4YS4A

Crystal structure of pf41 tandem 6-cys domains from plasmodium falciparum
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
351
structure length
258
Chain Sequence
MGKSHKCDFTKEKYLLSGEKEVSCEIDANPADDITFICPNLCFHTVNIAKNINQNKATMSIQDLLYGSVVYGNTLFISPYVRTNTPFYCFCNLDTVTIQKFLKINRFLKDDDELSIISKRGIMSVFVRSNNNVIKGCDFGNNNKNYFSHPISVAGVNNKVCKIQGKPGELVGFKCAFEENGKVEPPNCFDQVLHKNKVTDLKTLIPGYASYTNKHSSKYPYYLKIPHFVNEQYTIQCCSNNAQNEYTFELDIQPGESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merozoite surface protein P41
publication title The Structure of Plasmodium falciparum Blood-Stage 6-Cys Protein Pf41 Reveals an Unexpected Intra-Domain Insertion Required for Pf12 Coordination.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 63
structure length 258
sequence length 351
ec nomenclature
pdb deposition date 2015-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ys4A02
4YS4A 2YMOA 2LOEA
chains in the Genus database with same CATH superfamily
4LLDB 5GQBA 1KY6A 3AREC 3MR9B 4MVBD 4DKEH 4N9OB 4U6XB 3SDXF 1S7RA 4PJGA 4G8GB 3L3OA 3EYUL 4OGAD 4BSWA 2APBA 3KWWA 3H9HB 3LZOA 1Z9MA 5BQ7A 4ZMLA 3WS3A 5KYWB 5T1LA 4IBSA 1HIML 2FK9A 2GT9B 2PPCA 4DCQB 5C0NC 1JMZA 3JV0A 1M9WA 2VTFA 3CXHJ 5EC2B 4ZFZA 5C0GB 1K8DB 2H0JA 1SY6A 3MJ8B 1ES0B 5E8OB 2HUHA 3OZ9L 1FIGH 2RTTA 4TQPA 3K6NA 2IH9A 5D7LB 4XO3A 4KZDL 1GOGA 3TBTB 3W9DA 4U1NA 4UZUA 3SDAD 2IWGA 2F5AL 1M7DB 2CXGA 2DJSA 2YPLA 2GITB 3DHPA 4D9RE 1M9SA 3RY6A 2XU9A 2EDNA 5T33L 2EE3A 3FFOA 1IQDB 4YXKL 3IDGB 2PP9A 2NY1C 3ABMB 3LHPH 3T9WA 4HFWB 1NAMB 1TJIH 4WUUB 1UB5A 5BUAA 4HUNB 4L4TE 2DV6A 4H0LC 4I3GA 3FQXA 1WBYB 3TEUA 4XPBL 4BK5C 5DC4B 4NPYB 4NC2B 1JZ4A 1LEIB 4GT7A 3BUDA 4MNQE 5G2NA 4HBQA 1RK0B 1U8JB 5T5NG 5KVGH 3QO1A 1SY6H 3NDYE 5AAWA 5FR3A 1AGEA 4NENB 1IEBA 3TN0B 3GUTB 3SB3A 4H1LB 4J5VA 1AXTH 4G42B 2QHRH 5FO8B 3T1WA 1F4YL 2ESVA 4NUMA 4PY7A 5IQ7H 1MI5D 2R29A 4MCZA 5TK4A 2A73A 1U8KA 4BHUA 4M6OL 3HFML 4HKXB 5AD0A 4JRXE 1QFWM 4WTXA 2DQCH 4K0OA 3LZNA 3F7RA 2G5RA 3JWNE 4YDLC 3UBXG 4YL9A 3RGBA 1B4TA 4M9OA 3AGWA 1NINA 3G6DH 4IU2B 3BFOA 2FD6L 1J0KA 1FAKT 1KF9B 3H56A 3LS5H 4MJ5A 1N70A 4GQ9H 3WO3B 3ZKQD 5KSBB 1F42A 1DQQB 3MOBH 3NIGF 3CK0L 5D7KD 1W8NA 2ISDA 1D9KA 5CNHA 5H4YA 1SOQA 1XXFC 3MXVH 4WW2A 1XGZA 3D12B 2WZ5A 1A7PH 1PG7W 4I88A 4I3RL 3UBGA 3OR7A 5BS0E 4HZ1A 1NBVL 1ZVNA 1MG3C 1UXMA 2Z92B 2F19H 1MJJB 3W37A 1GZPB 2VMCA 4W4NA 3MRJB 3MOQA 3KXFD 1Z5LB 2EEFA 4JKKA 3NUKA 5I8CA 1A0QL 1WLHA 2R29H 5E2TH 4CGUB 5C07D 4XWGH 3NN8A 2RIKA 4LU5L 4ZPTB 1FZKB 1SHMA 4YHZL 5IFAH 2YPKB 4U1IA 2IALB 5DJ0B 3WMQA 2FHFA 1KTCA 2Q0ZX 1JZJA 1MUJA 3NJXA 4TUOB 2BLFA 5AB9A 5CCKL 3O8XC 1T20A 2NSQA 2DEWX 3EJYC 1JRHL 2JKSA 2E47A 3L5XH 1RZPA 3SE8H 3Q44A 1YPZA 3QUZA 3PGDA 1QSEA 3V4PA 4X5WA 3OXRB 2WW8A 3GMQB 3OR6A 4XXCC 4JDTH 4WSKA 4L5FE 5IREA 2D8KA 3DTDA 2VZ1A 2OMXB 2J88L 4NN6C 1FN4B 1AGCA 1DP0A 2GSMB 3BCFA 5D9SB 3VGEA 3N9GL 2Q7YB 1MRFH 2AV7A 3W2DH 3L3HA 5BVJA 1TLMA 3CFEA 5J6GA 1HT6A 3C6LA 1UKTA 2F74B 1JDDA 1TPXC 3NACL 1P1ZA 2H9GB 4TRPL 5BS0B 4LIQL 3BUTA 4BGLA 2M83A 1F1DA 1JFQL 5I8OL 1NKGA 3QR2A 1JOIA 3ES6B 2Z7UA 2R1WB 5B3SB 1J5HA 3AXIA 5DMYA 3I2CL 3JSSA 4HAKA 5IWLC 2O5ZL 4PJ8D 2YGNA 1ID5I 5HDQH 3ZUCA 2FTAA 3QW9A 3KD4A 1WZMA 3T6WA 3ZTNL 5DK3A 5E8EB 3V4PH 5GGSB 1TZHA 2PO6B 4NQDD 5HVHC 5C0BA 1HCVA 1UVQB 3VGBA 2CBTA 3BGAA 4JRFA 5K5YA 4QO1B 3CZNA 2K6ZA 2F53A 1OPOA 4N8VG 3P0VL 3O6LL 2C1PB 1N5AA 2BNQB 5B3NA 2CO4A 3NJKA 3TBSB 1WA1X 4UMSA 4M1DL 4GKZA 3PV6B 4I85A 4JAMB 3QCVL 3BYYA 5E2WH 5ETUA 1JZDC 3IAQA 2YUZA 2E4TA 2NSMA 1CFNA 2UUDH 4PJ5A 2DTSA 1GZQA 1Z0NA 3NJIA 3CZJA 3I6LD 4PJCF 5IFJA 4I4WB 1OP3K 5EOTB 1MFBH 4X6BB 3Q13A 2KLTA 1FL3B 1TJXA 2O30A 2HJFA 2V3DA 3MNVB 2GEQA 4RRPM 4R6UA 3U4BL 4BK8A 3HBQA 1IAIH 4OKDA 4YGAB 3IBEA 3HE6B 3MKGA 1YMME 4AC2A 5FYJD 1T21A 2BNRB 2MQGA 4OIFA 2ADJA 3KPLA 4JJHA 4NO0B 2R56H 1TTUA 3L45A 4EXKA 5L4MA 3ME0A 1OV8A 5E08L 1AZCA 2VAJA 4OCYH 1H0DB 3IXAA 1FYTE 1R3HA 4Y16A 5I1LA 5HHOA 1YEWA 1T2JA 2GTWA 4X7SL 1IM3D 2R0WL 1W91A 2ORBH 4A7VA 1IIKA 4H2CA 2DQ6A 3QUHA 2N0KA 1Q9WB 1I85C 2CBMA 3CAFA 2Z93A 3O3AB 3VSUA 5I76A 1A2YA 1LP9E 5DR5H 2CLRB 5I17B 2R8SL 4F57H 2OTWB 3P9LB 1V05A 2WLHA 4YBQD 2BNUA 2WUBH 5E9DD 4GQPH 3LHAA 4PN6A 3V6BR 3VG9B 4CVXB 2R2CA 4W9JC 4NHCH 1ZIAA 2ZUWA 4CILA 2VWEC 3FT4A 5ECJE 3E6FA 4WKZB 5AVQB 4WK2B 5GZND 3U9UB 4EI5C 1JTOA 5DSCA 3ARGD 1KBVA 1F13A 4RAHA 4Z95H 5E4IA 4OKVB 2XIDA 5A16B 4F58L 5ESQB 4G6JH 4G83A 1FQ9C 1KTLB 4F5CE 4N2MA 1CI3M 3GI9H 12E8L 1I3RA 2DS4A 4N90E 3SDDC 4EIZC 5JYMA 3GHBH 1TJMA 4MQXD 2NNCA 3OD3A 4TSAL 1YMMB 1MH5A 3ILDA 1P9MA 2MCPL 1GAFH 4KOCA 2FBJH 4E0RA 5KANI 1I9RL 5T3ZE 3CXFA 3VU1A 3VXNA 2BP0A 4M4PA 1KN4H 1AZZC 5EU6D 1NC2B 1FLRH 2PYFA 4OGAC 1X5IA 1ASPA 4WUKL 3TTSA 1JHKH 3WEMA 5ID0B 4U2YA 2C3XA 3V10A 4X5XA 1AYRA 3DTXA 1N4XL 3S5LB 3M17B 2A6DA 3C5ZD 5DJZA 3CSGA 3V0GA 2NXZB 4HJIA 3CDGB 5KYYA 1HEZB 4P2QD 1CQYA 1JF6A 4YZFE 3FFDB 3Q5TA 4PGDA 5KTEH 5T3XH 2NPLX 2J6EA 4AL8C 1P4BL 3SY0A 2NXYC 1UM4H 4XO8A 3SDAC 4ORGB 3SPJA 4MNHA 4H8VA 1TITA 5FX3A 3CCHB 4DP5X 4PJ9D 4QAMB 4GRWE 2HJLA 3LPFA 5L9DL 3UBFA 1WBZA 3RHWK 4NRZA 5LDUA 4P2CG 2VC2H 3RTQD 3MUUA 3QARA 2IG2H 3IPEA 3E2HC 3IAPA 3GRWH 5E2VH 3S4SA 3FB5A 1QLFA 2K3TA 3IDMB 3VFNA 1RURL 3SYAA 4XMLH 1BVLA 4BQCA 4EBQL 5F7LB 2DD8H 2WXJA 3TEZA 1I1RA 1FDLH 1TVDA 2RALA 3DSFH 3EOBB 4TQEH 3KBEA 1I7UA 1OE2A 3NJNA 1JGUH 5IB4A 4P3CH 1FNEA 4TUUA 3MRDA 5FC9A 2HLAB 5GHWH 4QHUA 5DD5H 2BOBB 25C8H 1MSPA 4W1TA 3EOAB 3H54A 6FABH 1IBYA 1N68A 4OZGA 3X2QB 3BGMA 4OQTA 3V0FA 2WXNA 4UM9B 2J6EH 4W9FC 3CVHL 4I0PA 1UJ3C 3F5WA 2J57A 4QY8A 4XNYL 3DX9B 4XTRD 5ERWB 5KW9H 3QEQA 1SF3A 2OFQA 3BVNA 4TULL 1JGVH 4TYUA 1A4JA 2WVTA 2L04A 1VESA 4NWTH 3RX9A 4RMUA 4UDUA 4WWKD 4ZODA 3KAAA 3QIWB 4A7TA 4PJEA 1IGTB 3OWEA 5CFAA 1LE5B 1J10A 4HIEB 5L8LB 3WIFA 1QFWL 3IJEA 3L3DA 4WGKA 1W72L 3T1FB 4KNUA 2CKBL 1G1YA 2E27L 1HX0A 3WG7B 4Y2DD 1DLHA 5AFAA 2K70A 2NZ9D 4HWBL 1IIIA 5IMOA 1DANU 4LCWA 4JCWA 4PHZA 4AL8L 2P80D 4S10A 1QI5A 1DBKH 3CU1A 3AABA 4JZJB 4C4KT 3PQYD 3EJSA 2ZXQA 4XI5D 4NQTA 4OQTH 5EU7E 1TO4A 1KWKA 1WH0A 3NBNA 3FH7A 3RWIA 4MD0B 1U8LA 1L4IA 1ET8A 2YRBA 4XNBA 2VJ8A 4YDJA 4XPTL 3J27A 2DWTA 4JJ5A 5EBWB 5D70H 1YYML 2PYEB 1KENL 1RVFH 4I5BB 4XCFL 2DN7A 4LE8A 3K46A 5A2FA 2YXFA 3DXAE 3P4OB 1S3KH 4AG4L 2O61B 4XXDA 5H35A 5L2KA 3RJDA 3D3VB 4HUXB 5FM4A 1TSRA 4K7PX 4HFUL 3U46B 3GBEA 2F7IA 4LSUH 1BX2B 4YHPB 4JM2F 2ZJSH 4P4RB 2C9AA 4KKAD 5FDYA 3AREB 2CWRA 4FQXA 5HGBB 4LQ1A 3RPIB 4U0RC 4RBPK 4DVRH 1R3LA 5CU5A 4YHIB 2DBJA 4YFLI 1MF2L 5MERB 5DXWA 1RUQL 4CADA 3CX5K 2ALWA 4NHUB 5HYSB 5IZ7A 4BYHA 3TT3L 1OCOB 4GQQA 3FCSB 4HWZA 2QQKH 1NDMB 3Q2NA 1MFAH 4WWOA 2WKOF 1HZKA 3MRGA 4QRSB 1TYJA 3B9KD 4KQ4L 5EZJA 5F1IB 2UWEA 3MA9L 4PJ8C 4QXWA 2ZOTA 5EO0B 3IU4H 4J8RB 1G7LB 4U05A 5J3HC 1NMAL 2VITA 4Z7QE 5LXGL 3AGVA 4UUJB 2GY5A 3ZDYB 4PRIE 1KIRA 4JVUA 4B9GA 3F3HA 4HS6B 1HOCB 4Y19D 2VW7A 1T1ZA 1J8HA 5SWSB 2BIQA 1PNDA 3V6ZB 3ZLQC 2ZCZA 4LPCA 3RZWA 2DWDB 3DXAB 1FNSL 2NY1B 2Q8BL 1DO6A 5DJCB 2E9GA 2NLJB 2OMVB 4WTZG 4XZ4A 3EO9L 3LH2L 3CSYA 3PFQA 4GAJL 4ODUB 4A2EA 3QUML 5IEKA 4Y4FD 5EF1A 4M8RA 2CCWA 5AOJA 2Z8VC 3DGGB 3PHQA 4MCYB 4DK5A 2EDXA 5G5DB 4D3CL 2E9WA 4JHAH 3QH3A 3RUGB 3WFDL 4JY5L 5E94B 1CLVA 4E5XG 3WIHL 2HVJB 1O6SA 3R19A 3FUHA 4RDQF 5HTSA 4S2SA 1J1OL 2OCCB 1EHNA 1HHJA 2G9KA 1OVZA 2Q76A 3V9EA 4XNMA 2QVIA 4U6YA 1EFXD 1OWRM 1XCXA 3CPLB 4KVNL 2FQGA 2WIMA 2RACA 2J3SA 1OGAD 1ILSA 4WCYL 4BWWA 3FN9A 5CN2A 1IL1B 2A99A 1GC1C 3QZWG 4PGBA 4YDLB 3T4YA 4Z7QB 4G59C 4IEFB 3BRDA 4XMZA 4PRIB 2D0HA 1RP9A 4LNRA 5FO2A 3LKSA 3GMPB 4Y9FA 3GS7A 1ZTMA 5TQ0H 1UG9A 2IBBA 1UWFA 1H3GA 2EDFA 4HLZG 2CCLA 2WQSA 2VH5H 4F8PA 2BDNL 5I1IH 2XKNB 4PJGF 1VZIA 4PRAA 4YBQC 3GO1L 1UXSB 5F93C 5TE7H 5DJ6A 1XH3B 3KW7A 2GIMA 5EEVA 3N0PB 4KROC 4X7CC 2GYSA 2PUQT 5ENWB 5HGHA 3NZHH 5GZNC 3MJ9L 4C59B 4CMMB 5H4ZA 3ARGC 1I1CA 3JQOB 4FNRA 3EYOA 4KGJA 3V2AR 3UBXI 1M6UA 4LCCA 5SX4H 4LT7A 4NP4H 4F27A 3TF7C 4X7DC 4MA3A 4KMTH 2H3KA 2J1WA 4P23A 4RISL 4J3OD 4LSTL 3UZEA 3WFHA 2IH8A 2AHIA 4ZW6A 1CICC 4FCHA 3O8XB 4LMQE 5LXVA 2G2PA 2C9XA 5F7MC 3NPZB 1LHZA 2IH1B 4U1KA 3DSNA 4AJYV 2N7AA 5DUBB 3O6FD 3C2AL 1B0GA 1GPOH 1A6WH 1IM9D 2DDQL 5GRZA 4AM0B 1HJBC 3BLPX 4QRQB 2AQTA 4U0QB 3WHE1 1DBAH 1T80A 2R0KL 4NN6B 4QT5A 4RGMC 3ZQ9A 3JYBA 1TQUA 1KCLA 1MCLA 2JJSC 4ZAKD 1P1VA 1AQ8A 3DO7A 5F0LB 3X13B 3WXWL 4PTUA 5JDSB 4LLYA 3C5ZC 3DX2A 3G5ZB 4JPVL 4WENB 4U2ZA 5FYJL 3U7AA 4GI9A 4CL7A 1RZ7L 2BSDA 2I07A 1TPXB 3K1KC 2BCKA 4MNGE 3TPUA 5EPMA 4XC1H 1FJ1A 3D05A 2A77H 1GC1L 4XOCA 1HH6A 1ORQA 3WE6A 1RK1B 1T2QL 3NFNB 4Y9BA 3T6XA 1IARB 5J13C 1BLIA 1NGXA 4MWFB 4ODVL 1KCWA 2YPLD 5F71A 3P4MB 3RTQC 1EHKB 2VLKB 1JNNL 5GGUB 5DJ2B 3E8VA 5ID1B 3D7PA 2B3IA 1GA2A 2WCSA 1WSST 4X8JA 2ZF8A 3FB6A 4N0UB 4AKPA 1W15A 5IW6B 5HVHB 3GLEA 3IFNH 2F58L 3KCPA 5CEZL 1ZLEA 2A6IA 5FAAA 4AMKH 1QLRA 2QR0A 3CZLA 5C08E 1VB9A 2X70A 4NCDA 2GG1A 3BKCL 4ODWB 1X7TA 2BRRL 4WW2F 3RDTA 3N5AA 3PDGA 2EC9T 3BAXA 4ZUVB 4DSYA 2YRZA 3W39A 3HC0A 2Q8AH 1JV5A 2VWEE 3OGOE 4NQEA 5I0ZA 4DP6X 4NPKA 3WY1A 1VCAA 1G4RA 5E4OA 4X7TB 3ZK0A 3CFTA 4JFVA 2HT4D 2ESVD 4L4VA 1CGUA 2AK4D 3LEXB 3MV9A 4WAFA 3CN1A 4MNGB 5D1ZD 3EAKA 5E03A 1GTFA 1U8CB 2FATH 2APSA 2EABA 4KQ3L 4XBMA 4X4ME 3BRFA 2C5DC 1JPSL 1I53A 1T1XA 2YKLH 1BMGA 3N85H 1IV8A 4MJIA 4Q56A 4KJPD 3DYOA 5ITBL 3DO3A 1AI1L 2XXGA 2MQ3A 5C8JB 2XVBA 4JB9L 4ZYKA 3R1GL 4Y2DC 3TFKD 2UZYA 4GIOA 1YEIH 2Z4TA 2W91A 3MBWB 1MRCH 3GJEA 4IBUA 4XHJD 2DYRB 3KPNA 3WDJA 1CGTA 2WZ6A 4FP8H 4EUPG 2CDFB 2EQDA 2GJ6D 4WY7H 4TOYH 4HUVA 1Y1DA 5C08B 1NIAA 5F7UA 3RIKA 3D1MC 3QDGA 4KHTL 4GG6E 5BO1L 3O3EB 4Y1SA 1LO2H 4QLRA 3IMUA 5ALCH 3U6RA 2ZT9C 4EI5B 1MHHB 3CHXA 4FD0A 3D2TA 5FYKU 3UTTA 1OAKH 5FHBH 4A67A 1JWUA 1WPCA 1YN6A 2A9AA 3GSWB 4RBPH 4YQXL 4XC3H 4JG1L 2QSCH 4QRRE 2BZCA 4LSVL 3SDXE 2IGFL 4UM8B 2RQ8A 2XV3A 3QFJD 4B97A 2OS7A 3SDDB 1BP3B 1REIA 3BIBX 3CVHB 3LVTA 1CT8A 3VNZA 2ADGB 1DJXA 2DI7A 4KVCH 3UROR 4YSRA 5I24A 4NUGH 3WN5A 3U36A 1JPFA 1TR7A 3DYPA 3WKYA 1LO3H 1ORSA 1QYGH 3IWVA 4Y1TA 5DVPA 3KDPB 2RCSL 1NKRA 4Z3FA 1QQDA 4GKLA 1XL6A 3C6LD 3D39A 1FNFA 4ALAH 1MAMH 2L8AA 3HKZA 3GHPA 3ZYJA 5KS9F 3S2AA 1SEBA 2O5XL 2ENSA 5AVXB 1WFIA 2CO7B 4UDTA 2HJKB 4HBCH 4R7XA 1PEWA 1OGTB 1SHWA 2F7PA 1MQKL 2BY3A 2WTRA 4R8WL 3ZL4H 4N9GA 4YXLH 4P5KA 4GG6B 3GSOA 1TQCC 2WLIA 1XF5B 3QXDA 4JY6A 3I02A 2PXYD 1E4WH 2DQFB 2J7LA 2NXYB 4LSQH 4NBXB 4E9SA 2MNJB 3SDAB 2MEJB 5HJDA 4H0IA 3RPBA 3RX5A 2YSSA 1EJOL 4PJ6A 1RIHL 4JW3A 3G04B 3K8MA 3QR1A 4R7NB 4IRSD 2VQTA 3B56A 4JM2C 5GRVL 5FIEA 1RLWA 4LDEB 5LWYH 1L3WA 3SDXB 3FO1A 4PRPD 1AZNA 1VZHA 4OJDH 3VYPA 3E2HB 3UBXA 1JNLH 1BWWA 3OB8A 3LKNB 5D5MF 1D2PA 2HFGH 2WXKA 2Z8RA 3GTNA 3QR0A 3X17A 4O51B 2MFNA 2YAHA 5D4QA 3WS6A 3FH8A 5I30H 3QIUD 2OSLB 2BMKB 1W9XA 1YHPA 2WO3B 1U8NB 4PJ5D 1EO7A 5LN8A 2NTSP 1FVDB 1YDPA 5E9AA 3OAWA 2VR8A 1T83C 3FUFA 3NCCB 3ZYZA 3ZE0E 3KPQB 1XD1A 5E95B 3R4RA 1U33A 3BKYH 4JFFA 3B6SA 3WD5H 3M1OA 2OMYA 1S7QA 2YMXH 3BHBA 2RA1A 2FVNA 3SKNB 3EJZD 1UJ3B 1O9ZA 4R2GD 2JIXD 1O0VA 3D33A 1FZJB 3EH3B 3MRNB 1HXYA 4OIAA 3NIGE 2E7LC 1KCVH 2OZ4A 5EIIB 4XP4H 5AVYB 4LCUA 1QW8A 5EBMB 4AT6B 3L2MA 4KC3B 1W6WA 4GO8A 4K3DL 1LDPL 4YL4A 1NDGA 1P5VB 1U4FA 4PV1C 4Q6YA 3TBWB 1IAIM 3T4AA 3CLEH 2R1YB 4HHAA 3TYGH 4JRYA 3EW3B 1V7NH 5KBMA 4K7FA 4FNQA 2R15A 5I0XA 5KG9A 2ZX9A 2B7DT 2CBPA 4NO5B 4O00A 4Q9BA 2XDHA 1DL7H 4OZIE 4UYQA 1NKOA 3K2IA 4JR9H 3H9SA 1RFDL 4ENEC 1SJHB 3LZPA 2MOGA 4F9PC 4YNYA 4B53A 4RQQB 1ZE3H 2WQUA 3DETD 3JTSA 5HDWA 3QUMB 3CV5A 4FKKA 5T3XD 2WINB 5I15L 1PZ2A 3C8KB 2ZX5A 4KJYA 3IS0X 1S3RA 4M1GL 1P69B 2CQVA 2OZ4H 2K6WA 4EDXA 5IIEB 3VJ6B 3GS4A 3HRZC 3GLDA 2B3RA 4NQDE 3BIKA 1ADWA 1A3RL 2H8PB 1UZ8B 3NIGB 4X7FC 4BFKA 4EDWL 1EERB 3HZVA 3O6FC 3Q6GH 5CUSL 4ABVA 4PFEA 5ACLA 5CCHE 1F0LA 3GYRA 1GGTA 3L3OC 2YK1L 3QO0A 3F2LA 3UEZA 3NEOA 5TDOB 5C0FB 1CTMA 4RZCB 5EULV 2V7HA 2N01B 1U2HA 4LBEA 4RIRB 4ZAKC 4RFEA 3I6LE 5AW1B 1L9SA 1OQXA 3EHBD 4N8VA 1E9OB 1YYLH 4U0RB 3HPLA 4ZX3A 2AXGA 2ZSVB 1BEXA 4P48A 1NBYB 3BP4B 3NABH 3H4HA 2EILB 2HRPL 1S2EA 2X1QA 4FXGA 1OM3H 2C9UA 1JUFB 1N3NB 1MCDA 4MXVF 3MPCA 2XWTA 3KBFA 2ZXCA 2PW2A 3L4TA 4HT1H 2VSDA 4PJ8B 5GSVB 3RZCA 3GMRA 3GM8A 4EF3A 3M8OL 1SYSA 2BVEA 3KYAA 5F2FA 2VAAB 4DKEL 1R5VB 5C9JA 3D9AH 1J18A 4AOFA 3UH8A 2VSMB 4QIRA 4QHMA 3HLAA 1G7QA 4PGZA 1U0QA 3FCTB 1MW1A 5E7BA 1QO3A 3MRCA 2F8OA 3HZYA 4OLZH 3MX0A 4NQDB 4HUKB 4OM1L 3BPLC 4XCYB 1C12A 2VZOA 1A9EB 4K3JH 3G5YB 2JKLA 1EUTA 4PJEF 1CLZH 1JE6A 4HWUA 4PJCE 3QP3A 3IGLA 3QQ4A 3MJ6A 5SWZA 7CGTA 3KLHD 1S78D 2H1PH 3KPRE 3HC3H 3TA3B 4Z3IA 5CEZE 4O5LH 4KO6A 3S8GB 1CIDA 2AI0L 3O41B 1RZGB 3BISA 1P4LB 5K33A 2VR7A 2EDLA 4LOFA 5AAWC 2EIZB 4NT6B 4PGJA 3BH9A 1NGPH 4QEGA 4DJMA 1JYVA 1UB6A 1AY1L 2HT4C 1A4AA 4I0PD 2VQ1A 1A1MB 2E7DA 1XEDA 5DS2A 2W81C 5D1ZC 2RHEA 4HW6A 4LLMB 1OK0A 1E3ZA 1WCQA 1HHKA 4GW5B 3LHPL 4H7VA 4K4KA 5D96C 1MW3A 1TJIL 4ZS6C 3FAXA 5IOKA 3CN4A 5BV7H 3UPRB 3BE1L 2X4TB 3VTAA 4FZ8H 5I6MA 3T2NH 4KJPC 5EU6E 5F9WC 2WM0A 4NIKB 1BBJA 3F7PC 3HG1E 3PAUA 5T1JA 1AIFA 5CHNB 1NGWB 1WS8A 1IM3B 4UILH 4CJ1A 1QPKA 3VD2A 2WJ7A 1UWXK 1LLAA 4P06A 4WW2C 1I9JH 4ZOCA 3GMMB 3TFKC 5GZOA 3K6SA 2WQWA 3PDOA 1LWJA 3KR3H 1QLEL 1V7ML 2YLHA 3WUWG 3LV3B 4Y4KD 4ZO6A 1AXTL 2ZXBA 5E99H 4XHJC 4AQOA 2EDDA 5IQ7L 4LCWD 2B2XL 1G1OA 2EZ0C 4IBQA 4PJCB 4P2QE 4F7KA 5H94B 2YOCA 4GKSB 4AZ8B 3MV7E 5E9DB 4JLRA 4PR5A 3KPRB 4F8NA 3G5VA 1CFSB 1BZ7A 3LN4B 3NPSC 5AQ0A 4KROB 4JPKH 3UTQA 5AOLA 4IJ3C 2IAAC 2MKLC 4L18A 1WHPA 3DMMD 1EH9A 1ZA6B 1K3ZA 3RVXD 1DVTA 4FNSA 3KPOA 3ARGB 5FDWB 5IHHA 2AP2A 3LS5L 4QXUH 3DA0A 4Q4EA 4GQ9L 2A7BA 3MOBL 4JDEA 1OW0C 4LLAA 5JNYA 2ZKHH 1I3GL 2Z35A 3MXVL 4NBZB 2QPFA 3QUZC 2X6UA 3PP4H 3LN9A 3L9RA 1CICB 1V10A 4OQ1A 2X09A 5DHXB 2XNAB 3VGHA 1IT9L 1NOLA 4IU3B 2E7BA 3SGKA 4M6ML 1VACA 5FCUH 4O2CB 3F7VA 5EU6B 3VGGA 5L88H 2W38A 3X3FH 2F7OA 3HG1B 3TBYB 1GRWA 1BVNP 1FYHB 3C6LC 1BWMA 1KGCD 1IVTA 3GINA 3CHRA 4AJVA 4X0KA 3B2PA 2FQDA 4RGMB 5IFAL 5DURD 4NLAA 3OJDA 3ZKXC 3C5ZB 2G75A 1CPUA 4P2QB 4LPXA 3TZVD 1I8AA 5TE4H 4PGCA 4UTBL 1KULA 4PBVC 2PXYC 4JGNA 1KYDA 2XPGA 1JK8A 2FR4B 3D2UD 4X5QA 3U1QA 1C9SA 3OAZK 4ZX6A 4NQCA 4LHJB 2OMTA 2VZ3A 3O3UN 4MJ4A 1R3JB 2IQAB 4X9BA 3G5XB 4JDTL 4HGMA 5J13B 2B1HH 4IRSC 1NFIA 2KUTA 2NY6D 1J8RA 4ZTOH 2XVKA 4XBEH 2ICWI 2CBQA 4G80B 3VDCA 1MOEA 2AQNA 1MJUH 3RTQB 1MRFL 3V0AC 3W2DL 3MLZH 4GSDH 3QJSB 5DWUL 3VWJA 4Z7OF 4OZ4B 3CZFA 2CO6A 4MDJB 3OKMB 1HXMA 1E9PA 2EC8A 1QTPA 1P7KA 3KH3A 2ATPA 4HQQH 3DYMA 3BDYH 2WCPA 3F7LA 3WTSA 2ZOWA 5DDHA 4RA3A 3DX8A 1PY4A 3PWVB 2YAFA 4YAQA 1VA9A 4EN3A 2JTDA 2YZ1A 4PBXA 3GDCA 2I7OA 4JFPB 1VKXB 1Q72H 4UOJA 2HA1A 1E50A 4FMFA 2ZCHH 3GEFA 5D1QE 1QRKA 5LGYA 4B96A 3ZT5A 1YEKH 4PRBB 4UU9A 1IFHH 3A6CH 5D71L 3RKPA 3V4PL 3VMPA 3ZHNA 3FONB 1DQDL 2Q87A 3RBGA 4QMEA 2DOCA 1G6VK 5EDXA 2F7RA 5JTWA 4XB7A 1IAKA 4ZFFA 1NCHA 4N3TA 2V2WA 3RGVD 2ZOKB 4PWKA 4AYMC 3APCA 4CJ0A 1A6UH 3ARFD 4TVPE 4YDNA 4OUUB 2AABH 4XCCL 4NKMA 3F7YA 4J3TA 1KXTA 5I1CH 4Y2DB 4HULB 4AEHL 1ZY9A 1ILUA 3UP6A 1UGKA 2AQ2A 3QIBA 2DRUA 4JO3H 4B7LA 4HGWA 5CEYA 1QWUA 4Z7VA 4J27A 5T1KB 1XGPB 3BZ4A 4QKXB 4DUXA 5FUCC 1X9RA 3FTGA 4CN1A 3KYKH 4XMUA 4R9HA 2IOMA 3W0WA 2IIJA 4OCYL 4KZEH 4PREB 2QZQA 1KPRA 3OPUA 3P3YA 3D4ZA 4LASH 5D1QB 3LSOA 4JN1H 3A23A 3LX9A 4QOKD 1XIWA 3VMOA 1IC5H 4DP4X 3L4UA 2CNYA 4HJ0D 1P9MC 4CW1B 2QGEA 5D7SH 1HU8A 3FUJA 1N8OE 5C0DA 5KVDH 1PZSA 4F57L 2VDKB 3QORD 5GRJH 4A63A 3OLGA 1SLVA 3M45A 1CXLA 1GGCH 3DRQA 4M7ZC 1N64H 3JT0A 1F90H 2WUBL 2X2YA 1MCWW 4JM4H 3IFPB 1BAFH 1C5CL 2UXTA 4NHCL 2X4QB 1FWXA 5AALA 1BD2E 2APFA 2CM5A 4HUUA 4M7JH 4YHML 3EHBC 4Z7UE 1VHPA 1SOKA 4I7ZC 4GLRI 1CF8H 1QHQA 5IW1B 3U7WL 1S5IL 3GMLA 1EZUA 4M6AA 3SQRA 1W16A 2LV4A 4NO3A 3EYSH 1KCSH 4G6JL 4C4UA 3FMGL 2AVGA 3QXWA 3DOSB 3TXAA 3GI9L 3VX1A 1PS3A 1Z6JT 4WW1B 4LLUA 1JV2B 4MA1C 1EZLA 32C2B 3PIQB 2HKAA 1KG0B 2FDBP 1GAFL 1WWBX 2R2BB 4B41A 2VB5A 5F3HB 1TQCB 4E5XA 3MUGA 2EKSB 1KN4L 4X4YA 1FLRL 1A1NB 1S7WB 5KWYC 3N50A 5DZPA 5BZWA 1XAKA 4JFXB 1H3PH 4Y19B 5JO5A 3NZSA 1T3FB 2NY7H 3TIDB 3RNQB 1N67A 2D9CA 4JM2B 3GWJA 4JVWA 4PJDA 3WTVA 1DVUA 2V5TA 2MCAA 2VDNH 4LCIH 4A1RA 4PJXF 3QDJA 3LKOB 3QZWA 3SGJA 1PAMA 1S78C 1DUYB 2BFGA 4B9IA 1YG9A 4URKA 5A1AA 3WXVL 2NY5L 1HAWA 1T0NB 2VISB 5T3XL 3ZZ1A 1RZ8B 3HUJA 2WO4A 3VX0A 3V0HA 1EEZA 5HD8D 1L7IL 1U42A 4IOIA 3BSZA 2B59B 5IF0A 2X4OA 4NQED 5HHMD 4JFDE 1MWOA 2X2HA 2WLNA 4I0PC 2LAGB 4I87A 4UQ2B 4KKCD 1F11B 3A67L 3E8UL 4L3CB 3MV9D 1R3KA 4MDRA 4V33A 4PV8B 1E43A 2IG2L 4L3AA 2EEAA 1EFXB 5E2VL 3CHSA 3GRWL 5TGBA 3QEGH 3EADA 5LUMA 2VJ0A 1ZLSH 4BD4A 5A43C 1XF4A 2UVEA 4D0BB 1ROWA 1OGAB 4WFHD 3PNWB 5F88B 4IQHA 2DD8L 2X87A 1FDLL 3DSFL 3LRKA 4MJID 4TQEL 5LNGA 1N7MH 3QNYB 1OWWA 3LCYA 3SO5A 3OXSB 5DLML 4A2HA 4X6DA 4LEEA 3OKKA 1CGSH 4JKPH 4PJGE 5I6XC 5DD5L 25C8L 2EH7H 5IMMB 2DJ4A 5DK2B 1U93A 2APTA 3KYNA 3G3LA 4I48A 4Y4KC 3ZTEA 4CNIA 1KBGH 2Y06H 5A2BA 2DWXA 4MMYB 2GBVA 3IMRA 5C0EA 2XZCL 5KVGE 3ABGA 3DROB 1M7XA 1H9DA 3BSZH 4OCXH 1UD2A 3QUXD 2O6DA 2X0VA 4HLZH 4G9FA 4BSVA 4HH9B 1LXMA 5ADPH 1JGVL 3DIFB 2HT2D 2DQMA 3MXWL 3P2TA 2QDVA 3O81A 4FXLA 2O6FA 3DMMC 3RFRA 1BQRA 1PZCA 3IDNB 3RVXC 3W3BA 3KYMB 2CRZA 3T3PF 1ASOA 1YEJL 2W59A 2YPLE 4LOEA 1BQ5A 3DURA 4G6KH 4WTWA 5SX5K 5CZXD 2VN5A 5E0QA 1JI1A 1W6LA 1TOXA 2EE0A 2Z1PA 4C56D 5BUGA 4EZMA 3RWHA 2VR3A 6TAAA 1DSWA 1DYZA 5JA8B 2Y7QA 1K8IB 2XKSA 3HRZB 4KX9A 1S8DA 3M07A 4UTAA 1I7TB 2F68X 4UQEA 1PDKA 2V7NA 3PPEA 2IPKA 2F18A 3SE4A 3COOA 2BVYA 2YSTA 3MROB 1ODUA 5TFSH 3O6FB 1U8OB 4BZ2L 2EINB 1K85A 3GB7A 4OQTL 2JCCA 1S7RB 4PJGB 2GI7A 2OI9C 3KCWA 3L3OB 4FQXC 4AKQA 4BSWB 4FADA 3S0PA 3IWUA 1G7IA 5T1LB 4ZAKB 5EIVA 2FJFB 2CR3A 4OZFG 1CK0H 5AZUA 2ESVE 5LGKA 3NIFE 4YC2C 4ZFZB 4PHXA 2N1KA 2HRGA 3FHEA 3TZVC 3RI5F 4DN3H 1MLBB 1NUGA 1QLEB 3PXHA 2VSCA 2Z7ZA 2Y69B 3W9DB 5E6ID 2R69A 2Y2WA 1RSYA 1YN7A 2MSPA 2NY6C 2ZJSL 3D0LA 2YPLB 5HGGS 4UTAH 3RJOA 3CIQA 3WAJA 1OM9A 1U3YA 1OD9A 2PABA 3F6LA 4I77L 2JLPA 1P6WA 3T6VA 4DVRL 4TM9A 3SKMA 1OP9A 1HQRA 2JQAA 1THAA 1UB5B 4OLYH 1INDH 1XB8A 3BPLB 3FO9A 4XN7A 3FU8A 3FQXB 3EGDA 1AVAA 4P9HC 2EXTA 2BFVH 1GL4B 4PW9A 4FG0A 3V6OA 4AX3A 3A5VA 2R9HD 2VMDA 2QQKL 3C6SA 3L3GB 4KMLB 5AKRA 1I8LC 3VM7A 5IB2A 4LPUA 3D0VA 2VXTH 4ATWA 3FL7A 1OCCB 4JFQA 5E5MA 3QO1B 4HK0B 1G1KA 4NPJA 1IEBB 1TJGL 5LBVA 3VRIB 3QHZL 1IZJA 3VCLB 4JFFD 4JKLA 2ESVB 4PY7B 4EUPA 3MCLH 5CU9A 2ZUSA 3F04A 1HCFX 2FLMA 3RNKB 1U8KB 5D1ZB 3UTOA 4HLEA 2R69H 3AQZA 1AOZA 3RL2A 4S1DD 5AD0B 1BVOA 1DLFL 3V0VA 3WY4A 5KBKA 1YPZE 1XBDA 4LSPL 5D96B 1QSEE 3V79C 3ZJAA 4NM4H 2FECL 4IMLB 2F9BT 5F9WB 2NNFA 1AQKH 3BPNC 4BFEA 1CUOA 1EAPA 3WNKA 1KYOJ 4HF5H 4UT7H 4JHAL 5T1DH 4WW2B 1SUHA 2PMZA 3ZSTA 2HB0A 2VN4A 4OF6A 5F9JA 5JIHA 1DFBH 3UYPA 2WYTA 3SBWC 4YE4L 2MTAA 3UG5A 1LO5B 1QWNA 1WT5C 4HV8B 5EFIA 3V55A 2GJ6B 4XMXA 3ULUF 1TXKA 5E23A 2GPZA 1COBA 2HX8A 4EUPH 1IE4A 5I8CB 1EEQA 4TNWK 4UI2A 4IJ3B 3A47A 3WEXB 3Q1SH 1R1CA 4U1IB 2PF6A 3GIZH 5GJSH 5GRUL 1MWAA 1QRNA 3EYQD 4FI6A 2IPUG 3ML8A 1MUJB 5AVTB 4ATTA 1X5KA 4HJ0C 3L3IA 5CJQH 2UY6A 4CC4A 4YSTA 5C0BE 1N0XH 5TQ0L 1T20B 1VFBB 3QFJB 4N2DA 1UZ6E 4P9HL 3O9WD 5I1IL 2F53E 3HZKA 3QORC 1BDYA 3QUZB 4FI7A 1NFAA 1Q9OA 3DX7B 3PGDB 5I66A 3SKJH 4NKOA 4X5WB 3U1SH 3V4PB 5JOFB 1WQVT 1PVHA 1A22B 4Z8FH 3BVUA 4X8CA 4YIQA 4X8GA 3ULUD 4A7UA 2LHAA 4PJ5E 1PSKH 3KVQA 1AGCB 1M1XA 3QZOA 1C8PA 3QPKA 4OLWL 4G3YH 4FC3E 5A2KH 2AV7B 5J6GB 3C6LB 2I85A 2LLLA 4Q9RL 3MCG1 4DFIA 3EG9A 2AEOA 2FQEA 4OFIA 1RZIB 4KMTL 1RL1A 3ZKXB 4OSUL 3QHTC 5FK9A 1PD6A 3MLVH 4AXWA 2ARJQ 4O2EA 4F7TA 3GMOA 3IU3A 3UGEA 4FQJH 2AXHA 3I3BA 5C3IA 1C7TA 3ALWA 3H8NA 3BD5A 1A6WL 3AITA 4FRWA 5I0WA 1JGDA 2L7QA 2X7LB 1QSFA 3CSFA 4FEIA 5HHOE 1WITA 3TWCL 2QADD 4IRSB 2X41A 1DBAL 1G94A 3DHJA 3SE3C 4HCIA 1TZHB 4IBVA 2RFXA 2OJEA 5C0BB 4KV5E 3EO0A 2Y0SA 4OI7A 2F53B 5I8EA 3ZZSA 2G5BA 1N5AB 2J73A 1CIUA 1GOHA 1ZXQA 4NNXB 2X4PA 5CINH 5DUMH 5KS9B 2A77L 5HHVH 5HD8C 1HWWA 5ETUB 1JHTB 1K9TA 3K2MC 4AWJC 1CFNB 1P6AB 4PJ5B 5C0CD 2XY2A 2IQ9L 5FUCE 3HPJB 5IFJB 1ZT1B 1YEFH 5DJXA 4KKCC 1HI6A 3ZKNC 1QFOA 2X6CA 2QTVA 5B21A 2JI1A 2VABB 3SPHA 5C86A 5I2IA 1Z0MA 2FJHA 4XP5H 3QZPA 1Z2KA 1IGFL 1T21B 3IFNL 1ZS8A 5DMIL 2ADJB 1XFPA 2OTUB 3KPLB 4DGIH 1JYWA 4QHNA 1E4KA 1ANUA 4NP9A 3ME0B 2OULB 4BFNA 5K9OA 1G7HA 5FFOA 7TAAA 4WFGD 5D5MB 4G2AA 4P2YA 1AE6H 1QP1A 1V3MA 1ZAGA 2MCG1 2JKTM 4MFHA 4PJFA 2RR3A 1MVUA 4RFOH 4WFFD 4AM0Q 4LB8A 1OOWA 2Z93B 2ADFH 5I76B 4IIQC 1A2YB 4HMEA 5LGJA 1Z3RA 3T8MA 3QUXC 3AC0A 4QHKJ 4ALAC 4IDJH 5CD3B 2FATL 4LHUG 4YH6A 2BNUB 5F7BA 5MHSE 4PW4A 2L0DA 2HT2C 5HYIA 3FQNA 1WA2X 4M5TA 3VXSD 4JK0D 5I1JL 1E5YA 1PZUB 4M7KH 4HVBA 3FT4B 3QFGA 2I32A 2YKLL 3NMEA 4FHJA 1JZEA 5BOPA 2Y1ZA 4N2NA 3SQBA 1YNKH 4P2OD 1TYEB 4NRXA 4OB5H 1X44A 3N41F 2GBUA 2BHFA 2OXHA 1I3RB 1ZTXH 1GCFA 1TEGA 2X3CA 1MH5B 1CLCA 5G55A 4E0RB 4C47A 1RD6A 3MRRA 4PRDB 1OLZA 3VXNB 2BP0B 4TOYL 2CUIA 3MGOA 1MCQA 2GTZA 4M7ZB 1JF1A 1DBML 3P3TA 2W8CA 4ISVA 4WV1A 5DTFA 1JIBA 1SLXA 2HMID 1KBKA 4LKCA 5ALCL 3H85A 3K4AA 4OZGE 4X5XB 1KBPA 4GQZA 3DUUA 4MTMA 4MXVE 2BSTB 2FEDD 3EHBB 2CLVA 5HI5D 1OAKL 3NCYS 4FERA 4MMZA 2A6DB 4WEBH 2V2TA 1BZEA 4PJ7A 2H6UA 4KHXH 5KYYB 3QEQE 1TZIA 3D25B 3CMGA 3NJGA 4OUOA 1R0AH 4MA1B 2IWFA 3RILA 4ODSL 3SY0B 4PG9A 3TEWA 4DVBB 5ICZA 5E6IC 4KVCL 3L95A 3L1GA 1F00I 1KWGA 3SDCD 4AYEC 2QVKA 4PJEE 5E51A 2CSPA 5AW4B 1LO3L 2HJLB 3OC8A 1WBZB 3C9NB 4HKZA 5KBNC 3LXAA 1R6VA 2OCJA 1NCCH 4HYTB 3CFQA 3MJ7B 3MBED 1GW0A 2PWEA 1MAML 4ALAL 4FLSA 4OH2A 3H1ZA 4A2DA 5F7FA 4LCWE 3WS6C 4HZLB 1BVLB 2F1EA 1QASA 1Z9OA 3NK4A 4HBCL 3MDJA 3RIAK 1GYVA 1I7UB 5IB4B 1FNEB 1BW8A 1RUML 3P0YH 3QZLA 1MCOH 4YXLL 4P0DA 3MRDB 4HPOH 1T1YA 3WTWA 2DWYA 4PRHD 4QHUB 4EN3D 1OK8A 2BWIA 1KFAL 5F89A 1BXUA 1OP5K 1A1OA 3PNRB 5IEHB 5FYKH 3WUWA 3QB7C 4OF3A 1ZE3C 4K7PL 3BH8A 2UYLA 5IESH 1N0LA 1FRGL 3F5WB 4I0PB 4OGZA 4U6HB 3SEPA 3MMEB 4QY8B 1NCIA 1NCUA 5FHAL 5LWYL 1RU9H 4B5EA 1MVYA 2V2XA 5CJXC 5I0YA 3CPUA 3BVNB 2PCPA 3RJQB 2P5WA 4R4FH 3S37X 1NMCC 1KC5H 5L2KE 3D4GA 4I1PA 2IANA 3DVGB 1JNLL 4OD1H 1B0IA 1SBSL 2HFGL 4IRJD 2J2ZA 5EIQA 4NI6A 3MGTA 4UDUB 1WF5A 4A2MA 3U0PA 2CRMA 1MREL 1SJXA 3S3PA 5I30L 1OL0A 4PJEB 5JW4M 3MRLB 4AMWA 1NFDA 3T4AC 3WIFB 3QRBA 1H3XA 3L3DB 4YWGL 5I6XB 2XQBH 1KGCE 1MAJA 5JPMA 2EEDA 4ABUA 1DLHB 2GK2A 3LNIA 4Y4KB 3WD5L 3NA9H 4JO5A 2YMXL 3IJHA 4A04A 3S48A 5IMOB 1BPVA 4LCWB 4NLHA 3QIBD 3B9DA 4XVTH 2X6BA 1XL4A 4G5AA 1NGYA 3QEHB 2NY4D 4PB0H 2GJZA 3LOWA 4CVZA 1KCVL 2UWEE 4D7PA 2PTTA 3ORJA 4W68A 1A8JH 5IBUG 4HPYH 3FXIC 1B6UA 1PJWA 3OPZH 2BOCA 3DMMB 3W0WD 3MA7A 1QBAA 2QQNH 4HZAA 4JJ5B 3ZL2A 5I9QC 1CE6A 1J8HE 3EYQC 4H8PA 5DFWH 2BHZA 1S7UA 4KKNA 4ZO7A 4I3SH 1H9VA 4MAYA 1BEYH 2OR7A 3B3BA 2WLYA 5ANMB 2DQTL 3DJRA 4LLWB 4XXDB 3MRFB 2QMJA 4JG5A 2A4CA 5KSVA 4MLSA 4XX1E 4BUHA 3BPCA 3JUYA 1SXNA 4JFHD 4N24A 4JR9L 4LEXH 1ZVYA 3QA3A 4PV9A 4PJDF 5E0FA 4Z3HA 3ULUC 3VGFA 4A2LA 1NIDA 2X05A 3TIEA 1C7SA 1I3VA 2ZOLB 4FQQA 3R4DA 2FB4L 1U3HA 2OI9B 4FQXB 1OAUL 4FNTA 3FOMA 5E2JA 2NUTA 1HQ4A 3BAWA 1R3LB 2AJXH 4MCMA 3L17A 3NCXA 4JFOA 5DURB 2V6HA 4CADB 4DETA 3V4VA 2YD9A 4YC2B 3RP1A 1GSKA 4PPTA 5DQ9B 3TZVB 3MRGB 1F4XL 5EZJB 2P8LA 1L3NA 3HNSH 4JEGB 1IGML 2YQBA 3D2UB 4Z7OE 1Q9KA 2VITB 5BV7C 2F8XC 2QADC 4Y0GA 1KIRB 2XETA 1ONQA 1U8MA 3GXUB 3HVDA 4S11A 2XG4A 4EI6A 3IN2A 5I5MA 2NY6B 4NQXA 1MCJA 4BH8B 1IEHA 2AV1B 3DX1A 1H3UA 5MP6H 4MZRA 1NCDL 5KVFH 4F7PA 2X4NA 3G7TA 2VN7A 4BIKA 3AS2A 3POHA 4XNQA 1WBXB 2WSDA 1YYLL 3RE0A 1TYRA 3OC5A 3KVDD 1A14H 2GEEA 3RAJH 3U0WL 3CSYB 2GFBB 4LLVB 1L0PA 5ABAA 5IEKB 4N0CD 4NZ8A 1OM3L 1ICTA 2TRYA 4NCC2 3PHQB 5IW3A 4YHOH 3QULA 3V4VH 3HS9A 4HT1L 5BMFL 3FZUC 4H8UA 3EJPA 3RWGA 1B2YA 1MCPL 2WBXA 3D9AL 4HHWA 1O6SB 4KPHH 5F6HI 4ZMYA 3DPBA 5D7IA 3ULSB 4YJZL 2XCMC 3GZKA 4AE0A 1HHJB 2Q76B 2LGNA 4XNMB 5EHFA 4U6YB 2YA1A 3D0AA 3Q06A 3ARYA 4OLZL 3QS3A 1UWYA 3QXVA 4K3JL 2PPAA 2ICEA 3FW6A 4KQ0A 3T77B 3UAJD 3CC1A 5ICXB 1OAYH 4D0DA 4AGQA 3ULUL 3QNFA 4F92B 4Z7OB 4PGBB 2ZG3A 2OQJB 3T4YB 4WHTA 5K9QG 5GGQH 5F7HA 1XR9A 3P11H 1Q0XL 5D1XD 1ULVA 2GSIB 3I9GH 2HWZH 3LKSB 5GZOC 1R46A 3BPNB 1NGPL 1T7ZA 1HKFA 1ZDQA 2CO1A 3LQZB 3IFOA 4WI0A 4MRCA 3N43F 2JCCF 2M8XA 5AZ2L 4KTGA 3WJJC 4LAJH 2E3VA 5AWNL 3WN6A 3BIAX 4FULA 3HI5H 3TO4A 5DJ6B 2WBKA 3QG7H 1S6NA 1DJHA 3NSDA 2AGJH 2DYPA 5HGHB 1KEGH 2NDGA 4FZ8L 3QJFA 4N0YH 2KHAA 2UXGA 4UIKH 4IGBA 2IDTA 4P2OC 3SIKA 1Q94A 3T2NL 4EPSA 2W9DH 3F64A 4U31A 5E00A 4A6YL 4FTVD 3O4LD 1XCWA 2EDBA 1IGCL 1RUAL 4E9VA 3UJJH 1I1AA 5BRZD 1FNGA 4QOKB 4UILL 4YLBA 3A6BL 5KSUA 2VQUA 3QXAA 1I9JL 3EOTH 2EVFA 3I3DA 3R0NA 2FHCA 3WFHB 4HUWA 2JWYA 4KVPA 1PZ5A 3GXDA 3SGKC 2BP5M 1H6FA 3QORB 1OTUC 1FFNB 3DSNB 2OL3L 4JFED 1B0GB 5E7FA 4ANXA 2WYZA 3MODH 1CGWA 3ZE2F 2AEQL 2XWBB 4LKXA 1A7RL 4QRBA 4P2RD 3HS8A 4ZQKB 2HMIC 3HHSA 2A6KB 1L7TH 4QT5B 4NQEE 3A4AA 1I8IA 2FEDC 3Q3GA 2UZIH 4IS6A 3VI4F 4F8QA 4LLYB 2ENQA 4WWNA 4QXUL 4L4VE 2Z7YA 3NSJA 4U1LA 3MV9E 5FM5M 2I07B 2XTLA 2BCKB 3TPUB 4PD4K 1D3CA 3VXMA 4ECNA 2E56A 1GZHA 2ZKHL 5EPMB 3MZTA 1AHWC 4OD3H 2OSWA 3S36X 4Q9QL 1DTUA 1HH6B 1ORQB 4ZFGL 1AR1C 5I6LA 5JIIA 1IBGL 3MCKA 1H6UA 4WO0A 3UO1H 3MSPA 3SDCC 4MJIE 3MYJA 4CSTA 4MHHI 5FCUL 4OFQA 3P40A 1RJLB 3X3FL 1ED3B 2NY2D 3IDUA 3VRLF 1W80A 2FHBA 3MBEC 3VWJC 3R06A 2YN5A 3THML 2C4FU 3FB6B 2YEVB 4H20H 1JPST 1ET5A 4KZ0A 2N0MA 1QUNA 1YO4A 1BGXH 3KCPB 2A38A 3QQDB 2A6IB 2ZP0T 3M6DA 3Q2VA 4JO2L 3BKMH 1QLRB 2QR0B 2WOYA 3A6OA 1EHLH 2OMWA 3UGXA 3CGTA 1F6AA 1NOAA 3AB0C 4F9LA 1TCRA 3QDGE 1ZHKA 4EN3C 3CN2A 4JMNA 3W39B 1B0WA 2I5YH 3HC0B 2JXMA 2FJGA 3HKFA 4NQEB 1YUHA 5HHMB 2WWKO 1K5NA 2B1HL 4G11A 2A0LD 4JO1H 2VR4A 1NCAH 3UTTE 4W9EC 2ENPA 4K7PY 4XBEL 4L4VB 3KL3A 2BVOA 2XPZA 3MV9B 3L3JB 3WJMA 3AVEA 3MLZL 4GSDL 5EMYA 5DRNA 3POCA 3TJHC 2FO4B 2ID5A 4XO9A 2WBJA 4JL2A 1OXYA 5ICUA 1T1XB 4OTXH 4MJIB 4EN2A 4HQQL 3BDYL 2XXMB 3H9YA 4PJXB 1BSIA 4PWEA 3TCXA 5ELIA 1WEJH 5C6TH 4L3EA 4BGDA 1JL8A 2WGXA 2AJYL 1YEHH 4M03A 4OFYA 1G0XA 1TKWA 5I6NA 1PLBA 4DOHB 3MNZA 3D39E 4K23H 4ZYKB 4Q58C 3P77A 2UZYB 3K4ZA 4WNQA 3AQYA 1JI2A 1ML0A 2ZCHL 3H55A 1T6VN 4JN2A 2VDOL 1P7QA 3QIBC 4IIQB 3MBXH 4N22A 4B9ZA 4BXSV 2QMKA 3DTUB 3KPNB 3A6CL 1BVNT 4UQ3A 4J2XA 9CGTA 5C0RL 2V9TA 1BYOA 2NY4C 4Z0XA 1AFVH 2EUZA 2NX5D 3QDGB 4XN5A 1AR2A 5D7EA 2N7BA 3D85A 2BIPA 1LVEA 1UURA 2FSEB 4O02A 4OZFA 1CLOL 2D7TH 3PWPD 5B7FA 3BUBA 1EZVX 1H15B 3NRFA 1JWUB 1NJ9A 1YN6B 2NNXA 1C16B 1QRND 5EC1A 1PEZA 4I0CC 4NC1C 3LN5B 2K3HA 5EBLB 5I1CL 4NDMA 4D9QD 4HKBB 4OCWL 4ERSH 2PN5A 2XVLA 3VSQA 4N1CA 4KXAA 4ONOA 5JLZA 1X4XA 4PH8A 1NIBA 1PX3A 5CP7A 4JO3L 1AHMA 4L29B 3WBDA 4L3FA 2CUHA 3KLAA 1JPFB 2HG5A 1XVSA 3FT2A 4WJKB 1ORSB 2ZUTA 1W0WB 3SKUD 4TQIA 4IK7A 5IFHH 1BBDH 3IB4A 3QDMA 3GHEL 4AQAB 4N2GA 4BA8A 1CFMA 4P2AA 4K8RH 2VNCA 1IO4C 2YD2A 4U3XA 4F91B 4JFFE 4LASL 3HHRB 4NUJA 1I8UA 2XQ0A 1A8ZA 1FC1A 2W94A 3FUNA 2VOTA 5J11C 3WKNA 3DI3B 3GMNB 4GS7C 1BCIA 4MXQD 4NNYB 3T3PB 1CL7L 1UXWA 5FGCB 5IUCA 4OZFH 4O02H 2AJUH 3WJLA 5GS2H 4W9CC 1AKJA 2XQYG 4N9GB 4X83A 5JYLA 1NUNB 4L2YA 4P5KB 5CZVH 1Q90A 3GSOB 5DMGD 4G8AC 3IGAB 5KVDL 2WLIB 3I02B 1RQ5A 5GRJL 3JWDC 1QNIA 1O5DT 1EDQA 1F90L 5E6IB 3S7GA 4JM4L 1QSFD 2GHWB 2R4RH 3UFIA 2YSSB 1ASQA 5CEXB 2DLGA 4GBXD 4ANKA 1XSOA 1TVHA 1GJUA 1OB0A 4IOFD 5BOZG 5I5JA 1ZEAL 4M7JL 3CSTA 2EUWA 1X6LA 1G5GA 2A6JA 4JRYE 1M05B 3HNVL 5ESAA 3P0GB 3EH5B 4N1HB 1UD5A 3FO1B 3AM8A 1CF8L 5MEOA 3SGJC 3ULVD 1DN0A 3UBXB 3VYNA 2NYZA 5DJAA 3HCVA 1C8QA 5EUOF 3DOHA 3EYSL 1ZLWK 2Y24A 2CJ3A 1NPJA 3N1MC 2JJTA 3E38A 3H9SE 3ZL1A 2GCYB 1DHKA 3U7YL 5JQIB 3EFFA 3ZDZF 1YDPB 1T5KA 3FOLA 3OV6A 4DAGH 1YQVH 4B9KC 4F37K 3ECBB 2VLJA 4JFFB 3B6SB 1H3PL 3HJ0A 4NN5C 1S7QB 3BHBB 5DS8B 1HINL 4NJ9L 4ONGH 3RX8A 3MRPA 2G4EA 4YR6B 3GSNL 4JHBA 4PP2B 1WAEA 1HXYB 4YDZA 2L7JA 2VDNL 1E4XH 3OGCB 4LCIL 1NMCB 1NC4D 2WNGA 4K3EH 4LSDA 1BYNA 1S7XA 1ZVSA 4LCUB 4GRWH 1QKZL 4NB7A 4ZUUA 1FPTH 4FQHB 5D1XC 1F3JA 5D4HA 3CQFA 4L8SC 2DQGH 1NDGB 3SE6A 4DF9A 1KEMH 2EDWA 2VXUH 4U1JB 2Y4SA 5AAMC 3BVXA 3T4AB 4EOWL 1JZGA 2PR4H 4G1EA 4HHAB 4Y7OC 4ZFOA 4JRYB 2DLHA 5E8PA 2JELH 1RIVH 3ZRFC 1QA9B 4PU2A 1EHAA 3MVSA 5KG9B 3NJJA 2AJ3B 1TTAA 3P54A 2EO7A 3I6KA 3C6EA 4NNPH 2J4WH 2WUCH 1TETH 3WFCH 1TT6A 4TTDD 3JWDL 4Q97A 4FJZA 2CH8A 1JGEA 4JHWH 1VGKB 1N7ML 1UT1A 1VFMA 4CAGA 3OJ2C 5DZJA 4Z3TA 5C97A 2R4SH 4KJYB 1LWRA 3OMNB 1CGSL 3APFA 2VJXA 4JKPL 1ITBB 5DI8A 1WAPA 1U8PB 4QJ4B 5I9QB 3WSQL 3WY2A 4EDXB 1NGZB 5JW3H 3BZ5A 3GNMH 4HIHA 5DQDL 5HHNA 3BIKB 5IP4A 1FH5L 1A6VH 2Y06L 4MA8L 5D7JA 1VAHA 3SE4C 2XLLA 1OSPL 3K5RA 3DGDA 2YR3A 5SWZE 5JXEA 4OCXL 3ARDA 4ZD3H 3CH1A 1UATA 4J7RA 3NCJL 4EO5A 5EEWA 1C5BH 3QO0B 2APXA 1OKEA 4TNWF 1D5IH 3RWDB 2V7HB 4R96B 3ZHLA 4DESA 2WD0A 4RFEB 4U1MB 4QRTA 3QRGH 4N8VB 2HLFD 4MMXA 3HPLB 1ZV9A 3UMNA 4NQSA 3QI9A 1M3JA 4H8HA 5K93A 1MFNA 3NFSH 4H25A 1D5ZB 1KJMB 5HPMB 1YYCA 2XWTB 2YJLA 3ARZA 2PW2B 5JHDA 1I1FB 4OV5B 3RZCB 5TFSL 4OT1L 1KDJA 3GMRB 1ACYH 1SYSB 2NY2C 5C9JB 5BV7B 2QADB 3DPDA 3T0EA 3VD7A 4QHMB 3HLAB 1G7QB 1KJ2A 43C9B 1RZQA 2DQIL 4QI3A 4WDIA 3O3BA 3HZYB 1WG3A 3MX0B 1C12B 1MHCA 1XSIA 3T3MF 1A02N 4Q74A 2VXVL 1XGRB 2YFNA 3V6OC 5GSRA 1NFDF 1OP4A 3QQ4B 5SWZB 1DCEA 1L9TA 1WICA 3MV8D 3S3BB 3FCBA 1ZGLA 3L2NA 1OANA 3EFOA 3EGSA 4K9EC 1E6OL 1DQLH 1NQBA 3BH9B 2GUOA 2A0LC 4JPIB 1OHQA 1R5WA 1AZBA 1CD1A 4WHCA 2VQ1B 4POZD 4LHUA 4H1LG 4BE6A 4QXTA 5HVFB 4G8FA 5C0IA 3NEEA 2IF7A 4XNUH 4OLYL 6CGTA 1INDL 2WIIA 2W95A 1YAZA 4LP4A 4YDMA 1A5FL 2APWA 1KJ2H 1BBJB 1HVXA 2QVTA 2JKWA 4YGVA 4ODTH 1VERA 2DMHA 5DHEA 3HI6H 1C5DB 1CFBA 1V5JA 4KXZI 4UNUA 3HZMA 1BOYA 3VXPB 4G8GD 3PDOB 4NQVA 1BG9A 3TO2A 4L9LC 1PKQE 1FP5A 4H4NA 5B1AB 3G6JA 5E1AA 4YSSA 2ZPKL 2PPDA 3H4FA 4TLKA 4XO5A 1I9IH 5KAQG 2XACC 3MTXA 1M3IA 5CGBA 1WCBA 2R69L 1IGJA 4X98B 1UYWL 3MRIB 2V17H 4PR5B 4QXGH 3G5VB 1ZLVK 1BZ7B 1NLDH 3VXSB 2H6PA 1ZA3A 4GXVH 4IOSA 4NQCE 5IR1A 2HVKA 2FYYA 4BFFA 4UNTA 5T5FL 1E8ZA 2Z8SA 4ZK8A 4FQ2L 2XHNA 4P2OB 1IC4L 3P4NB 3WTYA 1KPVA 1TQSA 3I75A 5K9QI 1PG7H 4HF5L 3UDWC 4CC4C 3TL5A 4MAYD 4FFZA 1TEYA 4IRZA 1BFVH 3MUJA 1BFSA 4ETYA 1UT9A 4DQAA 4JQXA 3L9RB 4JUSA 4XAWH 1X9LA 2EYSB 5D55A 3MRBA 1XTLA 2DTML 1A7OH 2WLMA 3VFOA 5C7XH 1QX1A 4K9EL 3KE0A 1VACB 4GAYA 4GMTH 3B3IB 1EVUA 2UXVA 1ZPUA 5FXCH 5JOEA 3H2PA 3FO0L 2BOLA 2V3FA 2E0PA 4Y4HA 1QBML 3IXTA 4JRWA 1HHGA 1SEQH 4HU2A 4N1EA 2OMZA 3RG1C 2YGVA 1GSMA 4X0KB 4BKLA 2OX5A 3DUHA 3OJDB 3H3BC 4J1UA 4UAOC 5IKCA 3PXLA 2Y3AA 2R2HA 4APQA 5ABDE 1PU0A 5CJQL 2E9IA 5LGHL 5DMGC 3TTYA 4L37A 2NQ3A 3EDEA 1T4KA 3M46A 4PGCB 3N41B 1AHWB 4ZOAA 3A3YB 4QJ3B 1JK8B 1AR1B 1E65A 3T09A 1EDYA 5D7IF 3SKJL 3U1SL 4FFZH 4J3UA 5E2UL 3SDCB 2FO8A 1VFUA 4IRZH 2ZYHA 4Z8FL 1GOFA 3K8LA 5KVDE 4IOFC 2F54A 1Y18A 1KTRL 1TVBA 3LS4H 1PSKL 4EZKA 3AXLA 3ZU8A 1A3ZA 1FSKC 4G3YL 2HLEB 2Y5TB 2NSXA 4KUCF 3MBEB 4D9RD 1UH4A 3ULVC 3VWJB 2HTLC 3CZFB 2HH0L 4QTIH 1UACH 1XR8B 4XXWA 3RVVD 1E9PB 3L9EA 5EO1B 1T1WB 3CLFH 4P8QA 4N8CH 1GKOA 2ATPB 3FUKA 3N91A 5I6PA 3RA7H 4MZ3A 4L4TD 3MLVL 4Z7VE 3MO1A 5DDHB 4I2XA 3DX8B 3SD2A 3ZX1A 5J57B 3AB0B 3PABA 1YEGH 4PRHB 1BMZA 1T0MA 4EN3B 4MNQD 1UXLA 3P9WB 1OSEA 3FTWA 4OCRH 4Z5RA 3W0WE 5K9KB 2C7UA 4RA0C 5FA3A 3NCFB 1TF4A 4P5SA 3KNBB 4UU9B 3HW7A 3REWA 2VLLA 3RFZA 4OLVL 3S6CA 1OIOA 5FLVA 1M4KA 1K2DA 3S5ZA 1SJVA 4ICWA 1D5MB 3QCTL 4YSAA 2PCFA 3H7BA 3KJ6L 1E4KC 5ACMA 5HGDA 4G7VL 4ZFFB 1IAKB 4JRXD 1M71A 5DEFA 1WGVA 5CINL 5CXPA 2G0KA 5DUML 3F12A 5HHVL 4ACTA 2CDEA 4Q9RH 5FCSH 2V5SA 2A3TA 4X9FA 4G6AD 1SMAA 3CFDA 4D9LL 2W9EL 4NKMB 5FECB 3F7YB 1KXTB 2LFEA 3BQUA 1YNTA 2KZBA 3VXRA 5MEQA 3SPIA 3UGUA 1RUKH 3QIBB 1U95A 2LVEA 4TTDC 4MAUH 4YFDB 5EU5B 4FF9A 3TO4D 4HJJH 4JFZL 5BS0D 4XP5L 2NY4B 4JVPA 2DYPD 5HDBF 2R39A 1KELH 3TYFB 3FTGB 4IGBD 5AL8A 3QYNA 5IJDC 3W0WB 1A7QL 5ACZA 2CIIA 1KPRB 1KCRH 5BJTA 3ULVL 4XMTA 4DKDC 5KEZA 1AE6L 2W88A 2XWJA 2CD0A 1I4FA 4JRLA 1BECA 4PJDE 4RFOL 3W11C 1MG2C 2ADFL 5ESVB 5GS1C 2QKIA 3BI9X 2FLBT 3GKWH 3QRFM 5ADOH 3QDJE 4YDKH 3CBKB 1KV7A 1CE1H 1L9MA 1VFOA 3GSNB 5C0AA 1EEYA 2HFTA 2HKFH 4DQOH 4WLCA 2VDNB 3HUJE 4WV1C 3ZMRA 2CUAA 4KK5D 3RU8L 3LZFH 3VB8A 2X2IA 4HUUB 4DPCX 3GSVA 3VTTA 4CSSA 3OMIB 3S34L 3V6FA 2HLFC 1YNKL 2EVHA 2ZXWB 4MMZC 3C60D 1F5WA 4PMEA 4JL1A 3GMLB 1N59B 4OB5L 5K1NA 3B2VH 2B20A 2YEZA 1SQMA 4NO3B 4ETQA 3ULAB 2C3VA 3LH9A 4OJEH 1MVFA 4G5ZH 4UQCA 2XRAL 1D7BA 5J11B 4XN4A 4GS7B 2ZXAA 4H8QA 4LLUB 2J5WA 3KDMA 5CIPB 4Q52A 4I9WE 1OF2A 1T7WA 3CXHK 3NOIA 5J6HB 3HE6D 3RB5A 3AU1B 1E28A 4FNPA 2ZYSA 3BP5A 5KBDA 2NW2A 3B83A 2VLRA 4E5XB 4DPRA 1FORH 3V52H 4X6DE 4C4BA 2GW5A 1YJDH 4QGTA 4RAUB 5BZWB 5C6PB 2Y7SA 4TSCL 5LAXA 2YRPA 3ZZLA 4XBGA 4N25A 5IGXL 5JO5B 1HKLL 1FO0L 3B5HA 3NG5A 3VXOB 5HXMA 2UZXA 4PJDB 4PQXA 1JTPA 4W9HC 5EU4A 4WWKA 1ZHBA 2MNUA 4XNDA 2JKRM 4WEBL 3VFWA 4E41E 3QZWB 4KHXL 3CDZA 3L6FB 5A6IA 5CILH 3E1ZA 4G9FE 1JG9A 1ZD6A 2WJ5A 4AVIA 1J87A 4GRLA 1ERNA 3EH2A 1X5MA 1R0AL 4N2IA 1EEZB 1WTLA 2YAQA 5JUEH 5TE6H 4P59H 1SM3H 3CFNA 5IF0B 4XPAL 3KPTA 3JYCA 1SLWA 4KXZH 1LP9F 2X53A 4POZC 4FLQA 3BFWA 4OLUL 4A7SA 4XGZA 1R3KB 4YHLH 4NN5B 5ABZA 5I19L 1NCCL 2QKSA 2JKNA 3QK0A 2P5EA 5EUKA 5TGBB 4Z76A 2WBJD 5EWIL 3IF1A 3SBRA 3PHAA 3D30A 2P8PB 1ZLVH 1A3LH 5EU3A 4YDVA 5SV4A 4HALA 5IV2A 4F2MA 2A83B 3OKKB 2JCCE 3P0YL 4HMDA 4HPOL 5D1XB 1PYWA 4LOVA 4AYDC 1XWVA 4L8SB 5L2JA 4OGYH 1FYTD 1IBDA 3VQ1C 1FVEA 1U93B 5DD1H 5JPMC 3KYNB 1NL0L 4I48B 5SV3A 4NO2B 3NTCH 5DJYB 3S8WA 4CNIB 2A9MH 5HY9A 4XP6L 5JW5A 4UT9A 2FEEI 5C0EB 1HYSC 1P7QD 1AG6A 1RHHA 3EBAA 3PWNB 4AW4A 4N26A 2FWLB 2X5PA 3NQKA 1YEEH 1A66A 4BSVB 1Y6KR 2HSIA 5KYUA 1J8KA 3EDDA 1KC5L 2Y1AA 3BUIA 3I50H 4UQAA 4K94H 3BT0A 5D2LA 3QQ3A 2Z4QB 1CDGA 1LE9A 4K71C 5I82A 1TJHH 2P28B 4ZMVA 1YC8A 2LLGA 4FTVB 3O4LB 3FF8A 4NKIH 3V5KB 2HFFA 1FNLA 4KJWD 4H40A 1CYWA 4MAYC 3RWHB 3ZE2E 1R24A 2GAZA 5AENA 2Y7QB 1EBPA 5AW2B 1MAKA 1R19A 4M62L 4XH2A 4QXVA 5F9OL 3NA9L 4M8QA 2V7NB 1FA4A 1DVFA 3CFCL 3U25A 4L8DA 4PS3A 1A6ZB 2IPKB 2WZPD 1BOGB 4XVTL 1AO7A 3EJUA 3V6OE 4JFEB 4B9CA 7FABH 3GB7B 4GRWF 5T3ZD 1HYRC 3N43B 4R3SA 4O4YL 1WD9A 2JCCB 4UT9H 1U3HC 1FFPB 1S9VA 3QDMD 3NFPB 2FX8H 4HPYL 2AQSA 1CS6A 1ZLUH 4AYFB 1JHLH 2CO2A 3OPZL 3TV8A 5F3FA 3Q2CA 2QQNL 3IPBA 8FABA 3VXTA 2FL5B 5ISZA 4JPWL 2PP8A 4OW6A 4HSCX 4UM9D 4FQIL 5CSBA 1NEZB 4HU8A 4R26H 1BEYL 4WSJA 1VSCA 2GSGA 2R7EA 3VQMA 5ILTH 5FM5O 5I1AA 1CFVH 5E8DL 3US9A 4W9KC 4LHQB 5H37G 2R0LH 2OR9L 3VFGH 1UOWA 1A21A 3D4YA 5HYJA 1YN7B 2ZWYA 4LEXL 3VW3H 1G7JA 3AQDA 3T65A 5LAPA 3ZN6A 5AYUH 1N18A 3QIWD 1Z9SA 2NY2B 2MIZA 1NBZA 3MN8A 3SPCA 3RVWD 3LKQA 3ZE2B 4PS4H 3RWCA 3WIIH 1S5HA 3EXLA 1KB5L 2Q1EA 3SKMB 4G7QB 1HQRB 4HIXH 4OAWB 1SPDA 3FO9B 3VXUA 1SF5A 3EGDB 5AB0A 2IOOA 2VDMH 3VI4B 4FQ1H 4AGOA 2DLTA 3C6SB 4YO0A 3U48A 5LKNA 3OWRA 1NOFA 1NM9A 1QBLL 1IBZA 3D0VB 1DUZA 3FQUA 1Q0YH 4PG2A 3HNSL 3LQMA 5E5MB 5JW4N 4FFYA 4XNXH 2P8MB 2XWZA 2COVD 5HI3D 1DJSA 2IXQA 1QRNE 4HDIA 5T1MA 5KVFL 2QFRA 3ATFA 3ARWA 4XBPA 5MP6L 3L1OH 3BVDB 3F00A 4FG2A 1N2RA 4FQCH 4N20A 2DF3A 1DVQA 2E7CA 4M3KB 4GSXA 2AJZA 4D9QE 3B9EA 4IIZA 2X89D 3GJFK 2XV0A 1FZMA 1A14L 2VDPH 3SOBH 3F58H 1NWOA 4CRPA 4CN4A 3WGVB 3LIZA 4M4RB 2V4LA 4TS6A 1KXVA 2E8ZA 1FVCB 2G3NA 1CDUA 3SCMA 4G6AC 1X5FA 1ZHNA 4XP9H 3OKLA 1T5WA 4N87A 3GSXA 1CO1A 3ARED 1JPTH 4QRPA 5JIPA 2KDYA 3SJVA 2VIRA 3MI6A 4KPHL 4Q2ZA 4MA7H 4ZUWA 5AW5B 3SBPA 3UYPB 3CZSA 1Q1JL 1RP8A 4L9LB 4MKMA 3GSUB 3TO4C 2HG0A 4GW4B 3G6AA 5EFIB 3UO8B 1JBJA 4Z23A 4FFYH 4JQVC 5D6CA 5DQJA 3PL6A 2W0FA 1OAYL 4IGBC 1IEAA 1ZT4A 5INDA 4X8XA 3U83A 3SGEH 5GGQL 1QSFE 2FIKB 3P11L 4ELKB 5DD3H 1XF3A 2HWZL 3ZMEA 4ADIA 1LWHA 1ND0B 1QRNB 2IAMA 1DE4A 2UY6B 2XQYA 3HMXA 1KB3A 2GJJA 3L7EA 3LIZH 3PP3H 3QJRB 5KVMC 4S0HA 1OHZA 3APDA 3X12B 3RGHA 4L0YA 7PAZA 1LYQA 5M95B 1INEH 3FB7A 1EMTH 4O9HL 2D31A 4UNVA 3DXAD 4TUKH 3EYVA 2NY1D 1VGEH 2QT6A 2RGSA 2D3JA 5I1GH 3CMOH 1B88A 1I8KA 2P3YA 5L4FA 3QG7L 4U3HA 4YIQB 2JB5H 1E2VA 1MJ7H 2AXFB 4G8IB 4QHPA 4UIKL 5IROA 3R8QA 3C60C 2W9DL 3DWTA 2EDRA 2ICCA 4HJGA 4E41A 4RAVA 3QUYA 3PHOB 3UJJL 1JPEA 3QVAA 2XTJC 5FA4B 3DJ9A 3FUMA 4Y5YA 4R4ND 3FPYA 1UM6H 3EJRA 5I74C 4AXWB 5K39B 2DQEH 4WHYG 3NCWA 4G6MH 3GMOB 3MUHL 2HP4A 3RWFA 4Y5XA 1ZTXE 3JV4B 4L8BB 2DKSA 5ICYA 3ZYIA 1Z9NA 2EXYD 2WWKT 3MODL 3HMXH 5EOQH 1QSFB 4KKQA 4LBAA 4NUQA 3T0ED 4NM8H 3MACH 3GS0A 2BVUA 4PRID 1L7TL 2GTQA 2WSKA 3GPEA 4MS8D 4PJFE 3JT2A 3ZMNA 2KDGA 2UZIL 3VFPA 1FSKB 2OYLA 1FGNL 2RFXB 3EUUA 4PJAA 4PVLA 4CMHC 5FPIA 5I8EB 4HWEL 4K73A 2G5BB 4AC4A 1NSNH 2X4PB 2XIIA 2ZE0A 3QBTB 1JPGA 2R0ZH 5AW3B 3KLKA 4YX2H 4KXDA 3WNLA 5F7EH 4MD4A 3GBNL 5DRWB 3HR6A 2JF1A 4Z7NF 3BAEH 1HE8A 3U9PL 1F6LL 1HI6B 4HJUA 4IHOA 3FU9A 1AGFA 4AYID 4Y8AA 2WBJC 2XX1A 1XGUA 5I2IB 3JV6A 2FJHB 4P4KD 5E1QA 1B90A 1E0OB 1BGXL 1IBHA 4QWWD 3VFSA 4H5SB 4QHNB 4S1RH 1EHLL 1TNMA 5K9OB 4OZHA 1SVBA 1YMHA 1G7HB 4MQTB 5EUOB 4KTDL 3ZBMA 2Y36H 2ZCLH 3LB6D 3FQRA 3VFMA 1K5WA 1KYFA 2WMPA 2I5YL 2JLLA 4ZO9A 1I1YB 1ITCA 1JZ5A 3UADA 2AZUA 4AEEA 1UD6A 3K0WA 4JO1L 1IGYA 3ZDZB 4PJ7E 4RWHA 5LGJB 5EEYA 5FGSA 4FNLL 5FYKE 1KLUB 5FWQA 1AZUA 1SN5A 4Y8DC 3CSPA 4OD2A 4IBYA 3BUYA 4RX4D 3GRGA 3ATEA 4U6XA 2QSVA 3HMWL 1WP6A 3FT3A 1D6VL 3MLWH 3VH8G 2VLMD 1G87A 4KJWC 4NRXB 3PGCA 4AKOA 1CN4A 3WNOA 1YEHL 4G7SB 5JHLA 2D4DA 2DICA 4XVJH 1MPAH 3MJ8A 4FG6D 3CXDH 3H3PL 3LEYH 4DKFL 3O6KH 2WP3O 5GS1B 3MBXL 4LP5A 2E9JA 4DZBB 4AEIH 1QFHA 1SXBA 2P7TB 5JA9A 5D7LA 3TBTA 3MLYH 3MGOB 2GTZB 3ZIYA 1J9RA 5LQBL 1AFVL 1F4HA 1DEEB 5TTRA 1M7DA 1RZFH 2MMXA 2XYBA 3K8KA 5CMAB 1J5OL 3CH8A 3NH7H 3Q7JA 4ISVB 4WV1B 1B3JA 3CLWA 2GITA 4Y4HD 5DTFB 5GISL 1J1PL 3BPOC 4LPYA 3HN8A 2VGLM 5IB3A 3S9DB 4R5VA 1KCUH 1IQDA 5FYJU 3DUUB 3TCLB 1LO4L 4PLNC 4OI9A 2D7TL 2CLVB 1KNOB 4XPHH 1OY3B 1LMKA 4MMZB 5AVVB 5EF0A 4WUUA 2V2TB 2R83A 4B9JA 3FUIA 2DWEA 1OQOA 1WBYA 5AEAA 3WJLC 5MENA 4MDIB 1TZIB 2P5WE 4NPYA 4F20A 2Y2TA 1T7XA 2IANE 4ERSL 5F1KC 1XHHA 4U7SA 4PG9B 3IFLL 4QCIB 3ZR5A 5IHUL 1RK0A 4OF7A 5JHLH 3HG3A 5AW9B 3QPQD 3TN0A 5ES4B 4CSZA 1NFDE 1CU4H 1GMEA 4G42A 3RVWC 2OZNA 1HWHB 2KQMA 3MZGB 4R4BB 3B5TA 4CC1A 2FZ3A 3T0WA 5I5IA 1GVIA 1JVKA 4HKXA 2LU7A 2F5BH 2YPVL 5DUPH 4HAGA 1H5BA 2BVQA 3MV8B 4O02L 4B0MM 1SHSA 3N1FC 5CZVL 4IU2A 3F7QA 5AOMA 4F2EA 5F89B 1Y6NR 2Y7OA 5KSBA 1A1OB 1DQQA 2XA3A 3PYCA 5L6YH 2HKHH 5HI3C 3QQNA 1F97A 2HT3C 3BH8B 3D4CA 5TPWL 4ZJ9A 2QPUA 1HTYA 2VUKA 2YAPA 3BMVA 1WZ1H 1UUNA 2V2XB 3IKKA 1NCWH 4IMKA 4JO4H 3UC0L 3VFRA 2PCPB 2P5WB 3P69A 1UGNA 3IRPX 3TT1L 2X10A 5T3ZL 1YQ2A 2ZKXA 2IANB 5KVFE 4UWQB 4P46D 2WVUA 1YECH 3SDDD 2J2ZB 3MRJA 4NAMA 3WNPA 2G3MA 1BQKA 1MFMA 3AWGA 4G9DA 3T3MB 4JFSA 4O58H 1J5CA 1ZSDB 2QTEA 1NFDB 3VVWA 1NTDA 3LXCA 3PWJA 2Z7WA 4N0RA 3QHFL 5DJ0A 4N4YB 5LB1A 4PW3A 3HFFA 2ZP8A 4TL5A 4DAGL 1SXAA 3KWXA 4FXKC 2ITCA 2WBWB 2K7QA 4ILDA 4PJIA 4HK3N 5JPMB 2KLSA 1FV1A 2DQUL 2IO5A 3OKDA 1URLA 1AHKA 4ONGL 3BP6A 1JAEA 1NGYB 1KB5B 3OXRA 1VENA 3GMQA 3HG2A 3GLAA 1E4XL 4M48L 3VG0H 3IJ8A 2ARWA 2YOAA 1EZSA 3LIUA 3ZQXA 1XGYH 5EU7C 2PTTB 4N2LA 1PLAA 4H8WH 4JDVA 5D9SA 2BOCB 1I8MB 3PDDA 1D5XB 4LESA 4BV1A 2WNWA 4FZEH 2OM5A 3MA7B 2RB8A 2NXYD 4K71B 3V4UH 4KJQC 2DQGL 4FTDA 3AS0A 2KYIA 4R7DA 1S7UB 1KEML 2VXUL 1J5IA 2PR4L 4YFEA 1BXVA 1EGJL 4MAYB 1JZ6A 1ZKAA 4LVNC 2QELA 5D7JC 3PJSB 3NQIA 1ECYA 1ZS2A 4XZUB 4QRRD 3AG3B 3W5NA 4AQEB 4JZOB 1U41A 4F7MA 5KSVB 1Z1WA 2R1WA 2BS8A 3ARDC 1JWMB 4NNPL 3BPCB 2J4WL 5DZOA 2YD8A 3R7RA 1U36A 2IDCA 3JVGA 2ZG1A 4BQBA 3QA3B 4Y1AE 4LSSH 1U3JA 3UCQA 3TIEB 2YD3A 4HS3B 3SGDH 1S7TB 4JHWL 4FQQB 3S98A 1U3HB 1L0XA 5AYQA 3FOMB 2NUTB 2PPFA 3QQ9C 1DDTA 4N2AA 5F7NC 5GGSA 4MMXC 3S88L 1F2QA 2PO6A 2YQ3A 4JFOB 2ITEA 5D7IE 1SYVA 3C5XA 3IJYA 3ABLB 4M5YL 4QO1A 3V4VB 3X1FA 5JW3L 3QWNA 1G9MH 1HDMB 3QXTA 4R4NC 4G72B 4U33A 5A6LA 3VFVA 3TH3T 1ZT7A 4LEOB 3TBSA 5L0QC 1OCWH 2K6YA 3DX0A 2B5IC 1U91A 5CSZB 2P47B 5IT2H 2CLZB 2EXYC 5TH2A 1T66D 3UL4A 3B2MA 3ZE0F 3T0EC 1VPOL 4EI6B 1EXUB 1C5BL 4YSDA 4AUYA 1TENA 1UCBH 2CHXA 2A9NH 1D5IL 4X6BA 2IMMA 3P30H 4MS8C 2P42B 2F2HA 4RNRB 4F7PB 1RK7A 4XRCA 3QRGL 3NEXA 1GW6A 4Z3JA 5L8KB 3A21A 2BNRA 2VDLL 3IM1A 2D7QA 4NO0A 1IUZA 5A2CA 3DLQR 4L4TB 2AEPL 3GC3A 2AK1L 3AY4A 2EE9A 1OARL 3HC4L 4EE2A 2F8VA 4V1DA 5EZPA 5JZ7D 1EK3A 4UAHA 4AVKA 4MNQB 2G9HB 1ACYL 4XNZC 2WWNA 2K4AA 2FO1A 3RWGB 1Q9WA 2VZVA 3O3AA 2YFOA 3DPBB 4Q89A 5D7IB 4ZNCD 4PTTA 1T03H 2GJPA 3JZYA 4OZIF 4RGOL 5I17A 3QEUB 5D2LF 3PU7A 1IQWH 4HD5A 5GGSY 2OTWA 3BP7B 2P5ED 3OHMB 3P9LA 4P4KC 1MJ8H 3QCUL 3HC2A 4HJTA 4JGMA 4L1HA 4QWWC 4X6CA 4WKXA 1UHVA 1NAKL 1G7MB 4L1BA 4D0DB 3OKNB 1GIGH 2NTFB 2H2PC 3UG4A 1HEJC 2X9WA 4JRXB 1NDTA 3LEVH 2NT0A 2V5YA 3L7FA 3U9UA 4XMKH 3BAYA 5E9NA 1XR9B 1R75A 3LB6C 5DVLA 3WNMA 1BPLB 1X5LA 4N0FB 3X1BA 5FOBA 5A16A 2QSQA 4TSBL 3S36L 1DQLL 2BP8B 1S9WA 4XNAA 4LAQH 5INCA 2AVFA 1JRHI 5HDBE 1AGBB 2CIKB 4P5TA 1R47A 3IFOB 4DGYH 4WI0B 3VXME 1YEDA 2XTJE 1AXSA 4PRNA 1DJGA 2DMCA 1LK2A 4HHGA 3NT0A 4NZRH 2P48B 3TO4B 5M7QA 3D69B 3ARUA 4GSUA 2QQLL 2DYPB 1MNUH 3VGAC 4CGTA 1EWHA 4X5PA 4XMWA 4IGBB 1Q94B 1CVRA 1A6TA 1RPKA 4CUCA 2B0SH 3B2XA 4EJ1C 3MLRH 4HGKC 4ODTL 4BDVA 1FNGB 4JKMA 4U7MA 3HI6L 5J3HD 2MNWA 5KSUB 1ZLDA 3A0OA 2WLZA 3CDGA 4M7LH 4FG6C 5DRZB 1HEZA 4OVVA 1TZGL 4HUWB 5C3TA 1ROCA 4JQXC 1PZ5B 3UZQB 4C58B 3AT9A 1FE8H 1I9IL 5AB2A 1XGQA 1MCRA 4ORGA 1BF2A 2V17L 1S9XA 4QXGL 5FYLH 3PAZA 4LVOC 3II1A 4Y4HC 4FNUA 1BHGA 3IRCA 4FHKA 4POUB 4GXVL 3TA3D 1OTTD 1ZOXA 2WXOA 1LQBC 4ZO8A 1I8IB 1FLTX 3O6MH 3Q3GB 3ZIMA 5JR1L 3KPSA 3C60B 5HDBB 3TVMD 3ZW3A 4GEIA 5EEXA 2YRLA 1DQTA 2J20A 3IDMA 2BIMA 1NICA 1PG7L 5DLLA 5CCJA 3ARBA 4X5LA 2XTJB 3FULA 3EOBA 1BAWA 1BFVL 1P7HL 4FDWA 3PY9A 1OF0A 3AS3A 3K74B 1BQHB 2BWQA 4KKRA 4XAWL 3LXBA 2UVFA 5I74B 5IJKA 4FA7B 1UCTA 2BOBA 5C7XL 1A7OL 2LU3A 4KO5A 3MYJB 3Q8CA 3QPQC 1HE7A