4YS4A

Crystal structure of pf41 tandem 6-cys domains from plasmodium falciparum
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
351
structure length
258
Chain Sequence
b'MGKSHKCDFTKEKYLLSGEKEVSCEIDANPADDITFICPNLCFHTVNIAKNINQNKATMSIQDLLYGSVVYGNTLFISPYVRTNTPFYCFCNLDTVTIQKFLKINRFLKDDDELSIISKRGIMSVFVRSNNNVIKGCDFGNNNKNYFSHPISVAGVNNKVCKIQGKPGELVGFKCAFEENGKVEPPNCFDQVLHKNKVTDLKTLIPGYASYTNKHSSKYPYYLKIPHFVNEQYTIQCCSNNAQNEYTFELDIQPGESE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Merozoite surface protein P41
publication title The Structure of Plasmodium falciparum Blood-Stage 6-Cys Protein Pf41 Reveals an Unexpected Intra-Domain Insertion Required for Pf12 Coordination.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 63
structure length 258
sequence length 351
ec nomenclature
pdb deposition date 2015-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ys4A02
2YMOA 2LOEA 4YS4A
chains in the Genus database with same CATH superfamily
5T5NF 5K69A 3GIZH 1KY6A 1QMUA 4HS6A 3ZR5A 4LNRB 4NX0A 4UYQA 1S7VB 3CSYB 1E30A 1XAUA 3NEXA 3L7FB 4ZTPH 4CBPA 2CLRB 2GIYA 1MIMH 2ZYSA 3D2UB 4JR9L 4U6TA 3IJ8A 3POCA 3B9KB 4Z3FA 2ZKHL 1UA6H 3C5SB 2DQUH 3RVWD 1KPVB 1WCQA 1ZE3H 3FT3B 4GSXA 3LEVL 4XNZB 4QRRD 5J9PB 5FYKL 1CICC 1CD8A 4KTGA 2QV4A 4U0RB 5EN3A 4AKPA 3BSZL 3OZKA 1J9SA 2DWSA 2MMXA 1FYTA 1KT2B 2NY5H 4KO5A 4RH4A 4XN2A 5AALA 4L4TB 3IFLL 3FB8B 1QUNA 2BZ7A 4YHKL 3RY4A 4FA6A 1RZJH 3VWKA 4N8CH 1MFVA 1H8LA 1TFHA 1QASA 1WQVT 2DLIA 4L5FE 1L9MA 1X9QA 4YR6B 5C0CD 5AWNL 3T8XB 5HDLA 3FUDA 2BHUA 1UXLA 2FO8A 3WU1A 5D2NC 4OF7A 1IAOB 2XZAH 5BRZD 1JZFA 3FQ4A 1DBBH 1MH5B 1GMEA 4H8UA 5E1AA 2L0DA 2Z91A 3WXWL 3EGDA 1HEJC 3IT8D 5MENE 3MJ7B 5LGHH 3T09A 2MQ0A 2JLPA 4YFEA 4D9QE 3H7BA 4GAFB 1R34A 2H6PB 2P48B 3PAYA 4FULA 3UG5A 4PTTB 3GMLA 5E51A 1J8HD 3DXAD 1Z9OA 3CFEA 4ONFL 3RTQC 2C3HA 3VD1A 3LQAC 2BVUA 4XNAA 2DWDA 4YSDA 1MZYA 1KEML 1S7TA 1QFWL 3G5ZB 4MMZC 4PP2A 3RWHB 2BJMH 2NQ3A 4NFCA 3T2LA 4JFTA 5AW1B 4WI2A 3EGSA 4WI0B 4ZK8A 5ANMA 5GS0D 4ZFFA 3DMMD 5CUSH 1IILE 5BUPA 3JV4B 1UACL 4HK0B 2HJKB 4GAYB 3MOAH 5FO7B 2AXFA 1BVLB 1JF1B 4AXWB 4O4YH 2EC9T 4R96B 5JZ7D 5FKAB 3NJIA 3BPNB 2XYCA 4YHPB 4I48A 5DD1L 4GLRI 1MCOL 1VZIA 1ZLDA 1PAMA 2W8CA 2XN9E 3OHXC 1WS8A 4KXCA 4OCSL 5GSVA 1FI8C 1JZEA 4ES8A 2ITFA 5C0EB 3N41B 3GI8H 3DROA 2CHZA 4OCLC 3L3IA 5LGKA 3O41B 1XH2A 4B3VA 4B50A 1I1FA 1I9RL 5JW4R 2WLMA 5T33H 5CJOL 3SKJL 2Y22A 3RVTC 2A4ZA 4UT7L 1A3ZA 4JZNB 4JJOA 4FQLH 2E8YA 1EXUB 2WSPA 5CU5A 5AVTB 4E9VA 4D9LH 4TNVK 5EEZA 3OJDB 2CA3A 3TO4D 4U1HB 4QHLA 2JJTC 3ESVF 5IB4A 4C57C 4TUJA 1TQCC 4P4KC 3QP3A 2QHLA 1PKQA 1BJ8A 2Y69B 4GLRH 5GGTL 2WXOA 1MHHB 5FA3A 5LBSA 3CMOL 3NYKA 3FS9A 3QUZD 4G7YH 1YY8A 2CO2A 3MROA 4RMSA 3HE6B 1MY7A 4F8QA 1BWWA 1N18A 3GSUB 3FB7B 2W07B 3L4YA 1BJ1H 2XV6B 2D3JA 4GIAA 2C3XA 1KYOK 3QC6X 2PCXA 3ML8A 5HVHC 1Z9SB 3QEQB 3MNWB 3DNKA 1D5XB 3T4AA 1KZYA 4BD4A 4YUEH 2AERT 1AS8A 2CK0H 4DH2A 4HT1H 1Q0YH 3SKNA 5BW7C 4KTEL 1WFIA 3FU9A 4NGHH 3VH8B 3MFGB 1BIHA 4PB0L 5D9SA 4ZUUA 3DPBA 2IXQB 2GK2A 4UILL 2LE9A 2WXRA 4X7TB 3GRGA 1OARL 4NRYB 3VXUA 5C0GB 2IADA 4IEFA 4BIKA 4QJ4B 1QYGL 1VHPA 2AAAA 3V79C 3BCFA 4NPKA 4GAGH 5DTFB 3D4YA 2GFBB 5CN2A 5F3HB 1AOZA 3HN3A 4L8BA 3BH4A 2HXAA 4XNMA 1YY9C 2EDRA 3HKFA 1OWRM 3B43A 2NUPA 2NLJB 1KGJA 4QT5A 5I2IA 5I75C 3MLWL 3R0MA 3EJSA 1AR1D 1KBGH 2J3SA 3VRIA 2BXYA 4ORGA 1MCLA 4QGTA 5IROC 1SFHA 2O6EA 5DQ9A 4OBSA 2NUTA 1JFHA 4AT6B 1G7MB 4JFOA 2XFXA 2F2HA 4CN4A 5JTWA 3MJ8A 2G60H 4H2CA 3CPLB 4Z7OB 4U0RC 1WFTA 3WMQA 4ICWA 5ESAB 4DGIL 3KL5A 3MV8D 3ZTJG 3PWJB 1JD9A 3KGTA 1A65A 1XB8A 4A6YB 3OKEA 4H13C 1HQRA 2CBQA 5BNXD 1QA9B 5A7BA 4X5QA 3RY5A 1MREL 1JNLL 4KY2A 4XO8A 2V17L 3SDXB 3AABA 4XBGA 2CBMA 1SBBA 3BPOC 3N04A 2WQ8A 3ASWA 3HJEA 3P30H 4FXKA 4Z7UB 4YZWA 3KPQA 1JZ6A 1IAIL 4X0NA 3PHQB 2DLHA 3G9AB 4DN3L 4LCWB 4PRHE 3B9DA 5CINL 3AJ7A 3MMEB 1U91B 2GCYB 3D34A 3SGEI 3EHBB 1WSST 2WO4A 3U7YH 4A7TA 1L7TL 4UDTB 1QSEB 4WDIB 2F6AA 1V05A 1ZVYA 2A4CA 2QQLL 3B7TA 3BQUB 4TLTA 5IFAL 1LXMA 2NX5A 5A2KH 4N4YB 2J2ZA 1QHPA 4I87A 1J88A 3ATDA 5HHOA 2BSSB 3PWPE 1D5BB 1XH3B 2RHEA 1AZNA 4LSSH 2R29H 4RQQB 4PTUA 1MAJA 4EDXB 1FFTB 3O4OC 2J44A 3SE9H 1H8SA 1A5FL 4NQSB 4XTRC 2L7EA 4Q9CA 3FQWA 4IHOB 3RNQB 3SGEH 1I8AA 3GKWH 3RWEA 3BKYH 4NZUH 3MKGA 4G9FB 5F71A 3GSVB 5DZAA 4ZAKD 4TVPL 2Q76B 1B0GA 3P77B 3ZDYF 1CFSB 2A74A 2YO3A 1E4KC 4KJWC 3VRLE 4HV8A 1WIPA 4W1TA 3PPEA 3FOMB 5I0YA 3TURA 1JCKA 4I4WA 1J48A 1TJHL 4CVUA 1Q0XL 2Z3FA 1LD9B 5GZOA 5EBGA 5I5IA 2YRLA 4PGZA 3GGWB 4X0KA 3D25A 1WGVA 3R06A 1UD4A 4JFDB 1G7PB 3SY6A 4CSSA 4N24A 1IUZA 3S35H 1XT5A 3VXQB 4NO5A 4G72B 3QR1A 4E9LA 4PCSA 2IWFA 3RNKA 3SYQA 1BZ8A 3BGMA 4PM1A 3QG7H 1HS6A 4HIJB 4EKXA 2XKNA 1O9ZA 2CRZA 3UYRH 1FVCA 1A3LH 5B8CB 5CN3A 4OVVA 4NQUA 1XGQB 1QPXA 4R84A 3FHQA 3PL6D 3ELQA 4LIQH 2AQ1A 2EYSA 2VIRA 1YYMH 4JY4B 4P23C 5D7SL 1GRWA 3MRIA 2AF2A 1YMHB 3PUCA 5KBDA 4JGUA 5IK3B 5IW6A 2EEBA 2R2CA 3OLIA 1P1VA 4P99A 4PGBB 3II2A 4ONGH 2FATH 2OMUA 3U1PA 1NGQL 3X1BA 2ZOWA 4IU2A 5I1HH 1J0YA 3OKOA 2YARA 3DX9A 1Q0EA 5EU6D 3GFUA 3JV5A 1P2CB 1H3WM 2HVKB 1WGOA 4X6DB 4EN3A 1AD9B 1PLBA 3ILPA 1WCBA 4YSTA 2GIMA 3A21A 3MLXL 2P7TB 2YRZA 4QMEA 4U3HA 4GMTL 3D4GA 4DGVL 1PD0A 3DURA 3UZEA 5CEYB 5AOKA 3WNLA 4UBDD 1NQBA 2VSKB 4ZFZA 3ZMRA 4ZSOA 1F4WL 3KPTA 2ILLA 4O58H 5AB0A 5IMLA 1G9EA 2VDMH 2OTUB 3F58L 3LN9A 1J1OL 2O5XL 5I1JH 5CEZH 3RGHA 5I71B 3IKCB 3OAUH 4YH6A 4ZW3A 2WLIB 1EEZB 1BVKB 4UIMB 4FN0A 5IESL 2ESVD 4MJID 3TBWB 2ZUSA 4GRWB 3BH8A 1RP9A 1HVXA 3ZT7A 1TJGL 1Q38A 1KWKA 5E8DH 3RGVA 2E86A 3BP5B 1GS8A 1T20B 3PWVB 4MA7L 5GGUB 2C5DC 4G7VL 3HR5A 4HKJB 4TUKH 3O3UN 3VWJD 4TNVF 4PRIE 3UAJA 5EEYA 5J12C 3QA3A 1E9QB 1GZQA 1BMZA 1OSYA 3W0WE 5C3IA 3HPLB 1ID5I 4V33A 2MKWA 2X3BA 2J21A 5GS3A 2NNAB 3EHBC 3VCLB 4Q9QH 1T1XA 2WXGA 3WAJA 3NTCH 4PRNA 3EH5B 4F5CE 1FHNA 1OHZA 2LOEA 3BWUF 2A9AA 2QR0B 4AITA 3O45A 1S7SB 2HT3C 3K72A 3RWCA 1TLMA 4PWJA 5C07A 2IQ9L 3V9FA 2WXFA 1FE8H 3S3SA 5F7KC 2QTEA 4Z7WB 3ZRCC 2EICA 1EAJA 2FR4A 2I24N 3O8XD 1LK2B 4LLQA 3MLTA 2KS0A 4P46D 4XPBH 3NACL 3V6OE 4UM8A 3F7QA 4YFDB 4TULL 5E8PA 3VXRD 3BUQA 5D6DA 1EVTC 3AG1B 1NDMA 2YAFA 2GUOA 3CHOA 4DEUA 4HF5H 4QYOB 5IB3B 1BGXL 2CLZB 4V1DB 4AQ1C 4Y4HB 2GT9B 4PJIB 3ZZSA 1EGJH 1T0OA 4MRBA 2GK0B 4FQPA 4M9OA 4R8WL 4WCYH 3ARPA 4OD2B 2EZ0C 3RPBA 4UOW1 2R29A 2K70A 4HAFA 1TTFA 3A24A 3P73A 5KBNC 2WSKA 1DVFB 1PQZA 2JI1A 1J5OH 3MRJB 5KSUB 2GJZB 3DX1A 2CDFA 5ACZB 2R15A 1AMXA 2QZQA 3MAWA 3KS0J 1EJOH 4IIQC 4IS6A 3W56A 4NYLB 1D7CA 4Z7NE 4QXUH 3EBHA 1Y07A 4FFTA 3CLEL 5IBUG 2DQEL 1SN5A 3MBXH 3DX8B 1ZIBA 3GZPA 5EBMB 3QH3B 3CVHH 3VFOA 2XPZA 4AGPA 3EFOB 1P9MA 4IRJA 2OZ4H 1VADB 3BIKA 3KWTA 1BEYH 3JWNH 1CL7I 3OGOE 2AQPA 4KK9C 4UOZA 2Q8BH 2FX9L 1RURL 4H25B 2R1YB 3SYPA 4HALA 2WLKA 2GJ6A 4HETA 4KI1A 3CZLA 3GIZL 1VEMA 3N5AA 4ABVA 4YS4A 7PCYA 1JZ4A 3CFKB 3KPOA 2Y7QB 2Z65C 1XGZA 3E1ZA 4KDVA 5H8DA 4J3OF 1XXDC 2H1XA 1A4JB 4GXFA 4MJ2A 3PJNA 4PGEB 4ZTPL 2OSLA 3ES6A 1SLWA 4WUUA 2XA3A 3EGXB 2VZSA 1UA6L 2DQUL 1M1SA 5I1EL 4XCEA 3EJTA 1MXDA 2FIRT 2H8PB 2BNRA 4Q9BA 5L2KB 1RJYB 5C09A 4WFFD 4FQCL 2NY5L 4HKBA 2DV6A 2NTFB 2VMFA 1RZJL 1OK0A 2F58H 4N8CL 4UTBL 1M42A 4HKXA 5I17B 5L6YH 4WENB 2FL5A 4WW1B 3T0EB 5JIQA 3RFZC 3SQBA 3QIUA 3WBDA 1QO3B 3TA4D 4B41A 3V6OC 4DVBA 4FA7B 3O0LA 4FEIA 3FULA 3CFCH 3MVSA 5ALBH 1DBBL 4J28A 1BQUA 2EE6A 1UVQA 1G6RB 3AXLA 4NC1C 5F96H 5I71C 1CVSC 3UP6A 4ZXBA 1KUMA 4Q4IA 4DT2A 4NM8H 1U21A 1T5XA 1T0PB 2GC4C 2QQNL 3FOLA 3V5DA 1E3ZA 3IAQA 5C86A 4P4KD 4XBEH 4H40A 4U7SA 5JYLA 3AU1B 3UTSE 1A14L 4O2EA 2WKOF 2D3LA 3B6SA 4N9OB 2X4SA 4B9CA 1E9OB 1JGIA 4HIIB 1L6PA 5BJTB 3QWNA 1MN4A 4OF6A 1CIUA 1AXSB 1H5BC 1HAUA 1HDMA 4HBQA 5IJKA 1NMCC 2JTDA 2BJML 5HHVH 4YHIA 4PJDE 1EQWA 5AKSA 3ULVC 3TN0C 3SN6N 1GYCA 5CUSL 5MEQB 4HUWA 5C0AA 1U3JA 1MFDH 5DJAB 4Y0GA 5D2LE 3MOAL 4TQPA 4NT6A 3RIAF 4M8UA 1PU0A 4O4YL 2QTVA 4JO4H 2R23B 5IVOA 1YLBB 2QPEB 5MEND 1B3IA 1T7VA 1IGCL 1YQ2A 3F7LA 3RDTA 3FU6A 3UTQB 1L6XA 4AL8C 4D9QD 1AXTH 1F86A 2EKSA 2YD3A 2RACA 3MX0A 5KS9B 2P8LB 2A5UA 3LVEA 4OH2A 1FJ1A 2D0FA 2V9TA 3ZL1A 1JE6A 1OF2A 2QEJA 2DI9A 5EDXA 2VABA 5EEVA 1TTRA 1AY1H 1SHSA 1ET8A 5T33L 4F58H 3BD4A 3X13A 1YY9D 2MCAA 1MG3C 1HINH 2YWZA 4FQLL 3WFDH 4XP5H 4P3DA 1IEHA 2IIJA 3VI3E 4I3SL 3MDJA 1KC5H 4WZ9A 2XIDA 3L3JB 5I9QB 4E5XB 1MCNA 4DEPB 5L2JB 5IROD 3V52H 2XN2A 1DFBH 1FYHB 3G5YB 4TUOA 2IANA 4ETYA 5FC9A 1FL6A 4G7YL 4ZI8A 3J07A 2X6VA 4QOKE 1MRCL 5IBTH 2X89D 3L54A 4PV1C 1BSIA 5DJCB 4AQEB 1F2QA 1Y0LA 5IW3A 5I1AA 4OZGA 2H7WA 3D3VE 1I9IH 2XN9D 3FU7B 5F9JA 1TITA 3QARA 3UP1A 2PTTB 3D07A 3UFIA 4HJSA 4KXDA 1AKJD 1EGJA 5IVNA 1U3HB 1SXZA 4YUEL 3CBRA 2CK0L 2FJHA 4G8FB 1Q0YL 1P7QD 4QYAA 1Z3GH 3SDAA 3U4AA 1T89A 3PV6B 4NGHL 4E42B 3DVGB 3ZRFC 5A16B 1HL4A 1HE7A 5KBPA 2TRYA 4UOJA 4LLWB 3SODB 3Q2VA 4K0OA 3CV5A 4OGZA 4AYDC 3HUJF 5IKCB 1BD2E 2DDQH 2YS4A 4GAGL 4U1LA 1AZUA 1R5IA 4XRCA 4EVNB 1SEBB 3FSOA 1RK0B 4GI8A 2Z31B 1ILUA 3CVHA 2R9HC 2ALWA 5IB2B 2OZ4A 2VQUA 3AREA 4J3TA 2ZX5A 1KBGL 2BHZA 4W70A 5KW9H 2VR7A 3U6XS 1AQKH 1JGDA 1FCCA 1LWHA 4XTRD 5G4NA 2QADD 4MJ6B 2H0PA 1ZS8A 1F11B 1ACZA 4ZMZA 1SYVA 4AMXA 2G60L 5BRZB 1QFHA 1NCNA 1KNOA 2Y36H 5EUKA 4F7TB 4X6BA 3F7YB 1ZV2A 2DI8A 2X7LB 4TLKA 4ETQA 4WHYG 2AC0A 5TDOA 1V27A 2VLRE 3RX5A 4LPVA 4XODA 3WN6A 5JDSA 2AXGA 4KJWD 3SJVE 4UNVA 3UBFA 5FDWA 3QWRD 3UTTE 1BZ9B 2IAMD 2VCOA 3X12B 4R83A 1A6AA 1PD6A 1WV7T 3MCKB 3P30L 4L3EE 4K5MA 3RB5A 5DWUH 1BVZA 3ZUCA 4M5YH 1SRDA 1WZMA 2AKRB 3QUXA 3WJJA 4IOIB 1FO0H 2YUWA 4K9EH 3H9ZA 5CGYC 5T3ZE 3MTRA 5E2VH 3U7YL 2B1HH 5IEKB 4DP1X 2CO6B 2KUTA 5EOCH 1Q9LB 5FYJE 1EHKB 1CGSH 3WY1A 1JIBA 3FU0A 5JORB 5I6LA 2QSCH 2QT6A 4G82A 3L95B 4L9LC 2XRAH 1AFVH 1BQLH 4HWEH 3IMUA 3FTSA 4LBEB 3TP4A 2WYTA 4WKXA 2BY3A 3WKYA 4PRAA 4RFEA 3H9SE 3IFPB 3SE9L 1DTUA 1OAJA 3FYEB 5J0BA 5F1KC 4P23D 2J4WH 4YBHA 4F80A 3KGUA 2JIXA 1A7PH 1KB9J 2ICEC 2OTWB 3HI1A 2CWRA 5F3FA 5T1LA 2F8XC 1R3LA 4WWID 2UZPA 2IMNA 4NZUL 3MV11 1YQVH 1PZ3A 1PY9A 4S10A 3MGTB 2H6UA 3HS0A 1QR1B 4PRHD 5AW4B 2XG4B 2FNBA 3ZE2B 1PL3A 3TO4B 4W9GC 1WA1X 1QSFE 4X9YA 3VSVA 3CXDL 3OMAB 4OIIL 5GGSA 3OSVA 3D4CA 2X5PA 1HILB 3H0TA 4L29B 1ZLVK 3SDYH 4BWTA 3ASNB 3W57A 4AUYA 5IZ7A 1JUFA 3CFIC 3OJVC 4HX1A 5D6CB 5FS5A 3FF8A 3PWPD 1IM3D 2Y0SA 4G42B 2BINA 4J8QA 2BP8A 1X6LA 1JN6B 1P7HL 2J55A 4MHHG 2OYPA 4KV5F 1DQLH 3I6SA 5JHLH 2F1EA 3CH1A 3FBKA 2WQAA 2VDRB 4U6YA 1NAMB 1ONQA 3UYRL 1A3LL 4U1JA 4JKWA 4NENB 3NH7H 3NEOA 1MCCA 3NJKA 4ZO7A 3HRZA 1AIFB 4EPSA 5TJWK 1XZWA 1YC8A 2LLGA 3IBOA 4HKZB 1M4KA 4LIQL 4UOW0 1LO5B 5I76A 2ZOLA 2WIIB 1V7MH 1U92A 4UQIM 1RIVH 1AIZA 3NBNA 1NC4A 4YHYB 1NUFA 4L0PB 1IZJA 1KGUA 3Q6FA 3ROOB 5D7LA 5I1HL 1XIWC 1Z6JT 2CIIB 1M3JA 2BC4A 4YXKH 4JRFA 2L04A 3FQ2A 4NO3A 2ZSVB 4F2ME 1S46A 4J23A 5J6HA 4IMKC 1FFPB 2JKRM 5JIHA 2BSCA 4WEEA 1RIUH 2B8OT 4JRXB 1DJHA 3HHMA 1AHWA 2HT3D 2HMIC 3LZLA 3U0WH 5F2FA 4K3EH 5TGBA 3VSQA 1Z0MA 5IG7B 3E80A 1HK6A 3IDYB 4O58L 4YSOA 3BWSA 5JXEC 2VDQH 2X2YA 2BHFA 5I1JL 3K71A 1HT6A 1OSPH 3B2DC 3TA3B 3BH9B 3OAUL 1TZAA 5ILTH 3P4NB 4K8RH 4M62H 1AQDA 1USZA 4AIXA 2E3VA 5KUMA 1BW8A 5JW4Q 3V5HA 1YUHB 3INUH 1Y6MR 3RDJA 2H26B 4HOZA 4G5AA 4AZUA 3DJ9A 3T1FB 1P4LB 4DKTA 4E9RA 3OKYA 2CDEA 1AO7A 2AV1B 5E8DL 2YAHA 4MB4A 4GW5A 4I0PA 1F4XL 3K2IA 1QRNA 4TUKL 3KR3H 4ZX6A 1RUAH 4PJBA 3AFLA 3SYOA 3UBXG 5C08A 2N01B 4BFRA 3AW5A 4H8PA 4DQOH 5L8JB 2E9GA 5DRWA 3LNHA 5LAPA 1BXXA 3FU8A 3FUFA 2CPUA 2ZCKL 2ZICA 3O3AA 4OQ1A 4PD4J 2FEDC 5C6TH 3QQ4B 3NCBB 4R5VA 3VFRB 4WW2B 2D7TH 3DTDA 3BAKA 3QDAA 3ZXAC 4Q9QL 3QEGH 3NTCL 3CJJA 2I7SA 5EC2B 3GHPA 1PSKL 1ASQA 1I4FB 4P9HH 4FXGA 2PW1A 3GJEA 4KK9D 1FE8L 3ZR6A 4FLRA 5FYLH 4KZ0A 3JZ7A 5TFSL 3ZVVA 1KGCE 1GHFL 2PP7A 2QVTA 3KPSE 3A6OA 4UZUA 4XPBL 1FO0A 3DSFH 3FSZA 4NO2B 4BFFA 4R97B 2HCZX 2WB7A 1DQVA 1IX2A 2CJ3A 3SE4C 4ACTA 3TH4T 3TT3H 3IDJB 2NXZB 4N5UA 1CYXA 4M6NH 3H2PA 4PRID 4QRPB 3WL9B 3K2KA 4GOSA 5I74B 1AP2A 2WQWA 2ZNWA 3RFRA 3OQ3B 1RHHA 1TZIB 2VW6A 4LVOB 1EGJL 1REIA 2V4LA 3W0WD 1NICA 4R4NC 3TXAA 4WCYL 2DQFB 1HEHC 2K8MA 3ETBF 5E6IB 2DI7A 1HXMA 5MEOA 4M56A 3FU5A 4MJ4A 3V0VB 3ESPA 1E4XH 4H8QA 5I26A 4LAQH 1EPFA 1J5OL 3C08H 2XWBB 3MJWA 3QUYD 2K45A 4JG0H 4WK0B 2O93L 1CB4A 5TDPB 3OQRA 4HJUA 5EU4A 4C8XA 1TZGH 4QXUL 3G6AB 5T8IA 1AGEA 1LO3L 1EBAA 3MBXL 5DJ2B 2ARJA 3ZE0E 3MREB 4RAUA 2BSDA 5CN1A 3FQRB 3CVHL 3PL6B 3FAWA 1ZPLA 1CIDA 3ISRA 1AOHA 1BZOA 2Q8BL 3MKKA 2G3NA 4HUXB 5E99L 1ICTA 1TTCA 1A4BA 5B7FA 4Q89A 1G0YR 2BNUB 3R8QA 1NC2A 3ILDA 3O4LE 4GRLC 1CBJA 2YD5A 2Q8AH 3GMNA 3JT2A 4JKPH 1XR8B 4PLJC 1I8LC 5JHLA 4JJ5A 2NY2C 1F41A 4NN7C 3WGVB 1M05B 2H41A 4WAFA 1WC7B 3TN0D 1T6WA 2I69A 3CC5B 3WLBA 3EYVB 3GNML 4OZGF 3CGTA 1BBDH 3CZKA 4FQQB 2K0RA 1D5MA 1FZJA 3NFPB 4KXAA 3WNKA 2EDKA 5D7EA 3ZSTA 1KENL 4MD4A 3QR2A 4NWTL 5FK9A 4F9PA 3BZFA 4JCWA 1QKZH 5TK2A 2F58L 2XYBA 3TBYA 3I2CH 2XTLA 4JFFB 1E27B 2UY6A 1NCTA 4Z6AT 5E00A 5SX5H 1IZKA 5L6YL 4BQBA 5MI0B 1FG2B 4WSGA 3CG8A 1UD6A 3DSNB 3TGXA 5B38B 2DKSA 2W65B 3ASOB 3IDYC 4XNXH 2XG5B 5TE7H 8CGTA 3PAUA 5KSBB 3NFSH 3CFCL 5CLWA 5ALBL 3G7TA 3LPGA 1RLBA 2EC9U 1JNHB 4LLDA 4JHUA 5F96L 1D5ZB 4PJ5A 2DTMH 4MQSB 3H54A 4NM8L 4ZT1A 4PJHB 2APWA 5DVMA 4W9JC 1NIFA 4N6QA 1BVNT 4H8WH 4XBEL 3T3PB 5LHDA 3HC3H 4MDRA 2B7DT 2AJYH 4JFXB 4L4VA 3BP6A 4LPXA 5DC2A 3N0PB 1S8DB 5G55A 1TYRA 1BOGA 3AG4B 3LN5A 2VB5A 2NPLX 1TMQA 3FCTA 2MOGA 4X5XA 3N44F 4V2CB 8PAZA 3WY4A 5L4MA 3QDGE 4MBRA 1YG9A 2CE6A 4MS6A 4F3FA 2EUZA 4Z7QE 1SXCA 4QCIA 3FZUC 1YNTB 3WKNA 5HHVL 3GLZA 3Q48A 1E5ZA 4MSWB 1KIQB 2VOTA 3PABB 4N3UA 3IN2A 3MLZH 1S9XA 1KXHA 4HP5A 4WFGE 4GG6F 1UA3A 2IH1A 3QEHA 1MFDL 4G5ZH 1X5YA 2DBJA 5IFHH 4P46B 1MI5B 3GBMH 2ORBH 4MBOA 2KZWA 4EAEA 2ZOTA 5HTSA 1T21A 4FQHB 4JO4L 3HZVA 3LEXB 3KZ8A 1JZIA 3RVXC 1GPOH 4JK0D 1KTLA 1I8MB 2Q1EA 4NQQA 4OAWA 2GKIA 4X7DC 4AQOA 3MLSH 1AXTL 1HZKA 3E3QC 1J11A 2I60H 9CGTA 1AQ8A 4P5MA 4A7QA 2N4IA 3POHA 2D3NA 2UYLA 4R97C 3EJUA 4AKOA 4EI6B 2CDGA 4F58L 2WNGA 4NUGH 1PF3A 1F00I 3C5ZA 4NBZB 4KX9A 4J3SA 4ACPA 1S6NA 2NXZC 1TVHA 2XPGA 3DUSA 3D39E 3HG3A 3WFDL 2EVJA 2P9RA 3WN5A 4WHYH 5TK4A 3RJQB 4CMHC 1KC5L 1JPGB 1KLGA 3HOGA 3MODH 2B39A 2LGNA 4OGAD 4P48A 4PJAE 1ZVSB 5CSZA 5AB2A 3L5IA 1E6OH 2KC0A 4ELDA 1EJFA 3OXRB 2DZEA 4G80B 1JOIA 1DFBL 3A23A 4K71C 4XPHH 3S3BB 3V52L 1WA2X 2IFFL 3QQXA 5DDHA 2X9XA 4AIOA 1FNFA 1OO2A 4XN9A 1OP3H 2ZONA 3BDBA 4I8DA 4DVRH 3FT9A 1YNLH 4JQVA 3ISYA 4OJDH 1ZWIB 4HHGA 1F58H 4F7CA 2X1XR 4JVUA 3GRBA 4APQD 3SDDA 2NYKA 2VZTA 4YWGH 1KCUH 1JZ5A 4G43B 3WLWC 4N2HA 3STZA 4ADIA 2G3MA 4A7GA 2QMJA 4HDIB 3NESA 2P5EA 5HGBB 2EECA 2A6JB 2QKIB 3MRHB 3NA4A 2CALA 2A83A 3LXUX 4MXVE 5CGYD 4JANB 5GPRA 2X9YA 5IHUH 4XCNA 3FUHA 1T66C 2PCFB 1ZK9A 4BZ1H 2FD6H 5LN4A 2LT9A 5FOBB 1DE4A 4UZGA 4W9CC 4ZBJA 2EUVA 2O5ZH 4WJ5B 3KHQA 3CUPB 4YNYA 4D0CB 4MMYB 4QOKD 4PJEB 3EOYG 4G8GA 4LSDA 4JFPA 4MHHI 4JDZB 3ARFA 3LKQA 3BO8A 2H4EA 2V2TB 3LQAH 1PZ5A 4ZUWA 5KW9L 3D3VD 3QYMA 1EAOA 5AVYB 1J9CT 1TCRA 4XCYB 3VMNA 4YDIH 5ISZD 2XQBH 3GXNA 5JOPE 1G9NC 4RGMB 2X2JA 1RP8A 3BPLC 4XP4H 2ZSWA 5D93B 2Y36L 1X5ZA 4RZCB 1G7QB 3UPRB 1TZOA 2WGXA 5GRVK 5E5MB 4JFEA 1CDCA 4FQ2H 1WK0A 2WN3A 3CVBA 1OB0A 5DHXB 3VXNA 3HBGA 4L8DB 2YOAA 3CSPA 5MI0C 4CC1A 1JWSB 1S7XB 1BD2D 1DYZA 4R7NA 1SJEB 3ARWA 4M5YL 1BZ7A 1KJ2L 2X05A 2CGRH 4B97A 1WJ3A 1J86A 3ZKNC 4KI5F 3H85A 2RA1A 1QPKA 1QLEB 3KNBB 4K9EL 4ODXA 4YC2C 3IGUA 4OF5A 4N1CA 1T5WB 1PZDA 3NZ8A 4I18B 5KVFE 3A6BH 5E2VL 2B1HL 4TS6A 5DRZB 5EOCL 3KLLA 1CGSL 2Q5BA 3MBEB 3AWFA 3CVDA 1A6TA 1G9MC 1U95B 3ZTDC 5I1GH 2CNYA 1G7JA 4FI7A 4JB9H 1ZLWH 4K5PA 5GS2H 2XRAL 1AFVL 4JFQA 4N0UE 1PFCA 2NR6D 2AJZB 2NYZA 3MBWB 3ULUC 2VLRD 3VU1A 2BMKA 2ZP8A 4ODHH 2HPTA 3ZT6A 4D0DB 3VE0A 3P9WB 4AK2A 3SJVD 5K59F 3T3MB 1O6TA 1H6TA 5J7CC 1A7PL 2ZT9C 4L3ED 2EINB 2ADJA 4G6ML 4QKTA 3CCHA 1J5CA 4ZQKB 3TZVA 4UDUB 3VXMA 4PJBF 1YQVL 1KFAH 3IXAB 1XIWD 4Y16C 4P06A 2AK4A 2WBJB 1MHCA 3MHZA 4O2FA 3UBXI 2AQ2A 5FYJD 2DWEA 5CD3B 2X53A 4JRYA 2F18A 4Q6KA 3D08A 2HMID 2AEQL 4DUWA 4DPAX 2XPYA 2ARWA 1IC5L 4OM0L 3CQQA 1FFNB 4EXKA 4WEBH 5LAXB 2BWIA 32C2A 1TTUA 4PREB 2FUTA 4UQDA 2GQHA 3VSUA 1AMYA 4XXWA 3DDGA 4ODUA 2BIIA 4N9GA 5TTRA 4W9EC 1NCCL 5FB8B 1DQLL 3FT2B 4OZHF 4Y1AD 5JHLL 5CHNA 4F15B 3IAGC 5DZVA 5DCCA 4NLAA 3UBHA 4PRPA 3VFVB 1EMTL 2GSGB 4K7FB 2CR6A 1KB5H 1EHAA 1P7QB 3M1CA 1UFUA 3P1VA 1TF4A 4LOFA 4JY6A 2AJXH 2PW2A 3ZLQC 2I9TB 2H5UA 3US0A 1NCBH 4IW4C 2OXGA 3NH7L 5C7ZA 3CX5J 4G8IB 3UPAA 1V7NH 1NBYA 1M7IA 1DFXA 2X4NB 3KWVA 1QSFD 1W8NA 1V7ML 4DFHA 3MXVH 3L3OC 1A47A 2EDWA 5BVPH 1RIVL 4WSKA 1EXHA 3M1BA 1CDIA 2ZXAA 4ZDHA 2Y6TE 4N6RA 2ODIA 4G6FD 2XCMC 4XBPB 3EYSH 1A8JH 5DVKA 5BQ7B 5GQBA 5DS8A 2QDWA 4LCCA 4FDWA 2K4WA 4B7IA 4YXKL 4Z7IA 4FQXC 4X50A 4PJCA 1TQVA 2H2PC 3UTZA 4Y89A 1TQBC 3TONA 1RIUL 5AZEH 1ZPUA 1TOXA 2QADB 2VZUA 4DHLA 3CN2A 4YAQB 3BLKA 3LQZB 3MRPB 3OKDB 3HRPA 2QQKH 4HSAC 4EIUA 1QAWA 5HP5A 1C16A 4WO4C 3ZDXB 6FABL 1I3RA 1DSFH 4IRSB 4L3CB 1U4EA 5AAMA 1MCRA 2VDQL 3EADA 2Q6WA 3CZFA 1A9EA 1GA2A 3F7VB 1OGAA 3WD5H 4N1EA 5AKTA 2V8MA 2VLME 3TYFA 1U2HA 4K8RL 2IAMB 4XCCH 5ILTL 4M62L 4BZ1A 2IPKA 4CN6A 4G8AC 3DRQB 2D7NA 3S36H 4RGNB 4FLHA 5D93C 3WJLA 1NANI 5EU7E 1MDTA 3O11A 5HJBA 1QFUH 3NIFB 4JM2D 4TL5A 4X98A 4ZQTA 1NOAA 3ZGIA 3O9WC 2GPZA 1CF8L 1WIUA 1ZHLA 1T0NB 1EO5A 3EO0A 3X11B 5TQ2H 1RUAL 2X4RB 2VISB 1EK3A 2EE0A 1HZHH 2XNAB 3IPFA 1H3TA 1MQKH 5B1JA 1M7XA 4R9HA 4PJGF 2WC7A 4Y4KC 4BFIB 1F4AA 2H32B 1JXJA 2VE6B 3RHWF 1I7ZA 5C6TL 5GRVL 2CUAA 1U8MB 2HFEA 2D7TL 4Z76B 2J1XA 4U3SB 3SPHA 5KUKA 5IV2A 3HMXH 3QEGL 4Z78A 1IQDA 3MUGB 3JSSA 1YEDA 1L9SA 2YGPA 3NJVA 4PV9B 4RESB 1SUHA 3KM2A 2EIZB 3X14A 3VJ6A 4XO3A 1DN0B 4GO6B 3OHXA 4PS3A 5FYLL 2JKIS 1CFQA 3HS9A 3KJ4B 4LL9A 3KLHC 4HH9A 3HG1E 3WTTA 4PW3A 1UXWA 1LM8V 3D18B 3OKLB 5EOTB 4D9LL 4FG0A 2I9LB 3DSFL 4FNSA 4PRHB 4B9PA 1YJDH 2PUQT 4PBXA 1BF5A 4TRPH 3TT3L 1NFIA 4M6NL 3LN4A 1A9BA 2HRPH 4N90E 3EYFB 4FTVE 4PLJD 5GS1C 1OP3K 1OQOA 2E7CA 3L13A 4WWOA 4FKKA 3HBPA 3WKQA 1OKEA 5DD5H 3SE3A 5G4OA 3WEMA 1N64H 4F93B 3BEWA 1F2XK 3PWPB 4E36A 5IM7A 2B59A 1E9PA 2P5WA 3KLKA 2AQTA 4JFUA 2YEZB 1Y6KR 2PO6B 1E4XL 4ZYKB 2AP2A 2G75B 3ZKXB 4LAQL 4C56A 5IJBC 1SQMA 3H7LA 3O3EA 4HPHA 5BXFB 3SB3A 2HKFH 3ULSB 3DIFB 3ZIMA 3MLRH 4XXCA 3MGOA 5DQDH 3KPSD 5DEFB 1AGFA 5I16B 2C7UB 3KAAA 4LDCA 2XZQH 4POUB 5BW7A 2H9GB 3UZQA 1NEZA 4ZMLA 2BVTA 2E7HA 4JW3A 1DJIA 4YQXH 4M48H 5IIEB 2P42B 4Q2ZB 5J57B 5K5YA 4RISH 4F8NA 4MVBC 1Y1DA 4Y5VC 5I5MA 2EEXA 2HVJB 4N5ED 1O6SB 1J87A 2VXUH 5HI4D 1NCWL 4LCIH 4JHAH 3L08A 3GSQB 3LXCA 5L7XH 2Y5EA 4LNRA 2UUDH 4NAJA 1X5FA 1S7VA 1MCPH 4JKPL 2C8NA 3CSYA 2LW3A 4Y9FA 2FJUB 2Z9TA 4A6YH 3L7FA 3L2NA 1R3KA 2CLRA 5TE4L 1KXQE 5DFVC 4E5XG 3D2UA 2Q0ZX 2FBJH 3IMVA 12E8L 1LE9B 1KB5A 2CO7B 3KL0A 1DJYA 2P4AB 1EFQA 2QHRH 3C5SA 2ZF8A 4XVUD 4U2ZA 1JK8B 1KPVA 4UWQB 4PG9B 1BBDL 2Z34A 3FT3A 2C7FA 4WNJA 4HXAL 5J9PA 1QTYT 2JH2A 3S8GB 3GSXB 3ME0B 4U31A 3CDGB 3F85A 2BOCB 4BZ2H 3QEUB 3RVXD 1KT2A 4ABUA 1H0DB 1QKZL 1CXHA 1NCAH 4L4TA 3FB8A 3I2CL 4A7GF 2FH8A 1KYOJ 2I26N 5ERWB 4YR6A 3T8XA 3OG6B 4XNXL 5TE7L 4ILDA 4IRSC 3W5MA 3NFSL 2NY4B 4CSTA 1ZLWK 3O4LD 1IAOA 4L18A 1ZIAA 4GSDH 1MH5A 2EEDA 3APFA 2YAEA 4R5XA 2DTML 1KDJA 1LO4H 4HBCH 3MJ7A 3BGFB 4GB9A 1A6ZB 4ZUVB 3WIHH 3K2MC 3KD4A 4UM9D 4RGNC 3O6LH 4H8WL 2H6PA 3HC3L 1U2CA 3QORB 4PTTA 3US9A 3OC5A 5DHMC 2OKMA 5DZ9A 1TJIH 5JNYA 2W0PA 2B4CH 5EZLA 1HCYA 4ZOCA 4YSSA 3QUMB 4QXVA 4QY8B 3OLEA 3SCMD 4HJ1A 4ABQA 2DM7A 3QXUA 5JHDE 5IMMB 1OAXH 3G5ZA 1RMFH 3RWHA 4QAMB 5C2BL 3MLZL 2AJUH 3QO0A 4JO1H 4WI0A 4Q6IB 2WZ6A 5CR8A 4G5ZL 3JV4A 5IFHL 4HK0A 4JQIL 4K2UH 2HJKA 3GBML 2JI3A 5GHWH 4GAYA 1FN4A 4ZMQA 5FO7A 3WLWD 1BVLA 1JF1A 4JFSA 4AXWA 2ICCA 4R96A 4I5BB 5FKAA 2CZNA 2WCSA 3GXFA 4KY1H 2DM2A 4YHPA 1GPOL 4U4BA 1UURA 1H15B 4KTDH 3LS5L 3DDFA 2A77H 3MLSL 3QIBB 5C0EA 1T66D 2L3BA 3CXFA 4P2RB 2I60L 1DUZB 3TNMB 3W0WB 4NO0A 3LRHA 1ZV5A 3O41A 4NZ8A 4NXKA 1T83C 1CS6A 2CCVA 4NUGL 1B4LA 3SKMB 2O5YL 1W72B 4YBLB 2APFA 3HMXA 1DVTA 1NCJA 4JZNA 1SDYA 2QQQA 4IOFC 1EXUA 1I3VA 2JK5A 4EIBA 4K4KA 4W6XB 5J1SC 3MODL 4U1HA 4R2GD 3RTLA 1I1YB 2YSSB 4WFGD 1CZ8H 4XPHL 5F93C 1MHHA 1XGYH 3S37H 3K2UH 4C83B 5CCJA 5FFLA 4POZD 2WBWB 4HYTB 1P0SE 3QCVH 1A02N 4FNPA 4L3AA 3NRPA 3NCCB 3HE6A 4FYRA 4X7CC 1E50A 3GSUA 5A2CA 3FB7A 4DVRL 2MQCA 2W07A 2H2SD 4CC4A 4P2OC 4XE0A 1B2YA 3KPRB 1YNLL 4ATTA 3QEQA 1F58L 3MNWA 2EJ1A 3Q5TA 1D5XA 4MDJB 1VKXB 7CGTA 1JVOA 3DBSA 2KPNA 4NUPA 5ITBH 4DGWC 5ES4B 4YWGL 1KCUL 1GVIA 3OPZH 5D1QB 5HYJE 3GEFA 3VH8A 3ZKND 1XF2B 4HH8A 2IXQA 3D39D 4WQOA 1XD0A 4Y5YB 4H0IA 3ZYIA 1ES0B 3DX2A 4I0KA 3KEDA 2W94A 5FIEA 4P57B 5IHUL 3TTSA 3AQYA 4NRYA 1R3IH 5C0GA 4BZ1L 2FD6L 3SGKA 4CVXB 2YQGA 2O5ZL 2OL3B 5DTFA 3ZKMC 2FWLB 1MJ7H 1L9PA 4CADB 4Z23A 4MAZA 2OYKA 1CFVH 4H1LG 3GSRB 2UWEB 1T6BX 3B3BA 2NLJA 3CLFH 5DZNA 1QUPA 3MRBB 4ATWA 2KLSA 2RB8A 2X42A 5E7BA 2EO9A 4AZ8B 2RIKA 1KGYE 3ZDYE 3ZDZF 4YDIL 1K2DA 3O2WH 4AT6A 1G7MA 1X44A 1DP0A 3QQNA 1N5YH 1IQWH 4XP4L 3VAEA 1IC7H 3IXTB 4LDEB 4HUVB 2XQYG 3CPLA 4R6UA 3P0VH 4PWEA 4LP8A 3QJHB 3O6FB 3L48A 2K6WA 5ESAA 4Y16D 3QIWB 4W68A 4A6YA 3PWJA 4TMPA 1BX2B 2NY3C 3HHRB 1T7XA 2NY1D 1QA9A 2CIKB 4PCKA 4A38A 3SDXA 4OI7A 2GIXA 2FUQA 1MFMA 4Z7UA 1ZXKA 2CGRL 4PJ8B 3OKKB 4JKKA 4H0HB 3BISA 3GSOB 3C9NB 1X9RA 3PHQA 5TF1H 2ZCZA 3VXSB 3BEVB 1CLCA 4LCWA 4XN5A 4AG4H 4BZ2A 4DKAA 5M95B 3FFCE 1U91A 2GCYA 3MMEA 3A6BL 3QDJE 3G5XB 3KBEA 2FBOJ 5I1KL 1RFDH 4WDIA 1QSEA 4ELME 5I1GL 2WBXA 3N1PC 2LU4A 1ADWA 2VWEE 3B9AA 3BQUA 4E41A 4CVWA 4JB9L 4RWHA 1N4XH 5JOPD 4ZS7L 4GNKB 5CKGA 1YA5A 2WANA 3FO2B 4GFTB 4FNQA 2A9NH 3MNZB 3TV3H 5AW8B 2XXCB 2BSSA 2BFVH 1GW6A 4HIQA 1D5BA 1XH3A 1HX0A 4ODHL 4YHOL 3WIHA 4RQQA 2XHNA 5JQHC 4KO6A 1CWVA 1A2YB 3PJSB 4EDXA 1V54B 2HJLB 3O2DH 3CVCA 3MCLL 4NQSA 1N6QH 1OANA 2Z35B 1QQDB 3IJHB 4ZW6A 3UTSB 1QNZH 4A39A 1CFNB 4TVPE 3WNIA 2ZPKH 4KKCC 3PLYA 4QR7A 1KFAL 4FKEA 1V5JA 4OGYH 3PF2A 4G9FA 1PLGL 1WTLA 4Y4FC 5GRXG 3GSVA 5HGDB 2HAZA 4GBXC 2Q76A 3OF6D 2Y24A 3P77A 2X0WA 1CFSA 4FQXD 4HISA 3AT9A 5J1TC 2ZXDA 4CU6A 5T1JA 5IOPB 2H2PD 3RZWA 1UXMA 4FZ8H 5CMAB 3HN5A 3ZIYA 3FOMA 4U1IB 3QXVA 2K3HA 4X4XB 1LD9A 4YBLC 3LTVA 4IIQA 4WEBL 2EQDA 1OGTB 3GGWA 4ZMNA 4WO4D 2X3AA 2P8PB 4JFDA 3UJIH 1G7PA 5JR1H 2UUDK 3WO3B 3VXQA 2FE0A 2Q3AA 4UQ3B 4IK6A 4AWJC 1INDH 4NNYB 3PS6A 5HYSB 2WCGA 1SOQA 2UZXB 4HIJA 2AJXL 3T0AA 1JZHA 3SBQA 1NCBL 3BUYB 3LDBB 3LPOA 5B8CA 3HLAB 1NAKH 4KOBA 1V7NL 4YDKH 2NZIA 1BV8A 1XGQA 1MOEA 5BO0D 1R0AH 5BVPL 3QVAA 4JY4A 3TO2B 2KDYA 4M3HA 4AENB 4HWBH 1YMHA 5IK3A 4JO5A 1BJ1J 2X4TB 3SY0B 4DN4H 1B0IA 5D1QC 1JTPA 4PGBA 1X7TA 4Y4KD 3EYSL 3QNZB 5EEUA 5JW5B 1F4YH 2ZOKB 4ANUA 3QCUL 3OLDA 2ZYHA 4HGKC 5BCAA 2ZJSL 3DV6B 4U1SB 1P2CA 2BSBA 3MUY1 1G6RH 3F2LA 2HVKA 3IMSA 1U58A 3ARXA 5AZEL 2VWEC 1AD9A 2P7TA 4I2XE 1B6UA 2VDOB 1OCRB 1DEDA 2QQKL 1XH1A 3HG0A 1DBJH 1HFUA 1QZNA 3LEYH 4JN1H 5F0MB 5F9WC 3VDCA 2XVGA 3M7OA 2DEWX 3QO1B 2DWYA 3DWTA 3I9AA 2OTUA 1UD8A 3KYNB 3REWB 2R83A 1SBSH 4XMXA 4XCCL 3IKCA 3SBRA 3BJLA 3IAPA 4QJ5B 1BQRA 2J73A 2WLIA 1EEZA 3C6LB 4HJ0C 1BVKA 3UO8B 4UIMA 4JDVB 5F6IB 3TBWA 4AVKA 2B0SH 2FLRT 3IU4H 1QFUL 2FO4B 3TPUB 1NOLA 5HYQB 3TH3T 3HLKA 2Y6SD 2JXMB 3BP5A 3PWVA 1T20A 5GGUA 2VXVH 1LJMA 5TQ2L 4HKJA 3DGGB 3MYZA 1HZHL 5EO0B 4AJ0A 1MQKL 4FEMA 4OF8A 4RFNC 2WQXA 4LCVA 1E9QA 3QFDA 4XP9H 5CO1A 5I1LB 4PUBH 3HPLA 1RXLA 2ZNXA 5AL0A 1DCLA 3GMRB 3AG2B 2JVUA 3E2HC 4U6XB 1S9KC 3HMXL 4XPGH 2NNAA 2IQAB 4YSEA 3VCLA 1A0QH 3G3LA 1E3FA 4OU3A 3HNVL 4ELKB 1CGYA 1H9VA 2FEEI 2IGFH 4KH2A 2VLMD 3UTTB 5FUOH 2QR0A 1IBZA 2Q2LA 1S7SA 4YL4A 3TIDB 4MVBD 2TAAA 3T0WA 3U4EB 2VSMB 2W0KA 4Z7WA 4MD5B 1FNAA 2BVPB 5B38G 3QZWB 1LK2A 2BSTB 5DFTA 2H0EA 2EABA 3D2TA 3CZNA 1YJDL 4MS8C 3VWKC 5EIIG 4TRPL 1T1YB 3H42H 2HRPL 2H6OA 4BSJA 3SPIA 4AM0Q 1JHKH 4TKWA 4QYOA 5IB3A 2CLZA 4V1DA 3EZJB 4Y4HA 2Y1YA 2GT9A 4PJIA 4UINL 4QHNB 2DQDH 5DD5L 4P07A 4QD2E 3PXHA 2GK0A 1G7HA 2CK2A 4MXQC 1N64L 3JUYA 4OD2A 1CE1L 3C8KB 3CK0H 2L4OA 2CO3A 4Y1TA 3LNEA 3H9SB 4D9RE 3VXUE 2DQCH 2V2WB 1DVFA 3O2DA 4WJG3 5JHMA 3N06B 2EDOA 1CK0H 3MRJA 5KSUA 2GJZA 3MV7D 2HKFL 2NSXA 5ACZA 2O4EA 3GMQA 5I66B 3MLRL 3HG1D 4X6FB 1FCGA 2WWMD 3RVUD 3P54A 1VDGA 5DQDL 3OPUA 2EIDA 4NYLA 1EERB 2XZQL 3H4HA 3FTWA 3N41F 4GYBA 3VQ1C 3DX8A 4FQIL 4YQXL 4M48L 4AH2B 3T9WA 3QH3A 5HYFA 1HJBC 3S5ZA 3EFOA 4FTVD 3WEOA 1VADA 4RISL 2DH2A 4H25A 2R1YA 4KUZH 5ESQB 2VXUL 4HD5A 4LCIL 4JHAL 4XGZB 1ZT4A 2Y7QA 5KWYC 3B9EA 4KNUA 1GGUA 4XMPH 4U6VL 1IM9B 2DQJH 1RD6A 2QSTA 1A4JA 4A6YL 3VFUB 5EV7A 4U3CA 4PGEA 1B0WA 4Y19E 3HB3C 2NZ9D 2FBJL 2HFGH 5CZVH 3EGXA 2QHRL 3EFFB 1FFQA 1QZ1A 4HMEA 2H8PA 1ND0B 1O5DT 3FQTB 1V55B 4D3CH 2D0GA 2KQMA 3S9DB 5L2KA 1RJYA 1VCAA 2IOIA 4XO9A 1G1OA 4BZ2L 1RZ8B 5SX4H 1NCAL 1U93B 2NTFA 2YLKA 3IVKB 5CM1A 4HWBA 4LSQH 3C75A 1F3RB 2NX5E 1GYWA 5I17A 1U8NB 4WW1A 3VXOB 3T0EA 1CD1B 2CKNA 3FT4B 5HHOE 1CQKA 3DOIA 3PHSA 3UMNA 1QO3A 2PP9A 2XZZA 4JM2B 1NCDL 2DMCA 2ZUXA 4UB0H 2O61B 2P52A 3H3PL 4GSDL 3ZKSD 4F2MB 2BW5A 2OTPA 1G6RA 4BH8B 4Z95L 3LZQA 4G1MB 3CZGA 2JQZA 4HBCL 4IOFD 3NSYA 3WIHL 4GKOA 1T03H 1LQBC 3O6LL 2YQ3A 1QBMH 5F9AC 2W95A 4HVBA 2WBKA 1JL8A 4OKVB 1TJIL 1AZVA 2CO4A 3NQKA 3AU1A 2B4CL 3P2BA 2GTQA 4OLXH 1NGXB 1KY7A 2B1OA 1N5AB 3ETBJ 4L9LA 4ZNCD 3OHMB 1E9OA 2WYHA 4HIIA 3WNOA 1NCUA 5LXGH 4GJTB 2CRYA 2AQ3A 1AXSA 3MFFB 3MN8A 5FV2A 1OAXL 4P2OD 3MUHL 1RMFL 1B9KA 4Z7OF 1JNNH 2AJUL 4JO1L 1SDAB 4OCXH 4JJHA 4JVWA 1K5NB 1G5GA 3LMJH 2ITCB 4WI4A 5MEQA 5DJAA 4K2UL 4ECNA 2XSKA 1F90H 3DVNB 3HUJE 2IEPA 3KLAB 2APXA 3NCMA 3QCTL 2BLFA 4TSCH 5CS7A 3RI5K 3VD3A 4Z7UF 1B4TA 1C7SA 2R23A 4H1LH 2W81C 4MNQB 4IBSA 3C60B 3QZLA 3ZX1A 3U6XA 2A77L 3UTQA 2O30A 4R7LA 3CTTA 4Q6YA 4E0RB 5KS9A 1JVKA 2P8LA 3MRQB 2W9EH 5JDJA 1W6LA 4KDTA 3MLPA 3ZKMD 2VDRH 2H47C 2P46B 3QHFH 4WTWA 3E6FB 5AZ2H 1F1GA 1G87A 5LNGA 2ITDB 3UAFA 5JHDD 1ODUA 4JG9A 2XTJB 2J8HA 1QW8A 2R2EB 4FXKC 1ZE3C 1BQSA 4PIRF 1FHGA 3L3JA 4OCNC 4E5XA 1CZ8L 4CU7A 5L2JA 3UZVB 3TVMB 1XGYL 2G3ZA 3K2UL 3WKPA 3NPSC 3G5YA 1NPJA 3QCVL 1T3FB 1SOSA 2NY5C 4AY0A 5E1QA 1NUNB 2BIMA 1RZJC 2LABA 3WEAA 1SN2A 4HPYL 3H9YA 1ZDSA 2BVEA 5DJCA 3VUAA 3AWGA 4AQEA 5DC4B 4M7ZB 3B5HA 3MUUA 2OK0H 3FU7A 4XO4A 2WM0A 3LJ3A 3THMH 2PTTA 3TIEB 4FA8A 1U3HA 4ZSOE 1LP9F 4G8FA 1KCBA 2B5IB 3OJMB 3OPZL 2XACC 4MNGB 3PV6A 1KG0B 3UCQA 5DJ0B 1DJGA 4E42A 3UTOA 3U0TB 3ZHFA 1Q9KB 1PY0A 5A16A 2KZBA 4TLUA 3E9TA 2HKAA 4LLWA 1T0MB 3K80A 4IYKA 1A4KB 4R3SB 5I6XC 3CHQA 5IKCA 1P6WA 2W0FB 3KYKH 4Y7OC 4MJ5B 1EWHA 3LPWA 1OAKH 2RAMA 2A74C 2DQMA 3V0AC 1SEBA 4EVNA 3ZE0B 4JPVH 1CFVL 1QNIA 1RK0A 4JM0A 3VFMB 4LRIA 4OJAA 2FHBA 3L7EB 2Z31A 3UC0L 2F5AH 3EG9B 3CLFL 1N70A 5ICYB 5IB2A 5T1KD 4JKMA 5JXEA 1WWBX 3KH3A 5GZOC 4HG4K 3B2XA 3S5LB 1YEJH 3NA9H 3QFJE 3U25A 1K8IB 3IDXH 4ZO6A 4MJ6A 4XMLH 1F11A 4RA3A 1IC0A 1X5GA 1IQWL 3DX4A 2IC2A 2IV8A 3S7GA 1IC7L 4RRPM 3WV0A 4KKCD 1Z2KA 5HYJD 4F7TA 1JZ2A 4Y4FD 3F7YA 2X7LA 2QVKA 1DR9A 4GBXD 5IW1B 3VG0H 5JQIB 3TT1H 3APMA 2XIBA 5DO2C 5C07E 2Y3NA 4JAMB 4H8HA 2X40A 1BZ9A 3SQOL 4MZ2A 3X12A 1AZRA 4KV5E 3MCKA 3K4DA 1PMYA 3CZSA 2VLKD 1CXKA 1BXVA 1M7UA 1YEIH 4TOYH 1HWWA 5I8EB 2WXKA 5BS0A 4XNQB 2AKRA 1YYLH 5TF1L 3M1OA 4IOIA 4AG4L 3VGGA 2Q2EB 3ILQC 4Z7VB 1CT8B 4Y9BA 5SWZB 2BZDA 3NSDA 3OB8A 5IEKA 1RFDL 3FQUB 4YPJA 2CO6A 1Q9LA 4M1CC 5BZXA 1GOFA 1NPUA 2XY1A 1NTDA 3BAXA 1N4XL 5K33A 2GW5A 5JORA 2XV0A 1S7RA 1MWOA 3VGDA 2A9NL 3TV3L 5CCKH 2HG0A 2V9UA 4HIXH 2BFVL 4EN3C 1KMGA 4OZIB 4LBEA 3PAVA 4Y1SA 3BUPA 4HLZG 3IFPA 3BAYA 4CW1B 3O2DL 2WSDA 1ANUA 5ALCL 3OAYH 1LLAA 2OTWA 2QJDA 1QNZL 3EDFA 4KTYA 4OJEH 2ZPKL 4JRWA 5F0JB 4HK3N 1YPZB 3EJZD 4XX5A 4G8EB 4PVBA 4OGYL 2HT4C 3FPYA 3MGTA 2ATKB 3F64A 3QDGB 3ULVF 2NTSP 1QR1A 5HGHB 4E9WA 4Z7QB 2XG4A 3TO4A 3QDJD 4R2GB 4NAQA 1I7RA 4WIQA 1GR7A 4YDNA 3NCWA 2V2XB 3E6HB 4JHBA 2J7LA 1GIGH 1HILA 2RH0A 3NZUA 4L29A 3RGVC 4UNUA 4X4MA 3GC3A 1ZEAH 1BQ5A 4B9FA 1OWWA 5D6CA 1RUKH 3EJJX 4TYUA 2XTJC 4G42A 3UAJC 3UJIL 3D7PA 3G5VB 1JN6A 5L4FA 4WUUE 1D7BA 4TTDD 3ZO0A 5KSAB 3L5JA 1OPOA 4CAGA 1INDL 1Z7JA 4DOHE 5ABZA 3Q1SH 2WMPB 1CLVA 4MB3A 3BHBB 5EMYA 4HMCA 1OE1A 4EQ3A 4TVPD 4HJ0D 5HHMB 4MNHB 4QEGA 1X9UA 4YE4H 1IU1A 5GZNA 5C09E 1CF1A 4AMKH 1NAKL 2YRPA 4NENA 2DMHA 4YDKL 3WS6A 3QG6B 3QJVB 1JV5B 1AIFA 1U8PB 1WDAA 2EDNA 3HVDA 1Z1WA 4HKZA 1UD2A 3GS7A 4B9GA 1LO5A 5G5DB 3V4VB 3SOBH 2WIIA 3UJTH 1I8LA 3C8HA 2AJ3B 1KTDB 3FRUB 2B5IC 4DN4L 1KIPB 2LTQC 4S1RH 2OCCB 3UG4A 3ROOA 3B1TA 4ZNEA 2CIIA 4M5SA 4GQ9H 2XICA 5BVJB 1ACYH 2ZSVA 1C08B 4IBVA 1FFPA 1OVZA 2CGZA 4HCIA 1X3DA 1YEKL 4F1ZA 4JRXA 2AEOA 2CAKA 1SNRA 2ALAA 2ENPA 3KBFA 4JN1L 2BY2A 1AGDB 1DBJL 2BIPA 3RILA 1W8EA 3BMWA 1G9MH 1OLZA 4UQCA 5DHEA 5FYJU 1QBAA 5CEZE 5IG7A 1SVBA 3P3UA 4JZJB 1F6AB 4U49A 4WEUD 4I3RH 1OGPA 3QDHA 5DEZA 4DEWA 4MS8D 1FP5A 1UOKA 3VWKD 4X5WB 1D6VH 1YHPA 2NY1B 4NC2B 1F8TH 4KNTA 4EI5B 3ULUH 3TA3A 3BH9A 1PEZA 3CFTA 3P4NA 4XI5C 5C0AE 5AAPA 3JZYA 4WGWB 2OI9B 2FT8A 2YBRB 4S0HA 2VR8A 4Q74A 2EUXA 5DURD 3IU4L 1YUHA 2UY7B 2H26A 4MXQD 1KTBA 1MRFH 1P9MC 1I8KB 1IARB 1P4LA 4N8VB 4EN2A 1X5MA 5AOZA 2VXVL 5INDB 4N3TA 3R7RA 5CZRA 4TNWK 4HEMA 2P3YA 1NUDA 4WI6A 2RMNA 4UQ2A 1F5WA 1LK3H 1H3VA 2VSCA 2D4FA 4Y8AA 3N9GH 4PUBL 5FECB 3T65B 4O02B 3QQ4A 4Z9KB 1OD9A 4QRQB 5JIDA 3IK2A 3QZBA 4E9QA 2N7SA 4WW2A 3VFRA 4XPGL 1K4DB 5JA9A 5LB1A 2F7PA 1A0QL 1YRKA 4FFZL 5A6IA 2IGFL 5EC2A 1I4FA 3D9AH 4G6AC 1P6AB 2CRMA 3LKNB 4IMLB 5SWSA 5F3BB 1FVDB 2IANE 1OTTC 4YPGB 2GC7C 3LX9A 2JJSA 5AZUA 4Y2LA 3V0EA 3P4MB 4KQ3H 1R75A 4IM8A 3WXVH 2PXYB 2VXQH 4W9KC 4NO2A 1PVHA 2XZCH 3ECBB 1G7LB 5KSVB 3NRQA 2CUHA 3CFDA 4OZGE 4N2DA 3P2DA 2P24B 3AQDA 1LO2H 3H42L 3K6DA 3BN9D 3IDJA 3MRMB 5HI3C 5GJTL 4QRPA 2C9XA 3WL9A 1JHKL 1HQ4B 1BG9A 1CG9B 2W9DL 1SMDA 1U8QB 1Z9MA 4W81A 3HB3D 1TZIA 2EE9A 5IREA 2ADFH 2XVLA 4N0UB 4DKFH 5F1IB 2DQFA 1W2KT 1T1WB 3N43B 4GMSH 4MASA 2IMMA 4HMDA 3A4EA 4RVBA 5E6IA 4MLSA 2H3NB 3G08B 3HA0A 1S5HA 2GBVA 3RX7A 2DQCL 4YDVA 3LRKA 1JPFB 2XJLA 3L9RB 3V0VA 4DO4A 5AOMA 5MEPA 4LESA 1CK0L 3PQYE 4QXTB 2XWBA 5EU5B 2J56A 2BS71 3NZHL 1SHWA 2V5MA 4PLKC 4NCC2 2HH0L 4P04A 4G6JH 5TDPA 1FG9C 3CQPA 4GFXA 4Q52A 5CSBA 2K7PA 5FR3A 1IAMA 3MNMA 2L7QA 3G6AA 3HTLX 1HIMH 3NMEA 2BPBA 5KS9F 3MREA 3FQRA 4J7RA 3PL6A 1B6DA 2AEIT 1SXNA 3LXBA 4XN4A 1DJWA 5D7IA 2PF6A 3H55A 4PGCB 4OLVL 4BV1A 1O75A 1OTUD 4KUZL 2VRKA 5FGCB 2EIEA 1GJIA 3AITA 2X4UB 2Q20A 1R3JB 2BNUA 3IWUA 4GG6E 2DYRB 2WNKA 4XMPL 5FW8A 1ZKAA 4YN3A 2DQJL 4U0QB 3VXUD 4D9RD 4RNRB 1XR8A 3GF8A 3K91A 3BZ5A 4OI9A 2CBOA 1M05A 5CZVL 2ZUQC 1S78C 4IJTA 1WC7A 4OIFA 2CGYA 3CC5A 2BOLA 2Z7UA 3EYVA 1B0RB 4U05A 1BZDA 2HVBA 4FGMA 3RX8A 3OBAA 4GAAA 4FQQA 4C4KO 5K39B 4NKDA 1QLEH 3NFPA 4ABWA 1ADQL 1FFRA 1UM6H 1XX9C 3KYOB 1CGVA 3SPVB 4LSQL 1ZLUH 5L8KB 4Q97A 4N2CA 4JFFA 1E27A 4BKSC 3QJXA 2QPFA 5DR5H 1FG2A 4ZG1A 2VMCA 3DSNA 5B38A 5KYXB 2W65A 3MZTA 1BWMA 2XG5A 5EA0H 3DHPA 5KSBA 4UB0L 1E42A 2VSDA 1A66A 2C3VB 3BYTA 3HKZA 4B9ZA 4I88A 3BQVA 1MFAH 5AVRB 3GK8L 4EI5C 1D5ZA 3N91A 2FZ3B 1P69B 1T03L 4MB1A 2EUWA 4Y19D 1UASA 2OI9C 4PJHA 3T6XA 5I8OL 3PDGA 1QBML 1T89C 3QQ9D 2FIKB 1XEDA 1U8KB 1OM9A 3AVEA 1U8OB 2PYFB 2XJKA 2ITEA 1TO4A 1JMZA 4JFXA 4DK3A 4OLXL 1S8DA 4PJ7B 3K6IA 5LXGL 3CVIL 2YPLE 4Y19A 1L9OA 2D0HA 4RRPG 1SDDB 4OLWH 1S5IH 1YNTA 1JNNL 5EBWB 3RL1B 2NX5D 3AT8A 4MSWA 4OCXL 1KIQA 3PABA 1MCEA 4NQXB 3LMJL 1LDPL 5HHOD 3SE6A 2CKBB 1F90L 2WWKT 3RWFB 4OFDA 4TSCL 1MI5A 2LU5A 5J6SA 2AFNA 3JWNC 4C55A 3W1ZA 4Q8BA 1JYXA 3LRSB 4FQHA 5F6HJ 3LEXA 2HTLD 3PDOB 1FZOB 3WUWG 1XGTB 4JS7A 1I8MA 2EADA 1X5JA 5J11B 2VN5A 2OR8A 2WQVA 1MFCH 1UH2A 3C8DA 3ELAT 2W9EL 3I75B 5EZOH 1QEWB 1F02I 1QVOB 2H3XC 3ARBB 2VDRL 3QXTA 3Q44A 3T6ZA 3U36B 3U82B 4GPVA 3BD3A 3BP7B 5E4AA 4CU8A 1PFOA 1J1XH 4EI6A 3QPXH 3L16A 5AZ2L 3UX9B 1NAML 1QHOA 4HCFA 1NCIA 1IKFH 3LKSB 5E6YA 4RMQA 2N0KA 4NP4H 5AVSB 2BNQB 1JPGA 4RGOH 1ZVSA 5GZOD 5EN2B 3DJSA 3IJSB 3BMVA 3IS0X 2ETWA 1OY3B 1S3KH 3QUXC 3OXRA 4G80A 4PJ9B 5D7LE 3WJJC 4U1NB 1XQ4A 4LEXH 4RAVB 2A0LC 1UOLA 1KCSH 2VXQA 3GBNH 3KMDA 5A1AA 3DK2A 3HG4A 3MZGB 1E2WA 2QPUA 3WIIH 1C5DB 4FTVB 4OUUB 4HUKB 4KI5E 2EDJA 2WW8A 2OK0L 1IFHL 4AYSA 2YHGA 4X5PA 1P5UB 1HXYB 1ZA3B 1ZWIA 5FHAH 4YXLH 4U2YA 2F8IA 5SWQB 3U83A 3ZE2F 3VG9B 1FAIH 1KJ3H 2NXYB 2M8XA 1JYVA 4G43A 3DX6B 3DHJA 2P26A 3A3YB 5CBEB 4HDIA 3PUUA 5D1XB 4J3BA 5HGBA 4BZYA 2A6JA 2QKIA 3MRHA 4LSVL 5D70L 3QZMA 1BQKA 2FYYB 4JANA 1EV2E 4TNWF 4LP5A 2XFGB 5B22A 1NLBH 2PCFA 1DBAH 4M1CD 5FOBA 3KYKL 5K59E 1HTYA 3HS0C 4WJ5A 3CUPA 4D0CA 4I77H 4MMYA 4YDMA 4CMMB 2QMKA 4BE5A 4PJEA 4Z1PA 1QRNE 4ZFOA 1IGYB 4JDZA 3C6SB 2F5AL 4FKHA 4PJBE 5C08E 3KYMB 4EN3D 2V2TA 1R19A 5DJDB 1YEJL 3NA9L 5IBLD 3N0AA 4A2DA 3K4ZA 3IDXL 1FGNL 1PJ9A 4GKSB 4LFHD 1GMIA 3NIGB 4XCYA 5HYSG 2Y4SA 4XMLL 3LKOB 2OJZH 1DLFL 4QRRE 2H32H 1WFJA 4XC3L 5D1ZC 1Z66A 4RZCA 1G7QA 4MDIB 3UPRA 3V0GA 3VG0L 2DPKA 5E5MA 2Q86B 1BFOB 1WZLA 4L8DA 1EZLA 1FZMB 4NQEB 2JCWA 1ESOA 1JWSA 1S7XA 3FUIA 3RP1A 5H94B 1SJEA 4OCWH 1YEIL 4LPUA 5AUMB 3V4UL 3RGVD 1XL4A 3FUNA 1N59B 1X7SA 5HVGB 1YYLL 3U0PB 3V0IA 3KNBA 2ZP9A 3FO1B 3TJHC 4L23A 5KOVC 3UAJD 3Q9PA 1IGTB 1T5WA 5EU3B 4DKDC 4I18A 3ZYZA 3CN3A 2IF7A 3MLVH 1K3ZA 5DRZA 5CLXA 1O5PA 2IV9A 3QRLA 3MBEA 1AG6A 5IHZA 1U95A 3GSWB 4GO8A 3BAJA 1J8HE 4LMQE 3K7UA 5E0QA 3IJEB 2ZG3A 1E5BA 1KV7A 4NHUB 2K6ZA 3TNNB 5FYKH 1IVLA 2FQGA 1TQTA 2AJZA 4LVHB 3MBWA 4HIXL 4OJCA 3PREA 1OAYH 5I6KA 4LARL 3AWEA 4QTIH 1JK9B 1HHHB 1LL1A 4KI5C 2DQIH 4D0DA 2P80D 5C07D 3RJOA 3DGDA 4P2QE 4PS4H 1KCVH 1MF2H 2EYTB 5F21B 1S9WB 4ZQKA 6PCYA 4QRAA 2X4PB 4UDUA 3ZRSA 3OD3A 4K3HA 1YCSA 1QFWI 3N55A 4H7VA 3IXAA 2NNRA 1S7WB 2B20A 5JHDB 2KI6A 2R69H 1IAKB 2WBJA 3I74A 3V5KB 1T2JA 4JN2B 5KN5B 2VKXA 4NN6B 1U3YA 4WW2F 4XMWA 5CD3A 2E7BA 3EO1A 1ECZA 3NFNB 4YE0A 2KHAA 4ONFH 3RRQA 3EBIA 1ZEAL 2WUCH 4I0PC 3UYPA 1RUKL 1FFNA 1TQSA 4N0CC 5LAXA 3Q3GB 4PREA 4IKKA 4XB8A 2XWZA 5FB8A 3RUGB 4XVSH 2JF1A 2NMSA 1ORQB 3Q1SL 4XI5D 3L6FA 2L8AA 2EDYA 2GSGA 3R1GL 4K7FA 1S7QB 4Y5VA 3VFVA 2C3WA 3H8NA 4XO5A 1ZOXA 3EH2A 1KACB 1YNKH 1GGYA 3F3HA 4PJGE 3V0HA 4AMKL 3Q43A 2I9TA 4IRJD 5FPIA 5DD1H 4J3XA 2NZ1A 4JQXC 4G8IA 1VFAB 4K7PY 2BM3A 1WYJA 1KYDA 3EOTH 4OCSH 2X4NA 3SOBL 2VLJE 3UJTL 1TIUA 2GJ6D 3RDTC 3F6IA 5LGYA 4K9EC 4YHNB 2NXYC 4XMVA 1ZLUK 5EZPA 3U2JA 4ZO9A 2PNDA 4OM1L 2G0LA 4Z5RB 1MW2A 4XBPA 5IVXB 5BQ7A 1UM5H 4RETB 4PVNA 4U1GB 5F97E 3Q1EA 3K0WA 4GQ9L 3HI6H 3IBEA 1ACYL 3O81A 2Q9OA 5CP7B 1RPKA 4WUUD 3NUKA 2FT6A 4M3KB 4WNQB 1T7WA 4A1RA 5HI5C 5GGTH 5AB1A 1QLFB 1PX4A 2PWEA 3P9LB 4L4VE 4ADJA 4YAQA 3LQZA 3MRPA 2BNRD 2JQMA 2FLBT 3OKDA 5HYJB 4U7MA 5D7IF 3WTVA 1AC0A 5C09D 2A9ML 4I3RL 4IRSA 3QUMH 4L3CA 4K7PX 3ZGHA 2D9CA 1F8TL 4PY7B 4H88H 2ZWSA 3F7VA 3B2VL 2IAMA 3QIUD 3LXAA 2BW4A 4CC0A 1VZHA 5DO8A 3V0DA 4GKLA 4NNPH 3GIVB 4OR1A 5IHZB 3W9DB 3OLGA 3VGHA 4ZXBD 2WAQA 4UILH 2Q10A 3JVGA 5DRXB 5FGBA 5I23A 5JYMA 3QJFB 1T0NA 4PLOB 4OF0A 5E4EB 4XN8A 3X11A 2Y2WA 1UEMA 3B8YA 2X4RA 2VISA 1QYGH 3ZDYB 4LCYB 1C7TA 1UH4A 3QAZC 5DD0L 4QWWC 1O9WA 3WI9A 3N9GL 3F7PC 4M9PA 4BFIA 2BVYA 2H32A 1EHNA 2VE6A 3CXHJ 5DJZB 1KULA 2YAPA 5B39B 5CEZD 1U8MA 3SYCA 5B1CA 1MW0A 3ZHNA 4U3SA 4Z76A 2V9QA 4PVMA 4PG2A 1TDQA 5DU7A 1FUNA 2X2UA 4MD0B 5FYLE 4PV9A 3D9AL 1IAII 2EIZA 2ROXA 5C7XH 3EUUA 1DN0A 5C0AD 2CPCA 2P49B 5IMKB 2ICWI 4JREB 2WTOA 3D18A 4KQ3L 3OKLA 4MCMA 3B2PA 4H26A 5EOTA 3WXVL 2I9LA 4PJAF 2VXQL 3S35X 4AX3A 2XZCL 4DGIH 3T0XA 3T3PF 4PRHA 4OT1H 3FFCB 4XVJH 1LO2L 2DF3A 1CDUA 2EIBA 4UU9B 1TYJA 4N85A 4ZX3A 2V17H 4GSRA 5AENA 4KK6D 1J7VR 5E94B 1H6FA 2F08A 4PS8A 3I50H 1M9WA 4UT6H 3ULUF 2WZ5A 1S78D 3GMOB 4J6RH 2F54A 1YNTF 2P5EE 3EF4A 2EH8H 3D69A 4GMSL 1KXTB 2X9WA 3PWPA 3Q8FA 4DN3H 1IGJB 4NCC1 2VNCA 2VZ3A 3LKPB 4ZYKA 4HGWB 1DJZA 2PO6A 2YEZA 4YOKA 3PV7A 2G75A 1CYWA 5CZXC 4LSRH 3ABMB 1BBJB 3HR6A 2ZX9A 5BXFA 5IFAH 4WWKB 2IAND 4UAOB 4QO1B 2FEJA 3DIFA 4G6JL 4G8GE 4F7MB 2OL3H 1K6QH 2GBAA 4LZKA 5DEFA 5I16A 2VN3A 2C7UA 4F37K 1KEGH 1OCOB 2R69A 2H9GA 2PWGA 4K8RC 1KTCA 3R8BB 1JZ8A 2XXMB 5EPMB 2WXQA 1AKPA 1WFNA 5IIEA 1PW3A 4Q2ZA 4X9FA 4EBQH 3QRFM 5HHQB 1OP4A 3QJQB 1OT1A 4BWUA 2F53B 4QF1B 3HPJB 3SDAD 5F7EH 2Z1PA 5C70A 4OY9A 2HVJA 4B60A 3QI9B 1O6SA 2DL2A 3QB7C 1A4CA 2YD4A 1DN2A 2YUZA 4E9SA 4NXSA 1LE5B 4JFEE 2VTFA 3GSQA 2XWXA 4XX1G 1XO8A 4F27A 1T7YA 1XTLA 4HCRL 1BLNB 3MGAA 1I85A 1C1EH 2PYEA 1KLUB 3VI4B 1LE9A 2CO7A 3C5ZC 4AYFB 4U1GC 1JK8A 3OB0H 4PG9A 3BZEB 3WN5C 3WTXA 3GTNA 5LO7A 3ARED 1UM6L 1MZZA 1VFUA 3WDJA 3GSXA 1KLFB 3ME0A 3CDGA 2CHNA 2BOCA 5TQ0H 3QEUA 1KCWA 3CU7A 1H0DA 1D2PA 2IH3B 3IE4A 5HDBF 4GP4B 5IHLB 4L5FL 4BXVA 5ERWA 5DR5L 3R7QA 4GQPH 3ZPDA 4DPBX 1R6VA 2DW5A 3HZMB 4NJ9L 1GYVA 3G6JF 4RWYH 4JQVC 1SJHB 3S6CA 5HXMA 1S3RA 2QGEA 4H5SB 1L4IA 2YD6A 2VAJA 3OVUB 1HZLA 1A6ZA 4ZUVA 5GGTA 2CHXA 4I2XB 2WXPA 3VXME 4NIKB 5EDSA 4JO2L 4RMVA 3QORA 5E8NB 3ILEA 3QUXD 2V7HB 1JFQH 5BRQA 1KIUB 2PCPB 1NIBA 1K4CB 3H4FA 4BQ6A 2AK4E 3QUMA 4JPQA 3UABA 3W82A 4QY8A 1AS6A 3DUHA 3SDCB 5DK0B 4OFVA 5CP3H 2CLVB 1HHKB 4OLWL 5IQOA 1GOHA 1S5IL 2YGQA 4JDEB 4JRYE 1XF3B 5IMMA 3TWCH 2HUHA 4FADA 1UWGL 5A2LH 4FC3E 1WEJL 2FLMA 3ZTNH 5C9JB 1R1CA 4Q6IA 2RQEA 4G1EB 4ESKA 3GLEA 2WHVA 3S3PA 1SJXA 2Y06L 2CJUH 4U4IA 5I28A 1KN2H 4TVUA 1UB6B 2DMKA 1HI6B 1J1OH 4I5BA 5HJGA 2OFQA 2JIXD 2NW2B 1BHGA 3TEZA 5T1LD 3L3IB 1H15A 1PAZA 3PHOB 3QIBA 1MFCL 1XGUB 4GH7B 4P2RA 2NRDA 1DUZA 4WY7H 4OJFH 4PJXF 3TNMA 2XKSA 4HU8A 3U2SB 1CLOH 3GXPA 5J4MA 1KPUB 1J1XL 3U30B 3EH1A 3MRKB 3QT2A 4PVLA 3SKMA 4FABH 1IKFL 2Z8VC 2DWTA 4NP4L 3I6LE 4P0DA 3CBJB 1TTGA 1ZSDB 3Q2NA 4KRPB 4HJJH 4RGOL 5E0FA 4A2EA 1YVLA 4XB7A 1S3KL 2YSSA 4ODBD 3NCXA 3KPNA 4LEXL 4W4OA 3FCGA 4WFEE 4C83A 3JWDL 5E2UH 3T3MF 4OLYH 3GBNL 2JV6A 3SO3B 2X1OA 4N8PA 3CX2A 4AV0A 1GSKA 3WIIL 2BS8A 3T4YB 2ODHA 4AEHH 2R1WB 1PZBA 2DS4A 3T2OA 3KPRA 1VESA 2ATPB 4HWUA 4YXLL 1IO4C 5C0NC 4UT6A 1QI5A 2AK1H 4MDJA 3D09A 4H20L 1VKXA 3WFCH 3W81A 2VDOH 5I73B 4NDMB 3NACH 3O3DB 5D2NE 1OPGH 5D1QA 1SZNA 3ARTA 2VJ8A 3GM8A 4OFQA 1SQ2N 1XF2A 2WLNA 4H8WC 1OGAE 4F20A 2YD7A 5BOZG 4Y5YA 3TJHD 1UUNA 1MJ8H 4P9ML 1ES0A 3TZVC 4P57A 1NC4D 1G6VK 1NLBL 1VF5C 1DBAL 4FLQA 4CVXA 3OMIB 5D7LD 2OL3A 1Z9LA 4I77L 1V10A 4CADA 4IJ3B 3AMLA 5HDQH 1UT2A 1ZTXE 5GSRB 4PW9A 1Q9OB 3ENEA 3GSRA 2UWEA 2UXFA 1XF5B 2J71A 4KI5D 2OQJB 1SYSB 3MRBA 4RRPA 4UANA 1PZAA 3R19A 4XOBA 4YGVB 4L05A 5A3IC 4AZ8A 3ORJA 5JXAH 2Z8RA 5HJ3B 3E38A 3IXTA 4MA3B 4HUVA 3HE7B 2Y3AA 3U1QA 4L8SB 3QJHA 3O6FA 3QIWA 1I9EA 3MRRB 1BX2A 2E6PA 5CJXA 4XBGB 2OYMA 3D52A 1IE5A 4HAGA 4KQ0A 5E6SB 2CIKA 3MV9B 3KPQB 4KKLD 3D87B 1D9KB 4XH2B 4OCWL 3VFPB 4DERA 2J1YA 4FQ1H 1AO7D 3A67H 2Z8WC 3OKKA 4NQTA 4PJ8A 3NGBC 4JMXA 1JHLH 3GSOA 4I0PD 4NQCE 1QRND 3C9NA 3VXSA 5C08D 3BEVA 5T3ZH 1TJXA 3U4BH 4EZMA 5L9DH 4ZTEA 2FSDA 3MLVL 1AZZC 5FUCC 5PCYA 3G5XA 3ZDXF 4FJ6A 4YMPA 4LCCC 1WUNT 3M86A 4UZSA 1TFPA 3K8KA 1YEHH 1GZHA 5I1EH 4EDWH 1P7BA 3OX8B 3K81A 3FO2A 3HZKB 3SDCC 4C56E 2JB6B 1OAYL 3MNZA 4F37F 4QTIL 5J5EA 2ED6A 2DQIL 4FQCH 1Z3RA 4LHUB 1A2YA 3NIFF 1L0QA 1U3ZA 3PJSA 4UTBH 2HJLA 2JI2A 4PS4L 1KCVL 1MF2L 1A25A 1DVXA 2DIAA 3BDYH 4LDOB 3RDTD 2Z35A 1QQDA 3IJHA 4PH8A 3UTSA 4KVNH 1CFNA 5AAMC 3TPKA 3S8WA 2YAMA 4CKQA 3KS0H 5HGDA 4QKXB 2R69L 5CP3A 3PDDA 1NOFA 3W2DH 5I1DB 3WTWA 5HD8C 1JPEA 2YFNA 3IGAB 4E9YA 2X44D 4IK7A 2QQNH 4WF7A 3WJLC 3SKOB 5IOPA 3LS4H 5CMAA 4ZUTA 5TPWH 4U1IA 3LD8C 3MRDB 3AG3B 1A14H 2GABA 5AEAA 1NDGB 3U30C 3LNDA 4X4XA 3HUJB 2WUCL 2AABH 2E0PA 2JCCF 3F7KA 4QRFA 4DIXA 4EI0A 1OGTA 1GTNA 3FJTA 3WO4C 1K5WA 5ELIA 3JWNG 5B1JC 2D03H 2P8PA 4MA1B 5CD5C 4CDHA 3RNKB 1NBZB 1PKOA 4KGJA 4XVSL 4P2QD 1N6VA 3PCYA 5IT2H 1JAEA 4NNYA 1QX1A 2BSEA 3EXJA 4GKNB 1G0XA 1L9TA 2G2RA 4YVNA 4F8PA 5HYSA 4ZPTB 2UZXA 1IFRA 1ZDQA 5BV7L 3R0NA 4GY4A 3N85H 4BSWB 1YNKL 1E40A 3B37A 3TCTA 5I6MA 2X4QB 1NEPA 1OW0A 2F1AA 3BUYA 1I1AB 3OB0K 4JFHE 1IGCH 1UB5B 4L4TE 1D7DA 3QJZA 1NM4A 4FL4C 3U46B 3EOTL 3SE8H 2Z6FA 4LGRB 3OWEA 3TO2A 4KROC 4AENA 3L5XH 1JF5A 2AEPH 1JCVA 4AGQA 3KCPB 3NCYS 5I73C 2X4TA 4QWWD 2EDXA 3V2AR 2OP4H 2BFGA 1G5AA 3QNZA 3HAEB 1UM5L 3H56A 1EFXB 1W80A 2ZOKA 2ERJC 3C6EA 4MZ3A 1E8WA 2HA1A 3HI6L 2IPUG 3DV6A 3KL3A 5CEYA 4I3SH 4U1SA 3CDZB 2TSBA 4MAUH 3ZDWA 1VLXA 4YHML 3BKCH 4DK6A 2DKMA 2WLHA 3SE3C 4ZFZB 2QGCA 3NIDF 4WV1B 4PYHA 3TC9A 3NCFB 3PNRB 1PCXA 1NIDA 2B9BA 4IJ3C 2YPKB 4OFYA 2XVBA 1MRCH 5FLVA 1E7UA 2XTSA 5EUOB 5IWLC 1RUQH 3CFJB 4XN7A 4EZKA 1FBIH 1ZJBA 3QO1A 4FFWD 3QUML 5I0ZA 1AYOA 4MMXB 5CGBA 1SLVA 1MVUB 3DOHA 3H3BC 3KYNA 4H88L 4KRMB 3P02A 1NZRA 2VLJD 4XXCC 3REWA 1T2QL 2VQTA 3QZNA 1S9YB 5C0BB 4F7PB 2X12A 3C6LA 2C9SA 4NNPL 3TEXA 5AW3B 4JDVA 3RZCB 2FO4A 3TPUA 4PJ5D 4M8QB 3ESMA 4WI5A 5HYQA 3DUUB 3RPKA 4YIQB 2XBDA 2JXMA 3QA3B 1ZT1B 1HL5A 2IVFC 3DGGA 3QFJB 5EO0A 1AXIB 4L4VD 4MYWB 1HKFA 2OCJA 2KQNA 1S4IA 2C4XA 4O00A 3MA9H 2XWJB 4JY5L 4EUPB 4AQ8A 2NY0D 2EDTA 3KPLB 2EH7L 3GMRA 4Y2DB 3EFDH 1PLAA 4XPTH 5EC1B 4U6XA 1W72L 4K8RD 1OCWH 1RPQA 2IQAA 3QSKB 4BINA 1F6LL 4M6OL 2XXGA 3B9KC 4ELKA 3UTTA 5C7XL 1X5LA 4L1TA 3TIDA 4WWNA 1WH0A 2J8UA 4XNZC 3U4EA 4MD5A 2BVPA 1LQSR 3ARGD 3O2VH 5FXCH 4BWWA 4MFHA 2BSTA 2P47B 2YOCA 3JTBA 2W80C 4OT1L 4K3JH 5HYEA 4XVJL 4GS7B 1RQ5A 4O2CB 1OGSA 3QEQE 4XCFH 1T1YA 3WNJA 1YC7A 3NOIA 1ED3B 4G11A 2DLGA 3I50L 1FL3B 4IOSA 4B96A 4UT6L 4N0YH 4QHNA 1E4WH 3OAWA 4J6RL 1IGIH 3C5ZD 1BAGA 2EH8L 5KVGE 3I3EA 1RI8A 4G71B 4AJVA 3C8KA 2A6DB 1VSCA 1XB3A 2X1PA 5FCUH 3H9SA 4HSCX 4B95C 5FYLD 4UTBA 4K3GA 4LSRL 2IGTA 4F7EB 1VENA 3OJ2C 5I66A 4LLMB 2NY6B 1BQHB 2VMDA 4X6FA 2OL3L 3V4PB 1K6QL 2WD0A 4J4PA 1VGEL 1RUMH 2YKKA 3CHXA 1UXSB 2M2DA 1KEGL 4MA1C 1WAAF 3SEPA 2GBUA 4AH2A 2JNZA 1TO5A 4EBQL 4LLYB 1N8ZB 2YPVH 3EO9H 1EO7A 3C87A 5KAQG 1I1RA 3SDDD 2VMEA 5F7EL 5JPNB 5ESQA 2WIMA 3GS0A 3H9HB 1XSOA 5ABDE 4Z7OE 2P5ED 3BPNC 1I1AC 4XGZA