2NX5A 3QPXL 2VABA 5F88B 5BXFA 3KVQA 7FABL 5CGYC 2AEOA 2VN3A 3TVMC 3FFCA 2W9DH 3OKYA 5I66A 3O2WL 2UXVA 3MO1A 1HYSD 4PRNA 3T6XA 4OV5A 1EHKB 5KSBB 4DVRH 1GYAA 4OJFH 3L1FA 2BMKB 4ELME 2ZF9A 3HE7B 1OWWA 2DIBA 2WAQA 5I75B 2N7BA 3GHBL 1LP9F 4M3JA 5I1IH 2AGJL 2AERT 4IGBC 3UEQA 5I8KH 5F89A 2PO6A 1WG3A 3HCVB 3MGAA 5KG9B 2VDQH 3TIDB 5GS0D 1ETA1 1X9LA 5ERWB 1AS8A 3GSQB 1WS7A 3IPEA 4XRCB 3TYGL 1NCDH 1MAMH 3QUKA 4JVPA 4TUKH 5FW6A 4N6QA 4GPVA 2C4FU 4AM0B 4LPCA 1AZCA 3VFTB 2AQ2A 5AOZA 4HV8A 3VXUE 5JDSA 2BVOA 2XWTB 3BEVA 4AYDC 2HUHA 5E4EB 5EBMA 2GUYA 5L0QB 3P0YH 2J1YA 3OHXC 4P5MA 1DDHB 4WUKL 3B6SB 3ROOA 1F42A 4CMMB 4JZNB 1F86A 3RURA 4NUJA 5IVXB 1HH9B 1I1YA 2X1XR 4JVWA 4ZOEA 3VFNA 4AQEB 4C55A 2WINA 1OZUA 4HC1H 3QZPA 1M1XB 3BDBA 3CCHB 4FEMA 4H44C 3MV7E 5D6CB 1D5XA 1MN4A 2CJUL 3UAJD 3FO2A 4L0YA 3TEXA 3CSBA 1MXGA 2OL3A 3VW3H 3J8F7 4WSJA 4PYHA 3VRLF 3ALPA 3P9MA 1KPRA 2OMYB 4JFYA 1JYNA 4NQCA 1G0YR 3ATEA 3HZMA 2G2NA 3CSFA 2MOGA 4KPHH 2B3IA 1JTTA 1I31A 4O4YH 4PJAA 3BPNB 2FEDD 2FJHB 2O6EA 5AW3B 1AD0B 3ULSB 3WS6A 3O8XD 5D1QE 1NCWH 4AYID 4S2SB 4NQDB 3II2A 4LLMB 1JZ8A 3IRZA 3OC5A 2DQFB 4NUMA 2P4AB 4XAKE 1NC2A 3K0WA 3WLWC 2NOYA 2WWMC 3CFCH 3S6CA 3BD3A 3WTWA 3X13A 3LRLA 4DZBA 3CU7A 3V6ZB 3GMPB 4XBPA 4GUQA 3KYMA 3VE0A 1C5CL 1P0SE 2XZQH 3KMDA 1ZVYA 3JV6A 5AUMA 1RJZA 5ICZB 3C2AH 2DIJA 3BAWA 3LPOA 4Q6YA 4Y2LA 4KUCD 5FLUA 4YK4B 2PYEA 3INUH 3UIYA 1E28A 4JQVA 1H3TA 1CFTB 3K1DA 5C0DA 3DX6A 3FKUS 4GQQA 2XOTA 1X9QA 3QW9A 1L6ZA 3LN9A 4QOKA 1KEMH 3SJVB 3QUZA 1UM5L 3BKJL 3PUCA 4M61B 5FC9A 3FRPA 1AQHA 1F6AB 3EOAB 3TBBA 1HWHB 2DMGA 3S35L 3UH8A 4UIKH 5I1DA 4ZO8A 5EEWA 1EERB 2DLIA 3GJFK 4JO8A 3E8UL 4QRPA 3WIHA 2W9EL 3I6GA 2UZYB 2CALA 3QZOA 1RIUL 4PJ9B 3NH7H 5JW4M 1NMCC 4WKXA 3BGFB 4L8CA 4HKXB 1J0HA 3ZSSA 1M6UA 2CO3A 1N6UA 2CBTA 3ZT7A 5AL0A 3HZKA 4PRDA 1WFUA 3PGFL 5T33H 1INEL 1FYTD 5J57B 5ID0B 4MXQD 2G2PA 2Q8BH 3TPUB 1UVQA 3C6SB 3ZDWA 4EIZC 3Q2VA 3QWNA 4Q9RH 4C83B 5EO9A 1SHSA 3M17B 2P8PA 2E9IA 3IN0A 3QUMH 4HXAH 2NR6A 4H8VA 2YA2A 4G9FB 3BSGA 5EU6A 2VQ4A 1C8PA 1H9VA 1BF2A 3G5XA 4QXVA 2O5ZL 1D5ZA 2H47C 2H45A 2YRLA 4OF7A 3E7JA 2ADIB 4OLXL 1HNYA 2FJGB 1KIUB 3AADB 2M83A 4GW1A 12E8L 2F08A 3D8MA 1IAII 4FQQB 5IR1A 4HWUA 3UTOA 1DQDL 2YQ3A 5J11B 2W92A 1QA9B 2HZHA 2YXFA 3W37A 1JV2A 3ASNB 4AVJA 4JPIB 3BWAB 1S78D 4YN3A 4JG5A 5FK9A 3GZQA 3RGVC 3SKJH 4FTVD 3UC2A 3VXTB 5CEXA 5IW3A 3CHRA 1T89C 1U58A 3T6QC 3M46A 5F44A 2WUCH 5JMOC 2WQWA 1G7MA 3BD4A 5TH2A 1J5CA 1H5BC 2H7WA 4QRSA 1DQJA 3Q3GA 4KKLC 4LOFA 1R3JB 4R0LA 5D7HA 2CHXA 2CLZA 4PRPA 3K6OA 3QJTB 3I9AA 1U4FA 3NP3A 4G8IA 4ZK8A 4WWKC 5C0CA 4FZEL 4FTDA 3M1BB 3QHFL 2GTWB 5FYJU 5C08B 4I87A 3PIQB 3FFDA 4HZLB 4P2OA 4R7NA 3F5WB 3FQWB 3JWOL 4L9LB 4WCYL 2XTLA 5DEJA 4FQXB 2DQIH 1ACXA 2XA8H 3FPYA 4XNUH 5FUCE 4JFVA 1JE6A 1NOFA 2WXJA 4ONHA 5L8JB 3EO1A 4ZDHB 4NZTL 1GJUA 5CJXC 2X2IA 3CN4A 1XGTA 3GKWH 3NACL 3V6BR 2HJLB 3W0WE 4JFXA 4YWGH 1IGTB 2DBJA 2AS5M 3HNSH 1BCIA 4D9QD 3KDPB 5KVGH 4EQ3A 1AG6A 4QTFA 1MG3C 5F70A 3SGKC 3T4YB 4FZ8L 1W80A 4NWUL 4YDLB 4N1EA 4ABUA 5DHXB 1M42A 25C8L 2O5XH 4WK2B 4ENZA 4KJWD 3BJ91 4ZMAT 3N06B 1UJTA 3O9WA 4QTIL 5IEHB 4PCTA 3N55A 4MB5A 1AANA 3C5ZA 1FNFA 1Z9NA 2QDVA 4MXVF 3V0WH 2AQTA 2W81C 3OX8A 3UC0H 3PJLA 4PJAF 2FWSA 4KKBC 1G7JB 1YMMD 2R2BB 3BSHA 3ETBJ 3RVXC 3QA3B 3A67H 2OCCB 3X1FA 2D2OA 1KN4H 3IFOB 4GUPB 4ZFQA 1WWBX 2D9QB 4U7MA 4OFVA 3ZTEA 1IU1A 2ICEB 4RISL 1JHTB 4YDKL 1BZEA 4XMXA 3PWJA 5HI5D 4Y0GA 1NKGA 5C0AD 5JXAH 3T0EA 3KPPA 2LR4A 4NNYB 1SEBA 4L0PB 5ANMB 3GBMH 3L16A 4UANA 3ZLQC 2FH8A 1AKPA 3UDWC 3AS2A 2HG5A 5FA4A 3DX7B 4JZJA 4M4PA 3R8QA 2VZSA 4HZ1A 5ITBL 1HYSC 2BERA 3AAZB 1J1OH 4FLHA 2F5AL 4H8QA 3V5DB 4C56E 5K9OB 3FQRA 2ZJSL 4FMKA 2Z65C 5KN5B 2RFXA 1EJFA 2G9HA 2FX8H 5JW5B 4BXSV 5CLYA 4QXTA 1CE1L 2ZSVB 4ZMWA 3MZTA 4LSVH 3BSZH 2K9UA 2ITEA 2AAAA 1XAKA 1KLFA 4PJGE 4WU5A 3QG6A 1Z9OA 2VDML 5F7NC 2FL5A 1LO4H 4RDBA 4UV7H 4BRVA 4IBVA 4O2EB 1A6VH 2V5RA 1OF2A 3LPFA 1ZAGA 5DJ0B 4GXVH 3EHBD 3AU1A 3K8MA 3LIUA 4AQOA 4C58B 2QSCL 4UYPA 4APQA 4B5EA 5I6MA 2FX9H 2NX5D 5IQ7L 2EVFA 3A4DA 4DUVA 1FG2A 3HHSA 3LEVH 4YXKH 1LEKB 4LXFA 5DA0B 4AYSA 2JKSA 2KLRA 4PVNA 3FFCD 3HNVL 4NM4H 5L2KA 4JFOB 4KK8D 3V4VA 3SDAC 3R0NA 1CIDA 4PH8A 3TCLA 4U1MA 3PHAA 3O2VH 4E41B 4DGWC 3V0EA 2ZWYA 2WMPB 2C9XA 1U8LA 1V7NH 3Q48A 1QHPA 3UO1H 4BKTC 5B38A 3UAJC 5MENB 4Y1SA 1INDL 1ULVA 2PO6D 2IC2A 3MRPB 3O11A 3LS4H 3Q2CA 4Z7QE 5CEZE 5IGXH 4G83A 3VFWB 1NIFA 3A24A 4G43B 2W60A 1OARL 3GSNA 1S3RA 3ZKQD 3EO9H 4K7FB 1ZJBA 3W2DH 4G6FD 4YBHA 3JVFC 2QV2A 5DS8B 3BPCA 4WY7H 2PPFA 5C2UB 2O6CA 2FEDC 1G6RH 4XP9L 3WN5A 3LXCA 3O8XC 5H94A 1N26A 2E74C 2WLYA 3ZE0B 3H9SB 5D96C 1J5OL 4FE9A 2DEXX 3QFDA 4AQ8C 1N67A 1T6VN 3WO3B 1J5IA 3GDBA 1NMAH 2AW2A 2DICA 2VAAA 6TAAA 3ZYZA 4FFYH 2PXYB 1IQWH 4GI6A 1SQMA 4N8VA 2VSKB 3RUGE 4Z76A 2FUTA 3T71A 3ULUF 3UG4A 2OCFD 2B1AH 3MGOA 1E5UI 1S7XB 2Q3XA 3BAEL 1HDMB 4JDTL 5D1ZB 3RIKA 4RA0C 4EI0A 4E42A 3QG7H 2ZXEB 4WI0B 4HA1A 5AYQA 5DMIH 2IAMA 1BAFL 3D4ZA 4XH2A 3VXQA 3G6JB 2E75C 2ZKYA 3BJLA 4NQCD 2KZKA 4QT5A 4PV9B 5B39G 2E76C 5E2TL 3FCTA 1BOGA 2ATPB 2H26A 4WHDA 5L6YH 1N5YL 2I9TB 4JKNA 3QT2A 4AUJA 4FGMA 1M3IA 3VGBA 1BP3B 1G84A 1S9XB 2BNQB 5CWSA 1YRKA 1BD2B 3SQOH 5I5JA 1NC2D 1R6VA 4MDIB 1EHNA 4MWFB 4C8XA 4CVXB 3LYRA 2K1MA 3SOBH 1NWOA 5GGVH 1S5IH 4JMNA 1OOAA 3D85A 1OSYA 1Q94B 1SJHB 4XPBH 1DEDA 1IC5L 3UTTA 3CDCA 3ZDZB 2AJ3A 4MXQC 2IALB 3MFFB 4HMDA 3ARFA 3CZSA 3T5WA 1TETL 2GY5A 3IRCA 4JR9L 4LZKA 2H4EA 5C1MB 2PYED 3CK0H 1GIGL 1B4LA 3PWPE 2BW4A 4A7VA 3BGAA 1O7SA 1T4KA 3VH8B 4AJYV 2R7EA 4X83A 2QSQA 4WHYG 5C0EA 4QOKD 3QUZD 4EUPG 1RP8A 4P57B 5IVZA 2XHNA 1IMHC 2FEEI 4NZUH 1PZ5B 4QHMB 4XVTH 4QRPD 4JFEE 2IQ9H 1TQCB 5CGMA 3KLHC 4YHZL 2VZ1A 5BOZG 2GSIA 2LFGA 4F80A 3INOA 5E1HB 4FCHA 3ZZ1A 2LE9A 4DQOH 1C16B 4YC2C 5A2FA 4K4KA 3QDMB 1JNHB 3CSGA 1WICA 1NFDA 1YUHB 4DKAA 1B0WA 2DTMH 4JM2B 4KH2A 4DEWA 1R19A 1S78C 1ZSDB 2R0KL 4OD3H 5EPMB 1TCRB 3D25A 5INCB 2Q2EB 1S7WB 2Y7LA 5IESH 1DN2A 3S3JA 1JHLL 3TO4A 1U3ZA 1F18A 2CDGA 4AQ1C 3F7PC 4H25B 5DVNA 4ZSOA 1ES0A 3BE1L 3V52L 2EYRA 2NR6D 5I6OA 3QVAA 5EU6D 4UU9B 4YLCA 1AS6A 2F1EA 2FTAA 4AIOA 5IB5A 1RZIA 4LRNH 2EECA 4YR6A 3A23A 2CMRH 4WI7A 3VGGA 4Y5XC 2YLHA 5FFLA 4JFPB 1IUZA 4ZFZA 2ZUXA 4HSQA 2X28A 3WS3B 1ZV2A 3L5WB 4XO3A 4V11A 1IKOP 3VDCA 1S9VB 4HPOL 2PCPA 4OIIL 3K6IA 5AZEH 2UUDH 4JHAL 4TL4A 3F00A 3HJ0A 3LRGA 4LPYA 4TM9A 4APXB 2FWLB 3DECA 3IXTA 1U92B 1KLGB 5FGSA 4S11A 1MREH 3BVVA 3U4KA 2P5WA 4Y9FA 4EO5A 4ZW6A 2X2HA 1FCCA 3P3SA 1FN4A 2DQJL 3ULUD 3KBFA 2WQRA 4PJ8A 5D2NB 4A2GA 1KB5L 1T1YA 1I1FA 4W81A 1JFQH 2LFEA 4KJWC 3HS8A 3KGSA 3L5IA 4LCIH 4X7SH 2QLVB 4GLRH 2VLKA 1GY1A 4NO5B 4PRPD 4CC1A 3IPFA 2I32A 2UYLA 3CVCA 2ODHA 5D71H 1ZS8A 5C0CD 2CHWA 4CU6A 4Y9GA 3NN8B 4PAZA 5I1HH 1QAWA 1W0VB 1FL3A 1LDPH 4P2OD 1E5AA 2A9BA 2VDLH 4JJ5A 2HP4A 4LQ1A 1BFVH 1BGXL 4KJPD 4GP4B 3PGCA 2HLEB 1A5FH 4F57H 5KJRL 1WWWX 2O6PA 1JN6B 4KKAD 2D4FA 4LDOB 8CGTA 2UZIL 2D7TL 3GNML 4GO9A 3TJEL 5HI5C 4UB0L 3OAWA 4LNRB 3L8QA 1HHJA 3LQZA 3CXDH 4TLSA 5FYKE 5FGCB 1ZHLB 3CVHA 1UWGL 1A64A 1IAIL 5FV1L 1UACL 5FYKL 1TU2B 5DUMH 3BDYL 3EH4B 4NT6A 5BW7C 2X5PA 2J6WA 4N0UA 1EBAA 4FC3E 4L4TB 1IZJA 2YR3A 3O9WD 3C75A 2XA3A 3C5ZD 3QRBA 2KDGA 3BKYH 2EDJA 4DGYH 4PUBL 3LNGA 1AZUA 1PYWA 3VYPA 3SCMB 1M6OA 1Q0EA 2FYYA 2HJFA 1MJUH 1S3KH 2QQNH 1WFNA 4D9LH 3FONB 4XMZA 5F3BA 1KIRB 1WJ3A 3N40P 3LH2H 5BS0E 1PY4A 1QLEH 3T0ED 3EHBC 4PJ5B 1SJMA 4G6MH 4YHIA 4AZUA 2ATKA 1TEFA 1IVLA 5IWLA 2WHVA 2WUBH 2ZXAA 3TNMA 3UYRL 1X5FA 1CL7I 2EC8A 4V2CB 15C8L 2ZOOA 5JYMA 1Y0LB 2A6DB 3ISRA 4Y5VA 4AGPA 5HP5A 4KK8C 4JJOA 1J11A 4YL9A 5EORH 4RDQF 4CVZB 2VOTA 3CBRA 4Z7OE 5L88L 3QORA 5EOCH 2J21A 5AVXB 2H1PL 1CTOA 1B0GB 2W0PA 3O4OB 2PO6C 3CFDB 1E9PB 2A9NL 1IM9A 4MCNA 1MVUB 3C9NA 6PAZA 5TE6L 1DLFH 2NUTA 5FIEA 3FL7A 4FP8L 2WZ6A 3KL3A 3CFTA 1A9EB 2NSQA 1A7OH 3NZHL 1B9KA 4OUUB 4P2RA 4RMRA 1QMUA 5E08L 2B9BA 3EOTL 4P46C 4AYMC 1NFDF 1TYRA 3HUJE 4WGKA 1UOWA 3QEQA 5IM7A 1E4HA 3V7MA 3L7FB 4G5ZL 1QPXA 1KTKE 5AB0A 1MI5A 5ITFA 5DZNA 1A4AA 3SDDA 4BWTA 5L2KD 4KOBA 1YNLH 4OCNC 4Q6KA 4MZRA 1J12A 3N3EA 4NEHB 1DVZA 5IB3A 1NCUA 2ZOLB 2A38A 4AC4A 1R9FA 2CKBH 3B34A 1A3ZA 5KYWB 4M1CD 3KCPB 1S9WB 1MSPA 2C9PA 4MJIA 2QPEB 2Z35B 1HQRB 4YHOH 3ZMRA 3FULA 4HF5H 1A1OB 4MX7B 2E6QA 1D5RA 1EH9A 4V1DB 2XTJE 2AVGA 4UTAA 3I3BA 5AW0B 5DTFB 2HT4D 1NAKH 4LBEA 2PWDA 2C1PA 3DTUB 3MLXH 2OJZL 1A66A 2ALAA 4G7VH 2Y25A 4PW3A 4N2FA 5CZXD 3FNKA 1ZLVK 3T8XB 3WS6C 1R5VA 1BIIB 1XGRA 4KRNA 5KAQF 3AREB 1ZDSA 4ZMZA 3H55A 3DNKA 1JD9A 1OY3B 1XL4A 4XPHH 1H8NA 4XNMB 4JGJA 2EVHA 3HAEB 1FC1A 2QR0A 1A9VA 1V5JA 2XWBB 1HNFA 1MFDH 1RIHH 4NHUB 4KV5F 3BUTA 4L29B 1I3RB 1JYWA 2IAMD 4UM9B 2ZCHL 3I50L 3Q13A 1A4JA 4JFFE 3IGFA 4JQVC 4X5WB 1OE1A 3RJQB 1OGTB 1EVTC 2OL3H 2GBVA 4Q8BA 5D7EA 3QUZC 1FNEB 4MQ7B 1K85A 4ADIA 2EUWA 2J8HA 2YPKB 4U3CA 5HGHA 1QATA 3TASA 3P2TA 2MKWA 4L5FH 5GGTA 1QR4A 3HC0A 2X3BA 1PZUB 1EJOH 5E7FA 3C09B 1AQDB 2A5UA 1JF6A 1DQLL 3QXDB 3TP4A 1LO5A 1XF4A 3MHZA 4U7KA 2W94A 1O9ZA 1UJ3A 2WTPA 2DYRB 3GB7B 4JHWH 2JWYA 3D85D 3SPVB 3KPSE 2X4OA 4HP5A 1XMEB 4LEOB 3VM7A 3UTTD 3FQ4A 3FN3A 4GBXA 4OZIA 2P7TB 1KJ3L 1WS8A 2CDEB 3ARFD 1J0ZA 2ITDA 5F9WC 4NRYB 3S96A 5MERB 2HKAA 4AYFB 3ABKB 3BGMA 1XDTT 1JPTH 1RJCA 4JDZA 3CH1B 3S5LB 5FOBB 1A7BA 4XCFL 4U1NA 4YX2H 1KIPA 1MCNA 4GAGH 4XPAH 4K71C 2QZQA 2J55A 4P5KA 5CLZA 1YECL 2ZUVA 1S7UB 2IPUG 4PJEB 5IKCA 2CR0A 1OAXH 5T3ZD 3GMOB 3SY0B 3HFFA 2EIZB 3W56A 1Y1DA 5E4AA 4O02H 3Q44A 3WIHH 3PNWA 5I23A 1DJIA 1RU9L 2GPZA 1KYFA 2X4RA 4A2FA 1HXYA 2VUYA 3S34H 3FPXA 5HDBB 1CDCA 1ND0B 1SHMA 1U8JA 2P8LA 4N2LA 4OZHB 2CK0L 5DRZA 4O2CB 4OGQC 3H3BC 2CO2A 2PTVA 4OM0L 1INQA 2OTUB 3IMWA 1GA2A 4F2MB 3TO4D 5DZJA 2VERA 4L23A 5C0BA 2JFCA 3PXLA 3FQUA 3RB5A 3VWJA 1VFAB 3VVWA 5CN3A 5TDNB 3ULUC 1UURA 4XMKH 1G87A 2BLFA 4Z7UE 4H4NA 5DK2A 4F7PA 3VH8G 3WXVL 1MCHA 4N28A 4OJFL 3QR0A 5KUMA 3V0HA 4BFOA 3CXFA 4DP0X 5INDB 4B53A 5DXWA 3ZO9A 1TZAA 3VCLB 4IKNA 3TBWB 5C71A 2VDKB 4K8RL 2YOAA 2Z0BA 2ICWJ 4P2OC 1EMTH 3EJSA 3WJMB 4KJPC 4FXTA 4K73A 3LHPL 4DSYA 2FEEL 2XQYK 1NWPA 3D39E 3DXAB 2WO2B 3NIDE 2QBWA 4OJCA 4WWID 4PPTA 3RDTA 3NDZE 4WEBH 4N2NA 1DCLA 5DRWB 2EDFA 1IKFH 5LCVL 1G7LB 1OB1B 1AZNA 2QELA 1K8DB 4D7PA 4A6YB 5DO2D 3BVUA 2P5WD 1HE8A 4GUCA 1JK8A 2QVFB 4BXVA 2MIZA 4PJ8D 4JFDA 1IC7L 4X4XA 2V2TA 3ULUH 3B9VA 2HG0A 3DPBA 5CS7A 4F8TA 2CRYA 2VLKD 3A22A 3O9WC 2OJEA 5ALBH 3ZRCC 4EKJA 2BFVH 3U1QA 3MRFA 1ZLVH 5HI4D 4NS0A 4XMPH 3C5ZC 4BJLA 1P4IL 1KY6A 1IIKA 4B6ZA 3VW3L 1EWHA 4Q9QL 5EUOA 1IAMA 4FNSA 5E2VL 3LPPA 3RA7L 1Y07A 3VUAA 3REWB 1I3UA 4DP9X 4XVJH 1CXKA 3V79C 4GG6A 4UCFA 5E56A 5C6TH 1OHQA 3BVWA 1F4HA 1NQBA 4A7GA 1R33A 1CI5A 3EFFB 2PWGA 2DQGL 4HD5A 1F58L 1W15A 2ZXCA 2LAGB 1JK9B 5J3HD 3ARYA 3CVIH 3KHOA 4M4RB 3T0EC 1WBXB 3VD2A 5KW9L 2F53A 2NY4B 2IXQA 3BT2L 2YQGA 1QLRA 1CGXA 4HKBA 4UILH 4HUCA 43C9B 2ESVE 4DO6A 1JGVH 2YEZA 3CFCL 4NENA 5EZLB 3DOSA 5CMAB 4FRWA 4JZJC 2CKNA 2WYZA 2NZ1A 2VQ1B 5KSVB 2CG9X 4QHUB 1QHQA 4BV1A 4X4ZA 2ZPKL 2DM2A 3IS0X 1U9KA 1YYLL 1JPSH 2FECI 1YNKL 1IFHH 2P52A 2Y6SD 4TSCH 3ELQA 1C12B 2Z4QB 2Y1ZA 2BHZA 4BSWA 1Q90A 2ZUQC 3R1GL 2EXSA 4PLOB 4HIIA 4YJZL 5I17A 3DETD 4G7YH 5AZUA 3DRTB 4L3CA 4W9DC 2IFFH 2H1LM 2OQJA 3QUKB 4LLUB 1IE4A 5F96L 4WFGD 4XE5B 4G2AA 4XXDB 2R4RL 4NC2B 2B16A 4APQC 2NLJB 2P5EE 1T5WA 3CBKB 4PJIF 1C5BL 4P5MB 3DO4A 1D9KB 3PWUB 4LPXA 3ZE2F 1XWVA 4JPKH 4JLRA 5J9PB 4J8QA 2DWXA 2XLLA 4LU5L 3MX0B 4HJGA 3QORD 3ATFA 4M1CC 2Z0UA 3T9WA 2NTSP 3V4UL 5T1LB 2XRAH 4AVIA 1TVHB 2Y7MA 2APVA 3O0LA 1HHHA 1D5XB 1U8CB 4UMSA 4TF4A 3FO2B 4MS8D 1DQML 3QIUA 1IM9D 4NFBA 4GI9A 3JT2A 5DHDA 4X50A 4F33B 5C6WH 3H42L 4HXAL 1P5UA 4ONGL 5EFIB 4W9EC 4LDLB 5KSAA 3BAKA 2JIXB 1BVKA 4P2RD 2HAZA 4YXLL 3HE6A 4PREA 1USQA 5B1AB 1O7DC 3SDXE 3WN5C 2FX7L 2B1HH 2EE6A 5AB2A 3QEQD 2WN2A 3CDZA 1T04A 4YZWA 1AYRA 2GHZA 2Q3AA 4NO3A 5AW5B 1NL0H 2R2HA 2XN1A 1L7TH 1NGXA 1MI5D 3BEWB 3CWGA 3VFUA 5FYJL 1ZD6A 3GSWB 3SDDD 2BZ7A 1GSMA 2WIMA 1JF1B 5D7LE 2KS0A 4LIQL 1RMFL 3LRSA 1E5CA 3SKJL 4MLSA 3V4VH 1DVYA 1E7VA 3UZEA 2WK2A 3B3IA 3ZHDA 1AY1H 5CUSL 4MJID 2YPLB 3L4TA 3MRDA 4PP2A 5EBWB 5CCJA 8PAZA 1MEXH 1CFVL 2WUCL 5EC2A 1CL7L 4BQCA 2IAMC 1Q38A 3HPLA 3P3TA 35C8L 3CLWA 1HIML 3GMRA 2DYSB 3NPSB 3VG9C 4R97B 4CUCA 4PR5A 1X5MA 1MHPL 1A7PH 5DWUL 2ENQA 5EMYA 1C5DB 3DROA 4JN1H 3GSXA 3GSNH 3FRPB 1NAMB 3WO4C 5I15H 4PS7A 5I1DB 4P4KB 1A6AA 2EO7A 4MD4A 3REVB 2VISA 1HE7A 1X5GA 1ZT4A 4PMEA 4RGND 2COQA 3U0TA 4DGVH 3P4MA 3K6SB 3TFKD 3NFPB 3QZWG 3AB0C 2GT9B 1V10A 3RIAK 1CD9B 1RZQA 3RWJA 1DL7H 4PTTB 2X05A 3UX9B 2DMBA 3E1F1 2D4DA 4XNUL 2BNRE 5KVGE 5JIDA 4GXUN 5IV2B 3GQFA 1S9YA 3U0PA 1Z66A 2CNZA 3ZN6A 5IB4B 3SEPA 4QEGA 2V6HA 3UZVA 3ZHKA 4L8BB 4U6TA 2MNUA 3ARFC 5DJ8B 4HIEB 1UT2A 3GKZA 3EYQD 1W0YT 3KWXA 3ZKSD 1IAKB 3CFEB 4Z7AA 1KPUA 1JGDB 2ZKXA 5EUOF 5AD0B 5I8OL 2FNBA 2YGQA 5EU6B 3UACA 1XB6A 4FOMA 1MJ7L 4J23A 4GG6F 3W39B 3DX9B 4JCLA 3FT4B 2J44A 3HBGA 4OCSH 2ROYA 4QXGL 4A7GF 4JB9L 4DFHA 2OLDA 2JB5H 1DDTA 1LE5A 5IFAL 3NCWA 1YEGL 3A6CH 3AT0A 5GHWL 4GW1B 3QHZH 4HGWA 4WUUA 1GW0A 4XI5C 2Y7NA 1DZ0A 3MNVA 3T65A 1IBDA 4X5PA 5I82A 1UUSA 1HKLH 5KVDH 1SY6L 2X41A 3HAEG 1Q9LA 1KTDA 4L1HA 3GBML 5HDQH 4Y2NA 3TO4C 1IX2A 2WTRB 2YD8A 4RZCB 2ALWA 1UTDA 3IBOA 1CDYA 3RY4A 2XN2A 3VI4A 2CUHA 1IFGA 5GRJL 1YQ2A 2MWCA 1EEQA 2F54E 2Y0SA 4KK9D 3U9UB 2PCXA 4DETA 5JQHC 4R0LB 4NLAA 1FP5A 4GAJH 3BKCL 2F18A 4N8CH 3UCRA 1F3JA 1FH5H 1O0VA 2Q0ZX 4R7LA 3ZDYE 4WI8A 2XPZA 3E0GA 5IUCA 1RZ7H 1CF8L 2OMZB 4XBEL 5T3ZH 1CPUA 5J6HA 3MRHB 4FKKA 3VB8A 3FTZA 1XMWA 3RL2A 3BLKA 4X9IA 5DI8B 3V7AG 3WFDL 1MCBA 2QTVA 4NM8L 3FFDB 4ZOBA 2IBGA 3FCUB 1G1KA 2LU5A 1SNRA 2EACA 4RMTA 4RH4A 2DQCH 4X6FA 3VRIA 5L8LB 3SPHA 1ZV5A 3CLEH 4NJAH 1NBZA 4C4KT 1OAZL 4G9DA 2HX7A 3EO1B 4G6KH 3C5SA 2XDHA 2WBXA 2Y22A 2IJ0C 3S4SG 5IMMA 5C0BD 1AC0A 5I1JH 5I6XC 1NCGA 1JPEA 2K70A 5FHBH 3VWJD 2J56A 3MREB 4M1DH 2WLNA 4HPYL 4PJ8C 1TITA 3S5LG 3ZT5A 4AITA 3QJHA 4FQ2H 3SYQA 2ZUUA 2ADJA 4TVPD 4JANA 1JOIA 1SXZA 4FJZA 4R4FL 1E5YA 5AVYB 2GIMA 5HI4C 3OD3A 4NZJA 4NKDA 2LTQB 2VDPH 5EU4B 2KPNA 4R2GB 3D07A 4L8DB 1D5MA 4R84A 4HQQL 2VXSH 3BZ4A 5GS0L 1PBYA 2BRRH 4OZFA 4RQQB 5D4QA 4PJBA 3FU3A 5CZVH 4FA7B 1I9IL 2XVGA 3NK4A 3QXTA 2E59A 4O51A 3L9EA 3RDTD 5J3HC 3ZMEA 1VHPA 3QIBA 1QP1A 1IC0A 4QRRB 4ADJA 4G6JH 3RWIA 3NCMA 5JOEA 4PGJA 1U93A 4NZFA 1RH8A 4KI5F 1CD1B 2RIKA 1ZJAA 4PJCF 4QTHB 3QCTH 3T2NH 3GBNL 4R90L 1OP5K 5IZ7A 5KYYA 4JFDD 2W65A 4EPSA 3S5YA 1TQTA 1TOXA 5ID1B 2C26A 1U3NA 4OH2A 1J8HB 5H35A 2GFBB 2N0KA 3FT3A 4LAQH 1C7TA 1YEIL 1JMZA 2WOYA 5JPMA 2P24A 4NXKA 3S8GB 4J1UA 1A8ZA 1QFUH 4FLOA 4I7ZC 3DETC 4XT1C 4YGAB 5GZOA 3OMZA 4RMSA 2FL5B 2RTTA 4LFHD 3LKPA 4KKRA 3CU1A 2HFTA 1MW1A 3G6DL 2XWZA 3NIGE 4C4KO 1OF2B 4O58H 4FNPA 2VDOB 5I1LA 4IKIA 1BAWA 1N64H 1YG9A 3L3GB 3VTAA 1T1WB 5IWLC 1BZ9A 1YN6A 3ARUA 1ZK9A 5FO2A 3CVHH 2LU3A 1H6EA 4J6RL 4M48H 2H2PD 4Y5VC 3HZYB 2OMBA 4OLEA 3U7YL 1GXEA 3MACH 1KENH 5DZVA 4KMLB 4OIAA 1IB5A 3QORC 1M7IA 1JZ6A 1MIEL 2XPYA 2BVPA 3IVKA 4GMTL 4PCSA 5EIIG 4JGUA 1SF5A 1KPVA 3CK0L 3PQYA 5B38B 2NW3B 4I1PA 5I1EH 4HAFA 1HXMA 5HHPA 4MS8C 3WTTA 5FWQA 3RLSA 5I0ZA 4HCGA 4N2IA 2GTZA 1T0PB 1W6LA 2CUAA 1DFXA 3VJ6B 3BZDA 3FTGA 2NY3B 4LCWB 1DEEB 1MHCA 1U8PB 5DYOB 3SKUD 3MBEA 1UZGA 1VZGA 1HS6A 1YNTA 2DWTA 3CNKA 3N2JA 2CPCA 5EOTB 3NEEA 3QYMA 3DV4A 4LLWA 3KHQA 1VRSA 2J8UE 4P23A 1NUGA 1FYTE 5LN8A 1CJYA 4RAHA 3SDDC 4MA8H 3Q2NA 3WHXA 3SGEH 2IG2L 1NCAH 2F58L 2AANA 4XX1G 3VI4F 5HJ3A 3RZCB 3GMMB 1R3HB 1FFNB 3IBEA 1MCWM 1JPGA 2FEJA 2V7NA 1DUYA 3GRWL 3D9AH 2CIKA 4QF1B 3B9KB 4UZSA 1S7QB 4Y1AB 1LP9E 3QIUD 4ATTA 1OTSD 2Z92A 5JHDB 3TIEA 3I75B 3CPUA 1QTYT 1VZIA 3GGWB 2XWJB 3V7AE 3MV9B 4QGYA 1KBGH 5KSAD 4NERA 5F7WC 2WLLA 5E99H 4OI7A 5JPNB 2FECL 3HE6D 5A2CA 1UB5B 1F4XH 3IDMA 4ZQKA 3RVVD 3TFKC 3OGCB 4RMQA 3HI6L 1NC4B 3O4LB 3GJEA 3OMAB 3ASWA 1KIQB 4M5ZL 3U83A 5B21A 1WZLA 1JHKH 4FTVE 3QO0B 1A1MA 3GLZA 3ROLB 1ASQA 3F6IA 1T0MA 1UATA 4QYOB 5K1NA 2P49B 4LARH 2CM6A 1PG7X 1U8HB 2AI0L 3TONA 4W4OA 4XPGH 2X88A 3DYMA 1G1OA 3EYQC 2YGOA 3D2UA 2OK0H 5E8OA 4XVSH 3HEIB 5C0GA 1XF2B 5MEOA 4H88H 1HI6B 3B1TA 3ISWA 4EN3A 5JQIB 3VRLE 2VE6B 4JPWH 1VGKA 1T22B 4PWFA 4U1SA 5CD3B 5IHZB 3ESNA 5DC4B 4U1KA 4ZX3A 4Q7DA 2BOBB 4CMHC 1FNHA 4PJBF 5FA3A 5GIRB 1UEMA 3CPLA 3EUDA 4UT6A 2GSIB 1T5KA 3DKHA 3O6LH 2X3CA 4DIXA 2CO7A 2K0RA 2B08A 4XCEA 1UJ3C 4N20A 4OF5A 2HFEA 2YRZA 3AWFA 4KXZH 4R4BA 3VD9A 4D9QE 4GRLB 3PABB 4BIKA 3D52A 2OMXA 1KGUA 1U6AL 4GBXC 3KM2A 1JWSA 2ZG2A 2J5LC 3DO7B 3B5HA 3V4PA 2BP3A 4Y5YB 3F3HA 2YBGA 1ZE3C 1P9MA 1J0YA 3WNLA 3D69A 2F7PA 2E8YA 3P30H 5GRXG 5GRZA 1YLBB 3DVGA 5JOPD 3MCG1 3RB7A 1Q9OB 3KGUA 3FB7A 4Z7VA 4KK9C 3ILDA 4JO3H 3ECWA 4X8JA 2NCMA 1TPXC 4A7UA 3E9TA 5CSGA 2XYBA 1G7QB 4DN4H 1C1EH 2DBLL 1YMME 3FRPG 1SOKA 3IJ8A 2UZXB 3BKYL 4XP1H 1BF8A 2VDKL 3F85A 5C9JB 1MFMA 2ZX5A 4PGBA 3LZPA 5GGTH 4XNYL 4MSWB 5SX5K 3RU8H 4ZUWB 4O00A 4R9HA 2VZUA 4ODWA 2LLGA 3QO1A 3RX5A 1AE6L 2QQNL 3IETB 1T2XA 2ADFH 2VXUH 1P84J 4WUUD 1L4IA 5C0AE 2IH1B 4QCIB 4Z7NF 4G3YH 3RNKA 3AXLA 5IMLA 4JKMA 3MOBH 3PAUA 4RNRB 5DJYB 2R0ZL 2YA0A 4F9LA 4B0MM 5BCAA 4ETQA 4U4BA 3L95A 1L3WA 2E7HA 5BV7C 1RK0A 4R5XA 3MXVL 3QCUL 3VWJC 4HOWA 3SDYL 1JG9A 4Z23A 1FL6A 4QHNA 2EEBA 1JGUH 4JAMB 1LO0H 3PV7A 4GMSL 3FH7A 3IB4A 1BWWA 2PW1A 4KRPC 3TV8A 3TBSA 1LD9A 4NIYE 3JTTA 4PB0L 3F7QA 5LWYH 3KR3H 1QO3A 3HC3L 3H6AA 4YE4L 1JI2A 1CMOA 1VPOL 2FB4H 2YGVA 3MRKA 3PHOA 4Y7OC 4YLBA 1YNTF 1FGVL 3E6HA 3F84A 1FZMB 3K81A 2K4AA 4O5LL 5GGRA 1BV8A 3GPEA 5I30H 2WVSA 4Z7WA 2NX5E 2DQ6A 4LL9A 1YEFL 2MHAB 3VXPA 3RDTC 3BW9B 4JFWA 4WU7A 3VACA 4TXVB 1HHJB 3FFCE 4U2YA 4HFUH 2A4ZA 1S5HB 4N90D 5BV7H 1RUML 2CBOA 3TGXA 3NA9L 4NNXA 4N0YH 1PKQB 4FL4C 1CGSH 4FHBD 3ULVF 3U30B 3MJ6A 4TPRH 1A6UH 3FTYA 3EGDA 5F7DB 2CGYA 1M3JA 1CXFA 4PY7B 4TVPH 3TC9A 2FHBA 4GG8A 1BQRA 3VDAA 3AG1B 1IC1A 3ME0B 4Q89A 4HF5L 4U6HA 2JI1A 4YH6A 1PL3A 4PG9B 1NGQH 3VXOA 2JJTA 5I5IA 2IWFA 2BS9A 3RWEA 5DJ6A 4HUWB 1KTLA 1I7TA 1JGIA 2QZ5A 2WKGA 2ZOKA 2I26N 4H2CA 5F3BB 2VKXA 2IO5A 3L9RB 3NUKA 3QIBD 4PRAA 3Q2LA 3V55A 1Q0YL 2HFFB 2FQFA 3SPJA 4NPYA 4NP4L 3D5OF 4UTBL 4JKWA 3TOPA 2WZPA 4E5XB 3SO3B 4OQTL 3PJSB 1Q1JH 1LQSR 2NT0A 3P40A 2H2PC 4OGYH 3H9ZA 4NQEB 3MLVH 3VGFA 3NCXA 2VJ8A 3UOAB 4NI3A 2VW4A 2FO4B 3X3GH 4HPHA 7CGTA 2HRHA 4URTB 4NQCE 4U0RB 1CDUA 4M7KL 3A0OA 1UKSA 4MXVE 4YHMH 2XQBH 5D7JA 4L5FE 3TXAA 1QBML 1T0NA 4PJAE 3Q05A 4RWYL 1WAAF 1MHHA 1QYGL 5GZOD 4L8SB 4LSRH 2OI9C 4XXCA 3K2UH 4G7QB 3TYFB 3T0DA 3GSRA 4HG4J 3C8KB 1YJDC 1MCOH 1UWEL 2HRGA 3HS0A 1FIGH 2X7LA 2G4EA 1G0XA 3MRRB 4L2YA 4OSUL 4WRLA 5SWQA 2HWZH 2VW7A 1L7IH 1ZHBB 2KQMA 3BAIA 4GKSA 2FR4A 3GPSA 4MMZB 4CW1B 3MRBA 2Y2TA 1JNNH 3QEHB 3EJTA 2VH5L 1MI5B 2EXYD 2HMID 4JHWL 4L9DA 4F58L 1TMQA 1QFWL 3MLTA 2PYEE 4MJ5A 5IB3B 2FGWH 5L4IA 4JRWA 3KYOB 3NDYE 4YHYB 4Z7VF 3KBHE 5I9QB 3WIIL 4PGCA 2G60H 3PQYD 5HHNB 3CMGA 4QOKE 1UB6B 3HG1A 4U49A 1GR7A 1ZVHA 4YNYB 1U4EA 1ZGLM 1VEPA 3QIUC 1N10A 1OTSC 5A2AA 3D0LA 2EE0A 4Y2OB 1ED3B 1G7IB 2EYSB 4QRPE 3ABMB 3H8NA 5KSAC 2O6DA 4OLYH 1FLRL 4IEFA 1NAML 4ZUTB 4GXUM 3FU0A 3IPBA 4WI3A 3HE6C 3DC0A 4AGNA 2E27H 3OKLB 1YJDH 2YMOA 4NPKA 4BSJA 4WHTB 3ZTJH 3KJ6H 1ACCA 3RVVC 4RGNB 3GMLB 1NKOA 3CFNA 5DYFA 4P23D 2ZCKH 4AKOA 5F7YC 2GI0A 4W9LC 3FQXA 1I7RA 4X6DB 4YSTA 4YVUA 2DQMA 1WK0A 3FHQA 3NCFB 1MUJA 5IMKB 4LL4A 4TUJB 3OG6B 2OMUA 3UZEC 3V5HA 3VGAB 2DKMA 1CBVL 3RIFK 4KY1H 3L3OB 2D0HA 4G1EA 4J7RA 3QE5A 3ULVD 1SLVA 5IOPB 1VADB 1NBVH 4U3XA 3ESOA 3H3KA 5EU6E 4BH7A 4ZT1A 3GZKA 2BOCA 3P9LB 5B38G 2WB1A 1A4JB 3MJ8B 4NZRL 3JV0A 5C0IA 5AW2B 3FUNA 4FXKA 4S1QL 4K5NA 4UOQA 4LASH 1KJMB 3UBFA 1EAPA 4LOEA 1JZ4A 2DDQL 3QRFM 5HGHB 1UKQA 3D4GA 2LU7A 2HKFH 1D5BA 4Z7WF 4XNXH 3CVDA 5CCKL 4E9SA 1TLKA 3SYOA 1MRDH 4XXWA 4AEEA 3IAPA 5IB2B 5EBLA 5TJWK 2XN9B 3ZMNA 3PWLA 4XNQB 1T2QL 4HIQA 4JDEA 4XP4H 3TWCH 4JKPH 3U7AA 1MCRA 1MFEL 3ULUE 4PJIB 4GUOA 2DI9A 3DJTA 2GABA 4YPGB 5BVPH 1T7XA 3D2UD 1JZDC 1Z5LA 4PRPE 2GYSA 5K69A 2CUMA 3ULUL 1MZYA 1QFHA 4EN3D 3QCVH 5C0CE 1YPZA 5J13B 1EPFA 2F5BL 3KNBB 4ZUVB 3TX4A 2YK1H 4MYPA 1CZ8L 4JO1H 2C4XA 4UUJA 3DJSA 4XMPL 2F8XC 2VDRH 2JELH 4L1BA 2QEJA 3HTLX 3F62A 3VSTA 4ONFH 1QPKA 1EANA 1AGBA 3FMGL 1NGWB 2GIXA 5JHLA 4IBYA 1FSKB 4RFNB 4PIBA 4KJQD 1UUNA 4EDXB 4BE6A 5DRNB 2WLHA 2GJZA 3Q5YA 2OSYA 1KULA 3CVIL 3FU8A 2A1WL 2QKIA 1FVCA 2CU9A 3QAZB 1HSAA 5LGJA 1OTTD 2DMKA 3A4AA 3BVXA 4XWGH 3GO1H 5E6YA 2EIEA 5LQBH 3EG9B 3MRIB 3HNTH 2V5YA 4JUSA 5JOFA 2BDNH 3OR6A 3RWDB 2HT2D 4X0KB 5TQ0H 3QDGA 2NW2A 3I74A 3EOBA 4KUZH 1KZQA 2NNAB 5GPRA 2VWEC 3W57A 2YMXL 1FZKA 1WC7B 1RK1B 4BSVB 4TSCL 1GY2A 2VXVH 4KJYB 5HHMB 1Q0XH 3U4BL 4M02A 1N0LA 2NMSA 3PDOA 4MCYA 4PBDA 4BFEA 5D5MB 3FB6A 4HS8H 2CH8A 1ZK5A 3G04A 5F97E 3T0EE 5L4MA 2HRPH 4XPFH 4FQ1H 2XUWA 1M1SA 4OCYL 2R1YA 4HYTB 2XXGA 1EDHA 1WHOA 3APMA 2Q6WB 1UD3A 4WO4B 3WL9A 4Q0XH 4HALA 3KPRB 3KPMB 1FVEB 4AV5A 4JRFA 1JPST 1NLDL 4NP9A 3LNHA 1FRGL 5KZCD 2GEQA 4OCRL 3TZVA 4JPKL 1GJWA 1IAOB 4MCZA 4OCLC 1I9EA 5FEBA 5F7MC 1MFCH 3QBTB 4X5XB 1FBIL 2P26A 4N87A 1GC1L 2Q76A 1PG7H 1NDGB 3GEWB 1GRWA 4LLVB 4XZUB 3C08L 4AI7A 4I48B 3GJFB 2WVVB 5FXCH 3VYOA 4AW4A 3CUPA 4U33A 1DLHA 4ZTOH 2PTTB 4DH2A 1IBBA 4CN1A 3R06A 2EE2A 1DO5A 4H8PA 2G75B 4B9CA 1LE9B 4KVPA 1BMWA 3OSKA 4TSBH 3SE9H 3MR9B 1PZAA 2C9VA 3QXAB 2B1HL 2VDOL 2R1XB 3L5HA 5KAQG 4WW2F 1YN7A 5BOPA 2EH7H 5L2KE 1XH2A 5IBTH 2RD0A 2A9ML 1L7TL 2PCFB 4N3TA 1NPJA 1L9PA 1ML0A 1SYVB 4ERSH 1BDYA 2HVBA 4L0ZA 2WV3A 5IROA 3LXBA 1JP5A 4P2YA 4NFCA 3V4VL 4HXBL 3MRGA 3TNNA 3EO0B 4AGOA 4GSXA 3V9FA 3DIFB 3E6FB 3WEXB 5ECJE 2HVJB 4D2NA 2R0WH 4N86A 1GPOH 2VDNH 1AIFA 4I9WD 4OFDA 1P4LB 4LEXH 4BQ9A 3AWGA 3CMOL 1G7PB 1H6TA 2NY2C 1O7DE 1L9MA 4HOXA 1FLTX 3ZY7A 1OAKL 2ENYA 2Y2YA 1E4XH 4ICXA 4OZFH 3BXNA 5KYUA 3FW6A 5IG7B 5EN2B 3LEXA 1VKXB 3GM0A 2DW5A 3QNXA 2H3NA 3CFUA 3ARDA 2MCPH 4CJ0A 2XC8A 3OJDA 5HD8D 2DAVA 4ODXB 1PX3A 3PGDA 2WZPD 1CQKA 4BGDA 3U2SB 4QLWA 4NJ9L 1AGDB 1E6OL 2RGSA 1IARB 3SYPA 1RJYB 2ZKHH 4P3CL 2KKQA 4X4KA 2B59A 2HMIC 4TRPL 1MOEA 3P2DA 2E9BA 2QDWA 2D31B 3QWQB 4HEPA 3CZNA 1YC7A 4N5ED 5BUPA 3L4VA 4JRXA 1YPZF 1XHHA 4JO2H 4AOFA 3KD4A 3RWHB 5BVJA 1Q1PA 1X9RA 5DUPL 1KXTB 1XIWB 4OZGF 1F6LL 2E9WA 5D7JD 3IJHB 2CO1A 5IB1A 1I9JH 3N9GH 3SDCA 2UX6A 3RGHA 4IQHA 2N0MA 5IW6A 1P5UB 2BZCA 4AV0A 4LCCA 2F19H 4AGQA 3Q8EA 4NNPH 5EO1B 5MEQA 4ODHL 1FIEA 2IH3A 2DWEA 2VJ0A 3PS6A 2F7OA 3LZNA 3MBEC 3KJ4B 5F7BA 2Q10A 2DYPA 4P23C 4Y16A 4YS4A 2OTWB 1ZLWK 4E5XG 4KZEH 4B9GA 3UTTE 1UXSB 3QJOA 5E8NB 1E8YA 4EDWL 1F1GA 4JE0A 5JR1H 1HX0A 1Q9KB 3CFJB 3JZ7A 2YXMA 4PRBA 2J72A 1LWHA 4PJCB 3FN9A 2GBAA 1P1ZB 3ULVC 3HG1D 1KNOA 3IDJA 5EC2B 2DI7A 3WXWH 1JWMB 2GJ6B 2W0KA 4K7PY 5C0RH 4TQEH 1ORQB 2DLEA 3BCFA 5T3ZE 4MD0B 4BKLA 3FU9A 5GXBB 2YS4A 3LY6A 2VCOA 1FH5L 3FCSB 1WE5A 4PWGA 1A7RH 3L45A 1RZ7L 3VXRA 1FDLH 3HLKA 4LHUB 2WQ8A 4IKJA 3PP3K 2ICCA 3FO9A 1TEYA 3H54A 3VFMA 4JZOB 2CJ3A 1NFDE 4PHZA 5BZWA 3X1BA 1JDCA 1OV8A 3S3SA 2ZUYA 3O3DB 1IC4L 1U8NB 2AXGA 3CLEL 4NZDA 2BSTB 5LXVA 1HC1A 1RAMA 5KYNA 1DUZB 4HIPA 1HL8A 4W4OC 1UA6L 1V7MH 4ZSOE 3MCYA 1J1XH 3ERXA 2YAOA 2K6YA 3EFDL 2J1WA 3ULVH 2FSEB 5JLZA 1NLBL 1QBLL 1ZLEA 4PJHF 2EEDA 2OFQA 4ODVH 4EN3C 4OLVL 5JHAA 2AHIA 2IBZX 3E3QE 4RAUA 3S2CA 5ISZA 2JTYA 3N1GC 3UJIH 4Y9BA 1RUAL 4W68A 3DV6B 4RRPA 1A6ZA 2DJ4A 1J05A 1KG0A 2JVUA 2Y07L 4MAUH 4YGVA 1XGPA 5DQ9B 4Z3IA 3HMXL 2K7PA 1K6QL 2PKDA 3H0TB 1U3JA 2JF1A 1K72A 3IJSB 1XSIA 2A6JA 2DI8A 2NY6D 2VXSL 4H2AA 2CCLA 5D4IA 1QQDB 1UXLA 5DLML 4OIFA 2FK9A 1UYWL 1Z9SB 5CZVL 4KK5D 2V2WB 4HWNA 3MNVB 2P5WE 1E9OA 4Y4KA 4EXPX 3K6DA 1XGYL 3G3LA 3RP1A 5A6MA 2IGFH 2YZ8A 3U79A 2OP4L 1BFOA 4DOHB 3GXFA 1AQKL 1OTTC 2J1KA 2XZZA 1T1XA 4ZOCA 3BKML 1P9MC 2VLKE 3OKEB 2YPVL 4X6EB 5DZOA 1BYNA 4J3OG 1DYZA 5MEPB 1OW0A 4JPVH 4NO0B 1A8JH 4P49A 3V0VA 2P80A 4LAQL 4ZJ9A 4AIZB 5DUJA 5HHVH 3W3BA 3S35X 3KYAA 1VACB 3HI5L 3NCBB 3DTDA 1WAEA 2XY2A 3S98A 4DW2H 1QFUL 1BFTA 4UT6H 3CSYA 1DE4B 3GXNA 1N6QH 5DDHA 2ZKMX 3L3IB 1G9NL 4OZ4A 2ITCA 5FECA 3L4WA 3QR1A 4FQLL 3UPAA 5BZDB 4MD5A 2R9HD 3Q8BA 4XNAA 3OAYH 3ECBA 3NK3A 3OPUA 4S1RL 3D3VA 3WFZA 4F9LC 2GJRA 1HH6A 3OKKA 3M6DA 5ADPH 1MKFA 2WXKA 3FU6A 1Z3GL 3FO0H 2AABL 1IQDA 5HYIA 3RL1A 5GJSH 3ES6A 1JUFB 2EDMA 4N0UE 3V4PH 5AVZB 1S6NA 1UFGA 1AI1L 3HB3C 3D51A 2R15A 3IWUA 3DBXA 2EYTA 4TTDD 4WFHD 1N68A 4Q56A 2XX1A 3FZUD 4K3HA 3IU4H 1NEPA 4NO2A 3QIWB 2CXGA 3QDGD 5AWNL 1AQ8A 3MA7A 1H6FA 2VIRA 3LMJL 4K0OA 1JZFA 2DQDH 5EC1A 4KXAA 4AT6A 1SXSA 3CIQA 4FA8A 1ZLWH 4NRXA 4S1SL 4WFGE 1OQXA 1F8TH 1YEKL 2HFGH 2CGZA 2QHLA 4H13C 2WLIB 4X98B 1N8OE 1U91A 4U2ZA 4G82A 3WNKA 2FBJL 3DRQB 4KDVA 3UPRA 2AXFA 1W8OA 3CTTA 3L3HB 1UXWA 1HU8A 4IRSB 3RVUD 3DK2A 2AJXL 3IDIB 5D1XA 3HKFA 1UCBH 1XCTA 2E3VA 3E2HC 1FG9C 1KSRA 2MOQA 3QUXA 5ENWA 4BUHA 5DVLA 1BOYA 3LDBC 5GGUB 3QQ9D 1D7BA 1A22B 2DQHL 3E1ZA 5SWSA 2BY0A 5J6GA 3TZVD 4N4YB 5FW8A 2UY7B 1WZ1L 1MG2C 1DJZA 4ZQTA 3L4ZA 1RERA 3UROR 1SRDA 3PP3H 4BYHA 5J1TC 2A77L 4NKQB 3MLUL 4JY4B 1FGNH 3QEGL 4XN2A 1HVXA 3VQMA 2JJTC 4H26B 4YDNA 1FV1A 4P2RE 3MUGB 3UXFA 5JPMB 1AHMA 4LVOC 2APXA 2F68X 3WFBL 1P7KB 5BQ7A 4LSPH 1GOHA 5DJAB 3UTPD 3WDJA 1S7TB 2C3VB 3QEQE 4A66A 4F1SA 3QFGA 3ARGB 5GRVK 5I0YA 3HBZA 5I18H 2RAMA 1MI5E 1CXHA 3AABA 5EULV 5FFOA 2X4QB 4TNWK 5HD8C 1WIPA 4ODUA 5JIPA 1OAJA 3H9YA 4Q14A 1JHKL 3UIZA 1KTJA 1XTLA 2XFXA 5IROD 3MRLB 3P9WB 3Q06A 4MJIE 2X0WA 4L4VB 2F74A 4ZZFA 5IW1B 3GK8H 3MCLH 4N5EC 2YRPA 1N0XH 2QHRL 5ALCH 4LT7A 5E8EB 3LZOA 3F6LA 5ILTL 1UEYA 3U36A 1KEGL 1CFNB 4N2DA 1BQUA 2YAMA 5DC9B 4NQVA 5D7JC 1CFQB 1FZJB 1OSPL 5CILL 4JPWL 4UTAL 2ITFA 3BIKB 1WIUA 3OB8A 1EJ6A 1PIGA 3N44F 1ETZB 4JY6B 4RGNE 4XXCC 1FNGA 5CAYB 4P5TB 3NZ8A 1UD4A 3HS0C 4F7CA 2YKLH 2E56A 3K4DA 1YNTB 4PJ6A 4W9IC 3ARDD 4K23H 5E9DB 1MLCA 3UTZA 3O6LL 2EP6A 3S36H 5F9DC 3AG4B 2Y36L 5B8CB 5I8EA 4B41A 2H8PA 2F61A 1MY5A 2NY0B 1A7QL 2BCMA 1BVNP 4N85A 3CFKB 2WZ5A 4IIQB 1I1RA 4L48A 4PY8I 3LQMA 3FTXA 3BH9B 4JRXD 2CJSA 3FUEA 5I1GH 3F7YB 4F5CA 2JJUA 3SQBA 5EUKA 2V2XA 4X6CF 3IJYB 3P30L 3WFCH 5CIPB 1MLBA 3DARA 5CJ8A 2WANA 2EQDA 5K93A 1JZHA 2XY1A 3BYTA 1F11A 3I85A 5IF0B 1AHWB 1N59B 1IGMH 3SDCD 5LJYH 1KB5A 3SPGA 1O6SB 3KPNB 4FF9A 4GQ9L 3SE8L 3FXIC 4L3FA 2CO6B 2D7QA 1F3DH 4HISA 4MVBD 4HIHA 3P02A 2AK4A 2O5YL 5LAPA 4C54A 1B2YA 4J3WA 2DYPD 4TNVK 4Y16D 4ABVA 1DP0A 3GS0A 1FPTH 3QULA 3GRGA 4MMXA 4RSVA 2VXUL 2IH9A 5I76A 2FZ3B 4OZIE 1T4WA 2BCKA 3A6BH 5HPOA 1MAKA 4PI2A 4R26H 4OLZH 1T0MB 3ZE2E 3B2XA 2W38A 1L3NA 1OKEA 2L7JA 4FXGA 4HMCA 1KLUB 2C9AA 4BZ2A 1MQ8A 4XNZC 4JFQA 2NZIA 2V5TA 3X17A 1UZ6F 5LGHL 5F88A 1AJ7L 5FKPB 1R5IB 5B3JF 3MN8A 4NN5B 1A4KB 3DX1A 3NGBC 4FXKC 3AWEA 1OCRB 4P0DA 2X4TB 4TSAH 5JHMA 1M9WA 5KSBA 1E4XI 3NFSL 3VXRD 2BMKA 1CLCA 3HE7A 1OGAB 4N24A 2MPAH 3ECUA 3KBPA 1OLZA 3PHQB 2BHUA 3D05A 4XXWC 2NY6C 1OIOA 4ZMVA 1R4XA 4FFTA 3VXMB 2CO7B 2Z6FA 3HCVA 2EC9T 5KG9A 3TIDA 5CNHA 4KK5C 1PCXA 1GGYA 5ERWA 4QY8B 3GSQA 4XRCA 3VFVB 3MLSH 4OD2B 5BMFL 5JIHA 5C0BE 3MLYH 1HOCA 2AV7B 1CQYA 3B2VH 1PG7W 3LHAA 2WXQA 4UNUA 4AM0A 5KTEH 3VFTA 5IHUL 5GISH 1IT9H 1RFDH 3V0AC 1G7HB 2XWTA 4HWEH 1QTSA 2DWDB 3KWWB 4TVPE 3PP4H 2NTFB 1KGXA 1RXLA 2R2EB 4DVBB 1DDHA 3SGDI 3B6SA 5ISZD 1PEZA 4P8QA 4CMMA 4MA3B 4JZNA 3VVVA 5IVXA 1HH9A 2AV1B 2VC2B 4AQEA 2WO4A 3GZPA 4K71B 1UWFA 3X1EA 1JSYA 1J48A 4TKWA 3T77B 4LHUG 3MYJB 1M1XA 2GUOB 3CCHA 4W1TA 5D6CA 2JLLA 3OXSB 4CN6A 2OR8A 3CHPA 4M6NL 2NY1D 3OPZL 3RHWK 4LMQE 3L2MA 2NYYD 1AZRA 1GS8A 2CHNA 2ZONA 2DJMA 5C0ND 3QQ3B 4LLQB 2XG5A 4HK3N 2R9HC 5EU5B 4Y4KD 4GW4B 1WZKA 4NQUA 3G7TA 2QKIC 3CSTA 3KH3A 1F4WH 4HUVB 4PB9L 1R3LB 3L4UA 1CICA 1QUNB 2DEWX 4JFDE 2Q86B 4BFKA 2FJHA 2G2RB 3ULSA 4F8NA 5IJKA 1ADQA 3HVNA 1V54B 4S2SA 4U1GC 4NQDA 3PUUA 4LLMA 1KY7A 4FQJL 4GYBA 3QPXH 4TTDC 2DQFA 1JXDA 2Q9OA 3PJNA 5JIIA 2ENSA 1FL6B 7FABH 3K91A 3QZMA 1J87A 3EBAA 1ZLSL 3V6ZA 1X5YA 3GMPA 3J27A 1UA3A 1BZ8A 3O2WH 5TQ2L 5EUOE 2HN7B 1IGIL 4KDWA 3HI1B 3MJWA 7PCYA 4M7JL 4GG6E 1FNSL 3GHBH 1F02I 1MQKL 2EABA 1D3CA 2AGJH 3HR5B 4G8GB 4NAJA 3EJUA 4LSRL 4OF0A 4CDGC 1JZ3A 5EF3A 2F53E 1AXTL 3SJVA 4M61A 4U1HB 3RVUC 1F6AA 1UD2A 3EOAA 3D3VD 3TYGH 2HWZL 4WU7B 1L7IL 3GHEH 1ZT1B 3QEUB 4HJJH 4Q6IB 3ZRFC 1II4E 2ZCZA 2UZYA 4ZI8A 4IBTA 5I1CL 4JE4B 3RI5F 2I60L 1J9QA 2NNFA 5HHQB 1A6TB 1KJ2B 2ZT9C 3QQ9C 2A0LD 3N85H 4PJ9A 4QXWA 4DNLA 2BIIA 3GD1C 4RGMC 3TZVC 4KTEL 2F1BA 1IVTA 4BFFA 4HKXA 3W9DB 1Q9WA 5E1GA 4L2LA 2DV6A 1V8HA 2V33A 1EFXB 4WUKH 5KBPA 3VA6A 5ID0A 2DLFL 1HCZA 4FFZL 4XOCA 3C6SA 3TPUA 2GHWB 3RGBA 1NUDA 2UY6B 1GKEA 1OT2A 4N1HB 3MPCA 4C83A 2CJUH 4GP8B 3BAJA 2WNWA 1BVLB 4QO1B 1I8LA 2WAHA 2GJPA 4G9FA 5D93C 1TZGL 3MROB 3L1EA 3WBDA 4B96A 4ZX6A 4NIKB 4Z1PA 4Y19D 3QDHA 4BKSC 2Z8RA 5D1XD 4PWEA 2ADIA 1EEUA 3QUXD 4RMWA 1MRFL 2FJGA 1KIUA 2HRLA 1Z5YD 2P1YA 5SWSD 4EAEA 3TPKA 1OM9A 2Q1EA 2QADB 5IROC 1NDMA 4B50A 2L3BA 3Q1EA 2BIHA 4FQQA 2ZYRA 4JPQA 1QA9A 1YEEL 3BVDB 3BWAA 4OKVB 5LGYA 1AS7A 4PVMA 5F0PB 3VXTA 5B7FA 1YYCA 1F5WA 5D6DA 1C5CH 1NBVL 3F7KA 3LN4B 5KSBF 2BSRB 3ARPA 3DX8B 4HHAB 5JW4Q 2EH8L 2JCCB 3A3YB 3P4OB 3X11B 3FUFA 4KMTL 4IU3B 3ALWA 2C3WA 5TPWL 1B4JL 4YSRA 4GFTB 5DQDL 3TT1L 5ANHA 4AUUA 1R3JA 1VESA 2CJTA 1R24B 3GSRB 5C0JB 4N2CA 5EWIL 1UM5H 2IV9A 2J1ZA 3FH5A 3ARDC 3S35H 3NEXA 5JIKA 2BP8A 2C9QA 5D7KD 3D4YA 4QRQB 2DS4A 3E8UH 2W9EH 2PPAA 3M1BA 5T1MB 4AG4H 5AB9A 1H3VA 2GTWA 4FLRA 2QSVA 3PIQA 4U0QB 4HZLA 4X6BB 5C08A 1P5VA 3F5WA 3FQWA 4L9LA 1RIUH 2WCPA 1LGVA 1ZMYA 4NN7C 4FQXA 4G42B 1SHWA 2C3GA 5K9JL 4JKPL 2BZDA 1WIOA 4CVUA 2E4FA 4ZDHA 4RBPK 4YBLB 5E1AB 5K39B 2EDXA 3PGFH 2HJLA 1A65A 1INEH 5CEYB 1IGTA 4LQFL 1RUPL 5IVXF 4CKVX 3OF6A 3GS7A 1TR7A 3SDCC 1BSIA 1FORL 3T4YA 4LCCC 4LSQL 5JORB 4DUWA 3CX2A 2AJYL 1TIUA 4OR1A 2VO8A 4PS4L 4MNGB 1HNGA 1N3NB 4MVBC 5IEHA 1YEDB 3VXSB 3LSOB 4JQIL 4EIUA 4ZUSB 4OFPA 4S1DD 3W81A 4EVNB 3LZFL 2O5ZH 3AQYA 4NOBA 4PS3A 2IWKA 2PF6A 5L4FA 5TFSL 2N7AA 1CLYL 4K3JL 4OLXH 1G7JA 2R2BA 3JWOC 4YVNA 3WTSA 5DZ9A 3QA3A 3IFOA 4GUPA 3EF4A 3DUUB 3OG4B 4WW2B 4PBXA 2VJXA 1DQDH 3VNYA 4AY0A 2J6EL 4DTGL 2ICEA 5FR3A 1JHTA 1V27A 3HW7A 1H6UA 4NCC1 5JOPE 5ELIA 5T5NF 3T2LA 1E3FA 2ZYHA 1YMHB 3GUFA 5LCVA 4G1EB 4NNYA 2PN5A 5ANMA 4OM1L 1VF5C 2OMWB 4A7TA 3L4XA 1FAIH 2F1AA 2P48B 4A2EA 5B7EA 2X1WL 1UADC 3MQIA 3DX7A 2PCYA 3C6LB 5IREA 2AJVL 3V5DA 2YAPA 4P2QB 5K9OA 4ZFGL 3TBTB 1UWYA 1WTLA 2AK4D 4PGDB 4WUUE 3QUHA 5JW5A 3OJVC 3CDGB 3OJ2C 4ZUUB 4X9HA 2DJSA 2NXYB 2R4SL 3G5YB 3JWOH 4U1JB 4WCYH 4XPFL 5AOIA 4G8AC 4JDEB 2D73A 1KCVH 4O2EA 3NP4A 3VI4E 4ZMPA 4CGTA 5GRYA 3K80A 5DJ0A 4CKQA 4Q0XL 4NZTH 1TTRA 3DGGB 3QQNA 1RPQA 4H8HA 5AKSA 1JL8A 2OULB 3N41F 1LEKA 4MA1C 3AC0A 3HC4L 1QSEB 2V4LA 2VWEE 3FU7B 4Z3GA 3EAKA 3CXHJ 4FZ8H 4JFOA 2W80C 3AQXA 4NWUH 3ZHNA 25C8H 3X3FL 4OZGB 1DJSA 3GM8A 4E41A 3HE7D 4G5AA 5H2BA 1HHGB 2WMPA 4QTIH 3RZWA 1OP9A 1RZGB 3RTLA 1P6FA 4NFDA 1ODAA 1CFBA 5MENA 2NY1C 3MRPA 2NYYC 4GSDL 4G43A 3H7BB 1TQVA 3THML 1DHKA 4ZFFB 1A7NL 2GIYA 2FUQA 4K7FA 4Y4KC 3SE9L 4PRIB 4N90E 3GLAA 2FIKB 4UT7L 5SWZB 3LVTA 5DS8A 3RWFB 4RISH 1ZLDA 4G71B 3CGTA 3O45B 5IBTL 4YDKH 2IBZY 3POHA 3H9SA 5A16B 4UAHA 3BUDA 1M05B 1RUKH 4AK1A 2F0CA 2BNUB 3ZZQA 4PJFF 1EHLL 2OYLA 1DZBA 2PXYA 1ZIAA 5D9SB 4CC0A 1RULL 1OW0C 1JCVA 5ITBH 3AFLA 4BCYA 2F5AH 4Y4FA 1HDMA 5D1ZA 4RIRB 3DA0A 3OAUL 2JK5B 1CLZL 2R0WL 2YSSB 2ZJSH 3GBEA 3VG0L 3MRMB 3KE0A 4FQCL 1ROWA 3DDGA 3MI6A 5G4MA 4PJBE 1TFPA 1MDAA 1UM4L 1HHIB 4LEXL 4GXFA 5AFAA 3AY2A 1CE1H 3LKOB 4XZ4A 3G6JA 4WWPA 2YD2A 2EXTA 5DJXB 1E4XL 3G04B 3O6FB 4ILDA 4PV9A 1ZTXH 2VDMH 4XBGB 4I5BB 4DEPC 2ATPA 1SDAB 2I9TA 1CICD 5J12B 3NFNB 5KVFH 5I19L 4BH8B 4NQDD 2YUWA 2MMXA 1S9XA 2BNQA 2DKUA 2QSCH 4F7TA 5IQ7H 2A0LC 1BD2A 2XSKA 3KVPA 3GTVA 3J2PA 4M7ZB 5KVEL 2IDCA 4F24A 4MDIA 3QP3A 4MWFA 3OWRA 4CVXA 3STLB 4MNHB 3ZYIA 3HNVH 4JREC 2DH3A 1Q94A 1SJHA 1HHKB 4BQBA 3BHBB 2IALA 3MFFA 4PJHB 3V0FA 4AW7A 3V0DA 5I6KA 2VB5A 1PQZB 3OB0K 3G5VB 3N9GL 3NJFA 3LH9A 4XO4A 5DZPA 2QJDA 3ABZA 1J0IA 2AXHA 3VH8A 3AACA 4TLKA 3RNQB 2YUVA 3KXFB 3SJVD 5B3SB 5F6IB 1UENA 1OARH 1SBBA 4P57A 4Z7NE 4IOFD 2X87A 1L0XA 1PZ5A 4QHMA 1IBGL 3TN0B 4JW3A 5D1XC 2AEIT 1DQKA 2Z93B 2XNAB 2AZUA 4I0PB 5EO0B 3JXAA 3MV8B 4F15B 4UOJA 3KPTA 4TS6A 3QUXC 4XP9H 1NFIB 1AMYA 1M7DB 3B83A 3U7WL 3LKSB 3EBHA 4PG2A 1J5OH 5E94B 1AR1B 1C16A 1X4XA 4X7TB 3QDMA 1JNHA 5JR1L 1AP2B 1OT4A 3PQYE 4H40A 1QVOB 1YUHA 4A63A 4JM2A 3TNNB 1PZBA 3BC9A 4KHXL 5EPMA 1TCRA 5A2LH 2GK0B 4NN6C 5INCA 1S7WA 4OGXL 4DK3A 4N9GA 4OIBA 1PZ3A 2AEWA 3BAEH 3NRFA 4JDTH 5HDLA 5C3TA 3BO8B 4Y4HC 5C7XL 3L7EB 2XICA 1TG8A 3X14B 3X12B 1DQTA 1U2CA 2P43B 4H25A 2NSXA 2B39A 4DPRA 1BAFH 5IHLB 4DCQB 2JKTM 4UU9A 1DANU 4L3EB 4FDWA 5E2TH 4HK3J 4W6WB 3G08B 2QLYA 4OF6A 3BAYA 5L9DL 5J1AB 3HHMA 2R29L 2CRIA 4JFPA 3BYYA 4U6VL 5LG1A 4QIRA 3WOVA 1KV3A 3WS3A 1CR9L 3L5WA 3FC8A 3V2AR 2Q7AA 5AAMA 3ZYOA 5EOCJ 2B59B 2Y06L 5BJTB 2Y1AA 3ULVE 1S9VA 2NZ9D 5BRZB 4XOEA 3NSCA 2VITB 5CLXA 5ICYB 4FFVD 4APXA 1IC5H 3HZVB 1U92A 1KLGA 1LWJA 2IBBA 5DFVD 1TUPA 2IDUA 1TETH 4JR9H 1U3HB 4X4MA 4YO0B 3GF8A 1GIGH 2CO4A 3IDXL 3POCA 5D2NA 2BXZA 5DF0A 1RI8A 4NO5A 2AITA 3EKCA 4FNLL 4HLZG 3NCCB 4HU8A 3N91A 2IQAB 2FIRT 4JFSA 1D6VL 1L0QA 2XZCL 4S1DC 3T1WA 2K6ZA 3NN8A 5DA4A 1F1DA 2GY7B 4GT0A 4IJ3C 4Y16B 1W0VA 3BRDA 5C08D 4X5RA 4YHZH 1T3FB 2GG1A 3F7VB 4DP4X 4FQXD 4ZAKB 3ZE0F 3P73B 1KTBA 4PWKA 3T3PE 3RFRA 3TM6A 2PETA 1FA4A 1JN6A 2IOIA 1OXYA 1OE2A 2R0KH 4LNRA 3UBXB 1JVLA 5G4NA 4G6AD 3VA2C 1CTMA 3QPKA 3OF6D 1ZHLA 4IOIB 1JHLH 3HJEA 4K3DL 3BZEB 2Y69B 4P48A 2VLJD 3GC3A 1TU2A 4HJEA 1O6TA 4JPVL 1X3DA 3BE1H 1CGYA 1MF2L 3V52H 4L4TA 1MCIA 2JV6A 3BP4B 3G6JF 3F7RA 3FB8B 1TKWB 2FT6A 3IMSA 4K8RD 1HEZB 1WSST 1T21B 4MMXC 4LK4A 1OQOA 1OHZA 3VD3A 3SCMA 1KCLA 3ZL2A 3F05A 3VFPB 4XC1L 1L9RA 3IF1A 3STZB 4KZDL 3FONA 1KIRA 1CVSC 4FXGC 1EXGA 4GW5B 4UQ2B 4OIIH 5E6IB 3FO1B 4JHAH 4PJ5A 5E70A 4Z7VE 4LHJB 4YHPB 1MCJA 3GIVB 1TJXA 2PWFA 4FI6A 3B8SA 3ZDZF 2GVYA 1H0DB 2GTQA 1Y0LA 2A6DA 1UWXK 2DQJH 3GIZL 3VGDA 2YD3A 1WV7T 5JYLA 3KCWA 1MRCH 4XPTL 1KB5H 2CA3A 4OB5L 4CVZA 2LVEA 2Z9TA 2UVEA 3A47A 3HE7C 1Y7VA 5I75C 5IJCC 4WGWB 1B0GA 4BK5A 1WT5A 4YHKL 3LNFA 4XX5A 3CFDA 3AJ7A 1E9PA 3LXUX 1MVUA 3HIZA 1A4BA 3HG2A 4MDJB 1BGXH 3WCYA 3B56A 4BCZA 1TF4A 1KYDA 5KJRH 4OUUA 2V3DA 1UCBL 3F12B 5F6HI 2UZIH 2D7TH 3GNMH 3K72B 3TJEH 4U3SA 5IQ9B 3EYVB 2A9AA 4WNSA 5D8JL 2BOLA 4FAAB 4LDEB 5E4EC 3L7FA 5L0QC 5E24E 3BCDA 1UWGH 1IAIH 4N25A 1QSFB 3OWEA 4ANKA 4XWOD 1UACH 3VFRB 1QNIA 4K3EL 4N2EA 1TVBB 1AXSB 4X6CB 2ZOLA 4E41D 5J0BA 5KYWA 3KCPA 1S9WA 4QGTA 3GLDA 4L4JA 2Z35A 1HQRA 2R59A 5L2JB 4Z7WE 3JBG7 1A1OA 4MX7A 5MEND 4V1DA 4PUBH 4DUXA 4P3DA 5E1QA 3JV4B 4LSPL 2CE6A 5DTFA 1O9WA 3F6JA 4Z18A 3PL6B 4F8QA 5I18L 2ZYIA 1CDBA 3S5ZA 2VN7A 5IJKC 2PMZA 1IQDB 3T8XA 1K5WA 1ZHNB 3RL1B 1JJUA 1BIIA 2Z31B 3H9SD 3AREA 1KJ2L 4K9EL 1IBYA 2JE8A 3D2TA 3T4AB 4CU7A 3DX3A 2WXNA 3UYRH 3S3BB 4J3XA 2APTA 2PXYD 15C8H 1R3IL 3NJIA 3X1NA 4JG0L 5GS1B 3DDFA 2Y72A 4D0BB 4XNMA 3EFOB 3HAEA 4I9WE 3MRQB 2XT1B 4Y4FD 5D1ZD 4HIXH 5L88H 2XWBA 4G11A 3GRWA 4NHUA 5EC1B 2J20A 2EE9A 5ACMA 4KRPB 4YK4C 2H1PH 1I3RA 4NQTA 2VMFA 4PRHB 4UM9A 4X5WA 4Z9KB 1TTAA 3LS5L 1OGTA 2E5EA 3P11L 1MH5B 4KQ0A 2A9NH 4I89A 1FNEA 2MTAA 4MQ7A 5SX4I 5TE6H 2WKOF 3GXMA 4IOFC 4FP8H 2YPKA 1HXKA 5EU7C 4Y19B 4QJ5B 3SQRA 3L9BA 4YDVB 2RA1A 2XXCB 3S36L 5E08H 2OX5B 3EOTH 4CA4A 3KL0A 1XGZA 2BNQD 4PJ9C 1I7UB 1BD2D 3IAQA 1AQDA 5DHEA 5ETUB 3QXDA 1KCSH 3BGFC 5FYJD 4G5ZH 4Z78B 4M56A 5HGBB 5ICXA 2AF2A 9CGTA 3GB7A 5CINL 3SPVA 2YSTA 4NWTL 2W95A 5AENA 3BPOB 4LEOA 5T1DL 5CU9A 1HINL 2P7TA 1GZQB 1BXAA 2CDEA 4PS8A 4NRYA 3N04A 5MERA 4AYFA 4QKXB 5I8KL 3U9PL 4HJ0D 3CH1A 2GSGB 3S5LA 2AFNA 3SHSA 5FOBA 2XKSA 1I8LC 5DMYA 3QFJD 4Z8FL 3K3QA 2XX0A 2OA9A 4FX5A 3UZQB 3PDDA 4PJEA 1S7UA 3DGDA 1NJ9B 4MA7L 4PD4J 3GMOA 4HD9A 2OJZH 3SY0A 1CYGA 1VCBC 2EIZA 2CRZA 1GYWA 4PU2A 4FCAA 1KOAA 1I1CA 2GAZB 2GITB 4K55A 1MWAB 3A6BL 1QKZL 1ND0A 4OZHA 3QDMD 4XP5L 1DJXA 1D7DA 4O2CA 1CXIA 5J11C 5J8OA 4JM2D 3HG1E 1GZPB 2NZ9C 2OTUA 1QASA 2F7RA 2QVMA 2BJML 5LBGA 4Q97A 1HOEA 4FFVC 4F2MA 3TO2B 4UZGA 2SEBB 5D6DC 4AL8C 2WZ0A 5DFVC 1K2DB 3ZIMA 2MQ0A 3IK2A 2WC7A 1VFAA 5TDNA 3AT8A 3A21A 3I50H 1ECYA 4LVNB 4LPUA 3NZ8B 4G59C 3ZKMD 2A9DA 5INDA 5IMOB 1NGZB 3KYNB 4U1LB 3CFBB 3MRCB 3VCLA 3TBWA 2LW3A 2W59A 1JNLL 4Q4EA 3KWTA 3ARVA 3PPSA 3KBEA 1TO4A 4QLRA 1QLFB 4L9LC 1DQVA 4J3TA 3WJMA 5E95B 4JGNA 4FQXC 1DQLH 3ZE1B 4EI5B 1BQLL 2ADGB 3DXAA 4KRMB 3DHJA 1ILUA 1MFUA 3CZLA 2VR8A 4M5TA 5DRWA 2MFNA 1PKOA 1G7LA 1OB1A 4BFIB 5AOLA 1K8DA 1KJ3H 4A6YA 3F83A 4G8EB 3VX1A 3RTQB 2XVLA 3UTQB 2JLPA 4BCXA 3U46B 5GGSY 4YDLC 3GMQB 1ZEAL 4XCFH 5F8RC 3VD7A 1PIFA 2OS7A 3ZGHA 1YECH 1NIDA 4M93B 3D30A 4I18B 4OLWL 4ATWA 4BDVB 5FO8B 1UOLA 4K8RC 4XNBA 4HOZA 1AAJA 3I6KB 5E2UL 2YQBA 1NZRA 2X4SB 2PWEA 5DR5L 1MCKA 1MFNA 2VMDA 3BIBX 1RU9H 3REWA 4D0DB 4J28A 2C9UA 3ESVF 4I2XB 5E8DH 4ELKB 1CC3A 3K71B 1JIBA 2CK0H 3EFFA 3VFSB 2EDRA 2ICEC 3T0AA 4P5RA 4UDUB 1JK9A 2IADB 4HEPG 5DO8A 3X1GA 3DUSB 4M4RA 1WBXA 2AK1L 4WJG3 1F13A 4HUUB 5E0QA 1YPZE 3FOMB 4ZO6A 4U4IA 1DCEA 5I28A 43C9A 5C07D 4ZW5A 5T3XL 5EZLA 1BF5A 4X99B 4PJDB 5CMAA 4HK0A 5C2BL 5B3NA 3TH4T 2VQ1A 1ORSB 1N18A 5C09B 2ZOTA 5KSVA 4L4TD 4QHUA 2AAVA 3RWGB 3WXVH 2MPVA 4NOFA 4QPEA 2KLTA 4AXWB 1ZXKA 4ABWA 1JV5B 2LT9A 2R8SL 3AU0A 2V37A 4K8RH 5JHLL 3V0GA 1SVCP 1C12A 2Z4QA 3SCMD 3WELA 1FFTB 1BBDL 1NSNL 1DVFB 2APFA 3MA9L 5D2LB 4R3SB 3I84A 5F9AC 5FA4B 3VTTA 3DRTA 3I02B 3LHPH 4LLYB 2VERN 4LLUA 1HOCB 1AKJB 2GJJA 3GHEL 4HJJL 1E43A 5AG8A 4WFHE 4XXDA 4PJ5D 1I9RL 4PN6A 4FI8A 4MJ6B 1BLNB 2NLJA 4UTBA 5LCVH 3N85L 4GY4A 4YHNB 2J73A 3EYSL 5HJGA 2FJFB 2Y9RT 2RB8A 4OQTA 3QDGE 4YUEL 4ORGB 4YHLL 5KJ7E 1USZA 4XWOC 1IC7H 1D9KA 3PWUA 4RETB 5J9PA 1L9SA 1QRNB 5EA0L 5IQOA