4YSAA

Completely oxidized structure of copper nitrite reductase from geobacillus thermodenitrificans
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
294
structure length
294
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
molecule tags Oxidoreductase
source organism Geobacillus thermodenitrificans (strain ng80-2)
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
total genus 101
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysaA00
4AI7A 1SFDA 3OMIB 4E9YA 3FSAA 3NT0A 3FPXA 1AANA 2BW5A 1SF3A 2GHZA 2AZUA 2JKWA 1RZPA 4G7QB 2CBPA 2P80A 1MZYA 1MZZA 2HX7A 3NSCA 3NJKA 4G7SB 3ABKB 1AZRA 1NTDA 4UAHA 1GW0A 2GSMB 4A2HA 2HXAA 1A4CA 2GB2A 1KDJA 2IDFA 3NJFA 4N8UA 1ZDSA 1ZV2A 2Q9OA 3ABMB 2GC4C 1GYCA 2CAKA 3MBWB 5AKRA 1FA4A 2BWDA 3QPKA 4ZK8A 1GS8A 2R7EB 4HAKA 3CVCA 4BDVA 5I6MA 2HX9A 4G71B 3FYEB 1AZNA 1A4BA 2I7SA 4A2DA 1A4AA 2I7OA 3UAEA 3BVDB 1VLXA 2ZONA 3AG4B 1ASPA 1WS8A 2XX1A 4HALA 2MTAA 2FT7A 1ID2A 1BQKA 1JXGA 2OV0A 4L0PB 2XVBA 4N4YB 1BQRA 2YAOA 4A2GA 4QLWA 1MG3C 3NSFA 5B1AB 1E5ZA 2DV6A 1JZGA 2CUAA 2YXVA 1JZEA 3DKHA 3UACA 4DP2X 3FT0A 2OJ1A 4BWTA 3WI9A 1KV7A 1J9QA 1L9RA 1NDTA 3IN2A 4HCFA 3C75A 1EHKB 3QJVB 2YQBA 1TU2A 2FTAA 1JZHA 2XLLA 5I6LA 4KOCA 2BP0A 2PCFA 2FNWA 2ZXWB 3ASOB 3EH4B 3GYRA 3X1GA 3S3BB 2BZ7A 1ASOA 1WA1X 4GY4A 5PCYA 4E9RA 2Y1AA 5B1BB 1A3ZA 1ET7A 4DP4X 3RYMA 3TASA 1QNIA 1W6LA 1TEGA 1RCYA 2IDUA 4AX3A 2DYSB 1ETJA 4DP5X 1M9WA 5I5MA 1FWXA 4KO7A 2PPAA 2VSKB 1KCWA 2HZHA 1DZ0A 1CC3A 2QPDB 1EZLA 3AZUA 1IUZA 2PP9A 3FU8A 1PNDA 4M4RB 5D4JA 4BDVB 1WS7A 1HFUA 1J5CA 1N68A 2UXGA 2X88A 1PMYA 1ZIBA 1ASQA 2JXMA 1V10A 1JZFA 4BK5C 4QKTA 3NP3A 4DP1X 3FS9A 2LLNA 2H3XC 3OMNB 5AFAA 3X1FA 1NPJA 1ET8A 2BP8A 1OOWA 1RKRA 2IAAC 4A68A 4YSUA 2ZWNA 3UGEA 3FSZA 3D12B 1NINA 4NAJA 2IWEA 5PAZA 1OCCB 2EILB 4BXSV 4F2EA 2E86A 3CZUB 3OD3A 4CSPA 4KO9A 4G72B 2VW6A 3NP4A 3TU6A 2BWIA 5E9NA 4Q89A 2R7EA 2PPEA 3WNJA 3IBOA 1R1CA 4DP0X 4KO6A 1W8EA 3FQ2A 4KOBA 1MDAA 3V9CA 1RZQA 1QHQA 1OF0A 3JTBA 2PCYA 1OE3A 3QJRB 4F2FA 3KW7A 3ZX1A 2N0MA 1PAZA 2BP0B 2W8CA 4G7RB 3U25A 2UX6A 1WA0X 4BWUA 2FWLB 1HAUA 1ZPUA 3AG2B 3QJSB 2VW7A 1QLEB 1KDIA 1BEXA 4DP9X 5B1JC 4A2EA 1M57B 3NJGA 5B1JA 2JFCA 2EINB 1JZIA 2UXTA 5I6NA 2XV3A 1KBWA 4W1TA 1SF5A 1URIA 3OM3B 9PCYA 4MFHA 3FSWA 1ILUA 2QDVA 4JKNA 3WNIA 2BW4A 2A3TA 2VM4A 1GY1A 1SHXA 1MG2C 3OMAB 1BXUA 2NRDA 1L9TA 1AQ8A 2YAPA 1FFTB 2WO3B 7PCYA 2FQEA 1KYAA 3WIAA 2VN3A 1AIZA 1L9PA 1NPNA 3PAVA 5I28A 2VMJA 3DIVA 5I5JA 4DP8X 2XV0A 1E5YA 1CURA 2QDWA 1ADWA 3FU7B 3G5WA 1KBVA 5AZUA 4E9TA 1ET5A 1AAJA 2VSMB 3MX0B 4YVNA 2HX8A 3TBBA 4A67A 5B3SB 2J57A 3N55A 3T6VA 4KNUA 1SHWA 5TK4A 1GS7A 2DWSA 1NIEA 3AG3B 5D4HA 1ZIAA 2IWFA 1NZRA 3IN0A 3WKQA 1M56B 3FSVA 4BWWA 4EF3A 2J56A 4GXFA 2RACA 3FYIB 2YAQA 3T6WA 3WG7B 1I53A 1WAEA 1T5KA 3NYKA 2GIMA 4YSPA 2UXVA 2BHFA 2IWKA 2HLEB 2IDTA 1GSKA 1PF3A 4KNSA 4Q8BA 1BXVA 2AANA 1XB3A 2I85A 2XYBA 1PLCA 1SDDB 1OCOB 1CYXA 3ASNB 2EIJB 1A65A 1AS6A 1JVOA 4PAZA 2FT8A 3PAUA 1V54B 3OQRA 4YSAA 1BXAA 1JXDA 1KGYE 4E9WA 5F7AA 3ZBMA 4E9SA 4YSRA 1AR1B 3FPYA 3CDZA 4DPBX 2UX7A 4BXVA 1AG6A 1NIAA 4P5SA 3T71A 4FA7B 2IH9A 2PP7A 2CCWA 4AKQA 3ABLB 1JXFA 1BAWA 1YLBB 1AZBA 5I6KA 1XB8A 2FQFA 4YL4A 3FU7A 4HCIA 2W88A 1V55B 3S8FB 3AY2A 1JVLA 2H47C 2J5WA 4RH4A 4UF7C 2YARA 1B3IA 1L9OA 1X9UA 2IDSA 2YAFA 3QQXA 4NB7A 2VW4A 2HRHA 1HAWA 3PCYA 4GP5B 3H56A 4WTQA 4GP4B 2VM3A 1OE2A 4DP7X 3PLYA 7PAZA 1BYOA 3GDCA 4HZ1A 2FQDA 4YSSA 1BQ5A 2EIMB 2CJ3A 1PZAA 3ZIYA 4NERA 1BYPA 3CG8A 5A7EA 2QPEB 3ZDWA 2PPCA 2FQGA 2XXGA 2FT6A 3S8GB 3X1BA 2YAHA 3QJUB 1X9RA 4YSCA 2XU9A 4E9XA 4KNTA 2BO0A 3KW8A 4AKOA 1L9SA 5TK2A 4FAAB 4HCGA 2PPFA 5FC9A 2DWTA 3ABGA 4AZUA 1W6WA 3CVDA 2BZCA 1XB6A 3HB3B 1JERA 3NSYA 4JHVA 1PLBA 5I5IA 4YSTA 3JT2A 3NJHA 3SBQA 2Y69B 4M3HA 4W9ZA 2WSDA 1OV8A 2XWZA 3T6ZA 3CVBA 2PP8A 4X4KA 3WKPA 3GXUB 4A2FA 1SJMA 1N70A 1E67A 1PY0A 1WA2X 5I6PA 2B08A 3BQVA 2DY2A 1AZUA 1NICA 1NWOA 2P80D 3H4HA 1KCBA 3IEAA 3V9EA 4WKXA 3NSDA 3FQYA 1AS7A 1JOIA 2DYRB 3X1NA 2Q5BA 2IH8A 2AFNA 3SQRA 3UADA 4YSEA 1AACA 2OCCB 4KO5A 4GP8B 5I6OA 2X87A 4JHUA 3PPSA 2HRGA 4HHGA 4E9QA 2TSAA 1TEFA 4ENZA 2EIKB 4P5RA 3TBCA 4TXVB 2J55A 3T9WA 1PCSA 5B7FA 5D4IA 1SNRA 3EH3B 1JZJA 3FQ1A 3NJIA 3PXLA 2IDQA 6PCYA 2YAEA 4GYBA 1F56A 5F7BA 3NJJA 2AVFA 2TSBA 3X2QB 4K9JA 5B7EA 1PZCA 1SDDA 1GS6X 1CYWA 1L9QA 4HHWA 3S3DB 2PLTA 2XXFA 1NIDA 1J9RA 3QJTB 3H4FA 1E30A 1J5DA 1E65A 1PZBA 4YVUA 4PCYA 2H5UA 2ZOOA 4YSDA 3S3CB 1AG0A 4E9VA 2WO2B 4YSQA 4A66A 1OE1A 3UABA 3EF4A 2FJSA 3EH5B 4F7KA 3CDZB 1NWPA 5I26A 1TKWA 1ILSA 1NIFA 5B1KA 3EHBB 3T6XA 2GI0A 1IC0A 4G70B 3ERXA 1OCZB 1AOZA 3TA4D 3SBPA 1GY2A 3PAZA 3DTUB 1IBZA 3N2JA 2XV2A 3HEIB 1IKOP 1PNCA 5ANHA 1AZCA 1SFHA 3X1EA 2B3IA 1GR7A 2XX0A 2AZAA 1CUOA 5IY5B 1J9SA 1A8ZA 3UAAA 2UXFA 2BP8B 5LDUA 1PLAA 4HIPA 1J9TA 2GBAA 1XMEB 2YAMA 3AW5A 3IE9A 1NIBA 2QT6A 3NJMA 5EHFA 3NJNA 3QJQB 3FU9A 1UATA 2XUWA 2GC7C 1ZDQA 4CSZA 6PAZA 1AS8A 3SBRA 1DYZA 4AKPA 4YSOA 4DP6X 3AG1B 2YXWA 1OCRB 4UANA 1IBYA 8PAZA 2MRYA 4DPAX 4DPCX 3NJLA 5B7MA 3L45A 2CALA 2PPDA
chains in the Genus database with same CATH superfamily
4WUUD 2ZX7A 4ALAL 5DHEA 4J4PA 4AI7A 1IGJA 3QXDA 3CSPA 1KPRA 2L8AA 3FSAA 4ODHH 4PEEA 3N5AA 3QWRD 5GZNC 5T1DH 4H25B 4DEPB 2AEQH 4WWKC 3QUXC 2WKLA 4LP5A 5DEFB 3S88H 4FCAA 4AG4H 2GSMB 1RLWA 3U30B 1YEGH 1EO8H 3GXMA 4BA8A 3P54A 3DNKA 4LEXH 2HN7B 4XGZA 4B0MB 4K7PX 2RFXA 3D30A 5DUPH 5FECA 4Z78A 3P0YL 3QQ9D 2N7BA 3EOBA 2R39A 2IPTL 4FZEH 4ZK8A 3C60B 2ICCA 3VYOA 2HP4A 3AB0C 3VGFA 4PRHB 4PRPD 2NY5C 2WZ5A 3NN8B 1GOFA 2EO1A 4KKLC 1CLYL 1OP3K 5TE4L 2PETA 1ZTXE 4JZJB 3TTYA 1NC2A 2UWEF 4NUPA 3FFDB 1VHPA 4UNIA 3KMDA 2YD8A 4XH2A 5JW5A 4OT1H 4L3ED 1AQKH 2CO4A 3CFDA 5C07E 1ASPA 4G8GE 4AM0B 3PGDA 5BUPA 3APCA 4JGUA 2D0FA 4IDJH 1I1YB 3GHBL 5EO9A 5EOTB 5GRZA 1ZXQA 2R15A 3LEVH 5CWSB 3QDJE 3L5HA 1MY5A 5CEXB 5ENWA 5IQ7H 3TM6A 4LHUA 2XSKA 1A6VL 4QRPB 2MPVA 3QI9D 2X1OA 3SOBH 3EFOB 3V5KA 1U6AL 3VFWA 2DQ6A 4DP2X 4MCZA 2O6FA 2XCMC 1LMIA 1MJ8H 2VDNB 2CUMA 3VQ2C 2FGZA 1NCAL 2NLJB 1HN1A 1WAAE 4S1DD 1X6NA 3BEWA 5DRNA 4LHUG 2H7WA 2IJ0C 1EMTH 1DVFB 3MRLA 5H2BB 3GJFK 5CJQH 3ECBB 2BP0A 2CRIA 2E76C 3JWDH 4ZFFB 1N10A 4P23A 5F96L 2ICWJ 4ORGA 5DD0L 3R4RA 3VXMD 1UTDA 1U8KB 1A3ZA 4BQ8A 4WJKB 2YA2A 5HY9A 4XP5H 1I9IL 1ETJA 2MNJB 1F8TH 4Z7VE 2GEEA 3RL1B 2F15A 4NZ8A 2OL3L 4PGDA 1GJIA 3QFGA 4I9XA 3BT0A 3B2VL 2QGBA 1TZIA 3KPPA 4AV5A 4WEMB 4NKMA 3GSUA 4PB9H 3GRWA 1UOLA 4IDLA 1NGWB 1KBPA 2RGSA 4QF1A 2UXGA 1RQ5A 3NK3A 4L2YA 1F6AA 1C08B 2FBJL 3EDKA 1CK0H 2ICEC 5I16B 3S2CA 4A38A 1DHKA 3LKRB 2XFGB 1E9PA 4CVZA 2R4SH 5KN5B 3CSBA 5AVSB 4C56E 4UQCA 2XY1A 3TONA 4CN1A 5JNYB 4XNMB 4DVBB 2L4OA 4GNKB 1EHNA 1AGDA 3F8UB 3GXDA 5TTRA 3TU6A 2BWIA 5J5EA 2ZZUT 4Q89A 4WW2C 5E24E 1WUZA 1XQ4A 2Z8VC 3C6LA 1YECH 1ZE3C 3ILPB 3K72A 3MRCB 2ZG1A 5DC9B 1I1FA 5GGVL 5IUSA 2AK4B 4H8PA 2AJVH 2FHBA 4YQXL 1NAML 3AB0B 2FDBP 1HESA 1B6UA 1ZEAH 3VGEA 2H0EA 1M2OA 1BBJA 4HMCA 4NKDA 1OM3L 1D9KB 1MOEA 3FQWB 4XC3H 5J9PB 4ZMPA 2H45A 2YGPA 5FWQA 3SGDH 3UTQB 1EEZB 2Y5TA 4HIEB 4CA4A 4XMKL 5B4MD 2FWLB 4XPAH 4N2NA 3CN4A 4Y4KC 1CXFA 1LEKB 3OWRA 3JWOL 1C12A 3NZHH 1XF2A 4D9QD 4GKNB 4UNTA 3FTXA 3TA3D 3SPHA 2WXGA 4LLDB 2CR0A 1CVSC 1EO5A 1GZHA 3F65A 4RFNB 4WGVB 3JWDL 1I3VA 5CP3A 2JK5A 4P59L 4TF4A 3H9YA 5LUMA 2X2IA 4S10A 1NM4A 1URIA 4LF3B 4LB8A 3PP4H 3JWNG 4JREC 2AAVA 3HRPA 1T4KB 1ILUA 1AZZC 5EBLB 1R46A 1GOGA 3K2UL 2UUDK 5D72L 2AF2A 1XR8B 5T3ZL 3VJ6B 2OL3H 5EA0L 5C2UB 1UQSB 5GS0D 3MBEB 1WBXA 1F97A 3GPEA 5D55A 5IJBC 3RIAK 5HYSA 3ZW3A 4JKPL 3B8YA 4A6YB 4JFFA 1KLGB 5DR5L 3FK3A 4M1GL 4OF3A 2P5PA 3SD5A 3S96A 1IX2A 1JYWA 2DQHL 3P1VA 3BPCA 2Y07L 5ESAB 1QA9A 4G8EA 1KELL 2C1OB 2VDOB 1VENA 2HX8A 1DLHB 3B8SA 1JZDC 3CC5A 3HS0C 4NQEA 4GKSB 1P4IH 5C6PB 3ZZSA 1UH3A 1TQSA 2JTDA 3A6BL 1R5VB 1E90A 1EANA 1UM4H 5CZVL 2DD8H 4XB7A 3U83A 1CL7H 2H32A 1F3DH 3AXIA 5HGBB 4BWWA 3BIKB 1KENH 1BD2D 3HNTL 3FYIB 4P3DA 4U1NA 3HZMB 3SEPA 3QHZH 2NSQA 3CBJB 3Q01A 3P9LB 4LAJH 1UWFA 5K39A 1GGCH 3L3JA 2P5EA 3OL2A 3ZE1F 2CZNA 3NOIA 4LSUL 1X5KA 3L7EA 1WFMA 2F9BT 4F93B 3LQMA 3P0VL 2VM9A 1BJ8A 3IU3B 2XN0A 4JB9H 1HU8A 4OI9A 4HUUA 4FLHA 1AXIB 1XB3A 4TL4A 5HYJB 4G7YL 3VD9A 1WT5A 1PY9A 2AQ1A 2P26A 4FLOA 1FYTB 5EU6E 3JYCA 4AUYA 2UVFA 4G11A 3V0IA 1AS6A 5KBDA 1AMXA 3TCLB 4BINA 5DJ6B 3OPZL 3F12A 5BMFH 2IWGA 2VWEC 3QWRA 5F7AA 3P2DA 4ETQB 4NM8H 5TF0A 4EDXA 2BFGA 1OIOA 2LU4A 2NYKA 2YD3A 5D1XD 2MCPL 3ZJAA 3KPRE 1ZK9A 2XZAL 2O61A 1OALA 2O30A 1KN2H 1H15A 2XBTA 2EICA 2VLKE 5LGJA 2Y7MA 3OKDB 4EI0A 4JGNA 3AS3A 1QW9A 3ISYA 2B1AH 4DKFL 1WG3A 2FO4B 5CR1A 3GSRB 5ICYB 3KYMA 5DO8A 1GGYA 32C2B 4KQ4L 5FUOL 3W57A 2EVFA 2X4RA 2QTVA 2OAAA 3N1PC 4LCUB 2FYYB 1H3WM 4MMYB 3GS4A 3QUYB 1KELH 2EIMB 3AGWA 3LPFA 5FYKH 4OSUH 1DUZB 1I9RH 2VN4A 4KXAA 4UUJA 1RFDL 2WXKA 1IM9A 5EORH 1TIUA 4FNUA 4HWBL 4N5EC 4GMSH 2WV3A 3VDAA 2UY7A 5KYNA 1AIFB 5D1ZI 3B1TA 4PCKA 4XXDB 3RKDC 1RUMH 3KBPA 1RU9L 4LDEB 5C07D 2I26N 2P8MB 3FZUD 4LEBA 2DQDL 1UCTA 3HB3B 2N1TE 4PWIA 3SDYL 4BH7A 3UGXA 1AMYA 1QFOA 3T1WA 1XO8A 3C12A 1P84K 2FLBT 2VDLH 2K8QA 3WO4B 2IBBA 4ZJ9A 1OKEA 2ILLA 3T6ZA 4MS6A 2YKKA 3SGEH 5C6TH 4AYMC 4I4WA 4KX9A 5TPWL 3STLA 1TPXB 4PG2A 1SJMA 3RWDB 4ZXBA 4JR9H 3ZRCC 1LLAA 1OPOA 2YRZA 3V9FA 4AMKH 3NJXA 3GTNA 1E5AA 5D1ZA 3IEAA 3MCG1 2HVJA 3V9EA 1KB3A 3DRTB 1RULH 4G5AA 5KBPA 2CGRH 2PYFB 4HIHA 2A6JA 4YUEL 3DMMC 3NFNA 4N3UA 2EDKA 4G8FA 2F19L 2BSRB 4RGNE 4FA6A 3VYPA 3QUMB 1QEWB 3OVUB 1SYVA 4UDTB 4HMEA 4NJ9H 4GP8B 4Y4KA 3UTSA 5CD3A 4MJIA 5MEOB 3UTZB 1OTSD 1F90H 3QQ4A 1U3JA 4HLZH 1M2VB 1BZOA 5C0BB 4Y5VC 2EIKB 3N42B 3ZDZB 1Q8MA 3EOTL 1HOEA 1I7UB 1R0AL 1G1OA 2YA0A 1KTDB 2ZOKB 3CPLB 4PGJA 1NAKH 3MUY1 4YBLC 1HI6A 2B2XH 2PW1A 3T3PB 3U9WA 4HFWB 3LCYA 4O58L 2MQ3A 5J3HC 3KPTA 2Z7UA 3MCLL 3QT2A 1INEL 4IRJB 5GJTH 2YAEA 1T66D 5E9DD 5KG9B 3CJJA 3NIGE 3PDGA 4R26H 4JDTL 4UQDA 4OV6F 4X42A 3GMLB 1TTFA 4HHWA 1JHKH 4NQCB 5GRJH 1JPFB 1W72L 4ES8A 2A0LD 2Q10A 3DVGA 4QT5A 4PJ8B 1LNUB 4WTZG 1X7SA 4IEFA 2G0LA 1E30A 5D7LE 3N44B 2V9UA 2ICEA 3GEWB 3BAWA 1KLFB 4G43B 2VCOA 4V1DD 5D1QE 4IJ3B 4J12A 3HB3D 4A66A 3JZYA 1BVKA 4GG6A 3UABA 2RQEA 1MFCH 2X6BA 1QFPA 3CN1A 4YDKL 3MRMA 3D4ZA 1MH5A 5D1QB 3QEQD 1YAIA 3UZQA 1NIFA 4LQ1A 5B1KA 3X14A 1G7IB 1I9EA 1KB5H 1BGXH 5DJAA 4XODA 5ADPL 5CCKL 4MA3A 3SKUD 5D1XA 4K3DL 3EFOA 4OF5A 2X6UA 4PV9A 4NKIH 5SX5H 3RI5F 5IT2H 4PW4A 3NVQA 2RR3A 4WDIA 4LHJB 4CJ1A 4F33A 4CGTA 4DK6A 2WXMA 2X4SB 1CR9L 3FTGA 2GBVA 5M94B 4KKLD 5EPMB 4I2XA 1H9DA 3VRLE 2YKLH 1U8MA 2B77A 2DRUA 1S7TA 2RH0A 1AXSB 5FYLE 3BZEA 4HEMA 4J1UA 5DMIH 4IJTA 4ONGL 2B20A 1M4KA 4PJEF 1LDPH 1UOVA 3IM1A 3N50A 3V6BR 2F1EA 4F15B 1INDL 1H8OA 3SYPA 1RZJH 3EIFA 3QRGL 4JY4A 4ECNA 1K4CB 4RFOL 4JK0D 4KZEH 2QVMA 5IHUH 2XXMB 3MROB 4YSOA 4DGYL 3SCMA 2Z7ZA 4PGDB 1FP5A 3W1ZA 1MHHA 2YPVH 1A22B 4JW3A 4Z9KB 3BKYL 4ELMB 1IC1A 1O7SA 3GSNL 3MV8B 5EU6D 3ZR5A 5J56B 4V2BA 3N43F 2BW5A 2LT9A 4NNPL 4G7QB 5I18L 4HU8A 1LO4H 1FYTE 1IEBB 4JDTH 5J13C 5L6YL 4NKQB 2VDRL 3NSCA 3O9WA 3GSNA 4HLEA 5C09A 3IFLL 5LVEA 2J21A 4O9HH 4WO4A 5CAYB 2HXAA 1EJOH 4YHOL 5FYJE 3MA9L 4B9FA 1M7UA 4FYSA 4X4ZA 3VRIA 4QTFA 3UZVB 5F7DB 3X3FH 2AP2A 2AW2A 5L0QC 5EEUA 4A7GF 3RZCC 3GS0A 4MA8L 1UCBL 1DUYB 4V1DE 3CHRA 2DH3A 5D1QD 2QHRL 3BZ5A 3MCKB 4WUUA 3HNSL 4FS0A 2HT2D 3TJEL 4RRPM 4HKJA 4PJCF 5DRXA 5A2FA 3QUXA 4WWKA 2G9KA 4NKDB 1BBJB 4FI7A 5JMOC 3M86A 4RX4D 5JOFB 3W5MA 4PJIB 4WLCA 3VI3E 1D6EB 1JDDA 1BBDL 2BCKB 5KSAD 4D0DA 5IZ7A 3FO9A 2O6DA 2YAOA 1P7QA 1NUDA 3Q1EA 1F86A 1H15B 3ARDA 1KPUB 3ZKSD 2BS71 3L2NA 5EUKA 2GHWB 3NAAL 3PP3H 4DKAA 3REWA 1FAKT 1CLCA 4A7TA 3IF1A 5LKNA 3RNKB 4NQXA 4DPRA 1J9QA 2ADJB 4XN5A 5HP5A 1W15A 2GTWB 5BZWA 3VFTB 5BZDB 1QP1A 1TTBA 2WLIA 3C75A 4ZS7L 5FYLH 4TNFA 3VFNB 1MRDL 2NNAB 3E80A 3QNXB 1TU2A 3O4LD 4LLMA 5D7KD 3QDHA 4LLYA 4Q0XH 3JTSB 5H94B 5IBTH 5C0AE 2NW3A 1KGCD 2DQCH 3OMZA 4PJXE 4AGQA 4IBSA 1GTFA 1WA1X 3INUH 3PFUA 2IADA 1IT9L 2HPTA 1WD8A 4GIPD 1OXYA 1XX9C 3RWIB 4OJEH 1K2DA 1EEYB 5LAPA 5E5UB 3DVFA 1M9WA 3VQLA 4KK8C 4OQTA 1A3RH 5DHXB 3MYZA 2Q3AA 1OP5K 2YPKB 2X0UA 4JPIA 5AQ0A 4I77L 2Y3NA 2IGFH 3QC6X 1CC3A 5F7EL 1Q4NX 5KWYC 4XN8A 1QSEB 5ALBL 1CLVA 3MA9H 4GPVA 1YQ2A 2CRMA 3L9BA 3MRPB 1LO5A 1WFOA 2XPYA 3CC5B 4JS7A 3RBGA 3FUIA 3VYNA 5ITBL 4XTRC 1SGKA 3QUYC 3VDCA 2X88A 3EO0A 1T7YA 4WEBL 1JMZA 1AGFA 4JFFE 4OFDA 5GRUH 5AB9A 1MNNA 1XFPA 3QG7L 1RD6A 5FW8A 3KPOB 1AE6H 4QWWD 4OFYD 4AQAB 3UO1H 3VFOB 2CBQA 4I87A 1QYGH 1RKRA 4OJCA 4ZAKD 3PXHA 4M8QB 5F97E 2EP6A 3UGEA 2FATL 1GYAA 4LSVH 4YBHA 4JFOB 3FRPG 4A1RA 4APQC 1F3DJ 2NW2A 4P99A 3T2PA 2IPKB 1D5ZB 4FNRA 1ED3A 3VO0A 2NY0B 3TO4C 4APXB 4G1MA 4P5KB 5I15H 4AJWA 5CJXC 4NFCA 2OJEB 4JFXA 3GMOB 4JMXA 1MREL 4O02H 1Q90A 4MJIB 5MEOA 1K8DA 1NC4D 4JCWA 4MAYC 2JKLA 4GAAA 4JQXC 3FT4B 3PWNA 4WI4A 2X1PA 1FLRH 1SBSL 1A47A 2F18A 1MJUL 3JTBA 3PJNA 43CAB 4AENB 1N59A 2NYYD 3KM1A 4FMFA 3WNKA 2ZKXA 1XGYL 4X99B 4HFWA 5E94A 1BWWA 2OSYA 1BZQK 3QI9A 4QJ4B 3GTTA 2Z93B 2PABA 5F1NB 4HDIB 1AGEB 4LHUD 2YUZA 1P53A 1OTTD 4XR8C 4MQXD 1SUHA 3T4AA 4Y1AA 4ZOEA 4CDGC 2B8OT 4XN9A 3CZKA 3DXAB 5DQ9B 1GCYA 2HWZL 4NQUA 1FH5H 5AKVA 5G5DB 5KJ7E 3NSJA 2XV3A 3SZKC 1KYDA 2WIIB 1J5OL 4OV5B 1UB5A 3CH8A 1FORL 1B0RB 4G43A 3BP6A 4AIOA 3TLRA 2WMPA 2E6PA 2FYYA 3MRNA 5IVZB 2G3ZA 2VAAB 2VM4A 4G7VL 3OX8B 2IGFL 4FABL 1TQBC 3QQNA 4Y16D 4XAKD 4LRIC 3IMUA 5GGQH 1IO4C 4YDVB 4JPWH 4O2CA 1CE1L 2XIIA 1X5ZA 2BM3A 1O9WA 2QL1A 3SKMA 1Y18B 3TX4A 5CLWA 3FQTA 1XF3A 4WI6A 5KVMC 2IG2H 3OC8A 1DQQB 4N3TA 4WEBH 3ZVVA 4YJZL 2UY7B 3AXHA 2VMJA 5E1AB 5DRZB 1AE6L 1MCJA 3G9AB 1BG1A 1P7KB 1JHLL 2X6MA 1UWEH 3L1GA 2Q0ZX 3U1SL 2VSMB 5FA4B 5FYKU 3KEHA 1E8YA 3T0DA 3BKCL 2Z4QA 2J57A 4WU7B 2P46B 4RMUA 4UM9A 5K1NA 3WS3B 1T22A 3BUQA 1GS7A 3KPQB 5C0IB 1FGNL 4GJTB 4EUPH 5JYMA 5J89A 1ZHBB 1AHWB 1KIRA 2FGWH 2W9EL 3LS4H 4ELME 4MJID 2X4QA 4YGAB 3JV4B 4BUHA 3NMEA 1K85A 5HHOD 5T33H 3U7WL 3K81A 2Q8BL 1C5BH 1P7BA 1ZHKA 2D2OA 4U0RC 1KCRH 2EH7H 1IGMH 2W5PA 1YEDB 3W2DL 4AT6A 1FHNA 2ZT9C 3HN5A 5CGYC 4YHIB 3GIZH 3SDXA 3BVXA 4XAKE 1KYOK 4AE0A 1IBGH 4PVMA 5HDLA 5AZ2H 4RNRB 1PLCA 1YEHH 1SDDB 5AKSA 3EBHA 1U4FA 1M2VA 2CJUL 2N4IA 2ZX8A 4LVNC 1JVOA 1UD8A 3UGUA 2K6WA 4M6NL 3C2AL 3RJOA 1FAIH 2NXYB 3MOAH 3NRQA 5HDRA 5BPPA 3MC0A 5D6DA 2RMNA 1PZ5B 1A9BA 4K8RH 5EEWA 4JZNB 5DI8B 4DGIH 3ZZLA 3CFUA 4FA7B 3VXRD 1C5CH 4XNQA 2CCWA 5CNHA 1BAWA 2VRAA 3ALWA 5I6KA 2G60L 3L4UA 3V6OA 1RK1B 4DVRL 3DX8B 4GQQA 4JFQA 1IZKA 4OLXH 4F3FA 2EIBA 1T3FB 1UXLA 1RIHH 4XTRD 3NA9H 2YUVA 1L9OA 1WSST 2FAUA 3OZ9H 4ODWB 2FR4B 1LNUA 4JHBA 3WHXA 4IEFB 2VM3A 2DQFA 4XPTL 3NCBB 1WVZA 4GIOA 5F6IC 4PJIA 1N2RA 1TG8A 1RZIA 3GI9L 3HN8A 4Z7OB 1HE7A 1ZD6A 3F3HA 4DO5A 3CIAA 4QLRA 3QHFH 4JRYB 3NZSA 3VMOA 2OMVB 2XBZA 3Q9PA 2JJTA 2QPEB 2WVTA 4G8GB 3IDXL 4Q97A 5CLYA 5DU7A 2FSEA 5DJ2B 1KTLA 4TQHA 1CZ8H 3UZQB 1DVSA 3I6KA 2WBKA 1G43A 3KLDA 1SXNA 5KUKA 5EF2A 2WHVA 2J4WL 4KNTA 1A21A 4UV7H 2SEBB 5HI4C 4TTGA 4ERSL 2W9EH 5E8OB 1OK0A 1MRFH 2OBGA 5CZRA 5I74C 1TO5A 1I7RA 2BNRD 2X4OB 2OQJB 1XGTA 4Y2NA 2JJWA 3JV6B 3BZ4A 3TO2B 1PSKL 3GBEA 1UWXH 2ZWSA 2ENJA 2X1WL 5EPMA 3NABH 1P5VA 1S3KL 3U46A 2XPGA 5T1DL 3BPOC 3MGTB 1M71B 1HCYA 1QFUH 1NAMA 2ZCKH 4O51A 4ZMNA 3U4BL 4RSYA 3GXUB 4TNGA 4I89A 4DGUA 5LXGL 4LEXL 2ENPA 1A5FL 5HVFB 1AZUA 1J05A 1HILB 1NICA 1BA9A 5MERB 2AJZB 1OWRM 4UT6L 5DMGC 5GRVK 4TUJB 4Y5YC 3WDHA 4XGZB 5EU4A 2RJMA 4JPSA 4XVJL 1I1AB 3B9KC 4ODXA 4N2BA 4PJDE 3MA7B 4OJYA 3PJSB 5AOKA 2JI2A 1INQA 2V6HA 4XMLL 3ARUA 3QEQB 4KROB 1FSKC 5I6OA 1C5DB 4CVUA 4X5LA 2VL5B 4U1KA 2W65B 3AT8A 5E56A 1T1YB 2VISB 3O2DL 2X89D 2ICWB 3SHSA 5IVXF 4YO0B 4BRJA 4EPSA 3RTQA 1SQMA 4LVEA 1ROWA 3FQ1A 1QFHA 2UUDH 5J12B 4YC2C 4F1ZA 3VXUB 1CT8B 4ZUTA 3SKJH 1J0YA 1QSFA 5FYJL 4R5TA 4MNHA 2ED8A 4MMXA 3MFFA 7CGTA 1TFPA 4LPYA 5E8EB 5ID0A 4X7CC 1I4FA 2DI7A 5B8CC 3KR3L 4XVSL 4FX5A 2YEVB 4G8GD 4GAJL 3DGDA 2LR4A 1NCHA 2Y1YA 5F3HB 3V6FA 3UJTH 4AENA 3W38A 1B4JH 3FB5B 1NCAH 1CIDA 3OLEA 3UBHA 2HYMA 1KTJA 4WWKB 3FW6A 3TZVB 2QGCA 1BAGA 5D6CA 2R2EA 4YSDA 3EADA 2P1YA 4PJ5B 1KMGA 4P57B 1P4LB 4AEHH 4WJ5A 3TPKA 2PYEA 5CSZB 4OJFL 4UT9A 5EIQA 1Q38A 1R5IA 2EDOA 4NNXA 4L9LC 1F42A 3CFCH 4GQZA 1D6VH 4IS6A 1DP0A 3H3BC 1CN4A 1K3ZA 1WWAX 1DVXA 2W07B 1DBKL 1Q0XH 1FH2A 5FIEA 3DHJA 5HI4D 5HJGA 3GSUB 2WNGA 4U6HA 5BXFA 1G9NL 2EXWD 2ED6A 2B3IA 1BFVH 1FNGA 2Z92B 3B9DA 2D7NA 4Z7OE 3STBA 1HXMB 3VD5A 5I30L 4H25A 1J9SA 3CHOA 4GB9A 2JLPA 4A39A 1ZMYA 1R4XA 4O00A 3BRGC 1MFEH 1WDAA 2ESVA 3TNNB 4HS8H 2BERA 2C34A 3QK0A 4TQIA 5TF1H 1GOHA 2JH2A 3P3UA 3QJQB 2GJ6A 3WJLA 3II1A 1AXTH 2CBTA 1HL5A 2DI9A 4AQ1C 1XXDC 1DJXA 3NCWA 2EKJA 2Z7WA 4XNMA 4YXLL 1UFGA 1YY8B 3M45A 4I18A 4NUMA 3RGVC 3VGBA 4EI5A 8PAZA 1TVBA 2OPCA 1QLRA 3GI8L 2DWXA 5DHYA 4IRSD 5FDWB 4KTEL 2EECA 1OB0A 2GJRA 1LJMA 2VKXA 2OMNA 3C6LB 1UURA 3C8DA 4ALAH 4LOVA 3V6ZB 4EN2A 5JHAA 2AK4A 1FZMA 2IALB 3K5SA 8FABB 3KR3H 1QLEH 4RISL 3ABKB 4U3HA 3I6GB 4GAJH 4XPAL 5JMRA 2ESVD 3ORJA 5FUZL 3FNKA 3TZVD 4KHXH 3EFDL 5DWUH 2ED7A 3PDDA 4YZFF 5T1LD 4FXGC 2FEEI 2ZSWB 4GXVH 1RJLB 2BWDA 2Q76B 2Y36L 3Q1SL 1ZSDB 1IL1A 4MYPA 1E8WA 4HPYL 5DA0B 3H54A 3QR1A 4F9LC 3CVCA 5ICZA 1JN6A 2NT0A 1T6VN 2DYPA 4ALAC 1T4KA 2NCEA 1REIA 3W9EB 4PRNA 1QTPA 4H88H 5FYLD 1NPUA 2I7OA 3LZOA 2EC8A 4GT7A 2RQ8A 3SPGA 5BV7H 1OGPA 4LDLB 1XGPB 1QSED 5HHXL 2D3NA 4DO4A 4DKTA 4FFYA 3MV11 4A2GA 5D1XE 3D51A 4YHZL 5FO7A 3CNKA 3K6OA 2B3RA 3NSFA 4XWOD 1M7XA 3DARA 4K9EH 5DZLA 5HY9B 3L1OL 3B7RL 5IQ7L 4MASA 5DD1H 1I8MB 3LIZL 4PJEA 4Z3JA 4OQTH 1A6VH 4M43H 1CO1A 4HGWA 1A1NA 1JPSL 3HKZA 3RWGA 4R97C 4UZUA 3ZDYF 3KXFB 2AK1L 4MXWL 4ODWA 4YHPA 4QCIB 2XTLA 2K0RA 2Y25A 2FIKA 1NDTA 5C0EB 2BNUB 6CGTA 2NY0D 1DLHA 1JPTL 1S9VB 1X4ZA 4EN3B 4CMMA 1IC5H 5IMLB 3VD1A 4M6ML 2J1XA 5I6LA 4HJUA 5EU5B 1G6RB 4N2OA 5C08B 1ASOA 1PIFA 1N4XL 4B60A 2ZP9A 4O2CB 5F96H 3P9LA 3RL2A 3QHZL 1HT6A 5GSRA 1QNIA 1XR9B 3MRKA 5DC2A 5JNYA 3M8OL 4M61B 4PJAB 5AVTB 3WJMB 3UCRA 2AEIT 3HS9A 4I5BB 3MLRL 1ORQB 4E41D 3QJOA 1X5MA 5I76A 3CWGA 2CDFA 4GRLD 4IIQC 4X5WA 3S88L 3CQPA 3DX6B 3GMRA 2APSA 3FU8A 1PNDA 2A83A 5HVGB 3WELA 3HW7A 1BYNA 2XWCA 2XPGB 3RGVA 2D7QA 4H13C 2YRLA 3LMJH 4Z3TA 5IVXB 1ASQA 2C3XA 1YC7A 5DFWH 4O51B 3FS9A 4AW7A 3ROLB 3WJLC 4K5OA 1ET8A 4X8XA 5FHBH 2E9WA 4OM1L 4OIFA 1WE5A 1CBJA 3OZKA 1QWHA 5IB5A 3FSZA 1TQUA 2F7PA 3G04A 3Q48A 4U1GB 2Z4TA 4F2EA 3DMMB 1RURH 4AT6B 1U2CA 1FNLA 3A6CL 2EVIA 3MA7A 3MNVB 4IGBB 3HE7C 3P4LA 1YSOA 3REVB 3EYOA 5L9DL 1CGTA 2I5YL 1YUHA 3ME0B 1KXTB 5T5FL 1W8EA 3MV9A 2VMDA 3PHQA 1TOXA 3QJRB 5GGTA 3ASWA 3KYOA 2ARJB 4GI8A 5HGAB 5I75C 1QUNB 4NN6B 5D2LB 2B9AA 4MNHB 5EORL 4KK8D 1A6WL 4P0DA 2Z8WC 3L08A 2EDMA 4BZ2L 1EZSA 3P9MA 4Y9EA 3QARA 4PR5B 4WWOA 1EK3A 1WGVA 1BVOA 3VFPB 2VQ1B 1MI5B 1ZWIA 3LHPL 5IMOA 4NQSA 5DFAA 2ARWA 1CMOA 5AVXB 1BG9A 3GJFH 3KPRA 3GO1H 3W39A 2O4EA 2CKBL 3DHMA 4OCRH 2A3TA 1CU4L 5GZOA 5I1KH 1QRNE 4KZCA 4OU3A 2CO6A 3U7YL 3BYTA 4JKKA 3CUPB 2DKSA 4FTVA 4JKPH 1YEKH 3NCCB 3VH8B 4IOIB 1EJ8A 5DR5H 3A0OA 3L3JB 5E00B 5E23A 4FQXD 5I1DB 5HI5D 2A74B 1UA7A 3QUMA 2C8NA 4NBZB 3UBXI 4Q9QL 2J2ZA 4U0QB 2A6JB 3KYNA 3GMPB 3T8VA 3FUKA 1KBVA 2MNUA 2RCSH 4L3CA 5LBGA 2VLJD 3WS6A 4FYRA 3UYRH 2IGTA 1RZ7L 3B9KA 3VM7A 1BIIA 1SHWA 3RI5K 5L4FA 1MCBA 4ANUA 2Z9TA 4L3EA 1IEHA 4G42A 3TA3B 3K6FA 3T0EC 3QEGL 1HI6B 5HHOA 2EIZA 3EO1A 3T1FA 4HLZG 1UUSA 3HG2A 3HG1D 2PNDA 3Q2VA 1F4WL 3GMNB 1IGIL 4GSRA 4P04A 3K0YA 3IYLW 3SGDI 3UBXG 3FTVA 1KIUA 4M62L 5DJZB 2BMKA 1LXMA 2YAQA 3HNTH 4BGLA 1I53A 1YUKB 3HPLA 2R4RL 4P46A 4XNBA 1S7VB 3H7LA 4X7EC 1QI3A 2PWGA 5EU4B 4XC3L 3WEMA 1Q72L 4RGMB 3IBEA 3CQFA 1EX0A 2OCFD 2WLJA 3X3GH 3NCJH 4P3WA 4PJ8A 5EUOA 1DQDL 4NZUL 4G7YH 3J2PA 4PJFF 1PKQA 2EIJB 1T83A 2I9LB 2WINA 3IJ9A 1F3RB 4ZO6A 4PG9B 1E27A 3HR5A 2NTSP 2NDGA 4NENB 1X44A 1R3LA 1WV7T 1WFJA 1BVLB 4PWKA 4IHOB 4X7DC 4E5XA 3MRMB 2GI7A 2DZEA 1KTKE 5EIIG 2JJTC 3IFPA 2RBLA 3LRSA 4JM2D 2DLEA 4NLHA 4M7LL 4RA0C 1AG6A 1BVKB 1NFIA 3N1FC 3T09A 1CG9A 5JHMA 1TKWB 1TTRA 1BIHA 2XZAH 3ULVH 3V0AC 1KN2L 3GLEA 4YH6A 3HBPA 1OTUC 3OJDB 1IVLA 4M48L 5IKCB 4PTUA 4FQ2L 4JE4B 5DJYA 2W88A 3AVEA 3AREB 3K2KA 3DIDA 2GG1A 1PU0A 5EIIA 4ODTH 2IDSA 3W9EA 4EQ2A 2PXYD 2AJ3A 3HLAB 1QR4A 2NZIA 4N0UB 5L88H 4KQ4H 5FUOH 2G75B 4HHAB 1FFNA 1BX2A 1TQVA 2CKBA 4QTIH 2FJHB 3KLAB 2HB0A 3L5XH 3P11H 1SMDA 5FKPB 3TBWA 2ITFA 2HH0H 3VXTB 5BZXA 1JZ5A 1NCIA 5T3XH 3MLZH 4I0PA 1BSIA 1IVTA 3P4NA 5JXED 2IH1A 2F5BH 5DHVA 4B97A 1FIGL 5F7UA 2LVEA 1M3JA 3FO1A 3SCMB 5D7JB 1GMIA 4L5FE 2O5YL 4BKTC 3I74A 2BO0A 1BREA 1ADQA 5TK2A 2G3XA 4FFZA 3RNQB 5CF3A 5HVHB 1AO7A 4K5PA 2NY3B 5DVNA 5I0YA 1NBVH 4P49A 3J8F7 4BJLA 1N5AA 2YWYA 5DD0H 4ELMA 3VXUD 1ZLWH 3ISRA 2BNUA 1IGJB 5DS2A 1MW1A 3JT2A 4TLKA 4BRVA 2BXZA 4PVNA 1MCKA 3CXDL 5ERWB 2XBDA 1IQWL 3RVVD 4CILA 1EGJH 5FDYA 3DGCR 2BIOA 2P43B 1H3XA 4U7SA 5HDBF 1KGXA 3WN5C 3WYRA 1WA2X 4K5LA 2B08A 5C09B 2M26A 1KJ3H 2YR3A 1NWOA 1XXFC 3O6FD 5HGHA 4KVNL 3VCLB 1J11A 5MENA 4LBEA 2B1OA 2WBJC 1O7VA 3NSDA 5F9OH 4FJYA 3ML8A 3OKNB 4NIYE 3VNZA 1NKOA 4X7SL 2I9TB 2XVLA 1DUYA 4GRLC 4ONOA 3D9AL 1S4IA 4PMFA 5TH2B 4GKOA 4Z7WB 1JPFA 4X6CE 1IQDA 5IB4A 2Y4SA 4NRZB 1T1WB 5E8DH 4F27A 1MI5E 5EN2A 3TV3L 2ICEB 4UCFA 3DUHA 1UFUA 3QIUB 3RDTD 3HZYA 1R5WA 5F72S 1MVFA 1KCLA 4LVOB 4AYBA 5I1EH 1YEIH 3QEUB 2GSIB 4N0FB 1T0OA 2JJSC 4UT9L 5JHDD 1TZ8A 1LO0H 3AXLB 2YWZA 4H0IA 3V0HA 5T1KD 4MLSA 1R3KB 4GQ9L 4NS0A 2XWBB 3L5WB 4UILL 4G8IA 3TC9A 3ARDB 1Z1WA 3GXTA 1BZ7B 4A04A 3ULAB 1FJ1B 3T3PF 3QIBA 1FFOB 3V4PL 4K9JA 5EZLB 3RNKA 3V4VH 1JFQL 4D9RE 2Y06L 4OCYH 2H2PC 4PVLA 1N6QH 3QW9A 2BVPA 3IXAB 1XSKA 3RGVD 1NDGB 3O41B 3VD3A 4N2GA 4AYFA 4F33B 3UDWA 1W72H 1X6LA 2X4TB 2Z31A 15C8H 1F1GA 1QMUA 4HEPA 4BFBD 1ACZA 4UYQA 4JO3L 8CGTA 1Y6KR 2V7NB 2B4CL 3PRZA 4PYHA 3KGRA 5DRWB 4AJ0A 4P59H 5JQIB 1HHGA 3EF4A 2FJSA 4NQED 4TUKL 1UT9A 3ZT5A 5DMGD 1ILSA 1HHIA 4BKSC 2JELH 2OMYB 5F3BA 4BEIA 4KK6C 1OCZB 4JQXA 3BE1L 1KJ2L 5EC1A 3WDIA 1ID5I 4KKBC 3ETBJ 3DOHA 1RV6X 3EBAA 3EBIA 3Q2LA 1M3IA 4WGWB 5DZOA 4CU6A 2M1KA 4DQOL 3TFKC 4W9EC 4PSRA 1SFHA 3SYAA 5LHDA 5CINH 2CA3A 3FCUB 5ECGA 5FA3B 1UGNA 2R59A 4F7EB 1DSWA 2EDQA 2ZKYA 1S9KC 1PJ9A 5AG9A 5IMLA 3VFOA 2UXFA 4HX1A 2LLGA 1UA3A 5I1IL 4LCYA 1J9TA 3GSNB 3GXFA 4QHUB 3UP6A 1XMEB 3WLWD 5LDSA 4KRNA 4XPHH 3KYKH 3QQ3A 5E8NB 4L4VE 3IFOA 3D8MA 3D85A 4K3EH 3IWVA 1T20B 4MCYA 4U6YB 1MUJB 3IMBA 2WYZA 5K69A 2ZD0A 4PJ7B 5CEZH 4D9LL 2JKRM 1SOXA 1FFPA 2E5EA 1QRND 3MRCA 3PIQB 4WHYG 4WVRA 1DEEA 3TF7C 3NIDE 1J0ZA 2J8UE 3QDME 4DF9A 3VFWB 4MAZA 3Q8BA 2FX8L 3D0LB 3H85A 4NP4H 4B9JA 5AB2A 3W81A 5I8CB 3QE5A 1MJUH 3SDCA 5C0DB 5ALCL 1O7DC 3QA3B 4LSUH 4J3SA 4X9YA 1P1ZA 2X4NB 2R29L 3MV01 5B21A 4R4BA 4KI1A 1MZZA 5EZPA 3EJYC 2Y5TB 3N9GH 4HIEA 4HUNB 5JZ7C 1E40A 2OM5A 5H2BA 4U7MA 4CKVX 4WUUE 4A2HA 4ZNCD 3TPUB 4OD1L 1XF2B 2QADC 1S3RA 4N6QA 1ZV2A 3B2MA 3HI5H 4L29B 2WXLA 3OAZH 3MBWB 2EO7A 3T3ME 3NPSB 3QPKA 2UYLA 1USZA 3FQUA 4JPKH 4KKCD 5HGDA 2NY7L 5C1MB 4FGMA 2CH8A 2IV9A 2GFBA 4UT7L 1RK0B 1RZ8A 4AQEA 2DMBA 2AJSL 2X2YA 4L4VD 4I0PC 2ADJA 4G71B 1WZKA 4XVUC 2QHRH 4HS3B 1MWOA 1YQVH 3E0GA 1ZGLM 3RVVC 2F08A 3IJEA 2NW3B 4G6FD 3QORA 3B9AA 4XNUH 1U8OA 5EDXA 1HIMH 1W8OA 4E5XB 2R0WL 3KZ8A 1J8HA 4ONFL 4KQ0A 3BEVA 1JXJA 4V1DA 1E5ZA 4Q6IC 5KAQF 2DV6A 4YIQB 2ATPB 5DDHB 2CKNA 3DX9A 1E9QA 3B83A 3QCUH 1XGQB 3QJZA 4KK6D 4UV4H 3TF4A 1G7PA 4HXAH 1CD8A 4Q7DA 4ZMQA 3ILQD 2BRQA 5DD5H 4PJBA 2XN9A 4UM9B 1BQHB 3UTTB 3ZSTA 3UFIA 4YL9A 3VACA 1ZGLA 4POYA 1ZHBA 2VLKD 1BMGA 1KIRB 5PCYA 4DSYA 5T33L 4RBPH 4YDNA 4WO4C 4HJTA 4GQPH 4JHWL 4PW9A 2EABA 1QFWL 4PWFA 1RZJC 2B39A 2FH8A 2E9BA 4O02A 3LXAA 2ITCA 4JN2A 4OIBA 3F58H 1MJJB 2OTPA 3X13A 5C6TL 4UIMB 1GHFL 2J2ZB 4XP1H 1X4XA 2FD6L 2WB1A 2ZOTA 3LV3A 5D4JA 4J6RL 3LKSA 5A2JH 3FRUB 2X3AA 2VDMH 4M1CD 3KCWA 4KV5F 3FO2A 2ENQA 1OPGL 1QAWA 3ZDXF 3GGWA 5IV2A 1N0XL 1VACA 5D1ZD 4BIKA 4KFZC 5AZEH 5ELIA 3BGFC 1P6AB 3ES6B 4I2XE 1QZ1A 1MCRA 4PRPB 4ZXBD 5MI0B 2VDQL 3N6YA 2EDRA 4DGIL 5HGGS 4L8SA 3IDMA 3QDJD 1J8KA 1A9BB 1EO7A 3V0JA 3LYRA 3SGEI 3T4AB 1QABA 3OD3A 2NPLX 4FG6D 3R1GL 1HIML 2VW6A 4UOJA 3IRCA 4L9DA 3S96B 1XGUA 2WBWB 3NDZE 1CDUA 2COVD 2WZPD 2A6IB 2PPEA 1NBZB 3DSFH 1H8NA 3W11C 1G7MA 4WSGA 4FHBD 1AJ7L 2UZXB 1ZS8A 2VZVA 2AITA 5EH1A 1UB5B 1Z3RA 3QSKB 4XMZA 1T4WA 4OLUL 2WSKA 4NENA 3M1OA 3JXAA 4S0SD 3SY0B 2GSIA 4N0FA 4R26L 1HKFA 2C5DC 4AMWA 3TVMC 4ZZFA 1HNFA 5BCAA 1UKQA 2EVJA 1ZPUA 2XWBA 3L5WA 1LEGB 4Y4HD 2XZZA 2PW2A 3OJDA 1ERNA 3CVHL 2AV1A 1XCTA 2FECI 2XWTA 1G9MC 5HYSG 4QHLA 3MV7A 4HUMB 5JIDA 2BSTA 3MUGA 2VN5A 4GMTL 1UYWL 2LAAA 1UC6A 2H6OA 4WY7L 3SQBB 2QLYA 3D39D 1M71A 4KKPA 2BNRA 1I8AA 3WNIA 4BSWB 4UBDC 3U46B 2OMTB 4KGLA 1S78C 4FQXA 5DMKB 1P5UC 4HUXB 1WEJH 4PI2A 3F12B 4OZFG 3FUJA 3CFQA 1DBBH 1G7JB 1AQ8A 1D5MB 5D1ZB 5K1JA 3QXAB 3WIAA 3ZZ1A 4XNAA 1CTNA 4FFVC 2H9GB 1T04A 3PAVA 4EE2A 5GRUL 4KJYB 5J1AA 2IV8A 1Z9SA 2XNAA 3DIVA 3RAJL 5I5JA 5EC1B 4Y5VA 1UB6A 4G8FB 4OZIB 4R2GD 1E5YA 5IOKA 1FL5A 1ADWA 5F71A 5A2BA 2XTJE 1KPVB 4P3CL 5CD3B 5JPNA 4H1LG 3IGKA 4Y7MA 5AUMB 4WK0B 5FHAH 1E2ZA 5EU7C 2YK1H 1NIEA 1T1YA 5HHMB 1ZLEA 4HIXH 4JY6B 5HI3C 2IQ9H 1CWVA 1G6VK 4XX1G 4ZXBC 4WEUD 1PEZA 1OT2A 2PXYB 3A3YB 3RY6C 3FUEA 3SSGA 1C5BL 1YG9A 5C7XL 3JV5A 3NYKA 3U6XS 1WZ1L 2EH7L 1SY6H 4QRBA 3IMVA 2D8KA 1MHPL 2VLJA 1YEWA 5L6YH 2XQBH 3ESMA 3BIBX 2V2WA 3UCQA 4D0BA 3BPLB 4G9FD 1HE8A 4FCHA 4A2LA 2VXSH 4WI5A 4X98B 5EO0B 2EYRA 4KHTL 5EUOF 3R8BB 1SBBA 2APFA 3P73A 3OLGA 5KVDH 5TQ2L 3GLZA 1KLFA 4ZS6D 4XMTA 1XEUA 3WXVL 2HRPH 4RMBA 43C9B 4PJ5A 2ZQKA 5JLZA 4HKZA 1P4LA 2E56A 1ZV9A 3F7VA 3WEXB 4G3YH 2PP7A 2BSED 1C5CL 4L4TB 3O6FC 4NNXB 1MCQA 2O72A 3IAPA 4MMZC 3WGVB 3U9UB 4PBDA 5FGSA 4ODVL 1BQLH 1ECYA 2E27L 2Y3AA 3SDAB 3ZO0A 1RZKH 2W07A 2VXUH 1T6WA 2KMWA 4RDQG 4WFGD 2ODHA 4HS3A 4RH4A 1CE1H 1X9UA 4NB7A 2QSCL 3G3LA 5AW3B 2DS4A 2P8PA 3QEHB 1XGRB 3QZWA 4NQTA 1FIEA 1NCUA 4BH8A 4DKEL 1BJ1H 2L7UA 3VG0H 3VFVA 1NAMB 3SOBL 3IETA 3SY6A 2VAJA 1TZAA 1RMFL 4LOUC 2UZIL 4QNPE 2ESVE 5IOPA 3KDMA 3H9SE 3LN5A 4F9LA 1K4CA 1ZT7B 3LSOB 2GJ6B 1V27A 3TT1H 3UZEA 4Q0XL 4V11A 1D5XB 2Z7YA 1KWGA 2W0FB 2PPFA 3DVIA 1W6WA 1T0NA 1MELA 4RA3A 5JHDB 3KGUA 1NUGA 1PBYA 1KLUB 3ZGHA 3NSYA 2PO6B 4KH2A 1JNNL 4YR6B 5IW3A 5HPOA 1YNLH 3LD8B 3QJFA 5E2TH 1KT2A 2UZYB 1G7LA 3FBQA 1B88A 1NMAL 2FO1A 4PJDA 4XNZB 4IRZL 1AHKA 2VXQA 3B5TA 4NJAL 5T1MB 4J8RB 1RVFL 1N70A 1JYNA 1KCUH 4PHZA 2FEDD 3POCA 3OR7B 3CFNA 1SJHA 5LXGH 2XKNA 2QTEA 3QS2A 1TTAA 2P9RA 3PJLA 4QRPE 1DVTA 2FVNA 3L3KB 4WW2F 3F5WB 3CFJB 1B9ZA 4XNDA 3TJHC 5B3SB 5H37G 2Q20A 4NZTL 5I1LA 3HE7D 1KXQA 4OVVA 5D1XB 1PD0A 1AACA 4G9FE 1MQKH 4MRBA 1A66A 2DJ4A 1ND0A 4M3KB 1KNOA 1CF8L 2X4SA 3MRRB 3PY9A 3QXTA 3VA6A 3T9WA 3QNZB 5JOFA 2E27H 4IU3B 4LCIH 1E7UA 4P57A 2BOBB 4PPTA 5SWZE 1XH0A 5ESQB 4ZAKC 4MSWA 2QEJA 4AQ8C 5F1IB 1T1XB 3H9SB 1YYCA 3PXLA 4TQ8A 1P4BH 2ENYA 2ZYHA 1OT1A 1F45A 3DV4B 3QPXL 3WEBA 3QBTB 4N8PA 1NBZA 4MCMA 4FHKA 1JYXA 1JIBA 3SGJC 2DL9A 4UQ2A 4XCNA 1GS6X 4HOZA 4Z1PA 4U1SA 3WTSA 2IBGA 3RVTC 3H0TB 1S7SA 1KPRB 3SPIA 2J4WH 5F7HA 5IESL 3MJ7B 3JTSA 3MJ9A 3PDOB 1D7FA 1XBDA 3AUVA 3QCVH 4GH7B 3QH3A 5DFVC 3WUWB 3U82B 2XICA 3L54A 1JNLL 5MEQB 2YD5A 3OJ2C 3VXOA 5TE6L 1GC1L 4ADIA 5IP4A 1XAUA 2GK0B 3DX6A 2WXIA 3GMRB 3TA4D 4IBTA 1ACCA 4W81A 4A6YH 2A83B 1N9PA 3RZCD 3MV7B 4KQ3H 1RVFH 1F4XL 4WCYH 1QLRB 5DHYB 1G9NH 2CDFB 3BKML 3INOA 3BESR 4KMTH 2ODIA 1ZTXH 3X1EA 1NC2B 2OSLA 1BCIA 2W59A 1JF5A 4G5ZL 4K2UH 4GW1A 2IALA 5IY5B 5IG7A 5D7IF 3V8CA 4XZUB 4HZAA 4YK4C 4AM0A 3US9A 1UWEL 3IMRA 3UTTA 2H8PB 1J7VR 3AW5A 1IKNA 5AVVB 3FU9A 3WE6A 1IAIH 4YGVA 2X42A 5DZ9A 1ZDQA 4O02B 4YHYB 4IBUA 2ZAIA 3AU1B 1H9VA 3GBML 3IJ8A 1AS8A 2L3BA 1ED3B 2EYTB 2ZG3A 3IDGA 3OSKA 3P40A 2ATAA 3LS4L 3QNYA 3KLHC 3R18A 4UANA 2MRYA 3PWLA 4FHJA 4S1SL 3MNVA 2F2HA 1W0WB 5T5FH 3IF1B 1MW0A 4IRJD 4KTEH 5LGHL 3Q5OA 4M5ZL 1R9FA 2A4CA 1SJEA 2M83A 3CV5A 1QBBA 4MMZA 5E7BA 3VQ1C 3ECBA 3QNXA 1JGUL 2OR9L 4N8CL 3LH8A 2E7BA 1TFHA 1R19A 5IEHB 3LAFA 3NZHL 5J11C 2QQKL 1KF9B 1F0LA 4ACTA 1DQMH 2HLAA 4HIQA 2GC4C 5D71H 2WWNA 2FWOB 2YJLA 1K2DB 3CBKB 5D5MF 4HJGB 3F2LA 3OKLA 3U0PA 5AW8B 5HPMA 1DL7L 3E3QC 2VR8A 4TSCL 1DQJB 3QZNA 5G5DA 2E8YA 5JDSA 2WXFA 1LP9A 5TE4H 1AZNA 2EXYC 5J6HA 3LEXA 1KN4H 2J25A 3ZE2E 5IMOB 4TQPA 5ISZA 1LO5B 3LKQB 5CSBA 4ZTPH 2QKIB 1DBKH 1Q0XL 3AG4B 43C9A 3MV7D 4AV0A 1Z9MA 1NFDE 5EU5A 3LZRA 3LZQA 5LQBL 5EOCJ 2OV0A 2B1AL 4DKFH 4IOSD 5KN5A 2O5NA 4L4TA 4IRSB 4TULH 2A9BA 4HC1H 1B0IA 5I0XA 4Y4HA 5L7XH 3MV9E 2A74A 2KL6A 4UNUA 1AGDB 5FCSH 3E8UL 4Y9CA 3L4XA 5E1HB 4FP8L 4HZLA 3LZFH 5EEZA 4M8RA 3CZNA 2NSMA 1I1FB 2X1QA 2OJ1A 2G9HA 3WI9A 1YN6A 5JPNC 1IEAA 3KYNB 1EZUA 1N7ML 3D0VA 3QEHA 4P9MH 3QXDB 4L3EB 3FFCB 4AGLA 3VWKA 2F7IA 4I0CC 4BSWA 1MRFL 1JZHA 4X0KA 1X9QA 4KOCA 3NCMA 1LO2H 3JV4A 3DGGA 3ZRFC 4XN2A 3HZVB 5ICXA 2H1PH 2GTQA 3MV8D 3RTQD 2Y1AA 1WFUA 3RGBA 3LEYH 3UYOD 1E4KA 3G6AB 4QRPD 2HSIA 2O5XL 3EDEA 3QI9B 3G5XB 5JW4R 1G1YA 1I9IH 4XXWA 3MODL 4BFNA 1YJDH 4P46B 5EUOE 4JUTA 1XZ0A 1OM9A 3U4BH 4LSTL 3NCEB 4BZ1A 3JVGC 2PWEA 3ABZA 1RPQA 2R1XB 3M7FB 1EAPA 4EJ1C 5AOMA 5AUMA 1E0OB 3I75A 4WFHE 3SKNB 1ZANH 3NK4A 3V0GA 5E6SB 5BS0A 2DBJA 2I9LA 5K59F 1WBXB 2H3XC 3OMNB 2DOCA 4MWFB 2F19H 3DVNA 3ULSB 5FYJD 5HGAA 4JKWA 1BPVA 1QUNA 2R4SL 3KXFD 3MV9D 5FS5A 1U2YA 3VE0A 1L4IA 3LKNA 4TSAL 1J88A 7TAAA 3OAYH 4AK2A 1JCVA 1FO0H 3OR6B 4C56D 2GUOB 4MB1A 4G72B 1LL1A 4NAMA 4QMEA 5BV7L 2IF7A 5I1LB 3FQNA 4EN3D 1KWKA 4XBEH 3KWXA 2YPLB 3CMOH 4Z7VF 1PD1A 2C4FT 5GRYA 2A0LC 4LRIA 4X98A 5EO0A 4GKSA 4Q14A 4WFFE 4AYGA 3G6DL 1MFAL 3MKGA 3QNZA 4TKWA 1OE3A 3BSZL 1RZIB 3NGBB 3D50A 4K4KA 2CHXA 3V79C 4N2EA 4XVSH 3TBWB 2KQNA 2PCFB 3UAJC 2HLFD 1T1XA 3H9SA 4ZODA 1VFBA 3PWJA 5D7JA 4XAWL 2VW7A 2XI9A 1JMXA 1AGCA 1BEXA 4ZPVB 4R7XA 1QRNA 3Q7JA 4WHTB 2VQTA 1LO2L 2NY6D 5CGYD 5KSUB 3WO3B 3HPJA 4P2YA 2UXTA 1UM6H 4M4RA 3S6CA 5CEYA 4PJ6A 2IAMC 1RUQL 3FXIC 3C5SA 3ZT7A 3IXTA 4UIKL 4HEME 4D7BA 3ARFB 4XWGL 2J73A 4R3SA 3MGOB 2EC9T 4LSTH 5I16A 2EQDA 5KVEL 2WWMC 4BQ6A 1Z5LB 1U93A 5GGUA 3ETBF 4M8UA 3FCGA 4N2HA 2D7MA 1N5YH 4MDRA 2E6JA 1FFTB 4I3GA 2AJZA 5DT1H 3ENEA 4U1LB 2Y5EA 3CXHK 1MDTA 2NY2C 3FN0H 1R24B 4OM0H 1NANI 3G9VA 4WU5A 1E4JA 3EZJB 5ESVA 3GRBA 3SE9H 4NRZA 1E9OA 2FO4A 1OB1B 5KYYB 2KERA 1SVCP 4BKLB 1I3GH 2GYSA 1GH7A 3KH3A 3BMVA 1J0HA 2GVYA 4BSJA 2XZCH 3KGSA 3L3OB 4RAUA 3RX8A 1PYWB 3A6CH 4Z8FH 3HMWH 2BWQA 3WDJA 4AIZB 1ZGLP 1OP4A 5FXCH 1RP8A 4ZMWA 1MF2H 4NX0A 3UTQA 1MSPA 1PCXA 1QASA 1NC4B 2Y24A 3RURA 1DUZA 3FSVA 3HAEH 1LO0L 1YAZA 3S3JA 3BSHA 3MCLH 5GSVA 5IMMB 2TRHA 2WZAA 3C8KB 4TYUA 5D5MB 5DJ2A 1GGCL 3CVHB 5GISL 2NY1C 2WANA 2QPFA 2WUBH 2D4FA 5C2BH 4ZX4A 3MJ8A 4KNSA 4S1RH 1IGCL 2NQDA 5L2KB 3QO1B 2WW8A 3WMQA 1X7QB 4UTAL 3D39E 1NDGA 4G9DA 4PIRF 2NY6B 4ZSOE 1V54B 4XP9L 2OMUA 3ZHKA 1JK8A 1JZ8A 1JXDA 4LRNL 2LAGB 2D4DA 2BIQA 2KHAA 5I1HH 1UQSA 4I4WB 1UCBH 2BOBA 4WV1B 3I9GH 4NQDE 2W92A 1S7QB 3DC0A 5F89A 1HDMB 1G4MA 1NL0L 3EAKA 3BZDA 4ELKB 5CN2A 2R1WB 1NBYB 3IFNH 4QI3A 3GMQB 3ABLB 5F9DC 2OMXA 1QI4A 3L3IB 3ARBD 4RFEA 1DQJA 4HCIA 4PW3A 4GS7C 2OXGA 3SDCC 4PBVC 3BXNB 1UWGL 4UQ2B 3S8FB 4KRMB 3TXAA 2R83A 3TBVA 5K9JH 2A1WL 2KDGA 3C5ZC 3GEFA 3TH3T 3RG1C 5EWIH 4WTQA 1IV8A 4ZMVA 4XPBL 1RUKL 4DP7X 2X44D 4K3JH 4WTXA 4ZUUB 5IHLB 1BYOA 2XV6B 4ONGH 4NQDA 5FCUH 5I1AA 4Y19D 4OM0L 4XCFL 2IMNA 1RIUL 3FQXB 3D6GA 3L1FA 4R4NC 3TT3L 3C2SA 1U8QB 3CG8A 4OSUL 1R34A 4QHUA 2FQGA 1R3IH 4XZ4A 1VA9A 2QZQA 3QRGH 1JD7A 5TDPB 2VLKA 5K33A 3PWPB 2G2PA 5I9QB 3BAIA 3OKNA 1I1CA 3IPBA 2ARJQ 1QQDA 2G3NA 2FK9A 3U6RA 4A7QA 5EU7E 5ES4B 5ITFA 1XBRA 1F4WH 2MSPA 4Z7WA 1E43A 1T80A 5HYJA 3PFQA 4JHVA 4Y4FB 5KTEH 2JIXA 3GD1C 2XTJC 3HNVL 1VGEH 5T1JA 4X0KB 3QUYD 3LIUA 4H2CA 3NIDF 1T7ZA 5GGVY 4JKMA 4F7PA 1FO0B 2IPUG 2IAMA 5HJBA 3F83A 3L2MA 3GRWH 3MOBH 4AMKL 1BJMA 2PYEB 5CSZA 1CDGA 3FCSB 3H4HA 3RVWC 1R3JB 1RULL 5CBAB 2Y6TE 5EDSA 4L8DB 4X6DA 5C07B 3K1KC 4XX5A 2G2RA 4AM0Q 2Q5BA 2DIJA 4AQEB 3D25B 1ZAGA 2KLSA 3STZB 1IRAY 2R2BA 1RIVH 3O41A 4LESA 1JZ6A 2D9QB 4IM8A 3D05A 3OB8A 4TV3A 3TJEH 4GINA 4JO2L 4PJ7E 4L4VA 3UAJA 4HT1L 4OIIH 4PJHF 5LNDA 2NX5B 4ENZA 3COOA 3D4GA 4RBPK 1NFDA 1AXSA 3BZEB 1JBJA 3LB6D 3G08A 3QISA 1R0AH 3IJEB 1UWGH 3M07A 3QORB 4RAHA 2CU9A 3VE0B 4ESKA 4D3CL 1M6UA 1Z0MA 1ZOXA 3N0AA 3T8XB 3TOPA 4UOW1 4QTIL 4NUJA 4JFHD 2NSXA 4XCFH 2BOCA 2V2TB 2Z1KA 3HZKB 2F8XC 1TTCA 4QTHB 5D7IE 3HRZB 2EZ0C 4QYAA 1SOKA 3ZMNA 3ZYOA 5IBTL 1PY4A 2H5UA 5KVDE 3KPMA 5FKAB 2DQCL 3B56A 4FG2A 2ERJB 4NHUB 2A73B 1JWSB 4Z7UF 2CGYA 4KXBA 3V10A 2DKMA 1LEIB 1OAUL 3GSVB 2MCPH 2NY1D 4ZX3A 4M93B 3HVNA 3QEQE 3GO1L 2DMGA 1JGDB 4Y2OB 2GCYB 4JJOA 5I1KL 3ERXA 3HPJB 1AOZA 2BSRA 4QXUH 1IAMA 3LKSB 4PLKD 1I7TB 1X5LA 3EUUA 4NNYA 1Y7VA 2OMWA 3MOBL 1S6NA 2RAMA 2EDWA 4LQFH 2J43A 4RGOH 3UTSB 2P8LB 3UTZA 2FX7L 1CUOA 5D9SB 5FO8B 3VWKB 3Q05A 2WQVA 4P5MA 3J27A 3O8XB 3UIZA 4X6CA 5ICXB 1H19A 2OR7A 5SWSA 3DUSA 1CGSL 5HI3D 4LIQL 4PJCE 3B34A 5B39G 1EH9A 4ZYKB 3OB0H 4FYTA 2QFRA 1EGJA 1NCNA 4RFOH 3FUMA 3VTMA 4BK5A 4FJZA 4TOYL 1BD2A 4N8VG 4Y4HC 5LWYL 3FCTA 4X80H 1XZ0B 3NJLA 4M62H 5CP3H 2A6IA 2VC2H 4ZTEA 4Y7OC 3V95A 3VMNA 4HGMA 4DJMA 4EVNB 2WLIB 3PNWB 2GHZA 2VB5A 3ARXA 2FE0A 4MNQA 5GRVL 3VSTA 2EACA 3X3GL 3PV7A 4QIRA 4HXBH 2H6PB 1WRFA 4DERA 1QACA 2WLLA 1QR1A 1LQBC 5FOJA 2Q9OA 2HFGL 2ZUSA 3FN9A 1SQ2N 3HUJA 3IJSB 3BRFA 1UM5L 2ZX6A 3QUZD 4HAKA 4QHLB 3S4SA 4C55A 1U8NB 1MI5A 5C3LD 1G7PB 4NJ9L 1A9EB 3SQBA 1HEHC 4P4KB 1F90L 1ZVSB 4QJ5B 2AHIA 5LBSH 2OS7A 2XN9D 4M48H 3QPQD 1U8MB 3UAFA 1ZHLB 4C47A 2QVIA 3WHE1 4J3BA 1IGYB 1ID2A 5DSCA 3F7RA 4Q9BA 3T2LA 3UO8B 3VXME 3WIHH 2KPWA 4OLWL 2R69L 3K1DA 4AQZA 1Q1JH 1UOKA 2DJMA 4X0NA 3EGXA 5T5NG 1SYSA 2APBA 3BMWA 5I6XB 4N0UE 3GK8H 1TVHB 3GXPA 4C8XA 4E36A 3T0EA 4FNSA 1OSYA 1GGBL 4OTXL 2JI1A 3O3UN 4N2CA 4ZW8A 2HH0L 1Z3GL 4HQQL 4XPHL 1TJIL 3F6LA 5E99H 3WY3A 4NQEE 3DLQR 4WI0A 2WTPA 1R33A 2F5BL 3REVA 4ES9A 5FX3A 3FT4A 3QXUA 1Z9OA 5FYLL 3ZT6A 3MV8A 3MNMA 1CXHA 1IB5A 1BFTA 1GYUA 1MWAH 5E95B 3ARFA 4FQ1H 3VG9C 5HDWA 4BFEA 4MJ5B 1JHTB 4BFIA 4PP2A 4DQAA 4L37A 2HVBA 3X1GA 1C16B 3C6LD 3WAKA 2J5LC 2ORBH 1PG7H 2C4XA 2PCPA 3CN2A 4E0RB 1KCRL 1U3HD 1X4YA 3LRLA 4ZSOB 2BSSB 3O3DB 5CXPA 4M3JA 5A3ID 3MTRA 4ZDHA 1JFHA 1FWXA 2YD4A 5BV7C 4OD2B 2D03L 2L7EA 2V9TA 4G6FB 4N20A 1KCWA 1XGUB 5E6ID 3MYJA 3UPRB 4KBPA 4BDVB 2PP9A 1EAOA 1OB1A 4PRPE 1J5CA 1CR9H 3G7TA 5C6WH 3LZNA 2WINB 5KVDL 4JDZA 4PGBB 3IGUA 2IEPA 1VDGA 2WTOA 3F6JA 3R06A 3OHXC 2NY7H 4F37F 1FO0A 2WVVB 3D9AH 1CFTA 4W4OA 3TBTB 4DH2A 2LLNA 1CCZA 5AFAA 2D9CA 3S34L 2BP8A 4MLIA 3A4AA 4J3UA 4N26A 5CGBA 4UDUA 1J0JA 1YMHA 1BLNA 2B0SH 3W3BA 1LE9A 4PCSA 1W0VB 4G3YL 5DK2B 1O6TA 4LSVL 1LEGA 3FBKA 1MAMH 2ZPKH 2DMHA 4LP8A 3A47A 4CSPA 3RU8H 3RVXC 2Q7NA 5DJYB 3DXAE 4MCZB 4W9HC 4P23D 2PWHA 5D2NE 3RLSA 3I02B 1YEEL 3KPNB 1A7RL 4DP0X 4IIZA 1YMMA 1HOCA 2H26A 3QDMD 4HUWA 4TRPH 5DRNB 4ZAKA 1YNTA 3BKYH 1OW0A 4AQ8A 3APNA 4D0CB 1KB9J 4LLVB 2YD0A 1IFRA 1FLRL 4Z0XB 5BZZA 5SX4H 3GSXA 3KPLB 4Q9CA 1RHHB 4K94C 1JUFA 4OLUH 4Z7QE 2ZUVA 2UY6B 5H35A 2JKNA 4FG4A 1FI8C 2XTSA 4LAQH 4CC1A 3P77A 1WA0X 3H3KA 4HXAL 3N85H 1HAUA 2IADB 3UYPA 3LH9A 4NCC1 2ITEA 3AG2B 2VDRB 3EDDA 3A24A 3I84A 1BFOB 2R1WA 1KZQA 2XIDA 5D7EA 5DJZA 5E4EC 1KTBA 3KL3A 4C4BA 1OF2A 1M57B 3RNQA 4KJWD 1ZKAA 2VDNH 5L4JA 4NM4H 3RKPA 1ACYL 3QJHB 3BXNA 3PGFH 2PMZA 5AD0B 1U8LB 1YYLH 5C97A 4L8CB 2ETWA 5I17B 2QZ5A 1HSBA 1QSEA 1J5OH 1U3HB 3NEOA 3SODB 1T0NB 1KJ2A 1FG2B 4GG8B 4JZJA 1L7IL 4IBVA 3KVPA 3EO0B 4E41B 4R7VA 3TEWA 2DQGH 4N2MA 1WZMA 3FH7A 1R3LB 3IS1X 5DUBA 4QDGA 4B3VA 4J6RH 4OGAD 4FXKB 1AQDB 1PZDA 4RGNC 4YWGH 1E6OL 2CGZA 4OCXH 3SJVE 2VN3A 3DSNB 3OR7A 5AENA 3B9EA 1G9HA 3MLPA 2FL5A 3OC5A 4M5SA 4HUCA 5IQNA 2WZ6A 2NUTB 2HUEA 3WFEH 4JCMA 4KKBD 5GZOD 1EJ6A 5E4OA 3KPRD 1MCWW 4NN5C 2HTLC 5CJOL 2P8LA 4JRXA 1K8DB 2GY5A 3UPCA 3LQZB 4NO0B 4XB3A 3BKCH 4FZ8H 2V8LA 4P5MB 3NBNA 3O8XA 1G7HA 5F21B 1R6VA 1S7RA 1NSNH 1IFHH 1RUAL 4MZIA 3L2LA 4JRYA 3MJ6A 1PS3A 1PW3A 2IWFA 3IN0A 3WKQA 3CZJA 1WZAA 4HKZB 3BUPA 5FKPA 1P69B 4FXLA 4K7PH 1WC7B 1YY9C 1IGML 1AGEA 1Q0YL 1ULVA 2CQVA 2VDPL 3W2DH 4XO8A 3D39B 5IHBA 4D7PA 3OAUL 3O6FA 2X1XR 5I1CH 1I7RB 1XGTB 5E2WH 4RISH 1FNHA 2ZKHL 4L0ZA 3WY1A 4EVNA 1EJOL 4YHOH 3F7PC 4P23C 1RHFA 6TAAA 1OCOB 3S37X 3U36B 2V5SA 2OI9C 4QYOB 3NIGF 1LGVA 2BNQD 3V55A 4ATTA 3BP6B 2E8ZA 3LOWA 2R0LH 2VGLM 4YSAA 3BT2H 2XWXA 1KGYE 1TXKA 3OX8A 4E9SA 4YSRA 4YHML 3Q5YA 5GS1C 2HJFB 1HHGB 2WLLB 2ZJSL 4PJGA 1OGTA 4BM7A 1JNLH 5GS3A 4BSVA 4BCXA 1XF3B 2YMXH 4OZIF 4PJEE 3IE4A 1CDCA 9CGTA 1XB8A 2OXHA 2XQ0A 4XCCH 4DVRH 3N43B 1YPZB 1ZA3B 2IFFL 5IW1B 2EIEA 2R9HD 1JVLA 2G5UA 4HAGA 4N28A 5DQJB 1JZ7A 1FFQA 3QQXA 4QTHA 4MKMA 5CZXD 2EEXA 2Y2TA 4NFDA 3DETD 4Y2LA 4Z3FA 3ZDYE 1E4HA 4LPTA 4I18C 3ULUH 2CO7B 4HS6A 1D5BA 3L9EA 3QPQC 4ZX5A 1KB5A 2XWDA 3KBHE 4KRPB 2VUKA 2JQZA 1OHQA 3GDCA 1C7TA 2ZOWA 1BQ5A 4AYDC 2X4QB 5KSAC 5ICUA 5DS8A 2CJ3A 1V5JA 2E7CA 4NERA 3VXRB 3KYAA 1LEIA 3HG3A 2XKNB 2XWEA 1G1KA 2YAHA 1DBAH 3MJ9H 4NT6A 2E59A 3TT1L 3HLKA 5KOMC 1X3DA 3ZYIA 3M7OA 2VOTA 3L4YA 4AGPA 5FAAA 1NQBA 4KXDA 3VXNB 3PIQA 4Z76A 1PD6A 1ZK5A 2D3LA 3QIBB 3L17A 1AR1C 4JG1H 2OMWB 3ZE1E 1QHOA 3HCVB 4RNRA 4LSPH 1PLBA 5LCVH 3D0LA 2BVEA 5JDJA 1P5UA 1X5GA 2X4TA 5K9OB 1LO3L 5FO8A 4XMXA 4K71B 5C0GA 2XWZA 2A4ZA 1OWWA 3B1UA 5CMAB 4X6CB 4LHQB 2PP8A 3WKPA 1WICA 4RLDA 2DLGA 4OZHB 4OLEA 2A9NL 4PJAF 3OKOB 1PY0A 3O9WD 2QQKH 5BS0D 2DY2A 4UT6H 2CNZA 1KLGA 3EFDH 5DWUL 2B59A 2FWOA 1CGYA 2IG2L 4GSQA 2H6UA 4HU2A 3FQYA 4F92B 5INCB 3DV4A 3AM8A 3GZKA 3Q1SH 4KTYA 3BT2L 3NRPA 3MYJB 3HR6A 1CK0L 1GZQB 3UPRA 3UO1L 4BELD 2R23B 4OUUA 4JM2B 2C9AA 2OMYA 5F3BB 4TNWK 1PVHA 1A7OH 1OY3B 2I25N 4JDZB 3CLFL 3WUWG 4S1QL 2MFNA 5DEZA 3BRDA 4HHGA 4Q2ZA 1OT4A 2Q7YB 4NWUL 4J3OF 2WVVA 3FU6A 4XOCA 2E75C 3H42L 1N2RB 1DJGA 5HDBE 1MPAL 4CSSA 5ISZB 4I88A 1J1PL 4F7TB 1RZKL 1CDYA 5JXEC 1BMZA 3CPUA 1N8ZB 4JQIA 5L9DH 1EHXA 3BEVB 4LSQH 5K59E 3HAEG 3WMPA 1OP5H 3N41B 2HT4D 3O4OC 5JW4M 4UAOC 5C0FA 5J06A 3VWKD 3RTQC 2AEPH 2FB4L 3PWPE 3NJJA 2V2XB 1GKEA 2KBGA 3QGVA 5EG6C 4N90D 3VG0L 3QPXH 4YDLB 2AQ2A 2DQEH 1PZCA 2WQ8A 5DZPA 2GSGA 4JANB 3IDYC 5KVFE 1G9NC 3CH1B 2WLZA 1HHHA 3FFCA 4PJDF 5KSVA 3T65A 5D93B 4HUVA 1B9KA 2VJXA 1ZT1B 3VMPA 1J5DA 1E65A 4GW1B 4O2EA 2ZOOA 1OAXH 3MGTA 3FO0H 1SN5A 2H0JA 4HC1A 4Y5YA 1TCRA 3U2IA 1WGOA 2NUPB 3VXPA 3HI6L 4ODUB 1MIMH 5FYJU 3ZO9A 5C0BE 5DF0A 3BWSA 3LEYL 4KUCD 2XRAL 4OZHF 3C5XA 4JQIL 2QQNH 4XP4H 5C0NC 5C3IA 3OF6D 2O61B 5A2CA 3CFCL 3DX4A 3QZWG 1O5PA 2WLKA 1DBMH 3NZ8A 4G7VH 1EXHA 1C8QA 4L29A 4OT1L 1CU4H 2DW5A 2NDFA 1T2QL 4IRZH 3DO7B 5GGQL 3L3HA 1GGIH 5I71C 3MRJB 2A9NH 2L7JA 3WD5H 1Y1UA 3DHUA 4IDJL 4ZMLA 3ARWA 3NZUA 2C26A 4LU5L 4NZRH 3FO2B 4IRZA 4LLQB 1TYRA 1HH6B 2BSBA 1I7UA 1ZLUH 3LB6C 1MIEH 3RJQB 4G80A 1PDKB 5DGRA 3O2VL 1RJYA 5AVZB 4U31A 5MP6H 4KNQA 1UD3A 4N8VB 1DCLA 1FZKB 3HA0A 3NH7L 3LKNB 1NIBA 4FJ6A 2ZWYA 4K7FB 4I9WD 1U8PB 3RVUD 4ZNEA 2K9FB 1FDLH 5SWZB 1IGFL 3RDTB 5GGTL 3ULVC 4IBWA 2JV6A 4NQQA 4PJXB 4PJAE 4NRYA 4DP6X 3E2HB 4KDWA 4IBZA 3WIIH 1SN2A 4LCWA 2IQ9L 2QLVB 3EKCA 3LXUX 4NPYA 2P3YA 1WD9A 4GXUM 4Z7QF 3U7WH 5EC2A 1XGQA 1DDHA 1Q1PA 1I8IB 4PWGA 3C6EA 3QFDA 1ZVHA 1VPOL 1XL6A 3AJ7A 1SF3A 2A99A 2AZUA 3ALPA 3LNHA 2CBPA 3BWAA 2N3JA 4RSVA 5D6CB 1IIIA 4Y0GA 2OZ4H 3T2NH 2O93L 2YMTA 1Q72H 4KK9C 5A6IA 1IBGL 2YRPA 3EOAA 1FVCA 2J71A 4XAWH 2J8UA 1VFBB 2IIJA 4JM2C 3KGTA 4N8UA 1BW8A 3GRGA 1DQML 4WHTA 5TGBB 4I5BA 1FA4A 3F05A 1EQWA 3SE4A 3TFBA 2D7PA 3MOAL 3F7YA 4N0YL 5F7YC 2DM4A 1THAA 5CO1A 1FE8L 4F37K 1G0DA 4JM0A 1U3YA 4ZW6A 1MFDH 1HOCB 4NPKA 1IEAB 4K55A 1W16A 3W0WE 3UX9B 3QUKB 4FEIA 4KJQC 4WO0A 4A2DA 3CDGA 1DE4B 3QDGB 2MIZA 1RHHA 4OCRL 1IM9D 3CFKB 3P2BA 4OLXL 2ESVB 4N2FA 3JTTA 3TEXA 3U0TB 1FNEB 3ES6A 4XMVA 2BY0A 4RWYH 5T1LB 2QR0B 1A3LL 5B1AB 3BQUC 5DO2D 1D5MA 1KCKA 2ZYRA 4NQDD 2RFXB 3V0WL 2CUAA 2QQLH 2Y6SC 2YD1A 1YJDC 4JLRB 1HYSC 5HTSA 2W95A 4JRXE 3D3VE 3EYOB 2D0GA 4DTGL 4JQVC 2YUWA 5JPNB 4HD5A 2YQGA 3AITA 3MUZ1 4GG8A 2DLTA 2CUIA 1ZS8B 1EHKB 3GBMH 4YDIH 4BKLA 5KVGL 1BM7A 3SKNA 3US0A 1NC4A 2VJ8A 1TITA 3GYRA 5AOJA 2L04A 5DHVH 1RU9H 5CU5A 4HIJA 4DW2L 3P3TA 1ET7A 5D5MA 4H0GA 2DN7A 4EI6B 1IAOB 4KXZI 3PYCA 1TMCB 3U2SB 4PD4K 2KZBA 1ORSA 2MOQA 3L4ZA 5I5MA 3BGMB 2PPAA 2ZOLA 3Q9QA 3A5VA 2HZHA 4PV9B 3MCKA 4GW5B 1H3UA 1IUZA 4UTAH 1NOFA 2CK0L 1C9SA 1TLMA 3AS0A 5FYKD 3IJYB 4KKRA 4CC4A 3TEZA 4I7ZC 4RIRA 2L7QA 1WO2A 1JZFA 4RRPG 1S7TB 2WKOF 4YUEH 3ZDYB 1FE8H 4ZW7A 2BY3A 4NOBA 3OKMA 1DJIA 1JV2A 3PWJB 4IOFD 3VXQB 1MCNA 4D94A 4PU2A 5ISZE 5D2NB 2VXQH 4M56A 4IOIA 3KJ6H 4HCRH 2OYKA 1HDMA 5GRXG 4N22A 5LGYA 5I1DA 4GXUN 1KC5H 5HDQH 2B1HH 4IKIA 4Y5XC 4PJGF 2WBXA 4Z7OF 2R51A 1NMCC 3L3IA 3PL6B 1TQTA 5F0PB 2WYTA 3MX0A 4KO6A 2JJSA 4NKMB 1J48A 4P2OC 2VL4A 3GMMA 2EE2A 4PJCB 3AACA 2FIKB 1KJMB 3C5SB 3V4VB 5C0EA 3HE6B 3TO4A 4ODHL 4JDEB 2W91A 5D4QA 2YD6A 4MX7B 5I0WA 3DUUB 3NEEA 1N6QL 2P4AB 3SDXE 3DJTA 3K74B 1E9PB 3CFIC 4FL4C 4CVZB 1FIGH 3RX9A 4U1LA 2V17H 2HG5A 2ZCLL 2O5YH 4QRQA 1OAKL 2YPKA 4FEMA 3NJGA 4ZRGA 3VGAB 2VLKB 2JFCA 1OLZA 3IDJA 4OLYL 3N1MC 1NUFA 5C9JA 3AADB 2JKJA 4Y4FA 1KBWA 1QVOB 5DK3A 5CM1A 2V2WB 1JCKA 5A6LA 1RUQH 4LL1A 2GY7B 3FOLB 4JM2F 4KK9D 2ZG2A 4X7FC 3SPVB 4C56B 1RXLA 1ZT4B 2I69A 1QG3A 1RPUA 4XWGH 4ZMOA 2NUPA 3VXPB 2WSPA 1ACXA 2IDCA