4YSAA

Completely oxidized structure of copper nitrite reductase from geobacillus thermodenitrificans
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 101
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysaA00
3KW8A 1L9SA 5I26A 4YSQA 1ZDSA 1AS8A 1NICA 2J57A 3UABA 4KO9A 2WO3B 3NJGA 4FAAB 2Q9OA 1OCOB 3C75A 4N8UA 4M3HA 4F7KA 1AS7A 4YSOA 1MDAA 1PF3A 1JZEA 1GS7A 2IWKA 3H4HA 1CYWA 1A8ZA 3PCYA 2IWEA 1BAWA 1JZIA 2CALA 2MTAA 4NB7A 5F7BA 4A66A 3FT0A 2A3TA 3T6XA 1KGYE 1JVLA 4BXVA 3RYMA 4E9SA 1J5DA 1JZJA 4BWTA 4F2FA 1JXFA 2CUAA 3CG8A 3D12B 1AOZA 4KOBA 5B1JA 2AANA 3NJLA 4PCYA 3WKQA 3FSWA 4YSUA 4DP7X 2UXTA 2EIJB 5PCYA 3OMIB 1GSKA 2FQEA 3ZDWA 1ASOA 1BQ5A 2OV0A 1MG2C 2CJ3A 3FYEB 4KNSA 1WAEA 4HHGA 2UX7A 4P5SA 3ZBMA 2XV3A 3BVDB 3UAEA 4W1TA 5I28A 5I5JA 2XV0A 4E9YA 1KBVA 1NWOA 4E9WA 4YVNA 2R7EB 4KOCA 2NRDA 4M4RB 4UAHA 3QJVB 2IWFA 3T6WA 3WNJA 3FPYA 2IDQA 1AANA 1QNIA 3X1EA 5EHFA 1ZIAA 4AKOA 2QPDB 2PCYA 1AAJA 1J9SA 1RCYA 2LLNA 4A2DA 4AKQA 1ASQA 1URIA 1JZHA 2I7OA 1NIBA 1WA0X 4A2GA 2X88A 3ABLB 2VSKB 2PP8A 1SFHA 1IBZA 1EZLA 2FT6A 1BXUA 2GC4C 1OCCB 2JFCA 3ERXA 1JZFA 2FWLB 1HFUA 4NERA 1OF0A 2WSDA 3QJTB 3UACA 3ZIYA 3FU8A 2UXVA 2MRYA 4DP9X 2BP0A 4FA7B 5I6PA 3SQRA 3HEIB 4A68A 2JKWA 2OJ1A 1TKWA 2XU9A 1V10A 4KNUA 1KBWA 2N0MA 1CURA 4KNTA 2YXVA 1AZUA 3H56A 1UATA 3CDZB 1BXAA 1N68A 1ILSA 1N70A 2CBPA 1PZBA 2IAAC 3NP3A 1AG6A 3FQ2A 1PY0A 4K9JA 1AR1B 3SBPA 4W9ZA 3X1NA 4E9TA 1ID2A 1QLEB 5FC9A 1L9OA 2VW4A 5I5MA 1QHQA 2J56A 4N4YB 1BEXA 3S3CB 1SHXA 2PLTA 3WNIA 1PLBA 2GI0A 3UAAA 2YQBA 4DP2X 1ILUA 1PNDA 3AG2B 3S8GB 4YL4A 2JXMA 3T6VA 3QJSB 3T9WA 3KW7A 4Q89A 4Q8BA 3UGEA 4A2EA 4G7RB 1NPJA 3NP4A 3NJHA 4HCGA 1CYXA 1L9TA 2HXAA 1J9TA 2UX6A 3MBWB 1ET8A 5A7EA 1IBYA 4YSAA 1NWPA 1OE2A 3JTBA 3FSVA 3FU7B 3PPSA 2J55A 2GBAA 1E5ZA 2PP9A 1GY1A 7PCYA 3DTUB 1A4AA 1AZRA 1AIZA 3S3BB 1CC3A 4ZK8A 4YVUA 1KCBA 1WS7A 4GXFA 6PAZA 3NSDA 2AZUA 1BXVA 1V55B 1MZYA 3NSFA 2VW7A 1L9RA 3QQXA 3N55A 5B1BB 5LDUA 4HIPA 1SDDB 1TU2A 1W6LA 3ABMB 1IUZA 2FQDA 1CUOA 2YAQA 2ZONA 2BZCA 1TEFA 1AACA 2IH9A 3EH5B 4WKXA 1KYAA 4GYBA 4HHWA 3NJIA 2AVFA 3DKHA 2YAOA 4WTQA 3S3DB 1PLCA 1SF3A 4YSRA 3X1GA 2Y1AA 4P5RA 2P80D 1OOWA 4G7QB 3NJJA 1JXDA 2HX9A 2XXGA 1W6WA 4X4KA 1PNCA 4BDVA 3CDZA 3NJMA 2B08A 2BHFA 3NYKA 4G72B 1OCZB 3H4FA 4G7SB 1EHKB 5E9NA 5D4JA 4AI7A 1ET7A 3QJUB 4AZUA 1PZCA 2TSAA 2YAPA 3FQYA 4TXVB 2IDUA 4QLWA 2ZWNA 4AX3A 2VM4A 4L0PB 4E9XA 2EIKB 1KDIA 3TBCA 1W8EA 2FQFA 1RKRA 1V54B 2H47C 2QDWA 3EHBB 4JHVA 1PZAA 4UF7C 3ASNB 2DYSB 4JKNA 2XXFA 2ZOOA 1PMYA 2CAKA 1JXGA 3V9EA 5AKRA 4GP5B 5PAZA 4E9RA 2BWIA 3ZX1A 2Q5BA 3FQ1A 4DP4X 4ENZA 2PPCA 2RACA 4BWWA 7PAZA 1BYPA 2FT7A 3EH3B 3NSYA 2XX1A 3TBBA 5I5IA 1BQKA 5B1AB 4DP1X 5TK2A 3PAUA 4YSSA 1RZQA 2BP8B 2I7SA 1WS8A 2XVBA 5I6LA 8PAZA 4JHUA 3CVCA 3X2QB 3FU7A 2HLEB 4QKTA 4BXSV 2QT6A 4A2HA 2E86A 1IKOP 5AZUA 4DPAX 2YAMA 3OMNB 2W8CA 3ASOB 1GY2A 1AZNA 1M9WA 2BWDA 3WI9A 4PAZA 1KDJA 1SHWA 2PP7A 1B3IA 4E9QA 1NIFA 4NAJA 2YXWA 4HCIA 2XUWA 4DPBX 1FA4A 2BO0A 2FNWA 2AFNA 2UXFA 3FPXA 3S8FB 3FU9A 2X87A 5I6KA 2Y69B 1X9UA 3WG7B 1AZBA 1PAZA 2GC7C 1GR7A 1A3ZA 1M56B 3DIVA 3MX0B 3NSCA 2R7EA 5D4HA 2P80A 4KO7A 4YSDA 3SBQA 1MZZA 1ET5A 2BP0B 2QDVA 2PPFA 2EILB 3QPKA 2WO2B 5I6NA 2HRGA 4E9VA 3AZUA 3WKPA 2VMJA 1PCSA 4DP8X 1JVOA 2HX7A 2H5UA 3AG1B 2VM3A 3OM3B 4G71B 1ZDQA 1XB3A 1HAUA 4GP8B 4YSCA 2ZXWB 1I53A 3EF4A 2TSBA 3AY2A 2CCWA 3QJQB 4DP0X 1GS8A 3PAZA 5B1JC 3CVBA 4HAKA 4G70B 2OCCB 1SJMA 3ABKB 1XMEB 3GXUB 3PLYA 1DYZA 4BWUA 4BK5C 3X1BA 1SF5A 2YAHA 1A65A 4CSPA 1TEGA 2XV2A 1J5CA 4A2FA 1VLXA 2HZHA 2UXGA 1J9QA 3IE9A 3PAVA 2BP8A 1OE3A 1PLAA 2FTAA 2I85A 2PPDA 1HAWA 1SNRA 2W88A 1XB6A 2DWSA 1XB8A 3IN2A 3NT0A 1NPNA 1E5YA 2BW4A 9PCYA 3IBOA 1OV8A 2GSMB 1GYCA 2BZ7A 1ZPUA 1BYOA 4HALA 5TK4A 2FQGA 1AZCA 3AG4B 4EF3A 4F2EA 1ADWA 1E30A 1NIEA 2AZAA 2GHZA 2FJSA 1AQ8A 2H3XC 1YLBB 2DY2A 1A4CA 1F56A 1FFTB 3FSAA 4MFHA 5ANHA 4KO5A 2HRHA 2PPAA 2BW5A 3EH4B 2EIMB 1KCWA 1KV7A 2XYBA 3N2JA 2GIMA 1FWXA 1NIDA 5B1KA 1OCRB 1L9QA 1J9RA 1R1CA 1T5KA 4KO6A 3JT2A 5B7EA 3CVDA 2YARA 3GDCA 5D4IA 3TU6A 4YSPA 3FSZA 4GY4A 2DYRB 2VN3A 1M57B 1GW0A 3HB3B 1AS6A 4DP6X 2YAEA 1NTDA 3OD3A 5I6OA 1ZIBA 3OMAB 3AG3B 3IEAA 3NJNA 3OQRA 3V9CA 1L9PA 2IH8A 1WA1X 4UANA 3WIAA 4DPCX 5B7FA 1ZV2A 2J5WA 5B3SB 5F7AA 2FT8A 3QJRB 3TA4D 2IDTA 4AKPA 3L45A 1JOIA 1NINA 1AG0A 1NIAA 1SFDA 1DZ0A 1X9RA 2PPEA 1GS6X 4BDVB 3T71A 3IN0A 2EINB 1SDDA 3U25A 1NDTA 5B7MA 1MG3C 3FS9A 2DV6A 3GYRA 1ASPA 3AW5A 5IY5B 3NJFA 2PCFA 2VSMB 3NJKA 2HX8A 4GP4B 1WA2X 4CSZA 4DP5X 1ETJA 1NZRA 2GB2A 1BQRA 2DWTA 2QPEB 2B3IA 1RZPA 3G5WA 4YSEA 2IDSA 5I6MA 3SBRA 1IC0A 4YSTA 1A4BA 1OE1A 5AFAA 1JZGA 3PXLA 2IDFA 3X1FA 1E67A 1E65A 1JERA 3BQVA 3T6ZA 2XWZA 2YAFA 2VW6A 3UADA 3CZUB 4HCFA 2XLLA 6PCYA 4RH4A 3ABGA 4HZ1A 4A67A 3FYIB 2XX0A 3TASA
chains in the Genus database with same CATH superfamily
3HE7D 4FFZA 4JGMA 4J3OD 3FQNA 4BSWB 3C60A 2DQIH 4JY5L 4JFOB 4ZTEA 1BZ9A 5T5NG 4I3RL 4CJ0A 1IGTA 2N0KA 3H2QA 3MRMA 2O5NA 2XWCA 3J2PA 4YSOA 1XCQB 1A8ZA 2XXCB 1T6VN 1CCZA 1FL3B 5EU6E 4K8RL 3P3YA 5FOBB 4H1LB 4F91B 5CEYB 4JDEB 1AOHA 3SB3A 2VDLL 3P9LB 1NUDA 5EO0A 1ZANH 2AANA 4M29A 5AOKA 1OARH 1R3LA 4MXWL 4PSPA 3VFTB 2K7QA 5JDJA 5EU6B 3PWJB 1A6TA 2AQTA 2VTFA 3MUZ1 3MRFB 4FNLL 3KBPA 3FTUA 2YIHA 4U6XB 4Z7UE 3FYEB 1NCOA 3N9GH 1E27A 2WLZA 2NX5E 4JG1H 3ZBMA 4JN1H 3SE8H 3WAJA 1FYTE 4KAQL 2DWYA 4Y7OC 1UB6A 4Y4KB 2MIZA 2WLLA 4QRSA 3WXVH 4R5VA 4Z5RB 4XVTH 3V4LA 4Z7UB 5EU5A 4NQDE 4X42A 3OLIA 1XR9A 1IFHH 2NX5B 3RDJA 1ZSDB 3MRPB 1PYWB 4R4BA 3VD0A 3N1FC 4JRXA 1JUFA 1R3HB 2VWEC 3VXUA 4G7YH 4XVUC 1IM3A 3OF6D 3CV5A 4FJYA 4WLCA 3BUTA 5LGKA 2F0CA 3ROOB 4M5YL 1DVSA 4NBYB 3S6CA 2UVFA 1EMTH 3RUGA 2AEIT 4QR7A 4TUJA 4Y1AD 1J5OL 3HZVA 1G9HA 4GG6E 3ULUE 3TYFA 2G3XA 5DEJA 3O3AA 4JG5A 5EIIA 2MRYA 4DP9X 2Z93B 2W59A 3M7OA 2VAAB 1U2YA 5LG6A 5CCGE 2X0UA 3ARGA 3OKNA 1CXIA 3DX7B 1CJYA 1HSBB 1MCBA 2ENPA 3DGGA 3NFSH 4AYGA 2VRAA 1EVUA 1TKWA 3BP5B 4K7FB 3K6FA 4X8GA 3ARZA 1HCFX 1TJMA 4HJ0C 2IAMD 2CO1A 4GRWB 4NYLB 2LVEA 4NO5B 1QO3A 2CDEA 4N6RA 3SGEI 4J5VA 3GJFK 3PU7A 3QCTL 1J10A 5DDHA 2X0WA 2QLVB 5A16A 4E0RA 4WFFD 3VXSA 5T3ZD 5E1AB 3MZTA 4W4OC 4A7TA 2F58L 4MYPA 2C1OA 4LCYB 3RAJL 3ARBC 1SLXA 4XN9A 3HC0B 4HV8B 3HG3A 5HJDA 4I4WB 5C7XL 1MNUH 2CLRB 3UZEC 1TPXC 1QHQA 3GSVA 4WWKB 2J56A 1XMWA 4AJ0A 2O5YL 3LEYL 4KXZH 2K78A 3RDTD 2DI7A 4P57A 5DMKA 5EZJA 5CZXD 2CHXA 4M6AA 4LK4A 5DVPA 4CGUB 1PQZA 4IRJB 3NG5A 4KKPA 5HI4C 2O6FA 4L9DA 2O5ZL 2AQ1A 3KW7A 4L8BB 3RJDA 5L6YL 2V37A 2A4CA 4HIEB 3KXFE 4MBRA 3T0WA 4DZ8A 4LSQH 3JXAA 4QXTB 4D2NA 3CH8A 4ZODA 4RIRB 1CBVH 3QHZH 4ICXA 1IEBB 4I0KA 2CIIB 4X80H 4DOHB 4NLHA 3KXFB 5DHXB 1EA9C 1RUAH 2XWJB 2WCSA 1NWPA 5ILTH 2C4FU 5A43C 2EDNA 2PP9A 5T1DL 2EDDA 2OMXB 5J9PA 1A4AA 3DXAD 2D9QB 3ARWA 3TV3L 4XP9L 3BO8B 1MW1A 3SJVE 3ZQWA 6PAZA 1JV2B 2DMKA 1KOAA 3X14B 1XF2A 3B6SA 4K7PY 4LVNB 3FT4A 2Y6TE 5DYOB 4B6ZA 4B0MB 1I4FB 3VCLA 4LPUA 3MYJB 3I85A 3NFNB 3ZE1F 3MOBH 4QRRD 3QBTB 2ITFA 2ARJQ 1F6AB 5SV4A 5ACZB 3OAUL 2NY0D 2CNZA 2GITB 1TJHL 4WUUA 5HHQB 3MV7A 2RD0A 2ZUTA 3LIZH 4FFWD 1KCVL 4IMKA 1KGXA 3DHPA 3F7YB 3NJIA 4U1KA 2J4WL 3L95B 4WGWB 1UWFA 1Q0EA 5ABDE 3JWNH 5LBVA 1JDAA 3QRGH 2P80D 2CLZA 1OD9A 1JYXA 2H3KA 4LKCA 1W6WA 5FR3A 2AQ3A 5L8LB 1KB9K 4JFVA 3CDZA 3NJMA 5CCHE 3HPJB 1W0YT 2IDCA 3NYKA 4N2AA 3DLQR 1S7QA 5FYKH 3GBEA 3APCA 4S1DC 1SEQL 3KPRE 3T8MA 1QI5A 3IDIB 4EUPA 2VDOB 2YBRB 4IKIA 4PP1C 1M9SA 4F8NA 2P8PA 4DQOH 3EFFA 4PTUA 4PGCA 3MCLH 3BKYH 1Q1JL 3CH1B 3KPRB 2H6PB 4MVBC 5FA4A 5BQDA 4AX3A 4N86A 4EKJA 5KVFE 4HK0B 1JZ7A 2R51A 3NZ8A 4NRXB 4XMLH 4JFDB 3TBTB 5J06A 3WTXA 3G5VB 4MQ7A 5I6XB 4MAYA 4OZGF 3VWJC 1Q9OB 1DQJB 1RZJL 4R96B 1RIVH 4OUUA 4QHUA 5IB2B 4N90D 4NQCD 5JQ6L 1GCFA 2WLKA 2H26A 4FEMA 2RFXA 3DX8A 5IB4A 3TF4A 4E9RA 3FFOA 3EGDA 5JW3L 2IOOA 3NRQA 4KVNH 4Z1PA 3V7AG 5IVXB 4KTDL 5K59F 2ZXDA 5IVXA 3L3GB 2DBLL 4CMHC 2CCVA 1JPGA 2D2CC 2NY3B 2B59B 3ZTJH 3ATBA 2ED7A 2I7SA 3Q5TA 1CG9B 3QWNA 4KRMB 5LVEA 5F89A 3BD3A 1TCRA 1KN4H 4XC1H 1F90L 4UIMB 2Y06H 2EDHA 4OLEA 3C5JB 4ABQA 4WHYG 1IMHC 2G9KA 4XPHL 2GUOA 3IGAB 3BIAX 3FBKA 1H0DA 4J3OH 4WW1A 1F58L 4NJAL 4JK0D 1ACZA 1I3RB 3DX1A 3QCUH 1S7SB 1CLOL 3EGXB 4PAZA 5D96B 1THAA 3GMNB 1DBJL 2WYTA 2YXWA 3QI9B 4QY8B 1JCVA 3FO2A 4NP4H 4ZW6A 3D2UB 2CDFB 5CMAB 1K2DB 4XHJD 1W8NA 5D5ME 4D8OA 1VSCA 1WYJA 1S7TA 2QQQA 5KAQF 2ZIDA 5I19H 3IGFA 3DIFA 4MXVF 4BUQA 3Q6GL 2WXQA 5B38G 4PUBH 5D5MB 3HI6L 1UUSA 2X4NA 3OWEA 3APDA 5IIEB 1RV6X 4GAGL 3KL5A 2FX8H 2R29A 3T3PE 1QI3A 4X6FA 3AMKA 3Q05A 5TE6H 5INCB 2W9EH 4GRLA 3HOGA 3WNNA 3H6AA 2Z1PA 5DQ9B 2V3DA 3T3PB 4KKCD 3PL6C 2VMJA 4ODVH 2L0DA 5BJTB 5HI5D 1JFQL 1ESOA 3SDAC 3CAFA 5F1SA 5HDBF 5JYMA 1LO5A 3OAZH 4GEJA 4POYA 1Y07A 5KSUB 2YKLL 2XQYG 3GI9L 4R5TA 1AKJA 4QF1A 1HAUA 3VFMA 4BA8A 2FAUA 2EXTA 5DD6A 1SBSH 3QNZB 4ADGA 2W94A 5LHDA 4MWFA 1HT6A 1P2CB 3SDXE 2CCLA 1U6AL 3ULUL 4QXVA 4G7VH 4UV4L 3TBSA 3PLYA 3K71B 3GXUB 4YDKL 5IEKA 2LGNA 3IMUA 3VX0A 5F8QC 1WICA 4FEIA 5FYJL 4JNXA 2FH8A 4JQVC 4I88A 4NZUL 1X44A 3NIDE 2DLTA 3QORA 4ZFFB 1JZ8A 1VLXA 3PV6B 4I2XB 3O3EB 4ELME 5IESH 4X99B 2UXGA 5JIHA 1E6OH 1OP4A 2WCGA 2AK4A 2EE6A 4LPTA 2ZZUT 1L6PA 4XB8A 2AV7A 4HSAC 4AQOA 2FWOA 4G8FB 3QDJA 1L5GA 2CRIA 4DZBA 2ROYA 3UEQA 3CHXA 4ELMB 2D4DA 3T8XB 3MTXA 3V7AE 4JZJC 1UD3A 2PW2B 2IADA 5DJDA 5K39B 4FI6A 5CWSB 1IM9A 5HGHA 5T3ZH 4ATWA 4EI5D 4HUXB 1YRKA 2FJSA 2OI9B 5DEFB 4JVWA 5ESQA 1KJ3L 3FK3A 5EN3A 3C8DA 2CRYA 4OLZL 4ES8A 4KJPD 4ZNEE 4N0UA 1JZ4A 3EJTA 5L4FA 4Y9BA 1FG9C 1LMKA 4DOHE 1FWXA 4MCYA 1PIGA 3B34A 3V6FB 4OJAA 1CTOA 3D85D 3ZN6A 4RRPM 3JTTB 4ERSL 1N4XL 2H0FA 8CGTA 4PLKD 5GRWA 2NW2B 3PHSA 5CU9A 3S3JA 4K3EH 2ERJB 5A3ID 1NPUA 3LKSB 1KY7A 4ZRGA 4KTGA 5JUEL 2ZCHL 5DMGD 3CX5K 4DERA 3FU3A 5C0BD 5K1NA 3ES6B 4HS3B 2UVEA 4LARL 1L9PA 5FF6B 1EXUB 1M71B 2P43B 5DJ8A 5D8JH 1PL3A 5EWIH 5B7FA 4LT7A 4QO1B 3RX9A 5AB2A 5CUSL 4U7KA 1DZBA 3GRBA 4WJG3 5TDOB 2CO7A 1BAFH 3T2PA 3SYAA 1MEXH 2AEPL 1HKFA 3FFCE 3LZOA 1UKTA 4YPGA 1OCWL 4CRPA 2NDFA 4G80A 4S10A 4O9HL 4BDVB 3F62A 2YD1A 2D0HA 5B38B 4B5ZA 1ZTXH 1G5AA 3MKKA 1UQSA 4WFHD 5T1KB 1J0KA 3JVFC 3PDDA 3UZVB 4NRYA 4OIFA 3BQUD 4C4KT 3B2DC 4PV8A 1B9KA 3T4AA 2Y5QA 5KAQG 1INEL 5DQJB 3GS0A 4POZC 1G9EA 5DFVC 3QQ3A 3F7LA 4PRHD 2OLDA 2NY7H 3R06B 4H8WC 3GSRB 5SX4I 1PJWA 4HPYH 3GSWB 1QBBA 1P5UB 2JKNA 1IJ9A 4PRAB 4YHKH 3S35L 2ESVA 1B6DA 5J3HD 5EO9B 1K9TA 2Y24A 4RFNC 3ZE1B 4GW5B 3RI5F 3O3BA 2C3HA 4NQSA 2VDOL 4IOIB 1FRGH 1BM3H 3BVNB 1UWXK 1E65A 1L7IL 2WP3O 3FCSA 5JIDA 1OTTD 2CO2A 3B9AA 3ZPDA 4TUOA 5SWZE 4PJGF 2KERA 2AGJL 4AWJC 1PDKB 4WO4A 2JJTC 4RH4A 4MZRA 2V0AA 3NDYE 1XBDA 4FA8A 2HAZA 3HB3C 3L4WA 4ZS6D 2DDQL 5F21B 5KVFL 3BDYH 1GKEA 5C70A 4AYEC 2EEAA 3NK4A 3RFZA 1P69B 1OCOB 3C75A 3HUJE 1KB3A 2OSYA 5JW4N 1KELH 3PQYB 2Q86B 1TTAA 1GC1C 1Y6MR 2OJEA 4JUSA 5FCSH 3PCYA 1R5VB 2IWEA 1NCDL 4FQQB 4PJ7F 3MV11 2SEBA 3EZJB 4LASL 4LHUG 2WKLA 4JQIH 3DPDA 2Z7YA 4XX1E 4F2FA 4RMWA 5FHBH 1QSFA 2XG4A 1FIGH 2BXZA 4IRSB 5JW4Q 1IEHA 3ME0A 4QOKD 3PG2A 1UA7A 3LJ3A 2Y1ZA 3EJUA 1WAEA 2Y3NA 4P5SA 3L6FB 2FYYB 4E9YA 2BSSB 2DM4A 4Y2LA 4UAHA 3WNJA 1EAPA 5K5YA 5C6TL 2ENJA 3T0AA 1J0ZA 4CC4A 2FZ3B 3K6SA 3K5SA 3QUYC 1ORSA 4G8GD 4IBTA 4JKPL 3VSVA 4AQ1C 5E1QA 3TEUA 4A55A 5JXAH 15C8H 4ALAL 5BNXD 4BFBD 2I7OA 1WA0X 3CTTA 1LNUA 2FH6A 3FUNA 5LXVA 3AAZA 4X9BA 1Y7VA 2V5SA 4R2GC 3BFOA 1NEZA 2XC8A 4CN6A 1E7UA 1WJ3A 2CDGB 5SWQB 3HG1A 4FCAA 1DSFL 3OXSB 4IIQB 4J4PA 5ADOL 1NOAA 3QEUA 5HVFB 3NA4A 1TYEB 5CP3A 1PZ3A 1QATA 1RZFH 3ZGHA 9CGTA 2XT1B 2EAEA 4C57C 4UQCA 3LQAC 3ARED 1N5AB 3M8OL 4PG9B 3ZSTA 3B7RL 5D1XD 1I8UA 3EUDA 2OJ1A 5H94B 1SMOA 1JBJA 1KIUA 1KLGA 4IOSA 2G0LA 2WWNA 3RHWF 5E08H 1HYSC 4G9FB 1JPFB 4XPTL 4NJ9L 1R24B 3F8UB 1UATA 1BXAA 4DFHA 4M61B 1NDMB 2VDRL 5FGCE 1QBLH 2AMUA 3GXPA 4A38A 5KBKA 4HBCH 5IB5B 5DS8A 1YA5A 3GZOA 1BJ1J 3FQ2A 4Q9QL 2YLHA 3BUYB 1PG7L 4NUJB 1FAIL 4YWGH 5FGCB 1XCQA 4AGOA 1E5UI 1CXKA 1L9OA 2VW4A 4K3DH 3ARFD 3VU2A 3MLVL 3VRLF 1VA9A 3QPXH 1KG0B 1FL3A 3PWNB 4NC1E 5IQ7L 1XBRA 3MRLB 4H1LA 1P1ZB 2Q76A 5CEYA 3CQQA 5JPMB 3T77B 4IS6B 5J8OA 5EIQA 3QG6B 5FUCC 1OAZH 3P9LA 2J1WA 1HHKB 1PNDA 2DIJA 4FG4A 5EU6A 4RMTA 4QAWA 3UYRH 1XCWA 3IM1A 4IKNA 3AJ7A 4U6XA 5I82A 3U46A 5T1LD 1A1MA 2A9ML 3Q0HA 4YHIB 4HOXA 1VIWA 3QO1A 1NPJA 1MLCB 2VSCA 4Z5RA 1EEQA 1V8HA 1YZZA 3MBWB 3QJOA 4Z7UA 5I1IH 4EN3D 3B7UX 4HZLB 3MHZA 2IALB 2NX5A 5EC2B 5ID0B 1NC4A 1PYWA 3ZDYF 1CL7H 5HHXL 1FYTA 1A6ZB 3C60C 5CIPH 1R3HA 1E5ZA 1GY1A 5HHVL 5E4IA 7PCYA 2AERT 3FMGH 3IDMB 3IRZA 1AIZA 3AU0A 4NQDA 3ZO0A 4D7PA 1JHKL 4LSVL 3HAEB 5FFOA 3EBAA 3KR3L 1JJUA 1FGVL 4B27A 4KJYB 4HS8L 2H32B 3RILA 1SEBB 4TL4A 2NY2D 1EFXB 5K33A 4M8UA 2HVBA 1M7IB 3PREA 2EDOA 5HDQL 3O4LD 2AV1B 3IRPX 3S36L 1XO8A 4OCWL 5KVEH 5TQ2H 5KZCB 1UM5L 4LCWB 2YEZB 2VAAA 3O0RL 4FG6D 1UOWA 4PGBA 5F0LB 3BYYA 4UCFA 5GRUL 3O6FC 1HDMA 4GG6A 3DX7A 3NUKA 1HSBA 1KB5H 2Q8AH 4BQBA 4K7FA 4M7LH 1SF3A 1XV8A 4NOBA 2VZUA 3DHMA 3B56A 2FX7H 3H3BC 4NYLA 4A63A 2AW2A 3IXTB 1OEZW 4GAAA 2G30A 3R8BB 2F74A 1SOQA 1GGYA 3V7MA 1KTRL 4Y89A 3II3A 5KYYA 1HEHC 5E1AA 3LS4H 1ZHNB 3FF7A 5E9DD 2P48B 3PHQB 4Z7NB 1E4WL 2W0PA 3OVUB 1KCSH 3HC0A 2L7UA 3VG0L 2YMTA 3VXPA 1KIQA 1OSYA 4KPHH 4WWKA 1B88A 1B0GB 4ODSH 4PLJC 5AW9B 4UDTA 3W39B 1MRDL 1DO6A 5D7JD 1YSOA 4IOFC 2WXGA 3PABB 3HN5A 5D1QC 3SGKA 2J88L 2QDWA 4M8RA 4DETA 1RK1B 2ZX8A 3VSQA 5I8OH 2O6PA 1OHQA 4MAZA 4ANWA 4IRJA 2EKJA 3POHA 5LCVA 3FOLB 5IF0B 2JWYA 5BZZA 5IG7A 2A6IB 4L8BA 2DQFB 1UACL 1FZKB 4HIEA 32C2B 3WO3B 2Q1EA 2A9NL 2KT6A 5DRNA 3KPOB 3EDEA 1XF4A 2X4TB 3GTNA 1MWAB 1UH4A 2AQQA 2P5EB 5TK2A 3DO7A 1EO8H 4M1CC 3MRJA 1Z5HA 1IEBA 1RLWA 2CIIA 3TJHD 3U4EB 4XMWA 3KXFA 3U4BH 2DD8L 1KXHA 2IFFH 5DJAB 3BAXA 2CZNA 1V3LA 1CDIA 3WN5B 1ZOXA 2JB6B 2A6KB 2W07B 2OMXA 1JNJA 1NANI 2NQCA 3PGFH 2I25N 3BO8A 1CLVA 2X4RA 3D07A 3QQ9D 1JV2A 4P59H 4PCSA 4WHTB 2OMBA 3L5JA 3WXWH 4YHYC 4TTGA 4L5FE 5DYOA 5GS0L 4PJGB 1I4FA 4KZEL 4U6HB 1KDJA 4NFBA 3MYJA 2F53E 1YEKL 2E7MA 3SJVA 1C5BH 3STZA 1FLRH 4HCIA 1F1GA 4B9PA 2WKOA 5ACZA 2XI9A 3ARPA 2GITA 1NCWL 1NOFA 1CBJA 1JMXA 1QWUA 2F53B 2N7BA 3DUSB 4NCDA 5KVGH 3KYMB 5E6IB 2H3NB 4PJ7E 5J4MA 2DQDH 1I7ZB 2FJGA 2DJSA 3B83A 3QEGL 3UBXG 3DX0A 5GS1A 3JVGC 5JW5A 1R47A 4CDGC 1BVZA 4MD0A 4PJ7B 3MX0B 3EZ8A 3CSPA 2Y1VA 4PY7B 4AV4A 2FR4A 4DO6A 3TEZA 2BJMH 2BVPB 2DQGL 3RGVD 2VUOA 4P2RB 3OX8B 2IO5A 2BOCB 2EILB 3IDIA 5FW8A 1Y18B 2YBRA 1JHTB 1BBDL 4Z0XA 3V10A 2MNJB 4GS7C 4UNUA 5EPMA 1KV3A 1VESA 4NNXB 4KV5F 4ZXBA 1WE5A 3FXIC 3KPRA 1SN5A 2LU3A 4XCFL 1GYUA 1HHIA 1MCWM 4HK0A 4GRMB 1EAOA 3TBTA 1QKZL 3ZTNL 1QNZL 1NCBL 1SVCP 4N2KA 4UYQA 4DGYL 4OAWA 1DUZB 1IC7H 3VFUB 1I8LC 1AQDA 1WH0A 1Q9OA 3AS3A 4L4TE 5E0QA 5IB2A 4GBXD 3RKPA 2EUZA 1UD4A 3V0VB 1RUKL 1IGFL 2XZAH 4UYPA 4P2OB 5AZ2H 2Z35A 1DYZA 1CLZL 2LFEA 4X98B 4DVRL 1MFCH 1ZS8B 4YLQT 4BFFA 4L4TB 2YAHA 2F19H 2PCPB 4CMMA 1VZGA 2QGEA 5LDSA 3U7WL 3FUIA 2B59A 3RVWD 3C87A 3LDBC 2XN1A 2YRBA 4HUNB 1G9NL 5LGYA 1ADQA 2LHAA 2ICES 5M95B 4O2CB 1NEPA 1JRHH 1FGNL 2JKXA 2WNXA 4ODUA 5J1SC 1ETA1 1GYCA 2DWEB 2MTPA 1I7RA 2XBDA 4MZIA 1PSKH 3IGAA 3W9DA 3WD5L 5FWRA 3SDCB 5DJYB 1FNLA 3WFCH 5F7EL 1Y1DA 1S7SA 3EGXA 4L3ED 1HHHB 5CNHA 2HLFC 2MSPA 2YO3A 3FSAA 1TDQA 5ANHA 3F58L 2EDWA 4DGIL 2IBZX 4QY8A 3CZFA 4FABL 1KCWA 4UNIA 4YFLI 3D2UA 2LR4A 3DYPA 2LE9A 1K2DA 2OCJA 3FUFA 3UBHA 5B1KA 4X6BB 2C4FT 3D33A 1HQRA 1YY9C 4KXAA 3VRLE 3ZE2F 3SO3B 4N3UA 4N9OB 1RAMA 1NAMB 3PNRB 5D5MA 5TE4L 2R2BB 4UMSA 5B21A 4KXCA 5IIEA 2LU5A 1NTDA 3WL9A 2JF1A 3F5WB 4XE5B 4HWEH 5I6OA 3IEAA 1XF1A 3GMMB 4TSAL 5INCA 4UTBL 2LTQC 4YFLF 2OKMA 1IQWL 2CMRH 1WA1X 3WIAA 2C34A 2JQAA 5DQ9A 3GM0A 2DH2A 2B39A 1MFBH 5BJTA 2CBQA 3B5HA 3I9AA 1IL1A 3KPSE 1MAJA 5D7IE 1IBFA 3IWUA 1E2WA 2KDYA 1IFRA 4OCSL 1D7CA 4LO9A 4KKQA 1AG0A 1FLTX 3EFDL 4NHUB 3V4VL 3ZDYE 3SKNB 2ZOLB 3KPSB 3QNZA 3BGFC 1NDTA 2D8KA 3WJLA 2OZ4A 1MG3C 1E28B 2BH0A 4N2EA 1GGUA 4UBDC 3ZDYB 3NJFA 1X5XA 3ABZA 3CVHH 5JNYB 3H3PL 2HJLB 3K71A 1IQDB 3L4VA 5GPRA 3VGAB 4RGNB 4L4VE 3VD1A 4GO9A 5C3LD 3SDXA 2A38A 4UI2A 1J0YA 1ZLWK 4ZFFA 1NCIA 4KUCD 4EXKA 2R1WB 3G9AB 4FQXD 4L4VB 5L88L 5E8DL 3D5OF 3JWOC 3NZSA 1I31A 3RY6C 1JZGA 3QXDB 4GJTB 2A1WH 4MMYB 1EPFA 2RCSL 4M9OA 4X5QA 2EC8A 2ATPB 2PR4H 4ELMA 3UMTA 2XN9E 2J8UF 5BS0D 2XWZA 4Y4FD 3KCWA 4K15A 3HHSA 4LFHD 2PW2A 2Q6WA 3W81A 4YC2B 1UA6L 4HUXA 4JRWA 2BRQA 3ZKMD 1EDYA 4QRPB 2XN9B 3BESR 3LD8C 5DEFA 1Z66A 3BP6B 4P8QA 4HWBH 3S35X 2EH8H 3HE7B 1HWWA 1AXSB 2VN7A 1K3ZA 1CIDA 2HRLA 4U7MA 3DOSB 4JX0A 2NZ9D 1Q38A 4XP1H 1G0DA 5CGBA 1PF3A 1W0VB 3V6FA 3ZL4H 3QUZD 1ZANL 4NCC2 4ZNEA 5DS2A 2RGSA 3B2VL 4J3TA 1MWAL 3WBDA 3GHBH 5F7BA 4YHZL 1T0PB 1CXFA 1Z0MA 5HGBA 3D0AA 3C8KB 3QORC 3N9GL 3BZ4B 4BGDA 3MRNB 1M7XA 4KOBA 2R0WL 2ZP9A 3WKQA 1UEMA 3KLHC 2EIJB 3O6MH 1M71A 5DCCA 2LLGA 5DD1L 1C5DB 2VQ4A 4C4BA 5DLMH 1XF3A 5MP6L 5TDOA 1U9KA 3GSXB 1YECH 2XVKA 5DSCA 1G1KA 3ZKND 3X13B 4ES9A 4KROC 5BPPA 2QTVA 3LNGA 1IE4A 4OCMC 3HJ0A 4QD2E 1QLEH 5I0ZA 1MREH 4L5FL 1CVSC 3K2IA 1LEKA 5EUKB 3LAFA 3FFCA 4KY1H 3UZVA 1E0OB 1A6AB 3MLRH 1VZIA 4P5TC 5T1KA 3H53A 3TO4A 1L7TH 1M7DB 1YEJH 5EIVA 3UJIL 2E7LA 1BVLB 1DDHA 2V5MA 4KTEH 1BZEA 4Y1AE 3KJ6L 3VXTB 4JO4L 3GSRA 1SFHA 2BMKA 1A6WH 4M8QA 2GC4C 1TFPA 1JTTA 2VL4A 4F15B 4J3SA 1E9OB 4OW6A 5DJ0A 3HS0B 2ZOKB 1DVTA 4GW5A 3THMH 1G7LB 4XMTA 5KBDA 5GGTL 4XNYH 3L2LA 3CSTA 5J13C 5JYLA 4IOIA 3QZPA 4XMUA 4FNSA 3MR9B 1KBBA 2BVOA 2J71A 2XRAH 5B39G 4Q2ZB 1KUMA 5DS1A 1JGVH 5KN5A 4ELKA 3BWZA 4PHXA 4RDBA 2R27A 3CHPA 3P0VL 4WFFE 5T3ZE 1MNUL 1EEYA 3N43F 5FO7A 1BJ8A 4KKZA 3D09A 2YRPA 3MREB 1F3DH 3AQDA 3BN9D 1N70A 2EDMA 1AXTH 4PJDE 4OUOA 1U8NA 2DIBA 4ZX6A 4MMXC 3QUXA 1ZGLM 2IAAC 2YEQA 4XMPL 4K9JA 3RVUC 2E4TA 5DGQA 4B9CA 1KZQA 3FQUB 1ZV5A 1TVHB 5GGRY 5FC9A 1VFBA 2Q86A 2HVJA 4AVHA 5FUOL 2XPGB 4FQQA 1NLDH 1GZPB 2FX9H 4RRPG 3HUJA 5EDSA 4HEME 4JHWH 3OMZA 3IDUA 1T4WA 1YNLH 5F8RC 2A74C 4PS7A 3S5LG 1T7XA 4WSKA 3QRLA 3QHZL 4PCKA 4X80L 3SZKC 5ALCL 2HRPH 1MJ7H 1PG7X 1SM3L 5KSAB 5CD3A 3QDGE 4ZFOA 1B4JH 4H0GA 2BSSA 4Q6YA 3CZKA 4WO4C 1IGMH 2NY6C 1CICB 4F7TB 3IDXL 2E3VA 4OF3A 3VD2A 3QDGB 3QZOA 4FMVA 5DD3L 1CFSB 3DXAE 5I2IA 3EG9B 4XR8C 3JTBA 4J2QA 3IDNB 3UXFA 2C5DC 1ZTXE 3DBXA 5DFTA 2FSDA 3Q2VA 3RNKB 3UPAA 2C3GA 3RG1C 4OD3H 4BZ2H 2E9WA 3UC2A 4KUZH 1NAML 1JGUH 4QRRE 2RAMA 4P23C 4PJCF 4UOZA 5IBUG 3JWDC 3HG5A 4MGXA 3ATFA 3LIZL 2O6DA 4PJ9C 3OXSA 4RGMB 5B1BB 4IIQA 4HPOH 5LDUA 3L5IA 3M07A 1K4DA 4Y2NA 3ZE2E 5C2UB 5I1DB 1DVFD 3MCG1 3ETSA 3BAIA 1T7YA 5ISZD 2IH9A 4CILA 1N5AA 4NIYE 2PCFB 4FFYL 4GYBA 4PG9A 4WKXA 4X2UA 1N67A 1J8RA 5D9SB 3C6LB 3CPLA 4GINA 3ZE2B 5IT2L 4I18B 1FFPB 2DYPD 2VXTH 3A0OA 1SXSA 5DJZB 4AEHL 4YHLH 2BIIA 3LNHA 3OGOE 3VW3H 1K8IA 4E36A 4R0LB 1R24A 1DR9A 3VFOA 4O58L 1F02I 1NDMA 3S36X 2IQAB 2NCMA 5AW5B 4ETQB 3ZGIA 5DUPL 4YIQB 3SPIA 1QSED 3BUYA 4FLQA 3W2DH 1NGXB 2FO4B 4NUJA 1OT1A 2DMHA 1ET7A 2F1EA 1DQQB 3BYTA 4K94C 4DKEL 4W9EC 5AB0A 1AGBA 4NO2A 3NH7H 1RIVL 2PXYC 1AQMA 3PWNA 2DI8A 4PWIA 4OKDA 4WK2B 5B39B 5JPMA 4J4PC 3T77A 4IS6A 4N90E 4U2ZA 1INDL 3HLAB 2QPFA 5JIPA 1U92A 4GB9A 3SHSA 4P4RB 3LX9A 1S46A 3F65A 1UM6L 5BRPA 1KN4L 2X53A 4NQXB 4BK8A 3GJEB 2Y06L 2DQEH 4KRLB 3OG6B 1F5WA 3QEQD 3MBWA 4XNDA 4HZLA 4YR6B 1P6FA 4J8RA 4LHUA 3IU4H 2CQVA 4I8DA 3DC0A 3VYNA 3GXFA 4BXSV 1J0IA 2DBJA 5DJ6B 3AS2A 2FE0A 5HYEA 4I0PB 5DEGA 4M56A 1IKOP 5AZUA 3MLPA 4BKLB 3IE4A 2J8UB 3S37L 1IAKA 4LF3B 1ZHLB 4KJYA 1SEBA 5K9KB 3ARSA 5KEZA 4HS6A 3G9VA 3L16A 4G6FD 4AEFA 1V7ML 2UY7B 1RP8A 2AV1A 3V4VA 1AQHA 4LHQB 1MAML 1SYSA 1VHPA 4LCWA 4JFZH 4FQIH 3TFBA 2D7QA 4HYTB 4N8VB 3BC9A 1H19A 3L9YA 4UQ2B 3RIFK 5TE6L 4FTDA 1YUKB 2W9EL 3QUMA 1NBCA 4MNGE 4IHOA 2NLJA 3MBEA 1U21A 1FNGA 1F11A 2X6CA 1MFUA 3IXTA 5D4HA 1UH3A 3MJ8B 2Q3ZA 5JXEA 5IBUB 4M93B 6FABL 5C97A 2P26A 5SV3A 4MNGB 2BSBA 1F86A 3CFJB 4G1EA 1CDHA 2PPFA 3MJ7A 2YD5A 5A2LH 3S88H 1CI5A 5I6NA 3PHQA 1CE1H 1SBSL 2EXWC 1IILE 2MJWA 3AUWB 1TIUA 4QEGA 1NSNH 4XX5A 5I0DA 3Q8CA 3UYPB 1E43A 3ARDB 2NMSA 4GKOA 4EJ1C 2CJUL 1W72H 3DX6A 3PAYA 5BZWB 4BV1A 4NKDA 4LLDB 2UY6B 4NENA 1EVTC 5H37H 3PABA 4BSJA 3QAZB 3AY2A 3OJDA 1GS8A 3PAZA 3GMQA 3QIBC 2Y22A 1WZLA 4CU8A 3MPCA 1I9IH 1PZDA 5GSRB 3FOLA 4OFYD 5AOIA 3M6DA 2CPUA 1ANUA 1HOEA 1MXGA 1E6OL 1ZA3A 1WZ1H 2WSKA 2A6IA 4V2CB 3U6XS 5IHBA 4TTDC 5I8CB 5E4OA 4CSPA 4DAGH 1ED3B 4FQLH 4LP5A 1IAMA 2UZPA 3KPOA 4JEGB 2XV2A 4MBOA 2X4TA 2IPUG 1IAOB 1MWAA 2Q8BL 1TZGH 3L3OC 4A2FA 1OAKL 3D4ZA 2CPCA 5DT1L 3DETD 1WZAA 1WEJH 2EDTA 1DE4B 4Q74A 3SDYH 2I85A 4D0BA 2NUPB 4CU7A 4OLWH 4WSJA 1P4LB 2R1YA 3GXNA 5DJAA 5D1ZC 5FM4A 3V6ZA 3H2WA 3DVNB 2A6KA 2W07A 4DCQB 4J27A 3NIFE 4WCYL 3C08H 1ZPUA 4DEUA 5L9DL 4OFKA 4FZEH 4WHTA 5FW6A 1NOLA 4PW9A 5I1JH 3L5XH 3MDJA 3HA0A 4Y4HD 2WBJD 3DURB 4AYSA 3ZZ1A 3C9NB 4U6HA 3TO2B 1NMAH 1CQYA 5TF0A 5I9QB 1TR7A 2EDYA 1YYCA 1WTLA 5KVEE 1FFOB 3PL6D 1NH6A 3FO1A 4B41A 3BJ91 4AMWA 2F53A 3DUSA 1PEWA 4RDQF 3KYMA 4LCCA 4YUEL 1GMEA 3PFQA 3GSNB 3DO3A 3UJTL 4EBQL 3LN9A 3KNBA 2WMPB 4PJ7A 5C0BE 3RKDC 4KFZC 3SE9L 3UCQA 4PY7A 1JK9B 4MLIA 4N85A 3QFGA 4OLYH 1KPRA 2BVPA 2P44B 3Q1EA 3ILQC 4ZUTB 5C3TA 5G4OA 4GSDH 3NESA 3OX8A 1R19A 1MFEL 5C0BB 2BOCA 4B9KC 3AC0A 5I1EL 4V1DD 4TNWK 2DMCA 3GPEA 1Y18A 3TN0D 3N50A 4Q14A 1H3VA 3QT2A 4X8XA 1WISA 25C8L 3ATEA 1BFVL 4PWEA 2XIIA 1QHPA 3BUQA 4MJ6A 4WFHE 3K2UH 2ZCLH 2I9TB 3HBZA 4I1PA 1I1AB 3KHOA 1XVSA 3U0TB 1GZHA 2BSED 4XBEL 1HEZB 2WXPA 3AW5A 4PRHE 2UWEF 4G5ZH 4R8WH 2XYCA 3V0VA 1QEXA 2GIYA 2K9UA 2ZX7A 5C08B 1BVKB 1VF5C 2HX8A 4X98A 1ZS8A 2QVIA 4OJFL 4UDUB 2V2XB 1SJHB 2X42A 2Z31B 4GP4B 4L4TA 4LRNH 4P4KA 3EYSH 4NZ8A 5GS1C 4PRHB 4M03A 2PCPA 5TGBB 4PJCB 3BGMA 4HISA 1A9VA 3T0EB 5IP4A 4F20A 5IVZA 1FV1B 2VO5A 3FHAA 3GZQA 1IU1A 1DL7L 5I8EB 2RTTA 1OGAB 3CDFA 1QPKA 4O2CA 1DQLH 1O5PA 3X1FA 5I1LA 1E4HA 3BVXA 2BIHA 2QGCA 1K85A 2DWEA 1YN7B 2R23B 1FFNB 1MCDA 1IGCH 1N0LB 3HJEA 3PJSB 4YS4A 3UTSD 4ZXBC 4MB1A 4CVUA 4M1DH 2V5RA 1ZVNA 1HL8A 1KELL 4F57H 2C9RA 3C2AH 3KW8A 4GLRI 3U2IA 4W9FC 1XCXA 3DIDA 2D7TL 3O6KL 4XPAH 3K4AA 1OY3B 2MWCA 3I6KB 4OD1H 3F7RA 4WNQB 1DBBH 2CBMA 1BGXL 1WWBX 2CBOA 1XR8B 4X6BA 3MU3A 2FL5B 5KVGE 3L4CA 3G7TA 3H4HA 2ZAHA 5I1GH 1NAMA 3O8XC 4HHAB 2QADC 4FOMA 3DTDA 3FT3B 2X2HA 3CQPA 1JXKA 3HFMH 3LIZA 1FYHB 3F5WA 1CQKA 2EIZB 4KXBA 3C5ZC 2WYHA 4WI3A 1RP9A 2OS7A 3S0PA 3K2MC 1NGQH 3HMXL 4POZD 3G6JF 5PCYA 3CXDH 5I8KL 1T0OA 3L13A 1S7WB 5IWLA 5AW0B 4A7GA 5K9QI 2AJSH 4FFYA 4N0YH 4RGOH 4RQQB 2XV3A 4ZMTA 5JXAL 5TQ0L 3B5TA 2WB7A 5BXFB 2Z7UA 1W91A 4WEUD 1M05B 3M17B 2WXMA 3UBXA 1MW2A 2IDQA 4Y5VB 2DIEA 2ZOLA 3F7VB 2OL3H 3KPSA 3TIDA 5D7IA 1LE9B 4IKLA 1T21B 2PCYA 5FYLD 4RDQG 1ZVYA 2V6HA 1T66C 2DM2A 3PF2A 4NO3A 5JNYA 1J12A 1JNHB 2HJLA 5L8JB 3RZCD 4ZQKB 1IQDA 1P4BL 2IBBA 4K2UL 3X12A 5IQOA 1YY8B 1ZS2A 5TF1L 5CO1A 5LUMA 4X0KA 4ORGB 1P7QB 3GUTB 1O7DE 3KLSA 3HB3D 1JHLL 2FWLB 1BG9A 4RWYH 3HC4H 5I0XA 1GAFH 5E2UL 4L4VA 1ND0B 5HYFA 5GZOD 3HI1A 2AXJA 1H6EA 1JIBA 1YEIH 3QXDA 4B53A 2ODHA 1SXNA 2RH0A 4MMYA 1N3NB 1BQHG 5ACMA 3W0WD 4WTZG 4XGZA 2EICA 2FDBP 2V8MA 3KPMA 4FQHB 4LVEA 5E0FA 4QRPA 2XN9A 3BSGA 5I23A 1R9FA 2HT2D 3TZVA 1RU9H 3BP6A 5DUBB 3HE7A 4PU2A 3FQTB 5KOMC 2VJ8A 4G83A 3NP3A 4QGYA 3ARXA 1KGCE 3VGBA 4ONOA 5D7LE 4YDLC 3DOSA 3I6LD 1ID2A 3RWCA 4NQVA 3X11A 4XT1C 4GKNB 3R1GH 4I13B 3UYRL 2D31B 2QZ5A 1BEXA 5IW6A 5D7LB 3GMRB 4L1TA 3C8KA 2VLKB 3D25B 1SY6H 3MRNA 3BPLB 4D0CB 4DP2X 4GIAA 5DEZA 4HC1H 4RMUA 1RIUH 5ERWA 3S8WA 1BLIA 3MI6A 3FU6A 2JXMA 3MFGB 4IK6A 3V5HB 4Z95H 1A6UH 2Z4QB 2VDQB 3MNVB 3GSXA 1LK2B 3NA9L 3A5VA 3X13A 3VO0A 5DI8A 3BPOB 1UTDA 3VTAA 2B2XL 1L9TA 2XIBA 5KVDH 4JPWL 2OMYB 3GIVB 2NY1D 3CIAA 3VGHA 4TOYH 3EYOB 4EN3B 4YK4B 1WBXA 2HH0H 3BAEL 4LL9A 3DV6A 4NN6B 5ACLA 1YMMB 5FM5O 2AAVA 1M7DA 3GSNL 4P04A 1IKNA 4QLRA 5KVEL 5F1IB 3OF6A 3D06A 2CM5A 2V3FA 1NLBH 3E0GA 1HCZA 2HN7A 3H85A 3SBWA 2KQNA 1V55B 4L8SC 3O4LE 3VXTA 4F2MB 4BCYA 3RLSA 2D7NA 3LRLA 3DJ9A 5I1KH 2BCMA 1PX3A 4MJ2A 4Y1AA 3HS0A 2ZOKA 1N5YL 4G6AD 3O4LB 1OTUC 2C9QA 1G7LA 5HHNA 2FX7L 5C0CB 3BMVA 1TEFA 2GHWB 1CB4A 4MZ2A 4NZJA 3TFKC 3MRBA 1YNTF 4M5TA 1U8KB 5I5RA 4N0CC 3X17A 4ZD3H 3T8VA 1U33A 3QA3B 2PO6B 3ILPB 4S11A 1S7UB 1KCSL 2IAMA 3TC9A 3DJRA 3DECA 4UTAH 4CN1A 5E9DE 3BUDA 3MREA 1I1YB 4Q9BA 4M6NH 1JN6A 5LAXA 1FZJA 2QBWA 4PBVC 1A6VH 5E9NA 4UU9B 1Q8MA 1Q0YL 5CLYA 1EO7A 5K9QG 2J73A 1GVIA 3G08B 1HCYA 2B3RA 3OWRA 3QNFA 2B1AH 4PJDA 3WIHH 1J48A 2XPGA 1BQHB 2IDUA 4KI5F 2YFNA 3BIKA 1GZPA 2QQLH 2VM4A 1OPGH 1CIUA 1ZE3C 2X9XA 3A22A 5DURB 1U8PB 2QFPA 3BEWB 3L3KB 4B9JA 2EUXA 1I9EA 3RDTA 5KSVA 4ZO9A 1V54B 2OJZL 2WAQA 1BG1A 4D9LL 5CZVL 4ZO8A 4UM9B 4JS7A 4JPQA 4HEMA 4F9PA 1M6OB 4ZTPH 2R0ZL 4R5XA 2CAKA 2UWEB 3TT3L 4C83B 2WUCH 1TLKA 2IFFL 5KSAA 1M42A 2Q5BA 3FQ1A 2BNRB 4KMQA 2XQYK 3BAWA 4JFFD 3I50H 5EZIH 4F7TA 4JL2A 2MEJB 5BV7C 3FFDB 4WIQA 3KG5A 3WXWL 2VISB 3QDGA 1OTSC 2OZNA 4M6OL 3O6FD 1EDQA 3QRFM 1JPSH 3QUXC 2VR8A 1G5GA 3RNKA 3VXRB 1MRFH 1SPDA 3UC0L 1C5BL 3BEVB 3BKML 4PRPE 2MQGA 2VE6B 5EN2B 3DXAA 1GY2A 4OZIF 3LY6A 2EYRA 1KYOJ 4PGJA 3MKGA 3VACA 1JZ3A 4JZNB 4R83A 1TJGH 1A25A 5KVGL 2NT0A 5BVJA 3FO0L 4PRPB 1IVTA 4HGWA 2ADJA 4QRRA 4F9LC 2QKIB 2QELA 1KZYA 3MLWH 1DQIA 2XA3A 1A7RH 3FPXA 2O93L 4ZSOE 3BIBX 4ZTOH 1HX0A 2BJML 3P69A 1CTMA 4PLJD 3DJZA 1UKSA 2ZJSL 2KZ1B 2ALWA 3LKOA 4R7DB 5D9SA 1ZLUK 3VWKD 1X9UA 1TMQA 1FFPA 4IOFD 5INDA 3S37X 4HUVB 4YGAB 5D1QD 1A3ZA 2QSCH 1L0QA 1WWCA 2DQUH 2P80A 2XWEA 5FXCH 2VH5L 3QXVA 3W1ZA 1J1OH 1OT2A 3IDYB 4E42B 1H3UA 2Z65C 1FSKB 2CR3A 2IQAA 3MCKB 5EA0H 1J1XL 5IFAL 1E5BA 4AVJA 1BQLH 3EBHA 4PW4A 3Q6FA 1NGXA 1J88A 4PTTB 2Q20A 1DQQA 2EE9A 4G3YH 3D51A 4A6YH 1X3DA 4OB5H 4Y2OB 4IBWA 3LKRB 4M1CD 4MAUL 4LEOA 4M7JL 2GJRA 5CN2A 2DQJL 5FYLH 4F37F 2DQHH 2XZAL 1HI6B 2JTYA 4G71B 5C0AB 5AZ2L 2HT4C 5T33H 5B39A 2NXZD 1SLVA 4A2LA 2QZQA 4R4FH 4DP0X 5B1JC 2V2WB 4ZBJA 4KRPB 2DLFH 3MRGA 2H6OA 5GGRA 1U95A 2YN5A 4P4RA 5E94A 4JQIA 3CUPB 4LFHG 2D2OA 2EEDA 3P9WB 4XODA 2VR7A 1UYWH 2ADFH 1FL5B 3JV6B 2DL2A 3EYVA 4ZDHB 1WWWX 4HH9B 3D39B 2XKUA 5D2NE 2WXLA 1AQKL 1K5NB 2W0KA 5DVMA 1KIPB 1FH5H 2BFGA 1KN2H 3K1KC 4HX1A 4PGEB 4RRPA 5DU7A 1HAWA 5F7NC 2XN2A 4LEEA 4WDIB 2Q3XA 4WU7B 4UILL 5D2NB 1HQ4B 4HJGA 2ZUXA 5DJ6A 3S5LA 3PHOA 3ALPA 4XCNB 5D70L 5J6GA 1OZUA 2L7QA 2D7PA 3Q1SL 3IJSB 3MACL 4L3EE 1KEGH 2OP4L 2I60L 4LGSB 1D6VH 3AG4B 4WNSA 4IDJH 4WI0B 1UC6A 3WTWA 5K9KA 1XH1A 1FO0H 2WM0A 4R90H 4XO4A 4JBSA 1CK0L 1E9QB 1MW0A 1S8DB 2UY7A 4L3EB 5LNDA 2WWKO 1IRAY 2W0LA 2HRHA 3V0GA 4DH2A 1KV7A 5AKSA 4XPBH 2WJ7A 4HAGA 2EEFA 2HMID 4RWHA 2VRKA 5KWYC 5IB1B 1AE6L 2VDQL 4JRLA 1QQDA 1ZSHA 5EDXA 1R1CA 4TNEA 1E2ZA 3T08A 1H8OA 4ZUUB 3V0HA 1B6UA 5D4IA 2WIIB 1RLBA 2ARWA 2P46B 2RB8A 2Y2TA 3W56A 2VL5B 5AENA 2BERA 1AS6A 4DP6X 2B0SH 3NTCH 2AQRA 3CFBB 4X6CE 3LPPA 2X4OB 3AG3B 4MNGA 1PZUB 2JNZA 3V9CA 3MLUH 3CFJA 5H37G 3QRBA 5IV2B 4CVZA 1X5AA 2HWZH 5C0RH 2BVEA 1FZOB 4X6CB 5D4QA 2J5WA 4MDIB 4YGVA 3AB0C 1XGRB 5E4EC 1GYWA 3V95A 5C0JB 3LQAH 4OCRL 5HY9B 3GI8L 3GRWH 4YFEA 5LJYH 4UTCA 2EDFA 3CVHL 3UYPA 1HE8A 1TQCB 2YRLA 3BLBA 3ARDA 2VN4A 3RGHA 3VNYA 4PV1C 5BZWA 1JGLH 2IH1B 1GS6X 4HKBB 4LLDA 3PWLA 4KH2A 3MUJA 2OMTB 1SDDA 3O9WD 3V8OA 5IHWA 3WDJA 1ASPA 1S2EA 3Q2WA 5GSRA 3DSFL 2GTZB 4XNMB 3EXJA 4IHBA 2OA9A 2FD6L 4Q6IC 1ZGLB 4Z3TA 1KJMB 3K72A 3V0EA 4UOJA 4C56D 5IFHL 4BKTC 1D5MB 2J3SA 1VFAA 1XDTT 3OKMB 5JXEC 2AJ3B 2EDEA 2V3EA 5DHEA 1DE4A 2BDNH 1FORH 2NUPA 4FQXB 4KKBD 3LEVH 1P4LA 3KMDA 1SXCA 2GBTA 4P07A 1UJ3C 2HT3C 1E4JA 3TT1H 2FSEB 3DVNA 4R7XA 2DQTL 4DCQA 2Q0ZX 4HWBL 2EH8L 4JFPA 4K9EH 1YNTB 1ZVSB 2FNBA 3TJEL 1Z5LA 3BI9X 2ICEC 1VKXB 3DURA 3QIUC 4PQXA 3F01A 2VR5A 2YRZA 4F8QA 4EI5A 3ZW3A 3N1QC 2OX5B 3ZL4L 4BE5A 3TVMB 1GIGH 1QTSA 1OSZB 3ZMNA 4F5CE 5JOPD 1CU4H 2EABA 5AAWC 4EIZC 3GHBL 3FONA 1FFOA 3ZKQD 4ZPVB 1KPUB 3UG5A 4F7KA 2Z7WA 1I7TB 4I3GA 1KC5L 3DX2A 4IKJA 3SEPA 1FNHA 3A6CL 2UZIH 2A6DB 3GSNA 3N1PC 1G7MA 2CALA 3D85A 3S4SG 2QSVA 5DUML 1N8ZA 1TNMA 4H25A 1DLFL 2X7LA 2WMPA 1DUYA 4E9SA 3HNSL 5DLML 4O2FB 1JK9A 3D12B 1A7NH 2AJVL 3US0A 4UBDD 4ZUTA 1KB5A 3FSWA 1AZZC 5LGHH 2IV8A 4WEBH 5ITFB 4K55A 5C0BA 4MCMA 2VSDA 2WXJA 5ICZB 1BQ5A 1AR1C 2O26U 1J05B 1B3JA 4GI6A 5BVPH 4BK5A 3E8VA 4KMTH 4HHGA 4PJ8C 4UB0H 3SODB 3BP7A 3PDOA 5I28A 2G4EA 4K5OA 1ES0B 1QA9B 3RI5K 4M4RB 5EOTB 1H5BC 5HHOD 4KTEL 2R0LL 2I9TA 2X1QA 1I1AA 2Q2LA 4PB0H 3U0TA 2VMCA 1A6WL 4TVPD 1QFWH 3CLEH 4M7ZB 5CJQL 3QULB 4BD4A 1ASQA 3M1OA 4RISH 3QIWC 3BQUA 1JZHA 1W72B 4N0RA 4BK4A 1BVKA 4P2AA 4UDUA 1N6UA 1TT6A 1SJHA 2Z31A 1C1EH 1YJDH 2QVTA 5GRYA 2DTSA 4PRHA 5G55A 4LL4A 4OLXH 2OTWB 1ZWIA 1QFUH 5I1AB 4XPGH 2FK9A 3KE0A 2XRAL 1F97A 1RJLB 3SDDC 5L4IA 3GTTA 2YZ1A 1AO7D 3FB8B 3B2PA 4BFJA 4N1HB 4P9HL 4W6WB 3FN0L 3LXBA 2J1ZA 1YN7A 5AAMA 2R23A 1FFNA 4MCNA 5E6YA 3PJSA 4U1JB 4YDJB 3VW3L 3OG4B 4LKXB 3TTSA 3IGKA 3O2VL 2HFGL 1IGYB 3UH8A 1UWGH 2GW5A 1UOKA 3KLHD 4G8EB 2D73A 1WT5C 4YAQA 2FX9L 1WD9A 3GSQA 5HYQB 4OF8A 4QIRA 1AG6A 2WP3T 4WNQA 3VFRB 1QVOB 1YAIA 3AUVA 1CVRA 5L2KD 2FL5A 3AVEA 4KROD 5LGJB 3BWUF 4IDLA 5JPNC 3KDPB 4L4JA 1HKLL 2VWEE 2X28A 4NKIH 3ROLA 1T03L 2V9TA 4HHAA 3U2SB 3K4ZA 1LGVA 1MJ7L 3AY4C 3FHQA 3WHXB 1G9ML 3PGCB 1BWMA 1PLBA 3UAAA 3D52A 1B4JL 5HPOA 1M53A 4HUKB 4JPVH 2OMZA 1DBAH 3AG2B 3HNVL 4FXTA 4N5EC 4X6EB 2ARJB 4WGVB 1S7WA 2X70A 3EOAB 5LNGA 4ODTL 1CFBA 4XMKH 5TTRA 3MXVL 1AHWA 3QUHA 4FLHA 3GKZA 4IU3B 4RQQA 3V4PB 4FI7A 2GJJA 4HU8A 1GXEA 3LKPA 4OD3L 2R15A 5BXFA 2HXAA 5J57B 1K72A 3S4SB 1C5CH 1A4KA 1SLWA 4ORZC 4Y5VA 3F7VA 4GAJH 2A0LC 1LE9A 3LHPL 2JB5H 4NRZB 1DFXA 1XIWC 1Z7JA 2QPSA 3K8LA 2GBAA 1U4FA 1X5YA 4HJJL 5AVUB 4YNYB 3X3GH 2MNUA 4MJHA 3RX5A 5C09B 4D7BA 3FSOA 4GXFA 4YVUA 3RHWK 4B9FA 4JFWA 1PTZA 1YY8A 2AZUA 3CIQA 1BZ8A 4FCHA 4XOBA 4B60A 3GUTA 1DFBL 1N2RB 3D3VD 4LLUB 4IYKA 1WAPA 5ISZE 1ZK9A 3L4TA 1ND0A 3RVUD 3TWYA 2APXA 2VXTL 4KZDL 1RZ8B 2P47B 3TPUB 5HYJD 1HU8A 4LESA 2AKRB 3ARBB 1LO0H 3JWNC 1R4XA 1LEGB 5ISZB 3NCJH 3AREA 1DHKA 3CU1A 3O41A 4GUOA 2AQNA 3BUPA 3Q2NA 2R59A 3IFNH 2EO9A 4PJXE 3X1GA 5FOJA 3EFOB 1T3FA 3FUMA 1UUNA 2UZXB 3W2DL 5AYTA 4FQHA 1JGEB 1NGPH 2BIMA 3NSXA 4QYAA 1HXMB 1AI1H 1QSEE 3D69B 3VRIB 3NH7L 3KS0J 2NR6C 3V5DB 4CAGA 1Q9LB 3SGJC 3FQTA 1T7VA 2WN2A 3P73B 4MA1C 5B22A 1MHHA 4HSQA 3L2NA 3IU3B 5DJ2B 1AYRA 3BPNC 5EF0A 1NBVH 4XCEB 4MLSA 3WMSA 1QR1B 1QSEB 4I3SL 2ZAGA 3MODH 2KL6A 4MMZC 1BSIA 4YZFF 1J8HB 2VDNH 4PYGA 5K1VA 4TXVB 5LQBL 3RB5A 2X3AA 3BN3B 3QXAB 3VQLA 2D31A 3ARFA 2NXYD 4NZTH 5D7LA 2OTPA 4M62H 1OB0A 4BA0A 4G1MB 1T6WA 2Y36L 3D25A 3BAKA 4XO3A 3DYMA 2FQFA 5K9OA 4JANB 1CT8A 3WKML 2DQEL 2HLAB 2IVFC 4R7NA 4XB3A 1AKPA 4P23D 1NCAH 3N04A 3V5HA 4HJ1A 2EIEA 4HDIB 1MFDH 2Z4QA 3IU4L 3MNVA 4LOUC 3QEQE 1LK2A 4MNQE 1N6QL 4V2BA 4F7EA 2M26A 2YA1A 3KBHE 4HAFA 4X8JA 4U6VH 1KT2A 1FHNA 1ZHKB 2IPTH 1T2QH 4MRBA 5EZOH 2K4WA 4MNQB 3KPPA 2BVQA 3JV4B 4FL4B 3EYOA 4EN3A 8PAZA 1T1WB 1OP5H 1A7QH 1YMMA 2CGRL 2M8XA 2DIAA 2P24A 4J3OC 1KJVA 5I30H 3E38A 3LMJL 3ASOB 4OLVH 3WS3A 5BCAA 5CHNB 5EF3A 4X7SH 1D5IH 3B4NA 2WLMA 2XBTA 2VC2B 1U58A 4MJIB 1TMCB 4QXGH 4OIBA 5EOQL 2PP7A 4Q52A 1WVZA 5CCJA 2CHDA 5E8NB 1I9RL 3CVHA 4XVSH 4N8CH 1DEEB 2VXVL 1J8SA 4MJ4A 3GHEL 5AYQA 3O4LA 1PEZA 2C7FA 1QLRB 1A3RH 1S9XA 5F7UA 2W38A 1U8KA 2YUZA 2F54E 1F4WL 1BFOB 2WINB 3S88L 3QA3A 1RULH 2YJQA 3ML9A 4HJTA 3VI4E 1FF5A 3VWJB 1UOVA 1NBQA 3IDJB 3IBEA 3CFCH 4OCXH 1MIML 2F54B 4F27A 4ZW7A 3PWPB 1WSST 1W72L 4FFTA 3L4UA 2O1AA 4UU9A 3RJOA 3FO9B 1GJIA 3JWOH 5EC1B 5MERB 3A67L 4FNUA 5JMRA 4HWBA 4UUJB 4TVPH 3M1BA 1I9IL 4CMHB 4WTZA 5IEHB 4WU5B 3Q5OA 5AW3B 3OM3B 5D2LF 3RX8A 1WZ1L 3OHMB 4LLVB 4YSCA 3CSYB 1U8PA 4K07A 3QJHB 5D7JA 3VFWA 5EG6C 4U2YA 1DJSA 3ZUNC 4CVXB 1D2PA 4UM9A 3VVWA 1DJIA 4APXB 3QJZA 1YDPB 4FA6A 1M6OA 1DCLA 3AXIA 1XMEB 1IBHA 1TQBB 2WANA 3H8NA 1E6JH 1ZT7B 2XA8L 4KKLC 5H4YA 3UBGA 3SGDH 4BH7A 2JKJA 1UWEH 4ABVA 5DD0H 4RMQA 1WBZB 2XJKA 3PE9A 4GKSA 3C08L 1WFTA 5CZRA 4YX2H 2TAAA 2VISA 1I8KB 1MUJB 5D7HA 2HJKA 3DUHA 5KVDE 5I75C 3A3YB 1VACB 3O45B 1DVQA 4OJCA 4U31A 2J43A 4U1LB 4AZ8B 1MCWW 1XTMA 2FQGA 2HFEB 1MJJB 1ULVA 3BCDA 3FQWB 1X6LA 3DVGA 3VDAA 4K71C 4ODXB 4JREB 2XTLA 2A6JB 4J3XA 4AQEB 5E8EB 4PRPA 2WTRB 4MFHA 3AWFA 4Z0BH 4N2GA 5C9JA 2BPBA 3N85L 4HF5L 5FW7A 7FABL 2BW5A 4HJUA 2EXWD 2QKIA 1SYVB 1DBMH 3UTQA 2WJ5A 3HW7A 3O2WH 1EGJH 1ZCRA 3HKZA 2G75B 4BELD 3SDAB 4PS3A 4AQ8A 1OSPL 3DROB 2YD8A 2FGWL 4GY4A 4HUVA 5HYSG 4ZSOA 3RU8L 3WKYA 1U8HB 1F45A 1SJVA 4PY8J 1SJEB 3GBDA 4JM2C 4AEIH 5AD0B 3OD3A 4GMTL 3IJEA 4HT1H 4F7MB 1ZIBA 5AWNL 3OMAB 4V1DE 1SHSA 3E6HB 3G5XA 3MCKA 3NFPB 3RGVA 1HHGB 1CFNB 2A77H 2ZCLL 5ICYB 4LSUL 3EOTH 4FP8H 1IC4L 1Q90A 4PJEF 5KW9H 3CDYA 3WFDL 1JWUB 3IDGA 4Y2OA 2AEQH 2DKMA 4I0CC 3CZGA 2KZBA 3VQ2C 3EUUA 5L7XL 4NNPL 4Z7AA 5LBGA 5D1ZD 3B9KD 3RRQA 2ZCZA 1CD0A 2WGXA 5JIKA 3VH8G 4HQQL 2CK2A 2V2WA 2QVMA 3N3EA 1YUHB 1CGWA 5BUPA 1AP2A 2W0FA 4JZJB 4GBXA 3IMTA 3UDWC 3VB8A 4QAMB 4FFWC 5FDWA 1LDPL 3NABH 1FIEA 1FJ1A 4ZAKC 2FBJL 4ZDHA 2FEJA 4CADB 4CSZA 4HH9A 4UT9H 3KYOA 1L0PA 1U3HC 3FZUD 1MCOH 2A9CA 4YSEA 1AGDB 1BAGA 1K5NA 3NZHL 3O3UN 5CM1A 5J6HA 4PGEA 3BH9B 4WU7A 1QPPA 5D2NA 1HQ4A 1NCCH 4YXKL 3JZYA 3UTSE 1XL6A 5DC4B 3IJSA 4TQPA 3UADA 1VCAA 2R56L 4HCFA 4UOQA 4FLSA 4IGBD 2PYFB 3ULVD 1JNNH 2BSCA 4OD1L 2Y07H 4WI0A 3T1FB 2I26N 4H2CA 5ICXB 4A67A 2XX0A 4L37A 4OSUL 2N4IA 3L3HB 1E9QA 4L3EA 4YHMH 1W2KT 4Y2DD 4GSXA 1MELA 3R7RA 4Q9CA 5L4MA 2Q9OA 4Q7DA 3FCTB 2FB4H 3QSKB 4ZUUA 2WIIA 2IG2H 3CXDL 3CN0A 4XO9A 3ZU8A 2NY5C 1JXFA 1J5DA 1HOCB 2VL5A 5IGXH 5F70A 5FYJU 1M6UA 3JWDH 1EHLH 4PJHE 4LCUA 3HHMA 1NBZA 4H8QA 1P6WA 4S2SB 3EDFA 4QHMB 1OAYH 1QYGL 2W91A 3SKUD 3QDAA 4X6CA 5TH2B 4MDIA 5C0JA 2VC2L 5GZND 4DWHA 2XQBH 5HY9A 3KVQA 5CU5A 3QK0A 5KBMA 4F80A 3MV8B 1ZLVH 2IH1A 1ZK5A 4RFNB 5FYLE 3T6WA 2ZUQC 4HKBA 1OWRM 4U6YA 2OMTA 5HYSB 1ONQA 1TTFA 3EJCA 1AAJA 3RURA 3TA3D 4RWYL 1GAFL 2GTZA 4ISVA 4ECNA 1KXTB 2X88A 5CKGA 2F7QA 4PREB 1YNKH 2N3JA 2KDGA 1FPTH 4N25A 1YEIL 3IVKA 5KS9E 1ZGLA 1KJMA 3S34H 2JFCA 1NMCC 4KK5D 4ZFGH 4RNRA 1I1RA 5KYNA 1D5MA 4HUWB 2AJ3A 4FRWA 2HKFH 2F7IA 2FBRA 1Q9KA 1D5RA 4FQXA 3W0WE 5KS9B 1YYLL 1QWNA 2DMBA 4RFEA 2FSEA 1NMBL 4MD5B 2ZCKH 2K7PA 1XCTB 2BY2A 3WEAA 5IHLB 1G4MA 1GOGA 3Q3GA 3O8XD 3QDMD 1KMGA 2BLFA 1YNTA 3T3ME 4KKCC 5FX3A 2N0MA 4Y4FA 3CFDB 1VKXA 4X6DE 2HVKA 5TDNA 3UJJL 5HI5C 3IPFA 3C5ZD 4RSVA 5TE7L 2FUQA 5BUGA 1CFMA 3UZQB 4DFIA 3A6BH 1JZ5A 3EYFB 5FM5M 2IGFL 3KPQB 3R0MA 1MJ8L 5DMYA 3WS6A 3BZEA 3QUKB 3Q43A 3GDBA 4HWZB 5BQ7A 2IAND 1KPUA 1I7TA 1FO0B 3WIFB 4F5CA 3VFNB 2D4FA 5TPWH 4B97A 1RIUL 1B90A 2A6DA 1W8OA 1Z9PA 2WAHA 3QZWG 3W38A 3U82B 1X5GA 2DEXX 2R2HA 2AK1L 4Z3HA 1FNSL 3QXUA 4TUKH 1X5KA 3QUYB 5D2LB 4AQ1B 2C1PB 3P3TA 2LVCA 4XN4A 1YEDA 3OHXC 3TBWB 4YBQC 1YVLA 5ICZA 5HVHC 1WFUA 3NACH 4TOYL 3U0WH 2CUHA 2WIMA 2XZZA 3BSZL 3GGWA 2YK1L 4Q8BA 4R2GB 5GRVL 4DKFH 1RUPL 3Q8EA 1ERNA 3K6IA 1ES0A 2NDGA 2ZG2A 4NGHL 3NP4A 1QA9A 5JDSB 2EVJA 2F8XC 4KQ4H 1ODUA 1BQSA 3FH7A 3LKNA 2AP2A 4K5LA 1HINH 1OXYA 2PWFA 1BPLB 2M1KA 4AGPA 3FC8A 1UOLA 4KJPC 4WW2C 1X7QA 1AZRA 1H8SA 2ORBL 1YEHL 1W72A 2ED9A 4MCZB 4XXDA 2C7UB 3VJ6B 3OZ9H 4OD2B 3CFEB 5H37A 1D7FA 2Q7NA 1XGZA 2VZ1A 4M6MH 3II1A 4KDTA 2XWBB 3BT2H 2OTWA 4P3DB 5JHMA 4HIPA 4D3CH 1TU2A 3IFOB 2F9BT 1RJLA 4X5XA 1A1NB 1ZY9A 3RPIB 1ITCA 5C0IB 1SVBA 2N59A 5A3IC 1GPOL 5EV7A 2HA1A 4PY8I 5DMGC 4HGMA 3BGAA 3FB8A 4K23L 4PS4H 1G1YA 5T3XD 5FUCE 4M6NL 1D5BA 3P4NB 3HR5A 5IVXF 4X7EC 2E76C 4U1JA 3Q9QA 4YDJA 2CNYA 4LKXA 1G6RB 1I85C 1RZKC 4A7SA 1IGYA 3BLKA 3CFTA 4Y19D 4PP2B 2ZX6A 3DOHA 4XNXH 5CN3A 1CXEA 2B08A 2OMNA 3L1OH 4NUGL 3S98A 2M2DA 3WIHL 4AIZB 4NM8H 4TQEH 2UYLA 4JW3A 1EO5A 2QQLL 1OPGL 2KC0A 4X4ME 1GGCH 2NSQA 3JTSA 2GJZA 2XWXA 2X38A 5DVNA 2P5WD 1BMGA 4Y16D 3DA0A 2VYRE 5F72S 1YEGH 5ECGA 1PD6A 2K6YA 5ADPL 1HL5A 4XPFH 1YC8A 4PJEB 3U30B 4E9XA 4FF9A 1XH0A 3CFUA 2EP6A 3U2SA 5JIQA 2B1HH 3WHXA 3PGCA 3FQNB 5B1CA 3C60B 4N2LA 1HESA 5J3HC 1MCCA 1BZ9B 1WGVA 4X6EA 2JIXD 2DYSB 3Q7JA 4JKNA 5EZIL 1U42A 1IGTB 2OM5A 1C16B 1JXGA 1UVQB 3UCRA 4G59C 4GP5B 2OTUA 5D71L 1V3JA 3LRMA 1BYPA 1OTTC 2WNWA 4LVNC 1WP6A 3GJFH 1OTUD 2EDBA 2J2ZB 3BLPX 3QZWB 3RIKA 3CFMA 4RFOH 2B20A 3PHAA 4FNPA 4HIIB 4XAKD 4DTGL 1UHVA 2HKHL 5GRJL 4NRZA 3OR7B 3ULVH 1A6TB 3UROR 3VTMA 4AC2A 3N0PB 4N0CD 2LU7A 5C09A 2MCPL 1E27B 4WVRA 2FO8A 2ZF9A 3SE4C 3KHQA 3MLWL 4HK3N 2IPUK 2NCEA 3GNMH 4AYMC 4H44C 5HPMA 1N2RA 3CDGA 4QRSB 5JORA 4NAJA 5IBLD 5EU5B 1AGEA 5CSBA 1XR9B 3L1EA 4QTIL 4C47A 4BZ1L 4N2NA 1JUFB 4W4OA 1RZ8A 3TPUA 4FG2A 5JA9A 2DQUL 1IM3B 2AKRA 3ARBA 3HFFA 1E40A 4LLMB 1DVFA 4H8WL 3FU9A 2X87A 3S8FB 1X5LA 5ISZA 2EDJA 3UZEA 5D1QE 4OCYL 3R4RA 2B7DT 2WLNA 1PPIA 2DLEA 5F7DA 2UZXA 2DYPA 1LHZA 4G2AA 2VLME 3KGTA 1XHHA 3HZVB 4U1HA 1CF8L 2FJUB 2F68X 3TYFB 4PGZA 4AMKL 1JNLH 1HXMA 1WV7T 4EUPG 3VRIA 1W16A 2ZYHA 4PJXA 3V5DA 1MCIA 3SY0B 5FYLL 2P49B 2R1XB 4WI5A 2E75C 3IU3A 1NA8A 3ARGB 2WO2B 3OB0K 3OKNB 4V33A 5DJ2A 3TBVA 3LTVA 4ADIA 1PW3A 3DGGB 3L9BA 3INUH 1QSEA 4XCEA 2IIJA 1TKWB 4JL1A 4YDIH 4CW1B 3COOA 1AMXA 1JWSA 3K4DA 1MVFA 1TZIA 2WC7A 2EC9U 2YSSA 4W4NA 2VDKH 4GP8B 2CDEB 3H0TA 2ZXEB 1O9VA 2APTA 1EXGA 1MHEB 1UYWL 2WBXA 2X6AA 3MRCB 5DDHB 4DF9A 2XZQL 3AROA 4LBEA 4JANA 4AGNA 3VXSB 3T2NL 1O0VA 3KVPA 4WI6A 1N7MH 1W15A 5F6HJ 2WNGA 1GC1L 2VR9A 1S7RB 2C1OB 2WQWA 1SJMA 3RVTC 2ZKXA 1R33A 4YHYB 1JWMA 4H88L 2PTTA 4OT1H 4H13C 1BZQK 5D1XC 1TO4A 3P0GB 1MF2L 3LPOA 4PRIE 5GGQH 3ZE0E 4L18A 3MGTB 2E7BA 5GHWL 4D8PA 3FUDA 1EJOL 2VXSL 2VZSA 5D96C 4UAOB 5DWUL 5F0PB 5E7BA 4MNQA 2EYSB 1D6VL 1U36A 1X5IA 3MUUA 3L3JA 3QEQA 3Q44A 4IDJL 4OGXL 1SNRA 5IBTL 3X3FL 1T1WA 4PRIB 1NPNA 3R4DA 1ETZB 4KK9C 1FO0L 1WC7A 2MCMA 2BNUB 4H5SB 3MLZL 2AQ2A 2YGVA 2BZ7A 1BYOA 3WUWG 2OL3A 1PD0A 3QWRA 2GHZA 3MLXH 3L1GA 2H3XC 5E8NA 4ANXA 1ZV9A 3D9AL 4WK4B 1D9KD 2XYBA 4I77L 2XTJB 4EIGB 1KY6A 4J1UB 3WNPA 3KZ8A 1MKFA 4K3JH 2EACA 4GS7B 1XGYL 2GJ6E 4S1SH 3TEYA 1RIHH 1WPCA 1UASA 4JJOA 4L2YA 3JT2A 3CVDA 4LPXA 2YARA 1BFTA 4PRDB 2J44A 1BA9A 3HBPA 1IC1A 3VCLB 1VFOA 1TOXA 2H7WA 2Y9RT 2GJ6B 3HE6D 3VWJA 2NNAB 4MQXC 1PY9A 5F3BA 3LQAL 2F54A 3FJTA 4HUUB 4NUPA 3CFIC 3MRHB 4FD0A 2YPKB 3VI4A 3H3KA 1NGWA 1NKRA 4TQHA 1KCUH 5EC1A 4PRBB 4U1KB 4NUMA 3OSVA 3ZZLA 4UUJA 1ZEAL 4G6KH 1HL9A 4LKCB 1NIAA 3N0AA 4ONGH 4WU5A 3SCMD 3CMOH 1W9XA 2Q2EB 1MWOA 1XWVA 4LDOB 3V0FA 2NY2C 4MJ5A 3LDBB 3U25A 2FWSA 2JELH 4MJJA 4YHPA 2AJUL 4Z7NE 1WFNA 3CU7A 1U41A 3HS8A 4BKSC 4EDWH 4O4YH 4EZLA 3ML8A 1NQBA 4EUPB 1DQMH 4WV1C 4APXA 3TM6A 3ENEA 4J28A 4ZX3A 2P8PB 3FH5A 3EFFB 4FG6C 4PGCB 4C56E 1ZT7A 2WLYA 4I89A 1G6RL 1T22B 2EO7A 4AQZA 2QJDA 3TT1L 4HC1A 4LSPH 3NZ8B 1SVZA 1BQRA 2YA0A 4MQ7B 1ZKAA 3K74B 4OGYH 1DQTA 2IDSA 3D2TA 1IC5L 3FB7A 3QXWA 4PRNB 1IC0A 1I8KA 1MUJA 4YSTA 4OVUA 5T3XH 5FUZH 2WQRA 2UUDK 5AFAA 5E6UB 2DLIA 4OUUB 3WFBH 1GRWA 3ZYZA 1NCHA 2I5YL 5EBMB 2ITDA 2H26B 1JERA 3MLYH 2RFXB 1Z9NA 3DX8B 5AVYB 3M1CA 4KKAD 4EZKA 1IKFH 3F85A 4DIXA 3R19A 3FTWA 2HFEA 4NN5B 3CN4A 4W9KC 4N0FA 4CKQA 5JOPE 4TQIA 3BE1H 4HZ1A 3FQWA 5J5EA 4H7VA 2WBJA 1JPGB 3FYIB 3SPHA 2A6JA 4AQEA 5E8EA 2WTRA 5J89A 3IAGC 4OBRA 1KEMH 5D7JC 5CZKA 5F89B 5DO2D 5FPIA 1FNEB 1QFPA 1JP5A 2WXKA 1SYVA 5FAAA 1N0XL 5MEPA 1GHFH 3PL6A 4AYDC 1UCBH 1AS7A 1UXWB 2G75A 3DHJA 5SWSD 1NL0H 3D05A 1JZEA 3FQ4A 3LH2L 2VLRD 2XQ0A 2GUOB 2IWKA 3DROA 4RAUB 5LGHL 5TFSL 1XQ4A 2NYYD 1FBIH 3AADB 4M48H 3T6XA 1BZ7A 5GGVL 1IGJA 1U8HA 4OU3A 1JZJA 3ECUA 5BVPL 2LQRA 4KMTL 12E8H 3P9MA 4F7MA 4O5LL 5I71C 3E6HA 1T1ZA 3FO2B 1NAKL 2Q87A 2K8MA 1P4IL 2I07A 3NFPA 2UXTA 1HHGA 1GSKA 4POUB 4MQSB 3AS0A 3I9GH 1AIFA 1MIEL 5AG9A 1MG2C 3IMVA 4U1MA 1YYMH 4DJMA 4CNIA 4FQCH 2LOEA 3O6LH 4JQVA 2NY4D 2BOBB 5L2JA 2J72A 4RISL 2X4NB 3HLKA 3IS0X 3QQ9C 4YE4H 3N41B 4TVPE 2H0PA 1P5UC 3GIZH 1A7BA 1PKQE 4ONFL 4UNVA 1JYVA 1AANA 1QNIA 3OPZH 4JE4B 5J6SA 1ZLEA 4X6FB 3E9UA 4AKOA 5BW7C 2X89D 3WIHA 4GRLB 5AB1A 2P7TA 3V0WH 2BSEA 4XXCC 4H20H 4XPGL 3A4EA 5LKNA 2EIBA 4PVBA 2QVFB 5IMKA 4FS0A 4FQ2L 4JZJA 3QIUD 1HILB 3ALWA 3VXOA 4XP4H 4JO2H 1GGIL 1K6QH 1IBZA 4CADA 5FLVA 3LD8B 1A14H 4ZW5A 2BM3A 5HP5A 1AKJB 4QF1B 4W9LC 2WSDA 4Z7WE 1S3RA 5DD6B 3QJTB 5DQDH 3WIIL 3LKQB 2CKBB 4MWFB 5LXGL 1ZE3H 2BP0A 4EEEA 2YQGA 3HEIB 5JR1H 3P0YH 3TBSB 3RIAF 3MJ9H 3H9HB 4AC4A 3HC3H 3A47A 1F6FB 4OZHE 1F4AA 3CBKB 4E41D 4QMEA 1TLMA 1TJXA 2Z0UA 1C12B 2PYFA 1P0SE 4Z7UF 3ULVE 3QORB 4U3XA 2ZXQA 3UTSA 2CA4A 5IMLB 3ULSA 1UH2A 5GS0C 4JRXD 4KH9A 1RURL 3U2JA 1PBYA 3VXUD 1ILSA 4ZUWA 5L2KE 4LIQH 1NCTA 2AV7B 3RPKA 1A0QH 2KH2B 4IRSC 4NKIL 5BV7H 1MRCH 3LZPA 2DICA 2WXNA 4PJ8D 1ECZA 4U3HA 3DI2B 1E8XA 1ZA6B 1OP3H 1VAHA 2DKUA 3FCTA 5L2KB 5F6HI 5DJDB 1DBAL 3K1DA 1T89C 5HGHB 1U3YA 3FQXB 1RUQL 3QZBA 3WNMA 5HGDA 2XJLA 2KBGA 4AIXA 2EUWA 5KSBE 3AU1A 1RUMH 1JAEA 1FVDA 1HOCA 2OSLB 5D1ZI 4OGZA 2GI0A 2CK0L 3CVIH 1EV2E 2YQBA 4N0UB 4P5TB 3FBQA 3QIWD 4QDGA 5L8KB 2A4EA 5F2FA 2YOCA 3ZYJA 4KXDA 4GG6F 4QRFA 4JFEE 3RVWC 4BZ1A 3VXQA 1WCBA 2OMWB 2D0FA 3LN5B 3OKLB 4MCYB 5A7BA 4GAJL 4N2MA 4HLJA 3RTLA 5CEZD 2JB5L 5TH2A 4PJHA 4N22A 2KS0A 2MPAH 4WO0A 3CK0H 1FDLH 3F83A 3L9RB 4JFEB 3SOBH 5DRXA 3EJZD