4YS4A

Crystal structure of pf41 tandem 6-cys domains from plasmodium falciparum
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
351
structure length
258
Chain Sequence
MGKSHKCDFTKEKYLLSGEKEVSCEIDANPADDITFICPNLCFHTVNIAKNINQNKATMSIQDLLYGSVVYGNTLFISPYVRTNTPFYCFCNLDTVTIQKFLKINRFLKDDDELSIISKRGIMSVFVRSNNNVIKGCDFGNNNKNYFSHPISVAGVNNKVCKIQGKPGELVGFKCAFEENGKVEPPNCFDQVLHKNKVTDLKTLIPGYASYTNKHSSKYPYYLKIPHFVNEQYTIQCCSNNAQNEYTFELDIQPGESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Plasmodium falciparum Blood-Stage 6-Cys Protein Pf41 Reveals an Unexpected Intra-Domain Insertion Required for Pf12 Coordination.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
molecule keywords Merozoite surface protein P41
total genus 63
structure length 258
sequence length 351
ec nomenclature
pdb deposition date 2015-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ys4A02
4YS4A 2LOEA 2YMOA
chains in the Genus database with same CATH superfamily
5EOQL 2XOTA 4MMZB 5EF0A 1EHNA 4U49A 1U95B 1HKFA 3IN2A 4XZUA 5H8DA 5C0AE 2ISDA 2ZXEB 1HHGA 4FKKA 1M42A 3S7GA 5KAQG 1RZIA 1H8OA 4E9SA 4Z78A 1TQTA 2G60L 3KGRA 4QHMA 5FYKL 3IGUA 4FZ8L 4ZO6A 5IBLC 3OAYK 4HLZG 5KYNA 3E6HB 1S3KH 3DYMA 3ILQC 3O6KL 4Q9BA 5KN5B 3S96A 4QHMB 3S35X 3FT4A 3S4SA 1HHJB 3VXNA 1YEKL 4OLZL 4GKZB 3OB0H 4Y19E 1NL0L 4WWKC 2X87A 2MCMA 1JV5A 2EDMA 3AQDA 3FZUD 3VXME 3X1EA 4QY8A 3CBJB 2A83A 3HEIB 4PJIA 3UTSB 3VG0L 3DV6B 3C5ZD 4N0UE 2ZUYA 3QPKA 4MQ7B 5KVFH 2F7PA 2IG2H 4P2AA 4XO9A 4YWGL 1OAJA 2O6EA 2HT2D 3GSWA 4NGHL 4NZRH 2AANA 3Q7JA 2G9KA 1E27B 1BX2B 3R06B 5D9SA 3F7RA 4HIHB 2FH8A 5A7EA 5DR5H 3ZT5A 5BXFB 4WEBH 2XWJB 3BCFA 5TE6L 4BKLA 2IH9A 1QSZA 4TL5A 1M2VB 3V7AE 1WWBX 3RYMA 1MVYA 2J8UA 4MVBD 3QFJD 1DVUA 3QE5A 5DRXA 1TNMA 4TOYL 1DP0A 5JORA 1D9KB 1XD1A 5EFIA 2Y1VA 2EADA 3DX0A 2GEQA 4XHJC 1I8LC 3NZ8B 3BQUD 4HWEL 1TNNA 3BPCB 1RHFA 4HQQH 2HKHL 2NY0B 2OXGA 4PUBL 4UB0L 1DQLH 2COVD 1RZPA 3W82A 2DQEH 5GJSL 4M3KB 1FF5A 3VCLB 4H0HB 3FTXA 3O6FB 3FU5A 5BRZA 2OS7A 3Q3GA 1CDJA 4EPSA 1PYWA 4AQEB 2Q86A 5LO7A 1EVUA 3F7KA 4NZ8A 3FQ1A 3L3GB 1CLYH 2LLNA 4OH2A 2CK0H 2HH0H 3TBCA 3ZTCC 1ORSA 1OSPL 5H94A 3GQFA 2EIJB 2VDQL 4XXWA 5B38B 4LSPL 2Y07H 5F89B 1LEIA 3E38A 5AW4B 3O3BA 2WYTA 3JBG7 3FHEA 4DUXA 2MTPA 4PB0L 3FQXA 3KEDA 3QCVH 2VRKA 4J3BA 2VJ8A 1D5MB 3ULVE 4G8FA 1G84A 2YXMA 1XF4B 5A6IA 4KKBC 3WTVA 4CU7A 1KULA 1Q8MA 2C3GA 2FIRT 2P5PA 4YOKA 5E08L 3MBXL 3FUNA 4JX0A 5T3XE 2QVIA 4J8RA 5H2BA 1ZEAH 2HT3C 3UEZA 4FQHB 3G5XB 3VNYA 5E70A 3A4AA 5HY9A 5EO0B 2CUMA 4N2IA 5GRUL 1P7KA 2ESVD 2ESVE 3NEXA 3MACH 2WIIA 1U2HA 5ITBH 1ZWIA 4JPVH 1SDYA 5F88B 1PQZB 4QRRB 4Y1AA 4F9PC 1WT5A 1OTTC 3RWIA 1A6TB 4OD3H 5BCAA 3KWXA 2IDQA 4WWOA 4PJHE 3ZKNC 3DX6B 1IT9L 2V3EA 2FNWA 4UQAA 4Q9QL 3LZQA 4CVUA 2M1KA 3EXLA 3LD8C 4TQPA 4G8EA 2F53A 4AH2B 4NXKA 4OIIH 2BHYA 3FQYA 1UM4H 1FYTE 1MELA 4KKLD 3ZDYE 4PBWD 1NMCC 1KLUB 1RK1A 1X5ZA 3TXAA 1G0YR 3HC4L 4PMEA 4PJGF 1NLBL 3ULUD 3O6LL 3PABA 4HS6B 2WWMC 3WSQL 3IJHB 3BRGC 5B8CB 2WXKA 1S7WB 5IOKA 1P7QD 2ZKXA 1FL6A 4Y5XB 2IBBA 3OMZA 2JJSA 2BNQE 4IKJA 4N0RA 4ELMA 1JE6A 4KXBA 2WBJA 3QDMB 3MCYA 4DW2H 3VWJC 2Y6TE 4UM9B 4N25A 5I28A 3S3DB 1BFSA 5IMLA 4PVNA 1NFDB 5CP7B 3V9EA 3ZRSA 3VI4B 2XBZA 4ZYKA 5I15H 3WFEH 1T80A 5FYKU 1I9JH 4FMVA 3L5XH 4AYID 3WUWG 4UDTA 1NWOA 3T0EB 1EMTH 1X7TA 2XYBA 3RDTC 2BIIA 3MRRB 2WP3T 2X12A 5SWSE 4L8BA 1BZQK 3UZEC 2VNCA 4PRPE 1RIHL 4KHXH 5G2NA 2CO1A 4LBEA 4PG9A 1K8DB 1C12B 5LUMA 2JTYA 1R3LB 5DJ0A 4CVXB 2AXWA 3H9HB 4MA7L 4YBLB 2DOCA 3QARA 4EQ2A 1T83C 3IPFA 1Q4NX 1N59A 4GP8B 2AJUL 1U4FA 2VLRA 3T4YA 2ZP8A 3BZDA 4XH2A 5KBNC 3P4NB 1BVNP 3A6OA 2WSPA 8FABB 5IW3A 3OKNB 4BFIB 1ZSDA 1GHFH 3GD1C 2QQKH 3S36H 3P73A 4LVHB 4XMUA 2ESVB 4KY1H 1UM6H 3DMMB 4CC4C 5FKPA 3VG9B 2BNQA 5IB3A 1HOCA 2XICA 4G70B 3VACA 4KNTA 4AKOA 3CWGA 4R26H 1HJCA 1P1ZB 4X9FA 3HB3B 1U91A 4RLDA 4F7CB 2Q7NA 1HCVA 4A38A 4BD4A 2C9AA 1Z5LB 5EH1A 3UG5A 1QQDA 2WGNB 5CD3A 2VW7A 4WI5A 4X9YA 1Q9WB 2HTLD 1O7SA 5F7WC 3UJJL 5EDSA 5TE7H 3I9GL 1A3ZA 2W0LA 2EIEA 5BPPA 2NSMA 1O6SA 4Z3FA 2EDFA 2EDDA 2Y69B 4MNQD 4RRPA 1B0IA 3HJ0A 1U21A 5A7BA 3TM6A 2DWEA 3TEYA 3BVUA 3O0RL 5MEOB 5L4MA 4KO9A 3V9CA 1QR4A 2WSDA 2EDEA 1G5GA 2B4CL 4BQ9A 4JR9L 1SEQH 4K94L 4XCFL 3ZTNH 5JIQA 3ZW3A 2ZF8A 3OAYH 3X12A 1P4IH 2WCSA 4LCWB 4PGCB 3PRZA 1BXAA 1P53A 1EXHA 4B9GA 4WHYH 4L37B 4JQIA 1P4IL 3ARFC 5GRJL 1FCGA 2OK0H 3QDMD 1I7UA 2I27N 1EFXB 2VSMB 1GTNA 4YEEA 1XGRB 2X70A 1TKWA 4N2MA 4PGDA 4U6VH 4GKOA 2EEDA 5D7IB 5ECGA 4EO5A 4Z77A 4JRYB 3KPNB 1T1ZB 5HBBA 1CDYA 1VGEH 4DGYH 3HZMA 3MLRH 4WO4B 3O4LA 1NANI 3HFMH 4N2KA 5AG8A 3VQMA 4PYGA 4TS6A 4FG2A 1X9UA 2CD0A 4GBXD 3QDGD 2NYYC 2YAPA 3FYIB 5CJQL 2YA0A 3QWOA 3U2IA 2VLJE 1BW8A 2X89D 2ARJA 1R47A 4HJUA 1CFQB 4TPRH 7PAZA 4WDIA 2GK0B 4G1EB 1XH2A 2XXCB 1V7ML 4X5RA 5JZ7D 5I1CL 3QJZA 4YHNB 1QP1A 4HK0A 1NDGB 2FYYB 1OT1A 1NAMH 1NCBH 3V4VH 3OHMB 1MFNA 5JDSA 1IAOA 3IDNA 3LKPA 5JA9A 1A4AA 2YBRA 4BK5A 1FV1B 4Y1SA 2FO8A 5D96C 1NGZB 5BV7H 1LD9B 5BO1H 5JHLH 1KXHA 5BQ7A 1I8KA 4WWNA 5J3HD 1Z6JT 2OI9B 3VYOA 4M7LL 4KX7A 1T4KB 4ZX3A 2PABA 2JH2A 4O58L 5TDNA 4KAQL 1AXIB 1FVDB 4UOZA 4QTHB 2V37A 4ZUSA 1RFDH 3IEAA 3SDXB 2DJMA 3WHE1 1HH6A 5AD0B 1HWHB 4NUMA 5GGUA 3FN0H 3QJSB 5KYUB 1EVTC 1GYAA 5AZEH 4FAAB 3BVNA 3O2DL 4JFDD 1DEEB 3DX7B 4P2YA 3L4CA 3NIGF 2WZ0A 5GRUH 2FVNA 1VGKB 4NN7B 2GAZA 3KPOA 1JI2A 4YBLC 5C08E 4TVSa 5C08D 2IAMB 1YNKH 2YXVA 4WNJA 5D70L 2E4FA 5I5IA 4HJSA 3RHWK 4HUWB 4NBXB 3MAWA 4XN5A 1BBJB 4JG0H 3BKMH 3DLQR 4FNQA 4L8DB 4PJCE 4PJ5B 1XB6A 1L6ZA 3QO0B 2QJDA 1ZTXH 1LLAA 1U2YA 1AXSA 4ZTOL 1KCVL 3L45A 4QPEA 1MCKA 2AF2A 4GO8A 4PB0H 1FO0A 5EBLB 3PIQB 1S8DB 4LCWE 1Q9LB 5CCGE 3CH8A 2C1PA 2O5XH 4HFWB 3T2NH 4OIIL 3TN0D 1UXWB 1P7QB 2CU9A 2CHNA 3DSFL 4MNGA 3WFHB 4ZMQA 3QYMA 3H56A 3FT0A 2UY6A 3AMKA 3GSNL 3HUJA 4D7PA 1BPVA 2ZXGA 4N2OA 4E2OA 1TQCC 1N2RA 4PH8A 3U7YL 1NEZG 1FIEA 1UKQA 2IDSA 1A3RL 2JJTA 3QI9D 4JG1L 3Q06A 3NCCB 4D0CA 4YL4A 2WQ8A 2VR6A 1XWVA 2X2JA 3QJOA 1XGYL 1U3YA 5FW8A 4OZGB 3CFCL 1B9ZA 5IK3B 3G6AA 1CDUA 5JQ6L 2Y3NA 3RIAK 2R69H 4K5MA 4OD2B 3OKMB 4POUB 5FYJU 1IQWH 4Q9QH 1VFBB 3S35H 3C8KB 3BPLC 3FRPB 3I6GA 4Q2ZA 4EEEA 4FD0A 4J4PC 2XWTA 1OCZB 3L3DA 4HCRA 3SB3A 1PSKL 1E6JL 5D5MB 5D71L 4E41E 1FRGH 1WZMA 1EBPA 2CKBH 2FGWH 2YRZA 4G9DB 4AQAA 4DKDC 1S7SA 5B1AB 1I9JL 3TBBA 3BT2L 4E42A 3DBXA 5D7LE 4EMZA 1JXFA 4NQDD 5T3XL 1R75A 4KRPB 3WYRA 4LIQE 1LEGA 4Y5YB 4C4UA 4CU8A 4MA1C 4OLYH 5TJWK 4X6BB 3N9GH 2QV4A 4TYUA 1NPJA 2WV3A 3WSQH 2P43B 5CN3A 5F8RC 1G7HA 5BRPA 2A77H 4YDJB 2X41A 4K71B 3BWAB 3S5YA 5HGGS 2Z93B 1PW3A 3DRQB 5C0CD 2OW7A 4BSWA 2B9BA 2HRLA 2OAAA 1ZHKA 1S3RA 4PUBH 5F7KC 1N0LB 1NMAH 3Q6GL 2VO8A 4PJCA 1TT6A 2OL3A 2RAMA 2Y36L 3FT3B 4N9OB 4N2AA 4WU5A 4KDTC 4TUKH 3VX1A 4FQ2H 1G7LA 3AY4A 2PO6B 1KELL 4Y9EA 5CWSA 3QQ4B 2XHNA 4N3TA 4JFVA 2IPUG 1KCWA 3PLYA 3HFFA 2AAAA 4UYQA 3VI4E 4EDWL 1M7IB 1JWSB 1YEEH 5HI5D 1IEHA 1HH9B 3RJOA 3KCWA 4XAKD 4ZAKC 1PLGL 1U3HB 3FUEA 4PRHA 5HGHB 4JFDA 3P0YH 4PFEA 3MNZA 5TQ0H 4PGBB 3OKDB 2YIHA 2AFNA 1J0KA 4FEIA 2V17H 3RWJA 1WC7A 2J55A 3BP4B 5D8JL 1K4DB 1BQLH 3GBNL 5FGCE 3RDTD 1BG1A 2RFXB 2HUHA 2XIBA 4IOFC 5TE4L 3MRJB 2CO3A 5E08H 1K6QH 3A5VA 2ZCHH 5L2KB 3GXFA 4NM4H 4XMPH 2N7SA 3N04A 3VRIA 3IGLA 3JWNC 2KT6A 3N40P 2NY0C 4KMTH 3ABZA 4AEHH 3MRPB 4MZRA 4JREC 4JL2A 1JTOA 1TYRA 2BINA 4L9DA 3MXWH 1EBAA 3WIIL 4LPXA 3NGBB 2FIKA 4ADJA 1KPVA 4Z3IA 5DRNB 3HB3C 2UWEB 3MNZB 1YN6A 3ME0B 5HGHA 3HNSH 3LEYL 5D70H 1KB5B 1I9IH 1KYDA 1D7CA 1M7IA 5I8OL 3W3BA 4MCNA 3V6BR 4AJYV 3SJVB 4PBVC 5E0FA 4KK5C 5DZJA 4FFZA 4DP0X 3MJ8A 4DHLA 3PNWA 3U1SH 2IOIA 4U3XA 2ZKYA 5DZ9A 2A73B 2BNQD 1F13A 2VXTH 4P2OB 2VXVH 3OAZH 2R4SL 4X4ME 2GITB 2ITDB 9PCYA 3BGFC 4PJDE 3L95A 5I5JA 2WCGA 4ZNEA 4P05A 3L4YA 1R0AL 1NANH 4HJIA 2UWEA 1SVCP 3PL6A 1JZ2A 3ZQXA 4QF1B 2FUTA 5ALBH 4MJIA 5DHVH 5CO1A 5MENB 3ARBD 3LN5A 3R7RA 3MRPA 4XP9H 1GMEA 4IS6A 2EEBA 5HHME 3EH3B 3QZNA 1P5UA 1VPOH 4HIEA 1KLFA 4GAFB 3VAEA 3DBXB 4E42B 5KSVB 1EANA 3C6SB 2F54A 1PGRB 1ZVYA 4K5NA 4BK4A 1UWYA 4WEBL 3WTXA 1F41A 1Q9OA 3CDFA 3F04A 4PP2A 3UDWC 2XVGA 1RZKL 2BJML 4QHNA 2JFCA 3I6GB 2BW5A 4FQQA 4PHZA 1KTKE 5ICXB 1HK6A 2VZSA 3TH3T 2V5TA 4I88A 2YD6A 2EDYA 4YDIH 3SGEH 1O7DE 1AR1B 3PFQA 5B1JC 1ZPLA 4WUKL 2X3BA 5DDHA 5F7FA 5LCVA 2DIEA 3CU7A 3UH8A 5A43C 3X3FH 4HX1A 1YEJL 3MUGB 5F1NB 1T5XA 2A9CA 3IXTB 3FCUB 5KYWB 4YHLH 5IHZA 2WXQA 3HLKA 5C0FA 5TPWL 1UB6B 4I2XB 1C5DB 4OJYA 1Z9SA 5BZDA 1U41A 2ED6A 2X1QA 5CHNB 3V79C 3BSZA 5E9DB 1LO5A 2HUEA 4YDJA 4Y4FC 3H9ZA 1M1XB 4OY9A 1FO0B 5EBLA 3IYLW 1FFNA 4NFBA 5D8JH 5E00B 2OXHA 3WFEL 4K94C 4MVBC 2YQBA 3ULUL 1R3KB 4GINA 3WTWA 5BV7C 3F65A 3HHSB 1QFHA 3F58H 1F6AB 2NDGA 3BAIA 1NIBA 3BKCL 2EVJA 3UIZA 2P52A 4ZMOA 1E30A 4HUWA 4U1JB 4X9HA 3V0DA 1XB3A 4POYA 3T8XA 2VXSL 3OF6A 5EEVA 4N0FA 1YEHL 3LQZB 2IQAB 2PXYD 1SXBA 2JB6A 2CNYA 4JS7A 3ZOAA 1P4BL 5D1XD 5JQIB 3NGBC 3S2AA 2BIOA 1S7RB 3ASWA 3C60B 1HILB 2EDHA 4PJAF 1OY3B 1UJ3C 3L3OA 5D1QB 4LPVA 1ET8A 2VUOA 5EUOA 1CICD 5EBMA 1WS7A 1AQMA 3D85A 1QSFE 4M6AA 1IQDB 4TSCH 4CGTA 3L4ZA 4XX1E 1DSWA 1QKZH 2UWEF 4G42B 4U6XB 1FYTA 4DTGL 5CIPH 3EFDH 1WA1X 2BVEA 4P5KA 5DEGA 4JG0L 5CJXC 3M7FB 2VUKA 3AY2A 4PJXF 3UBHA 1MHHA 3NK3A 1O6VA 1K72A 4JMNA 2YD2A 4LLUB 3GRWA 3N44F 4FLQA 1U92A 5IJKC 2HJKB 1T21B 4ALAH 4YO0B 1FV1A 3SBPA 3TZVC 2J6EH 1BBDH 2QELA 1CU4L 1I75A 4PYHA 4Q6YA 4DZ8B 5CGYC 3PY9A 1M05B 3D5OF 3FO1B 3O6FC 5FECA 4NQQA 5LWYH 2G2RA 4J23A 3H2WA 2GIXA 3S34H 5F0JB 3STZA 3D0LB 2HXAA 1OSYA 1INDH 3EJTA 3AT8A 3GB7B 3HG1B 3VGAC 5F96L 3ZMEA 1ZANH 4IBLT 4L8DA 5KEZA 2B16A 3II1A 4LCYB 4NZUH 5INDB 3JTTB 5HI4D 5ESQB 1DANT 4APQA 3K46A 3HZMB 4DN4H 1T1XA 2GUOA 4BFBD 5E99L 4HXBH 5HD8C 2NY7H 1IKNC 4TPRL 3FB7A 4U1GC 3OXSA 2D2CC 3TTSA 2X70B 4IBWA 3BXNA 4RFNC 3V10A 4KJPC 4Y8AA 4R7DA 1MVUB 1NPUA 4J3OF 3BDXA 4H8WC 2QMKA 3PPSA 5DYOB 4YVUA 2DLIA 5C0IA 3T71A 1H3XA 3N85H 2CO6A 1DCLA 3EJSA 1J1XH 2KZ1B 2QKIC 2R0LL 4Q89A 2EUWA 2HFTA 1HEHC 5A40E 3PQYE 1EEUA 3DX8B 5DD3H 3WHE0 3NOIA 4K3JH 3FQ4A 4B5ZA 1I9EA 3Q05A 1I8IA 1MWAH 1YEKH 4L1HA 1D6VH 2AI0H 1A7PH 1YHPA 3QHZH 1F4YH 3GMPA 5G4MA 3RFZB 3AVEA 3S37H 1GAFL 3KPMB 1PKQA 1O6SB 4UDUB 3ZSTA 5I23A 4ETQA 4URTB 1USQA 2X6BA 5F97E 4KY2A 3HE6D 2G3NA 1AR2A 2LOEA 5JW5B 5GS1A 3D0VA 4TNWF 5I6OA 3IGKA 4FZEL 2F53E 3PAYA 2R1WA 3H9SA 1CCZA 4ZUUB 3NSCA 3ULUH 4NKMA 4PJ7A 4UTBL 2ARJB 1UXSB 1XMWA 2E7DA 2VDNB 5EB9A 4HUKB 2FNBA 4H88H 1R5VA 3CX5J 4PI0A 1IFHH 1QVOA 1AZUA 4UT9L 5TGBB 5D1XA 1FG2B 2RCSL 3DPBA 3TCLB 4P46B 3IS0X 5FF6B 5LGJB 1MJ7L 2VR7A 3KWVA 5FGBC 2VDMB 3FCSB 4BUHA 5BW7C 1AXTL 1NC4B 3DMMA 2ESVA 2JLLA 4DP1X 4JRFA 1IC4L 1CDCA 2J73A 3AY4C 3EOTH 2J57A 5TE7L 8FABA 3FQRA 3QXTA 2AVFA 3UTQA 4UZUA 3HNTL 3O9WA 4BFGA 3ZKMD 1ZLUH 2C9XA 2MNJB 4ODWA 2XTJC 2RMNA 4PJGE 2QTEA 4FL4C 2AV7B 4P3DA 4P5MA 2ENYA 5T3XD 4D9QE 3N1FC 1QHPA 4D8PB 3D9AH 4OF8A 4HEPA 1CQKA 4KROC 3U2SA 4Z7UF 1F0LA 32C2A 1G6RL 2RHEA 1EAPA 2QGCA 3JZYA 1CLYL 5DVKA 2D7PA 4MDJB 2IXQB 1DL7H 1E4XI 2UWEE 1J7VR 5DS8A 2CLVA 3RI5K 1LJMA 1YEDB 2NT0A 4GSXA 3EYOB 4A39A 2DLFL 3DK2A 3RVXD 3RZCC 1GC1C 1E4XL 4L8SB 3MOBL 2ZWNA 4R5VA 1MOEA 1Y6NR 3G6JE 4RESB 3TPUB 1XGPB 1ZJBA 3KJ4C 4RMWA 3MZTA 1UM4L 4ZS6C 4RFOL 4XP5L 5I17A 1HINH 1R46A 1RSYA 4UOJA 1BQ5A 3MCKA 1CXLA 1ZT7A 2KERA 3WTTA 1T6WA 4RGOH 1S9YB 4JNXA 1WIPA 3CVIL 3BH8B 4XZ4A 1X4XA 2Q3XA 1LK3L 5B3NA 1JNNL 2NXZB 3B9KC 3I75B 5KBMA 3CN4A 5EU6D 5ITBL 4K7PY 3S9DB 3BDYH 4G6AD 5E4EC 3BLBA 4BFFA 1W72H 3GSOB 4NPKA 4YWGH 4DKFH 2OZNA 1MRCH 1AVAA 4ZFOA 1IKFL 1KT2A 1WIUA 2VLRE 3DDGA 2YPLA 3MA9L 3GSXA 1U8PA 1GJWA 2JE8A 1XF1A 3KYAA 2X4PA 2J72A 4UT6H 4LGSB 4XPBH 5DD1H 3VSVA 5KTEH 4BUQA 3MV01 4IW4C 3TO4A 4AYBA 5GQBA 3K0YA 5FM4A 1OPGH 4L3FA 4S2SB 3CFTA 3WTSA 2H0JA 4F80A 2X4RA 4H1LG 5ITFA 4DT2A 2DTML 4XMXA 5E6ID 4PR5B 3H9SD 2ZJSL 1MHPL 4PWGA 1QSEB 3MV8A 4Y4HB 1U30A 1BAWA 5C0NC 4Y1TA 4ZYKB 3VI4A 4Z7OF 1L3WA 3DOSB 4NYLA 5AKTA 2GC4C 4JE0A 4NAMA 2BSSA 5DQJB 2WLLB 2R0KH 4NP4H 1CXIA 2WB1A 4GSUA 4IBQA 1M3JA 4IKNA 4JGMA 2WBJB 4N6QA 1IFHL 5LGHH 3U7WL 1KENL 3J27A 2NY1B 4L9LC 4LMQI 4OLUL 3K6NA 2NTFB 5DA0B 4YK4B 1ZS8A 1AS8A 3GHEH 4L48A 1RD6A 5MERB 1E4KA 3UX9B 1UTDA 2LU5A 2OMXA 2VERA 3BVWA 3GHEL 5EZLA 3ZJAA 2X4TB 4J3OC 4I3SL 3U79A 3SBQA 1A4JA 5E1QA 2VDPL 3FL7A 3O3BB 4FFZL 4A6YB 1H9DA 2GFBB 2AJZA 2WQUA 2GW5A 5T33H 3DVFA 4DAGH 4MCYB 1ORSB 5H94B 3QNYB 4HKJA 3OPZL 4WHDA 4JJOA 2MOGA 2YGVA 5DGRA 3N50A 1KYFA 2VDNH 4E36A 1MIML 1IIIA 2V5SA 4ACPA 3Q01A 4IGBB 4LRIC 4Z95H 4OGXL 1U8NB 3QUKA 5FWRA 4NQEE 4TF4A 2AQ2A 1EHLL 4DSYA 2DQTH 2E75C 3WNLA 3SGDI 1MHCA 3PDOA 3TTYA 5DJYA 5F88A 3FUIA 1D9KA 1EHXA 4Q4EA 4A7TA 1XGTB 4ZMLA 2CO7A 2P8LA 4ODSH 2MCAA 4TN9A 3VU2A 2F19H 4LPCA 4JO2H 4HHAA 3KPPA 3RUGA 2R9HD 4PRPD 4WO4C 5ABZA 1EUUA 4NRXB 3MR9A 3G6DH 2XG5A 3KDPB 3ZHLA 2VL5A 3UIYA 1E27A 3ZT7A 1RZFH 4YHIB 4RWYH 1JVOA 1AGFA 3FCTA 4MQ7A 4YDVB 2M26A 3S3PA 1VFOA 1KB5H 4G6ML 2HTKD 4CNIA 5C0RH 3RWFB 4GEJA 5CLWA 3J8F7 4IKIA 4OZ4B 4QHUA 4O51A 4NNXA 4XPAL 1PCXA 3IVKA 3TX4A 5I1EL 4WTXA 3APMA 3L5HA 1D5IL 4ZOCA 4JQXC 3OGCA 2ILLA 2TSAA 1B88A 5IHLB 1UFGA 5HYJB 3GM8A 5AW1B 2DAVA 4Q97A 1BD2B 5F3BB 2QKIA 1PKOA 4MNHA 4HEPG 1MI5E 3UC0L 3BW9A 5BZWA 3CVHL 1TSRA 1EXUA 4BCYA 5C0BD 4ICWA 1X9LA 4JM2D 1QFWI 4PY7A 5HDOA 4LPYA 3VGFA 3OV6A 3PGDA 1U8OA 1CE6B 1QA9B 2AEPH 3HC3H 2A6IA 3Q48A 4BQBA 2A6DB 2EH8H 3OKLB 4MNQE 1T04B 4GW5A 2VAAA 1RUQH 2AABL 4H8WH 5D1ZD 4ANUA 5DRXB 4DETA 1AGCA 2YD9A 1U8KB 5I76B 2WJ5A 4APQC 2L4OA 3DUSB 5JPNB 3NFPB 3H42L 4XBEH 5SX4H 3LNDA 1Q94A 4HKXB 2IF7A 1P6WA 4KZEH 5CIPB 3TWCH 1GCYA 1FNSL 3QUXD 1BX2A 5GRWA 3UMNA 1EIBA 2E7LC 1PFOA 1UH2A 4BQ8A 3EG9A 3CHRA 2DYSB 2VQUA 1F4AA 2IH1B 4H88L 2A6DA 4NZTL 3ISRA 3OJVC 4NP4L 2EKSA 1VFUA 3PWJA 4XCYA 1NMCB 1WWCA 5IJKA 3GEFA 4M6OL 4V1DE 4P06A 1MW2A 4MCZB 2P24A 3IDMB 1QFWM 4DPCX 1PD1A 2OYMA 3C5XA 3S96B 4E9VA 2R23A 8PAZA 5LG1A 4DO6A 3GXMA 4MNHB 2XQYG 2WXNA 4MJ6B 3K2MC 2IV9A 2ZUUA 1RPKA 4LAQL 2CNZA 5HYJA 3IDMA 4FDWA 3I50H 4NP9A 3QIBD 1G7PB 1KCVH 1PX4A 1WAAE 2BCKB 6PAZA 3L3IA 4M4RA 3WNNA 4Z7OE 3CZSA 2H4EA 4K3GA 1L7TH 1IBGH 2G30A 3IVKB 4HDIB 3L3OC 1EQWA 3GK8L 1TJMA 3BD4A 1C9SA 3LKOA 2JJSC 4CNIB 4GKNA 4HU2A 2IIJA 4OCMC 4AMKL 1TQBC 1AHWB 1UVQB 4LARL 1TQBB 5CF3A 4ECNA 2NXYD 3D9AL 4BQ6A 3T3MB 1FH5L 4LEXH 1XF2A 1IX2A 3LIZA 1H5BB 3IJ9A 2ARJQ 3NYKA 4XNZC 3AITA 3MRKA 4HS3B 3KL0A 1BQHA 1E9QA 4Z7QF 3ULUF 1UWEL 4HIIB 4G8AC 4NRXA 2P5WD 3VH8B 2KUTA 1WDAA 3H3BC 4R7NB 5E99H 2AJXH 4QRRE 4AKQA 1EFXD 2Y2WA 3IDIA 2PYEB 1R3IH 1GGIH 1WFMA 2EE6A 3BAJA 3KWTA 5BUGA 3ZIYA 1RUPL 2UYLA 5F8QC 3MLWH 3E6FA 3MRFA 4AG4L 3VWKA 4GI9A 1XHHA 4QRPA 4JZJB 1U8OB 5D7HA 4FXKC 4PGEA 4J3XA 1QSEE 3PGDB 4YVNA 1NCUA 2VLME 4JQIL 4LEOA 4XP1L 1TJXA 5IV2B 3DJ9A 1OTUD 3G5ZA 2QSCL 1EHAA 3QEUB 1GGBL 1IEAA 4NUQA 2K70A 4UTBA 2FB4L 1A4KA 1LVEA 3F7YB 5F3BA 4AK1A 3X17A 5ICUA 4FNLH 1ZLSL 3A6CL 2ENQA 1VRSA 4TSAH 1J0YA 2JELL 4ZFOL 4LCIH 1ULVA 3DX3A 5FW6A 4JPSA 3JTBA 1DTUA 1MWOA 1YEIH 3DJRA 3MJWA 4KTYA 4Z23A 5C3IA 4XNAA 3PV6B 3WNJA 4F2MB 3GPEA 3STBA 1NUDA 4BYHA 2QADD 4JVUA 2PR4L 1OPGL 1VCAA 4ZFFA 3NH7H 3OZ9L 1CXEA 1XD0A 4AVIA 5K9JL 1KBGL 3WXVH 2XG4A 1GRWA 2E7BA 1E5UI 2CAKA 5MEQB 1EDYA 3UBXI 3LKRA 4ZQKA 5TH2B 3WS6A 3VXRA 4ZTPH 3GXDA 2XVKA 1E9PA 1A1MB 2Y06H 5FO9A 1IIKA 3O8XD 4YQXL 3QEGH 1JG9A 2WO2B 4M1CD 3RBGA 3SO5A 4HPOH 2GCYA 1KN2H 4X99B 1Q0YL 3U4BH 4KOBA 5DJYB 3QEGL 4AE1A 4WIQA 3C5ZC 1MHCB 4WWID 4K9JA 1CFVH 1ROWA 2AQNA 1ZDQA 2FO4B 2CSPA 3O0LA 4MA7H 2YPVL 2WPGA 4N0YL 1E90A 1U8LB 5AQ0A 1J10A 1XF5A 3TNNA 4I48A 3CFJB 3VD7A 1VADB 5E51A 4Z9KB 2CWRA 3TA3B 3VD1A 1U8PB 2WZ5A 4FJ6A 3NJVA 4KRNA 4MJIE 2GT9A 1E9OB 3RQ3A 1I1YB 3QZWA 4MHHI 1T66D 4R4FH 4OZGE 4P57B 4MSWB 3ZHKA 3HAEB 1KB9K 1QPPA 5CILL 3QDJB 4LOEA 5ANMB 3UO8B 3MRQB 1B0RA 4JKKA 4M00A 4GAYA 1DVYA 4OD1H 4BGDA 4HGWB 3TT1L 4EI5B 3MTXA 5FFOA 2NUPA 1Q1JL 1S4IA 4GUCA 1MREL 2VDRL 3DMMC 3RUGE 1SDAB 1ZDSA 1ORQA 1ZGLB 4F91B 4MYPA 4X5LA 2LGNA 4NDMB 4WHYG 3SGKC 3BH8A 4NNPL 3KVDD 3QXDA 1RU9H 4P4KB 3QUZD 2Y24A 1BD2E 1V3MA 1AR1D 1PF3A 2FDBP 1M7XA 1L7TL 4ATTA 2ZD0A 3WE6B 5DF0A 3MGOB 4M48H 1YLBB 1SOKA 5M94B 1IGYB 1I85A 1WGOA 1T4WA 2OMWA 1IL1A 3LSOA 5AB1A 1T1WA 2E9BA 4NQTA 2ERJC 3W38A 1CD1B 1KOAA 3CFEA 1M53A 2CE6A 2OP4L 3FFDB 4GXFA 2BOCB 1UHVA 2EZ0C 2FWOA 4R96B 2AVGA 2CIKA 3RWCA 3AM8C 3O8XB 3MLWL 4YDKL 5LHDA 2VUYA 1F6LL 3E3QE 3MRLB 2ICCA 2P44B 5HHMD 3QQNA 2EABA 3JV4B 4HGMA 1TVBA 4HFUL 5FLUA 5C0JB 4I4WB 4RNRB 1QRNA 2XACC 2J88H 4JLRA 3L48A 2DWDA 4EIUA 2ZWLT 1IC5H 2AK4E 1ZLWH 3MLZH 1IM3D 2KI6A 2VTFA 1OCOB 2OZ4L 3FUHA 3GSXB 4I18A 4UBDD 1JNLH 1RP9A 1UA6H 2OSXA 2R4SH 3L9YA 1PFCA 1XF3B 4NQXA 5E1IA 3WIAA 3TGXA 3DVGB 5DEFB 1DVFD 2VXQL 4NSKB 3IAGC 1TEFA 4MMYA 2B5IB 4NNYB 4MD0B 4UYPA 3PAVA 5FM8A 5B1BB 1YYCA 1CPUA 2CG9X 2Y7NA 3B9KD 3VMNA 1AJ7L 1NC4A 5CP3A 3ZRFC 3AC0A 5AB9A 3FUMA 3B9VA 2NZIA 4H5SB 3WUWB 5J89A 3OD3A 2IALA 1NSNL 3RFRA 3SY6A 3MNWB 2X2HA 4Z7AA 1AC6A 1VACA 4I7ZC 3IFPA 4X5XA 5D4JA 2VITB 1AZNA 1B4JL 1O9WA 3O4LD 3IM1A 2RD0A 5AAMA 3K91A 1ADQA 2NY0D 2PUQT 5I17B 3CXDL 3TPUA 2MCG1 4ZX5A 5JW3L 3U6RB 1P9MA 2BJMH 3WN5B 5ADPH 5KW9L 5PAZA 5I1AA 5EF1A 3EYOA 3AABA 2DM3A 3BKCH 3I50L 3O4LE 3WXWL 2MCPH 1UENA 4XC3L 3B2UD 3BP5A 5AW0B 2DEWX 3RA7L 1VLXA 4A2MA 5CJ5A 3P0YL 4P8QA 1LK2A 2ZNWA 3QRBA 3GSQB 4NT6A 5DHVB 2W0FA 2XKSA 4PBXA 2V6HA 4P5MB 1K2DB 2F2HA 4WFEE 1JIBA 1G87A 3FDWA 1ASOA 4LSQL 2AQ3A 1QOKA 4YDMA 3PAUA 4E9TA 3UTQB 5E56A 1MFCH 2DH2A 1F4WL 3QDME 4MAUH 1QSFD 3EJYD 3OXRA 4LIQL 4HKBB 5C86A 1PD0A 2PF6A 1R4XA 3V6FB 3VQ2C 3J07A 4PD4K 4V2BA 5K39A 1AY1L 3RIFK 5C09D 3GSRA 4ZFGL 1V05A 2C7FA 2P26A 5JYLA 3ABKB 3MKGA 5DHXB 3GXPA 4QTFA 5E6YA 2WWOA 3B37A 1T1XB 2GUOB 3ATBA 4YFDB 1G7QB 4QRUA 3L9BA 1IARB 2H32A 1U58A 2NX5D 1RVFL 4H2AA 4NCC2 3SDAB 1QVOB 4AYDC 4ZUTA 5TDPB 4LESA 2R0ZH 3CPLB 4UV4H 5FB8B 3PL6D 1LDPL 3D0LA 2FWUA 2VWEC 3QNZA 4L29B 4LSVL 4NKMB 3TT1H 5MP6H 5CKAA 3EH5B 2ZSWB 3IDXL 2WTRB 2MPAH 4L05A 3VNZA 3EYFA 1JAEA 1J48A 3CAFA 3GMPB 3RFZA 3KJ6L 3H3PL 1WBXA 4HCGA 4KPHL 3LH9A 2OTPA 4KTDL 4X6FA 1WAAF 1MCHA 1ONQA 1JHLH 3RVXC 1UG9A 1IQWL 3EJYC 1ITCA 1M7DB 2J12B 4JN2B 1DVTA 3F00A 3ETBJ 4HIQA 4UWQB 5DEGB 5CCHE 3HN5A 2ITFA 4A67A 3MZGB 3VXTA 2FZ3A 4QNPF 2Z91A 1NLDL 4OIBA 3NSYA 5GRZA 2CRMA 3CD4A 4GSDH 4PRBA 1ERNA 1HNFA 5FDWB 4WCYH 1BZ9B 4MJ5A 4CSPA 1BMWA 5EUOB 5EZOL 3K7UA 3Q2CA 3OXSB 3O3UN 3ZTJH 1ZXQA 2YFNA 4XMVA 3D39E 4PREA 1NCWL 5GGVH 1VA9A 2SEBA 1L0PA 4JDVA 2BMKB 3CLWA 4PJ9C 3S6CA 2X10A 2K4AA 3C12A 5J9PA 1R6VA 5ESQA 3BAXA 3Q8EA 2IDFA 2VXUH 4RMVA 1YQVH 4ODHL 3KCPA 1XFPA 3GB7A 1QHOA 4OZHB 4LVHC 4FQXD 1YQVL 4ODHH 2BSEA 1P5VB 5J4MA 4U1NB 3WKPA 1KJ2A 4TLTA 4E0RA 1XGQB 4LP8A 2X5PA 1UB5B 4BFEA 2YD1A 1HKLH 2NNRA 1XGQA 2WBWB 3DKHA 4GRMB 1XBDA 2HJKA 3QVAA 4P59L 2W92A 4NHCH 4A2HA 3CZFB 4NO0A 3V6ZA 2BFVH 4FFVC 3WEXB 2A9NL 2FX7H 1G5AA 2YOAA 1MHHB 1RZJH 3OB0K 4HX1B 1E3ZA 1V3JA 1GL4B 2DEXX 4PLNC 5IMMA 2I07B 4XVTH 3ARDA 1FYTB 3M17B 5I30L 1HCFX 4ZO8A 3SDXE 2K6YA 1TMCB 2GG1A 2BVQB 3GLDA 1A9BB 3KHQA 3RA7H 1INEH 3MO1B 2XWRA 4N0YH 4QHNB 3U1PA 1TVHB 4K5OA 1A7BA 5IB4A 1VSCA 4WWPA 4PJHB 4X5WA 4Z7VF 5FGBA 4A7UA 5IQLA 4UIMA 4A63A 1NCGA 1DBML 1BZ9A 1FL3A 3GM0A 2PR9A 1P6AB 2HT2C 2EICA 3NSFA 4C54A 1WFUA 4H0IA 1DL7L 3VXTB 4PTTB 4U7KA 5GZND 1F6AA 4IS6B 1A9VA 1OAZH 2CM5A 4LLQB 2VDQH 3DGDA 5F7MC 1I9IL 2FCBA 3MGAA 5GS1C 2YKLL 1TG8A 2IH8A 3SCMB 1FFNB 2B59A 4JHZA 3FOMB 2Q9OA 1VZHA 4KK5D 5HVGB 2NW2A 1H9VA 4OFPA 3RRQA 5EU6A 3JV5A 2PW1B 1LO5B 1MFMA 2R83A 1OD7A 2V2WB 4N6RB 1MI5A 3SBWA 3FBKA 4RGNC 5JIPA 5D96B 3B1TA 5D2LB 1OSEA 5J5EA 1AGDA 1T1YA 3L54A 5I24A 4JO1H 5KSAC 3APNA 1WF5A 2QBWA 4BE5A 1NBVH 3EJRA 5ALBL 5IHZB 5D6DA 1CZ8L 1BYOA 1UH4A 3QDAA 3U0WL 1DBAH 4Z7OB 1HWWA 3EJUA 3B9DA 4JRXD 4CAGA 3S8FB 4FHKA 3VI3F 4ZD3H 1J8KA 1BLNB 4PLJD 1MNUH 2WXGA 2DQDH 2IAMC 3QUZA 1TETH 5I1GL 2CMRH 3X13A 2AQPA 5I1GH 3TA3C 4I2XE 2G2NA 2F8XC 2R2BB 1NICA 5EUOF 4YXHL 3RJDA 1AP2A 2I60L 1MJJB 4O02B 4UUJB 3U0TA 1RUPH 3NIGB 2WQRA 2CIIA 3RVWD 6TAAA 2NR6D 2ADFH 4NPYB 4PD4J 4PU2A 3WXVL 4DK5A 4WW1B 3QISA 2R1XA 3OR7A 5D72H 4HD5A 3RKDD 4KJWC 2BIHA 2CJSA 3MJ6A 1RERA 1JFQL 3FO9B 4HAKA 5ENWB 4RBPK 4KDVA 1WC7B 1Z1WA 4P9MH 3V4PA 2X4NA 5C0DB 2DTMH 1I7TB 4WW2A 5I1CH 3JWNE 1YEJH 1IAII 4OJAA 3CX2A 1CD0A 1U3HA 5SV3A 2CKNA 3CSTA 3VXSE 3VM5A 2YGOA 1HCYA 4FFYL 2BSRA 4F1SA 4R5TA 2VDQB 3ASNB 5AVZB 2F1EA 2YHGA 3DIFA 5DHYA 3K6DA 4JW3A 4J2QA 4UOW0 4U1IA 1G7LB 1RH8A 1T7YA 1Y0LA 1HEZB 3GMOA 4NWUL 1TTCA 3FO0L 1S9WA 4WU5B 4X6EB 4XPTL 3AWEA 1A7QL 2HB0A 2H47C 5IQNA 1BVLA 3AT9A 4F9PA 3ULVC 2Z8WC 1KNOB 2KLRA 1FAIL 2WXMA 3EGSB 3AXHA 5IREA 4I77L 4XMZA 1HHIB 1EMTL 3TASA 1ILUA 3FH8A 4KUZL 3P77B 4WI6A 5FCUL 3SD2A 4E9LA 5C6TH 1KPVB 5IROC 3IAPA 1F56A 4OCLC 3WUWA 5J56B 5IFHH 4JFOA 4X7EC 2LW3A 4AK2A 5E2VH 3D2TA 1LEKA 4XWOC 3O2DA 1AHKA 5F9JA 1OF2A 1X4YA 2VMJA 1QI4A 4TL4A 2EXYC 2JF1A 1KY7A 1KN2L 3LZFH 4NLAA 3BKYH 4PRPA 2XRAL 3D3VB 2A0LC 1MY7A 4Y5VB 3SYQA 4M1DL 4MJ2A 25C8L 3F12A 3D87B 3A22A 4UT7H 5JIIA 1EO8H 2Z34A 4I18B 5GGTL 3NRFA 5JIHA 2OFQA 3C5SA 2DLFH 3CZNA 3L3DB 4ZW7A 3IU3B 2B1AH 2XV3A 2LABA 4G6JL 5GGQH 5KANI 3ILQD 3EYSL 2WZAA 1VFBA 5AYQA 3L2NA 3NP4A 5CBAB 2Q7YA 3FQUB 2Y23A 4M6MH 5HVFB 4IDJL 3PAZA 5E1GA 1DQKA 2LHAA 5DJ8A 5T1LB 4HF5H 4U0QB 5GJTL 3F8UB 4ANVA 3IU4H 5HI3C 3EO1B 4N0UB 1MIMH 3TLRA 5K59E 4FC3E 2B0SH 2B3RA 4PJ7F 1WBYA 4YR6B 1XB8A 4TLUA 3G5WA 1N2RB 4HC1H 4RBPH 5IG7B 1IAKA 3PDDA 4MMZC 4FNLL 4U7MA 3OLIA 4LSRL 1TYJA 1LTXA 3NVQA 1FZOB 2VLKA 2E9IA 1O75A 4M8RA 1HESA 1IVLA 5F2FA 1G7HB 1M6OA 1PZ5A 1UOLA 4G71B 3CN3A 4L9LB 4HXBL 3PIQA 4WW2F 5INCA 3UTOA 3BP6A 1PL3A 3FT2B 4YPJA 5IBLD 3GLAA 1WICA 1DJIA 1ZA3B 3QGVA 4X6BA 5CEZL 2ADGA 3ULVL 1CC3A 5JHAA 3BWUF 2EQDA 5SWSD 1S7XB 3S2CA 2F5BL 3K81A 1ACZA 7FABL 3DX2A 4C56D 4OW6A 2WHVA 1OHZA 2OMYA 1FL3B 3OVUB 2YAMA 4CN6A 4P2RB 4KVNL 1Y7VA 2HMID 2EUVA 4U6TA 4RGNE 2O61B 2W9EH 1VGKA 3VA6A 3U0PA 4ZPVB 1BZ7B 4S1DD 4JFXA 5D7JB 4HG4J 5A6LA 2EVFA 2R29H 3D12B 3FO2B 4KKBD 2OMTA 5HGBA 4YHOL 4NENA 2R0LH 1HAWA 1D6VL 2JJVA 5C0BE 1TJHH 2G5RA 2L7EA 3D34A 3FQ2A 4M62H 3SDXA 4B0MM 1AE6H 1DJGA 3L17A 2ICEA 4PJXB 5DO2D 1KWKA 3AFLA 5HSFA 3RGVA 3QI9C 1T0MA 2JKWA 1N6UA 2W07A 5BZZA 4F15B 43C9B 1R17A 4YSRA 1A6VH 3L5WB 3RJQB 4D0CB 1DE4B 1ECYA 1H3TA 4R3SB 4DOHE 2XN1A 4R0LC 2WTPA 5JQHC 1AHWC 4ZQKB 4MMXC 5BNXD 2EILB 3E0GA 3UPCA 3WLWC 5ADOH 1JNJA 4JDTL 3L7FA 3SDDB 4GMTL 2D2OA 2MOQA 1KPRB 3K2UH 4G82A 3C9NA 5F9WC 3VTAA 1DVQA 3ZL4L 2LFEA 3JVGA 4BZ1L 4UIKH 3WAJA 4HJTA 3BWZA 5E2VL 4E41A 1JZ4A 2W60B 1K8IB 1NAKH 3BO8B 4KH9A 4F33B 4BZ1H 2CZNA 3LDBB 4HLZH 4L2LA 4Y4KD 1RZJL 1NCHA 3ABMB 3E7JA 1EV2E 2WINA 3I6KA 4UT9A 3U36A 1X5LA 4B5EA 2B4CC 3CQFA 1I8UA 1HINL 2AITA 1ZY9A 3MV7A 2W9DH 4JRXB 5IJDC 1DDTA 1T1ZA 1EX0A 4JRYA 1MRDL 2RGSA 3DXAE 3EOAA 2AXJA 4ZMYA 2XZAH 1A4KB 1U3ZA 2FJUB 5KSBB 3WIHA 3ZKMC 2ED7A 3N91A 1EFXA 5CU5A 2I9LA 4MJ5B 4U1SB 5CD5C 1MH5B 4JFHD 5FHAH 4XO4A 4LARH 4QHPA 5TFSH 1JDCA 3ARWA 3X1FA 3EGDA 1CFNB 1MCDA 3VWKB 1KTDB 5EOCH 3RX7A 3I74A 2LV4A 5CN2A 5AOZA 1FJ1A 5KVGL 3EO9H 4JFZL 4HUUA 5E23A 2CR3A 3UEQA 4OM1L 1BMZA 4CGUB 4ZTOH 2Y5EA 5JDJA 2CBQA 5E2UH 3KAAA 3WNOA 1ONQB 1I8KB 4JY5L 1PSKH 3CLEH 1LMIA 3FF7A 1HZKA 3WMQA 5CNHA 4B7LA 1H5BA 1AGEA 1LWHA 4DUWA 1IC7L 3VFNA 5JR1L 1R24A 1Z3RA 3KR3H 3LD8B 3D18A 4G6AC 4LGRB 4YXKH 1R0AH 3KHOA 4G1EA 1MPAH 3RY4A 1KZYA 1IKNA 3DXAB 1IVTA 2B9AA 4GG6F 4X50A 3LKOB 4NIYE 3MJ9H 1XGUB 4F7CA 3VWJA 2Z7ZA 3ZR6A 1OCWL 1HXMB 2GABA 3EZ8A 4LLYB 1EO5A 2WXLA 1U58B 5L7XL 3MRCA 5BRZD 4EBQL 3VFPA 3EH1A 3HS8A 4R0LA 4NZRL 3VA2C 2JMRA 3IPEA 4FG6D 2OL3H 3UYPA 5IGXL 4Z7UE 5I1LA 2NCEA 1VFAB 3DO3A 2DKUA 3RVTC 4EN3B 4X7DC 4P2CG 3TA4D 3KLKA 5IVNA 4PJAB 3JYCA 2P24B 4I3RH 5L9DH 5BS0E 1YY8A 1MAML 2P5EA 1ETB1 2RIKA 2VN7A 5DI8A 2E8YA 4PJ5D 2IDUA 2DV6A 4AIZB 3KM1A 3QIUC 5FLVA 5EUKA 2JJTC 2W0FB 4R97C 3D25B 4NJAH 4J1UB 5HPMB 1JK9B 2OMZA 2WQAA 3GGWA 2DBJA 3ML8A 5GGVL 2D7MA 4PRDB 4X6CE 1OD9A 4LU5L 4MA8L 3VE0B 4PG2A 2C9SA 5D7LA 1P84K 1JYNA 3NIFB 3ZHNA 4E5XG 1IM9B 2FJHB 4HCRH 2WSKA 4OFKA 4K3EH 3T3MF 2GBTA 3N42B 3LN9A 1W91A 3BIKB 3HG5A 5DJZA 3WTUA 2CR0A 1UYWH 1UJ3A 5ESAA 4KMTL 5F7NC 5CP7A 3RTQA 2HTLC 2PCXA 3NUKA 3X1BA 3MV8D 2ZCHL 4AQ8C 4AYSA 5HYJD 1TDQA 2VAAB 5AAPA 2QHLA 3QIBA 5DHDA 4GXUN 4D0DA 3X3GL 1WK0A 1QFWH 2WYZA 1P1ZA 2D3VA 4Y5XA 5JOFA 4P49A 1PZUB 5JOEA 1UD4A 5JOPE 3F7LA 2IWEA 4K7FA 3L16A 2F6AA 3C2AL 1I3RB 4Q6IB 4HMCA 4RWYL 4BDVB 5GS0L 2PETA 2QKIB 4D94A 4MAYA 1PX3A 4YQXH 1BD2A 4HPYL 1IFRA 3IMVA 5B38G 4MDRA 4GG8A 4RDQF 2ZKHH 3L3HB 4XXWC 1HL5A 1J0JA 1FH5H 3ARBA 3GMMA 4QRQB 2VXVL 1FO0H 5CJOL 1WJ3A 3QUYD 2N0MA 3QQ3A 3HLAA 3K6OA 3E8VA 1ZLUK 3ZGHA 2I26N 1WCBB 4YFEA 2F53B 4AH2A 3MRHB 1N6VA 1C7TA 2EEFA 1YNTF 5D7JD 4HEMA 1FC1A 3AG3B 2FWSA 5J8OA 2CO2A 2Q20A 3QA3A 1IGIH 3FQWB 4QRRA 1ET7A 2R9HC 4K7PX 4LOFA 3CDYA 5HHNB 5KVDE 5EOCL 1CTMA 2FWOB 1SUHA 4OI7A 2OK0L 2DQUH 3ARSA 4HT1L 5LNEA 3LZRA 4WU7A 1E3FA 2P8LB 1IL1B 4X80H 4Y9CA 5IROA 3OMNB 1EZLA 2FB4H 4ONHB 5DCCA 3MGOA 4G7SB 5FA3B 1CN4A 5CLYA 2UX7A 2VXQH 2LVCA 5ISZE 1JV2B 2DLEA 1P5UC 4U6YA 5TF0A 3K3QA 2P28B 1SJEB 3QR2A 2KPNA 3CMOL 1D5MA 2Y7LA 2FR4B 4YXKL 5IEKA 1J5OL 3VFTA 1DO6A 2QPFA 4HIPA 4HWZA 4XNXH 5EBGA 3K5RA 3QDJD 4BH7B 3PABB 35C8H 5G4NA 1YVLA 4K73A 2IV8A 3CSYB 4HP5A 3MRQA 3EAKA 3TJHC 1NFAA 2AXGA 2OR9H 3HZKA 3WJJA 2XX0A 3BZ4B 4RGMB 1E9OA 5HDBE 2AJZB 5TPWH 3P0VL 2AV1A 1PYWB 2HPOA 5AWNH 3VSUA 4P59H 3I9AA 2XTJE 1OE3A 3DOIA 4OGAC 5D7IE 5AVUB 1GZHA 5A2LH 2ZYIA 5ACZB 3DNKA 4GMSL 4YLQT 3O11A 5D7LD 3M7OA 4XN8A 2NUTA 5B39G 3ZSSA 1YO4A 4ZW5A 5DJDB 4PCSA 1ACCA 3UABA 4IRZH 3RZCB 2DQGL 4X99A 3B2VH 4U6HB 4PCKA 2AERT 1HQRA 1J12A 4HSCX 2EKJA 2GJ6E 4WU7B 2JI3A 4IIQB 1P7KB 3LY6A 3FJTA 5GSRA 3K1KC 4HGKC 4PW4A 4PJBE 1OAQL 4B9YA 1E8XA 4LE8A 1THAA 2FQEA 4XOCA 5D9SB 2RACA 4DEPC 4X6CA 1XXFC 2FK9A 1MJ7H 5FA4A 5HD8D 2H3KA 3ARXA 4N9GB 1UCBL 2PPEA 2X1XR 5SWZD 5M95B 2A9AA 4TMPA 4UT9H 3UAEA 4M7LT 1XIWC 3W0WE 4LNRA 4PJIB 2NQCA 3FQXB 3OM3B 3SYAA 3NJLA 4WUUD 3TBYB 4BBWA 1OP4A 4I3SH 4ODUA 1C5BL 1AO7B 1T20B 3VFWB 2EIMB 5KZCB 1JZ5A 1QLEL 3ARBB 3GMMB 4F58L 3P54A 3F85A 3NPZB 3HMWL 2FEDC 1A8JH 3FT4B 4RFNB 3S4SB 2M8XA 2TRHA 2O6FA 3NCWA 2PTUA 2A9BA 4JK0D 3L1FA 1SLWA 5AVXB 1PY4A 3OGOE 5T3ZD 3QZWG 4N5ED 3LQAL 4AGQA 5DMKB 1YY9C 3U4AA 4OCSH 5IV2A 4UTAL 3ARGB 3FTUA 1J9RA 1JV2A 1E4HA 4Q14A 3I6SA 5KVGH 3NZ8A 1GZPB 4HIXH 4HKZB 2C7UB 4KKAD 4WTZA 3MLUL 4IHBA 2R27A 3IDIB 4Q9RH 4WK4B 3OZKA 4PJ8C 5GRJH 2Q6WA 2GJ6D 3KLHC 1VESA 4NBZB 4MD4A 2JWYA 4PVLA 3HMXH 2WLZA 4J6IA 3BP7B 4LDCA 3N1PC 5I71C 4W93A 1QBMH 4NCC1 4AENA 3GMRB 4KNQA 1LO4L 3UTSD 5FFLA 3SE8L 3GGWB 4PS7A 3QS2A 1AHWA 1UVQA 2N7BA 3HAEH 3MLSL 4J1UA 5DVPA 5HYSA 3U2SB 2VMFA 1NDTA 1VB9A 4HH9A 4HOWA 2VABA 4FLHA 1T89C 2UVFA 3EOYG 5IR1B 5JHDD 4FJZA 1PNDA 4RIRB 4K8RC 1JV5B 5DZNA 3L3IB 4BELD 4ZXBB 4K15A 2C3WA 1NDMA 4MD5B 2KLTA 1XR8B 3REWA 3CC1A 3B5GA 2NY2B 2DWTA 4Y9BA 4MJ6A 5KN5A 2QQNL 3L08A 1WA0X 1G0DA 4Q6IA 1F4YL 1LYQA 2DH3A 2ITCB 2CDEA 2RR3A 3DV4A 3N6YA 4U31A 2A3TA 5T3ZE 1S9XB 3ZDXB 1NBQA 4NUPA 1T5KA 2F08A 3STLA 4QAMB 1NGPL 5JOFB 4UTAA 4FQLL 4Y2LA 3IMBA 1JZGA 1R5VB 3WELA 4D0DB 4ONGH 3CHOA 2N01B 2HMIC 3CX5K 3F05A 4TULH 5DUPL 4M5ZL 1JZ7A 4XP6H 5DURD 2WNXA 4FXGB 4NJ9L 3T4AB 4YHML 4H20L 3G9VA 5HYIA 5E6SB 5JO5B 2G0LA 1S7VB 1P1VA 4XAWL 1NAMB 1OP3K 3V4VB 1ETA1 3ETBF 1URLA 2BP8A 2DQFA 5L2KD 2ATKB 1ZK5A 3ZE2F 3L4UA 3MV11 1HNGA 4LLDA 1JPFB 2CLRA 5ICYA 3IMTA 4LSSH 3D69B 3JV0A 3DWTA 5K1NA 1J8HD 3UAFA 3CFMA 1AKJD 5F9DC 4UQ3A 4YE0A 4Y2DA 4IIQC 2Y5QA 2FLMA 2V3FA 1FJ1B 3RDJA 3VI3B 5EZIH 3WG7B 3OQ3B 2I9TA 3KVPA 4ZMXA 2X53A 3N1MC 3ZDZE 3SQBA 1JSYA 4MAYB 1WV7T 1NFDE 4PY7B 4YHYB 5ESVB 5ID1B 5DI8B 3D09A 3PPEA 5GPRA 4AYFA 4M1CC 3G3LA 2WP3O 4U1SA 1JN6B 1MVUA 2QSVA 4M5TA 4XB3A 2X1PA 3TCXA 3LXAA 2YC1A 4O2FB 4YPGB 4RA0C 2QV2A 3AACA 4M4PA 5EPMB 3NIDB 3HG4A 2C9PA 3UJJH 1OGTB 3TIDB 3V0WH 4L3CA 4HC1L 2J4WL 4N68A 5DFVD 4N1CA 3GRBA 2FX8L 3N1QC 1PPIA 1JWMB 4UCFA 4OZ4A 4B53A 3HG1A 2FLRT 2VCOA 4F3FA 5C3LD 2WZPA 2FD6H 4J6RL 2H0PA 1HSBB 4H40A 3H3KA 4M48L 4KFZC 2X6AA 5C0CA 4J6RH 1NOFA 2P80D 1HC1A 5T1DH 4BWUA 2ZONA 3OG4B 3OLDA 4F7KA 4NQVB 2CJTA 4JN1L 5FAAA 2EYTA 2V9RA 4ZMAT 1AANA 4WLCA 1GGYA 2Z8RA 3LRKA 3ZDZB 3QJVB 4GSDL 1DUZA 3RUGB 1JOIA 2EXTA 5T3XH 3NN8A 1MDAA 1PG7L 3X14A 3FAWA 43C9A 4EBQH 2W07B 3FFCA 1MWAB 3D05A 1D3CA 2PW2B 5DLML 3TURA 1N5AA 4AM0B 1HS6A 5TK4A 3SKNA 4E5XA 4H8UA 1E5AA 1O7DC 2YJLA 3HCVB 3M45A 2E56A 5DWPA 4EZMA 2PWFA 4LQFL 3PP4H 4BH8B 3CVIH 1BIIA 2HVJA 1D5ZA 3KLSA 2OA9A 1B6UA 4OJFH 1ZVSB 3ULAB 3PWLB 5C1MB 2CGRL 4JFXB 3C60A 2FUQA 2YMXH 1CT8B 4Z0BL 1CICB 3AG2B 4GUPB 4RVBA 4P2RA 4XVJL 4N0FB 2VDOB 3IDYB 1E6OH 4WKZA 3MODL 3QNYA 3I2CH 4GAGH 1SVBA 3Q8FA 4H7VA 4J8QA 1WCQA 5JXEC 2WINB 3I6KB 1OARL 1RZ8B 3U36B 5KYYA 1SN5A 4JDTH 4N8UA 3T1FB 2EH8L 1DVFA 1PAZA 2HG5B 4NUJA 3TVMC 1HKLL 5KS9F 4ORGA 2K6WA 4YX2L 1K8IA 1J05B 1ZA3A 3BO8A 2XN9B 4NJ9H 5E00A 4Z3EA 5C97A 5L4JA 12E8L 4Y0GA 5FO7B 2HLFC 4OLVL 5E9DA 1V54B 1NCNA 1UQSB 3JWNH 2QQLL 4G8IB 3UAJC 2EJ1A 4X4KA 1EZUA 2YMOA 2ADIA 3D2UD 5IW1B 4R3SA 1H6TA 1J0IA 5DFVC 3MLPA 1WBYB 4YR6A 4TNGA 3UJTH 4Y9GA 1OAYH 3LRSA 4YIQA 5MHSE 2D31A 2ZG1A 1URIA 1VKXA 4DF9A 5C0AA 1CO1A 3VMPA 4ZJ9A 1FLRH 2MNWA 4HAFA 2OX5A 1ZS2A 3PQYA 2P8PA 5KYXA 2DIBA 1TO5A 2AS5M 2CBOA 3K2IA 4BCXA 3IWVA 3PHOA 2W59A 3CZUB 3SBWC 1YCSA 3MV8E 1JGEA 1ODAA 3TO4B 4OU3A 2PPAA 1J86A 1IKOP 3AQXA 2CGYA 1BZ7A 4LCVA 4OD3L 1UM5L 5E8NA 2JB5L 5DURB 5ISZD 5C9KA 2MKLC 3C6SA 4XPHL 2AXFB 3TOPA 1RK0A 3OJDB 1OTSC 4FHJA 2WZPD 5JZ7C 5IVXF 5F9JB 1IGIL 5DUJA 1NCCL 1NM4A 4XWGL 1IBGL 3SPVB 1TQWA 4LKXB 4OF0A 3KL5A 3ZE0F 4JFPA 4MJID 3OAZK 4YSDA 5JNYB 1A1NA 3P77A 4U1KA 2X4QA 4B6ZA 2QGEA 3VD3A 2X2YA 1G4MA 3CDZB 3EYVB 4BE6A 1ZT7B 3QRFM 1IBDA 1GS7A 3MCKB 2GITA 5FYKH 3AXIA 3WKNA 5C8JA 3WEMA 1AZRA 3C08L 1RJLA 2WN2A 3RUGF 2YSTA 1SHWA 2IVFC 2ZOLB 1ZD6A 4WRLA 3MBEB 3EO1A 3RX8A 3DIFB 4C57C 5L8JB 2KPWA 2QVTA 5D1ZA 2EDXA 3S3BB 1YYLL 2YK1H 1SEQL 4K94H 3ZTNL 4V1DA 4YSCA 2BSRB 3QSKB 3U6XS 1MAMH 4MDJA 4MA1B 4AQ1B 3GMNA 3G08A 1M57B 4HJ0C 2JKTM 4R97B 3QUXA 2FIKB 3ZO0A 4DKAA 2WM0A 2X4UB 3VW3L 4JFWA 2VISA 5KSUB 1IGTA 3U46A 5C7XL 4N0CD 5I74C 4GLRI 2VLLB 4X7TA 3RE0A 3WJMB 5DD0H 4UNTA 1CB4A 1J87A 5HHVH 2Z64C 1G7JA 3F12B 5HHOA 1XR9A 5I2IA 1CFTA 3B2XA 3CV5A 2FT8A 5TD4A 1WT5C 4QLWA 4UILH 1JS4A 1E2WA 3RB7A 4NPYA 4P23D 1Z66A 2OKMA 2A6JA 3BPLB 4CW1B 1CDGA 4L3EE 4G5ZL 4HV8B 3U0TB 2RQ8A 3TN0B 3VFMA 2GB2A 2IGFL 4ZPTA 5AB2A 1AIFA 1CE1H 2Z8SA 3CSFA 3WY3A 1NCOA 4ZMZA 1FVEA 5DHEA 2XZZA 5GSVB 1D5RA 4K8RD 3H2QA 5KVDL 1FYTD 4RCAA 4A6YL 1R3JB 4PV8B 2JKJA 1T0OA 4NN5B 4F7MB 1HXKA 3B5HA 3IDJA 2QQKL 4ONGL 2VJXA 4YNYA 4JQVC 3GSNB 5KVFL 4QRAA 1OGAA 4J28A 2NXZC 1BVLB 1QW9A 4P5RA 4KRPC 5E2TH 1N4XL 2WXFA 5G5DB 4IQHA 3OHXB 4ODTL 4X9BA 3IJYA 3QAZB 3GMOB 4IMLB 5IQ7H 3NP3A 1DBJL 3ZE2B 2FQGA 4O00A 3UZQA 5CGMA 1S9KC 3EFFB 3PWPD 3AB0C 4W4OA 3ZUNC 1QO3B 3P40A 4JO4H 4JFFA 3V0WL 3DRQA 2FJGA 3U4EA 1SDDA 3GNML 1DFXA 3P1VA 2DKSA 4DVRH 1MHEA 4FCAA 5EU6B 1OALA 1FFRA 4DGUA 5TE4H 2X09A 5K9OA 3J7HA 4U4IA 5C0DA 3H6JA 1RZQA 4PV1C 1EGJH 2OULB 1ED3A 1SXSA 3O0RH 2VSCA 3QUML 2ZUQC 1N68A 4BINA 2F19L 3DIVA 3DPDA 4DGIH 2YZ8A 3L5IA 4Y5XC 2IH3B 2VM3A 5EEWA 5FIEA 4JG1H 4LCUB 5DC9B 3ZMNA 1OT2A 4G9DA 3W9DB 1I3GL 2YKKA 4LCCB 3ZZLA 1Q90A 4KDWA 1CFSA 4IRZA 2UY7A 3IT8D 4RRPG 2YEQA 3BEWA 3EFDL 4HT1H 2WO4A 43CAB 1D7FA 4YC2C 4LPUA 2B0SL 4B9ZA 1GPOL 2JNZA 3H6AA 4APQB 1W80A 3SYPA 3OKMA 3TIEA 3JTTA 1FPTL 3QDGB 4JO2L 3U7AA 2EO1A 2QKSA 2PYFA 2JQAA 4XVUD 3NPSB 2EVIA 2PN5A 1WA2X 3ECWA 4XWGH 3D39D 1W2KT 3KJ4B 4ISVA 4WKXA 3B7TA 2OYLA 2XWBA 4AUJA 5CFHA 3O6FD 4LDEB 5J1AB 3HE6A 3K4ZA 3G7TA 3V7AG 4YHPA 5FHAL 3GXIA 2NZ1A 3QIUA 4MNGB 2JKSA 5EO9B 5FKAB 1L5GA 4ZDHA 3Q9PA 1G9NC 1A7NL 5F3HB 4MKTA 1JPST 2C1OB 1UOWA 5I1EH 4ODXB 4R8WH 3V4PL 1VPOL 4JAMB 5LAXB 4F93B 4PWJA 4DGVH 1AXSB 4OLXH 2VR5A 3BC9A 4YZFF 1EK3A 3L7EA 5AKRA 3MOAH 4L5FE 1JMZA 3FB5B 1O9ZA 4YGVA 1BBJA 2H0FA 4N2LA 3QFGA 4O58H 2XFXB 1T7XA 3D85B 5EBMB 1O7VA 5CD5D 5EC1A 1FAIH 4GKSA 5C0ND 5KJRL 4P9HL 3VH8G 4ENED 4NQEA 1OZUA 2ADYA 2XQYK 3TZVB 2EVHA 2HVKA 4WUKH 2CKBB 1NM9A 2DPKA 3FZUC 1NEZB 4QEGA 5CLZA 4I13B 5E8DL 3MNMA 2NY1C 2KKQA 5ADOL 1DANU 4D3CL 4GW1A 4QT5A 3HHSA 2UZPA 3NRQA 4JFDE 4FFYH 1FSKC 4DP4X 3ZZ1A 2Z65C 1DVFC 4TSCL 4I18C 2IANE 25C8H 2ZUXA 4YAQA 5BQ7B 4X6FB 3QJHB 4HZAA 2YAOA 2P8MB 1CBVL 4LVNC 5MEPA 4XVSH 3QIUB 4U1LB 2BVPA 3RPIB 3EYFB 3QZOA 1MCWW 3C6LC 1A8ZA 3C60C 4RISH 5FOJA 5AAWA 3E3QC 5KVEH 4GRLB 3SE4C 5E6RB 1P5VA 5IFHL 2IMNA 5C6WH 3BAEH 4HPHA 2NQ3A 2CK0L 2WBKA 3EGXA 1KLGB 4KUZH 5JA8B 4MBRA 5GIRA 1R3HA 1YEHH 3QUMH 5LLIC 5HDLA 3P4OB 3QYCA 5AALA 3VG9C 3VRJB 3CIQA 2RTTA 1JDAA 2XRAH 1P4LB 1U93B 2G4EA 4HUCA 3RP1A 4DGIL 2VXTL 1W72B 3BUQA 4QRUB 5SV4A 4BCZA 3DTDA 4WO4A 4JPVL 4WV1C 3I9GH 1RUKH 3QHTC 5D7IA 4ZUVB 3V5DB 1TTFA 4AJVA 3E2HB 3D7PA 4UU9B 3PU7A 1SVZA 2DKMA 2WN3A 5J13C 5AW5B 2R2EA 3V6FA 2YPLD 5C0AD 2VZTA 3EH4B 3S98A 2DM4A 2EO7A 4JN1H 3Q1EA 4XN4A 5D2NE 4ABVA 1R5WA 5FX3A 1WWAX 2BS9A 4X42A 5EWIL 3ETTA 2WXIA 3BZFB 2YLHA 2QVMA 4HCIA 4IK6A 4XCCH 4M6ML 4CADB 4M1GH 3VGAB 1MFDH 1K4CB 2DM7A 4JFUA 3U6XA 4QJ5B 1N8OE 1KTJA 1U36A 1OIOA 2J6WA 3QUXB 1GIGL 5IFJB 2DJ4A 4ZZFA 4HUVB 2BP0B 5DUBA 5A3ID 1J8RA 2J4WH 4KQ4H 1C5CL 1FFPA 3NTCL 3R0MA 5HDQH 4UQIM 1TQSA 4W70A 3ZZSA 2EDJA 2BWQA 3V95A 3WN5A 5AOKA 5A2BA 3D4GA 3ATEA 3HZYA 3NACH 4PAZA 3VI4F 1XGZA 2VE6B 1QQDB 2FEEL 2L04A 3EF7A 2F1BA 4I3RL 3EKCA 2C9VA 3CUPB 2J3SA 4ZUTB 3WO3B 2LE9A 3KPSA 4BIKA 2WLIB 4OV6F 3PWNA 4Y2DC 3QFJE 3CFIC 1F3JA 3I02A 5I16B 4PGZA 1BJ1J 4IRSD 2OTWA 4OSUH 4MZIA 4YLCA 5JHLL 4B97A 3ZL4H 1AO7E 4I5BA 3VXUB 3FTSA 3EUDA 1QFOA 3FB8B 1AO7D 1JF6A 4XN9A 4AIOA 3CLFL 1JGLL 1OTTD 2K7QA 4MXWL 3KWUA 3P4NA 3DVGA 4XH2B 4FFWD 5DEFA 5SWSA 3VVVA 4R7XA 2VLRD 5BVPH 4CVXA 1CXHA 4KK8D 4F24A 1NCDL 1NCJA 4UF7C 2HKFL 1A6VL 4PJFF 5J1TC 5CJQH 2QFPA 3H4FA 2V8MA 4G7YL 1EERB 4NKOA 5C0JA 5IHBA 4RRPM 3GMNB 2E9GA 4BZ2L 2EE0A 3UTZB 3NBNA 1FP5A 4JY6A 4UNUA 2C9UA 3RFZC 2FATL 4V1DB 5CEYB 2D7TL 1X5GA 1VKXB 4W68A 5AW3B 3LN4A 3ULVD 4HCFA 4YHKH 1MFBL 2PO6A 5CWSB 2ZOLA 3IK2A 1JHTA 3H53A 5MENE 5AENA 3IJSA 1GH7A 3FT3A 4WWKD 3HG2A 5E2WH 1U8MA 3QULA 4G8IA 2XV2A 3ROOB 2NT1A 4FS0A 1RZ7L 3L2MA 4WI8A 3WKQA 4LOUD 1RURL 5DZPA 4EUPH 1OF0A 2VDPH 4XCEB 3O41A 1L9TA 2W1NA 2XZQH 4DEWA 2IQ9L 1MRDH 4JJ5A 1BVOA 2RBLA 1A65A 4P2OD 5B8CA 4WENB 2VSDA 2Z35B 1J05A 3PG2A 2WKLA 1G9ML 2TRYA 4ORGB 4EI5A 3AXLA 1DCEA 4ALAL 1BZDA 3DSFH 3S3JA 3QIWA 1HX0A 2FTAA 4Y7OC 3S5LA 1KJ2L 3HE7C 4NQSA 3UACA 4Y4KA 1DQQB 1L6PA 4L4VB 2GT9B 2YUWA 4UAOB 4AQAB 1K85A 1DQJA 1YJDC 2DMCA 4XB8A 1MIEH 4N1EA 4ESKA 1RZFL 3D85D 1J8HB 1QX1A 1VADA 2F0CA 3C09B 4I48B 4U05A 3FRPA 3DURB 3PWVB 2AK4A 3L3KB 3P3SA 4IKLA 5JLZA 5E2JA 3FTWA 1BXUA 2H1XA 2R29A 4Z7UB 1GOFA 4N2GA 5E8OB 2YGPA 2WUCH 5A2JH 5AKVA 1T7ZA 3JUYA 1ZE3C 2BPBA 4ZUWB 3TT3H 4Y16A 3X14B 3C6LA 4ZFZB 5AAWC 3EADA 5H4YA 3NZUA 2V5YA 1F1GA 1ZPUA 4FTVA 1MZYA 2UY6B 4JBSA 4QRTA 1XXDC 4KVCH 1NLBH 3O4OB 5IEHB 1JPGA 4JKMA 1OAKH 3MV9D 4JRYE 4HZ1A 4F37K 2LTQC 1MY5A 3D30A 4NKIL 4B96A 2C1PB 1Z0NA 4DEPB 2B1OA 4GIPD 4IBVA 4CC1A 3FULA 3M46A 4RQQA 3TFKD 1FGNL 4EDXB 2LU3A 1J5CA 3QJFB 5F89A 3DVNA 3JV6A 3PDGA 3ULVH 1MCOH 4U4BA 2YSSA 1ZHNB 1FZMA 2IAMA 1V7MH 5FOBA 1UEMA 3EYQD 1ASQA 3WO4B 4Z3GA 5BOZG 3L1GA 5EPMA 2GUYA 4XP6L 1DEEA 1IEAB 3DX7A 1XH0A 2X2UA 4BV1A 4AYMC 3WD5L 1MJUL 4X6DB 3CFJA 1D5ZB 2Y06L 4Q0XL 1HZHH 1XL4A 3R4DA 4AYGA 4LU5H 1MFAH 1MEXH 1HH6B 1BZEA 4JO4L 1OM3L 2IDTA 2ZKMX 5AD0A 2FO4A 1QLFA 4J3UA 4QRPB 4KI1A 4ZUSB 3MRFB 5LBGA 1ZHBA 3QZMA 1MFBH 4IRJA 4NAQA 3BD5A 1OK8A 4OM0H 1QPKA 2H26A 3F3HA 4E9QA 4Y2DB 2V5RA 3EOTL 4WK0B 4XXCA 4OKVB 3LRLA 1H0DB 5CZRA 5I1IH 3VXRB 1I7RA 2X40A 4M6NL 5E1AA 3RU8L 5ICYB 1LD9A 2F7IA 4S1DC 4KY1L 3HUJF 5DS2A 3ZDWA 4JO3H 1N12A 4FQIH 2GJPA 2DQFB 2Y7SA 3QUMA 4L8CA 2VKWA 3ALWA 4TUJA 5GXBB 5DC0A 1E3XA 3DROB 4GO9A 4O4YL 5D7EA 5IJVA 2MQ3A 1O9VA 1WSST 2HG0A 4JRWA 3U9PH 4EI5D 5JO5A 3TESA 3FB6A 3T8VA 2KS0A 4N2DA 2EINB 1HSBA 2GK2A 5DRZA 3QNFA 1WFOA 4OQTL 2IWFA 4AXWA 2E76C 1S6NA 3Q6FB 2C5DC 2Q8BL 2CBPA 3HNVL 1QI3A 3WBDA 4N28A 3STLB 1CGVA 1OT4A 4R6UA 3R1GL 3GSUB 2AMUA 2Y5TB 4HVBA 4QKTA 3GRWL 3IB4A 1J9CT 2DQHH 4LLWB 5I6LA 4YPGA 4X8CA 1CYXA 3GSVB 2CHXA 1A7RL 5CJXA 4MCZA 3OL2A 3C8DA 1T22A 1RZIB 3MRIB 4PJ5E 2CDFB 4GJTB 2BIQA 5EF2A 2N0KA 3LHAA 3KPRE 4GW4A 1Q0EA 4XWOD 2MSPA 1FFQA 3GBDA 3UO1H 1JPTH 5TFSL 3IKCA 4WO4D 2H1LM 3KE0A 1MXDA 3IMRA 3SE9H 5BO0D 4KXDA 4CKVX 2B14A 2R2HA 2J20A 3MA9H 1DJXA 3N85L 1SMOA 2P7TA 1RJZB 1E5CA 2HCZX 3VXRD 1OO2A 4AENB 1JNLL 1P2CB 4RDQG 3VH8A 2W38A 3H7BA 4I0CC 4FA8A 3CZEA 2G5BB 1JGLH 1XF2B 5EHFA 4NXSA 4AMXA 3NQKA 5FV2A 2JIXD 4G7VL 5D72L 2ZWZA 4W9EC 5TDOA 3MNVB 2FSDA 4P9HH 4KJYA 5DEJA 3KNBB 3F2LA 4N90E 4KQ0A 2YMXL 4M8VA 4Z0BH 4GW5B 4K9EL 3CZKA 35C8L 2CA4A 4FLRA 1EAOA 3A67H 4HWNA 5B3SB 1T03L 4HDIA 4PS4H 5LG6A 2WKGA 5CEZD 1CUOA 2APBA 4MAZA 1PG7X 1RSFA 2PWEA 1I8MB 3BVVA 4R90L 4AYEC 1F42A 4G6KL 4JM2C 2Z9TA 4KRMB 3RILA 3UL4A 3UYRL 1TU2A 3HHRB 3LJ3A 2H6OA 2R23B 5E5UB 3B2DC 3QFDB 5H37H 3W39A 3OKNA 2EDQA 2O5NA 4AWJC 5ISZB 1RY7B 3AREB 2WLHA 4P4KC 2F74B 4JANB 2B2XL 3CXDH 4FTDA 2Z31C 2X38A 3T4YB 2I5YL 3CQPA 3K80A 1MFUA 5EEUA 1ET5A 3TWCL 3UAAA 4CU6A 4W9LC 4H8HA 1TJHL 1HT6A 1AD9A 1KBBA 4J5VA 3G6JB 3H42H 5HGAB 2VDKH 1I1FB 1T5WA 4RISL 1SN2A 4YDVA 4OFYD 3LKQA 5AW6B 3RIKA 1A7OL 2OQJB 1F3DJ 1IAIM 4AEHL 3MYZA 5FS5A 1TZHA 2ZT9C 1ZV2A 4I1RA 5FGCB 2HAZA 3TBWB 3ROLA 5HHXH 2WMPB 4FP8H 5F44A 1RZGB 2DDQL 3BP7A 1OE1A 4KMLB 1N10A 4ES8A 2C34A 2HH0L 1HWGB 3BKJL 1MCEA 1JPSH 2YQ2A 5F7EL 4BQCA 4WHCA 1CIUA 1EO8L 1A3LL 3NCBB 2AJUH 3TJEH 1KCSL 4W9ZA 2QPUA 1UM5H 1XX9C 2Z4QB 3OKLA 4GG6B 2X88A 4JFYB 3RZCA 3MI6A 3PHAA 1O0VA 4NO2B 4X4YA 4DN3L 5H4ZA 4XNMB 3FYEB 3NIDE 4XOEA 2E4TA 1H15A 1Q9KB 3MRMB 3ARGA 1KFAH 1CGTA 1OB1B 2F18A 2NUTB 1RURH 4NO3B 2YEVB 4MASA 2DD8H 4KK6C 1OZTG 3GSNH 3WFDH 5JR1H 3CVHB 5T3ZL 2AZUA 5ABDE 4BUGA 1HNYA 1ILSA 1MCJA 2IPTL 2QZ5A 4TSBH 5AL0A 4FABL 1RK1B 3RKPA 1Z9OA 3VYNA 1E0OB 4DQOL 1ASPA 4JL1A 4HJGA 1J18A 1TTGA 2YD5A 1A4JB 2CUHA 2XQYA 4A6YA 3DHPA 1A7NH 2HN7A 4LNRB 3TBYA 3WNKA 2UZYB 1FLTX 2O6CA 3QUYC 4O02L 2NQDA 3FCTB 2ZUQB 5HDWA 3MRMA 3NRPA 1QI5A 1KTCA 4LL1A 3MX0B 5DWUH 3VFUB 2DB8A 2XA8H 4MDIB 3OR6B 2VL5B 1QFUH 3E8UL 1BEYL 3K5SA 3MR9B 1YMMD 5C07A 2VZUA 3BRDA 2R59A 1HL9A 1NGPH 3ATDA 3KPRA 5DJAA 4XCCL 4XVUC 5D71H 1SXZA 1BFOB 3T0VA 2ZYHA 5F9AC 4X4XA 1KB9J 5EO0A 3UADA 1HQRB 2EC8A 2IBZY 5D7SH 4OSUL 2R29L 5ITFB 4M93C 3OR6A 4OT1L 2G60H 5I0ZA 1CFMA 5HJ3A 3MX0A 3TNMB 4ZSOA 3SYCA 2WQVA 1UADC 3OHXC 5HHVL 5DC4B 4I3GA 1DQML 4JRXE 1IGML 3BWUC 5T5FA 1T5WB 5B21A 3UYRH 2AEOA 4LSSL 4YC2B 1IBFA 3KW7A 4BXVA 5JXEA 4YHZH 4YDNA 2J71A 2AV1B 2M2DA 2UV3A 4PJ9D 3QQ3B 1RFDL 4JG9A 4FTVD 5EO1B 2H45A 3LIZL 3N43F 4G8GA 2VM4A 4JFFE 1UGKA 3WLBB 3RX5A 2AXGB 3HZKB 3L3HA 4JFFD 4B9JA 2ENPA 3O45A 1MJ8H 2PYEE 2JCCB 5E2TL 3VXMB 4G6FD 2O93L 1AI1H 1EAJA 3CDGB 4O4YH 5F0LB 2XVLA 4BH7A 3T6QC 2Q10A 3WJLC 5C09E 4OAWB 4HMEA 4XX1G 1OK0A 2QR0A 1YPZE 1UWGL 3KGUA 4EOWH 1WO2A 4P04A 3SKJH 3AB0B 1A7OH 3UBGA 4G8GB 2APTA 1I85C 3SHSA 3GBML 1UWFA 4GAJH 5EO1A 4XNMA 2AGJH 1NCIA 2TSBA 3RGHA 3P2BA 3MU3A 2Z4QA 2AGJL 4NN6C 5D1ZI 1QSFA 4D2NA 1DVZA 2R4RH 5CUSL 4PVBA 1Y6MR 4LVOB 4MMXB 5B1KA 3SKMB 3R0NA 1G1OA 5DJZB 3GO1L 4PR5A 3T6XA 2ODIA 1BV8A 4XNZB 3LZPA 5CM1A 2XFGB 3GINA 1P2CA 3MBEC 3GT6A 3I3EA 3GSWB 3T3PB 4I0PD 2OQJA 4ZRGA 4XCNB 2NLJB 3ARFD 3LHPH 3LPPA 5BUPA 1NZRA 4DP5X 3DV6A 3KPRB 2HSIA 4D8PA 4LIQH 5LDSA 4Z7VE 5KUKA 2VDLL 2Y9RT 4YFLI 4WJ5A 1S78D 2Y22A 2YN5A 1RZ7H 3R1GH 4ZFOB 2AQ1A 3MCLL 3ECVA 4R2GB 4X80L 3CLEL 2VH5L 3QIUD 3HNVH 3AREA 1IUZA 1JVKA 1Q38A 1AYOA 1HAUA 1GGTA 4MKMA 1YEWA 1E65A 3QRLA 4RFOH 4XP5H 2HRHA 4OCYH 1I3RA 5DJ6A 5DFTA 2FE0A 5GJTH 1E4KC 3ZDXF 5J11B 5GS3A 5JHDE 4QXUH 3CFKB 5EEXA 3NACL 2VR8A 4P46A 2DL9A 3FCGA 1HI6A 4YSPA 1GKOA 2XWXA 4UI2A 4F2EA 1CLOL 4KX9A 1GA2A 3T65A 1ND0B 3UO1L 3OLGA 1A3QA 4KJYB 2R1WB 1FH2A 3H9SB 5B7FA 3QWNA 3LH8A 3UP6A 3HZVB 4O9HH 3VDCA 3NK4A 3D18B 4FNPA 3SE9L 4WWKB 4DN4L 1FL5A 1FA4A 1TTUA 3V0AC 5K1JA 5IWLA 3EIFA 3GRGA 1KGIA 1RLWA 5J06A 3ARRA 32C2B 5IB2A 4UQ2A 1TCMA 4CVWA 5A6MA 1U8IB 4HJEA 5DZAA 2ADFL 2ZX9A 3GJFH 1CGSH 4J27A 1TUPA 4IRJB 4Z76A 5ABAA 1MF2H 2CO6B 4BKTC 3LS5H 3GIZH 4JB9L 4JGJA 3WLWD 2JKIS 2WD0A 3O9WB 1OVZA 4AL8L 1VEPA 4JDZA 3KPQA 4WFHD 1A2YB 5EU3B 1OGAD 2DYPB 1JYXA 1FFOB 3B3IA 3HZ3A 5TQ0L 3K6SA 1WQVT 1GGUA 3KL3A 2BY1A 3HVNA 3VFRA 2H2SC 1I1FA 1OSZB 4HSAC 1PZAA 2XTSA 4LLWA 3LZLA 3PREA 1MQ8A 4PJ8B 1KCSH 2E8ZA 1RUAL 2Y5TA 5DC2A 1FZMB 1GC1H 3DMMD 3SJVD 4F7PA 5D1XB 4DTGH 5HI4C 3SO3C 4ZX6A 3G6JF 1VDGA 5ID0B 5INDA 1J1PH 3ARZA 1BMGA 4F37F 3RL2A 2GVYA 3QEQB 1ZAGA 3QFDA 1XGUA 1HDMA 3RWEA 4XVSL 5C7ZA 3DXAA 2DLHA 5EEZA 5GRVL 1B4LA 4YH6A 1EZVX 1KJ3H 3R8QA 2ZOKA 5IJVB 1QTSA 4ZW8A 1AGEB 1CXFA 2C3VA 2EZ0D 1ETZA 4L1TA 5A2AA 3LNFA 5KZCD 2B77A 3ARFA 4R4ND 4L4TB 4WEUD 4FTVB 3U9WA 4Z7NF 5L88L 5I6KA 2E6JA 2D0GA 1U92B 2J8OA 1PLAA 2EIKB 3Q2NA 1PY0A 5LNDA 4X8XA 3ZE0E 3QRGH 5GZOA 5DXWA 1FQ9C 4IU3A 3RGVB 4PSRA 4MAUL 4OFYA 5DGQA 3DUUB 2DY2A 2ICEB 2V4LA 3O9WC 4OF7A 4U6XA 3HC2A 2UZIH 4A7GA 4S1QL 2ZICA 4LP5A 4PGJA 7PCYA 1SJHB 3OMAB 2AK4B 4NC0B 2D9CA 1MCBA 4X6DA 3WFDL 1XAKA 4H8PA 3BAEL 3BXNB 1YG9A 1CICC 2ICWA 1W0WA 2ZQKA 3HPJB 3QJTB 3X2QB 3KZ8A 1VAHA 2NYKA 2L0DA 4RAUB 3F62A 4JRXA 1BP3B 1NMBL 3U2JA 3BH9B 2E7LA 4AV5A 3S5LB 4KVCL 6PCYA 4NWTL 4LLAA 1Z9MA 1C1EH 4OF3A 4F33A 3HFML 2WLYA 3LEXB 3LPFA 3ZYIA 5CEXB 1WLHA 2BVTA 3ZDYB 5LDUA 2ZOWA 4MLSA 1M1XA 3NIFE 3DO7B 3T2OA 2IFFH 1CE1L 1JUFB 3WFBH 4NQCE 1F8TH 2EYSA 4L2YA 5DZLA 3U48A 3JWNG 1H6UA 5EIQA 1X