4YSAA

Completely oxidized structure of copper nitrite reductase from geobacillus thermodenitrificans
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 101
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysaA00
5B1BB 4A2DA 1M9WA 1A3ZA 4DPAX 4BWUA 1AS8A 3ZDWA 2Q9OA 2XV2A 4G7SB 2BW5A 1KGYE 3AY2A 3QQXA 2GSMB 2N0MA 4PCYA 5I28A 2BHFA 5D4HA 2FQEA 1ZIAA 4TXVB 1WS7A 2X88A 2H5UA 4CSPA 2FTAA 3NJJA 2HRGA 1BXVA 2BWDA 3PXLA 1BXUA 5B7FA 2PPCA 1AZNA 1XB6A 4BK5C 2XXGA 5LDUA 1JZEA 1NIAA 3AZUA 2PCYA 6PCYA 4HCGA 1ETJA 2I7OA 3OMIB 1IBYA 2E86A 5B1AB 5IY5B 3CDZA 4HAKA 1GW0A 1XB8A 2IWFA 2DYRB 3DKHA 4KO5A 3HB3B 2FQGA 2LLNA 1FWXA 2HX8A 5I5IA 1SFDA 1MG3C 5F7AA 2XYBA 4DP6X 4KNSA 3MBWB 5A7EA 2OV0A 1JXDA 4WKXA 4WTQA 3ZIYA 3NJFA 3SBPA 4GP8B 4UAHA 3FPXA 2UXVA 4GXFA 1AOZA 1JZGA 2RACA 2XVBA 1JZJA 1R1CA 1J9QA 2YAOA 4DP4X 3DIVA 1SHWA 4AZUA 2Y1AA 5TK4A 3ASNB 2PP9A 3JTBA 1OCZB 1WS8A 2VM4A 5B1JC 2XXFA 3ERXA 4NAJA 1DYZA 3WIAA 1GYCA 4YSRA 1KDIA 1PLAA 1A65A 1AQ8A 2UX6A 3BQVA 4E9YA 4P5RA 4F7KA 2AANA 1NIFA 4G71B 1IUZA 2EINB 3PAZA 3T71A 1SDDB 2QDVA 4QKTA 3WI9A 2JXMA 3PCYA 1OE3A 1J5DA 2VSMB 3FU7B 3WKQA 4YVUA 4AKOA 1W6WA 2YAHA 4KO6A 4KOBA 2WSDA 3FQ2A 2A3TA 1KBVA 1XB3A 2J57A 5FC9A 3C75A 2BZCA 2J5WA 2DWSA 2PP7A 2VW4A 2WO2B 4E9TA 2PPFA 4UANA 2FT6A 3X2QB 3T9WA 2QDWA 4FA7B 2CALA 4YL4A 2GBAA 1UATA 1YLBB 2GB2A 4N4YB 2I85A 2BP8A 4A67A 4FAAB 3NP4A 3NJLA 4A2EA 3IN0A 4RH4A 4F2EA 2PPAA 3QJRB 2R7EA 1ASPA 3UGEA 4DPBX 1AAJA 3PAVA 2HRHA 2PLTA 1WA1X 2J55A 1ZPUA 1AZUA 1OV8A 4YSQA 1JZFA 2XUWA 4HHWA 5I6LA 3NSFA 3FSVA 5F7BA 1GS6X 1RKRA 2BP8B 1N70A 2YAMA 3EH3B 2IH8A 1PNDA 1RZPA 3PLYA 4DPCX 1GS7A 1W6LA 4JKNA 1RCYA 1ET7A 1ASOA 2B08A 2IAAC 2IH9A 2TSBA 3FYIB 1SF5A 2QPDB 4CSZA 3PPSA 1V55B 1ET5A 2EIMB 2ZXWB 3PAUA 1I53A 2DWTA 5I6MA 2AZAA 3NJIA 3NJHA 4ZK8A 4BWWA 1JERA 2B3IA 8PAZA 3EH5B 4W1TA 1IBZA 4PAZA 3IBOA 1PY0A 1E5ZA 1PZAA 3IEAA 1KV7A 2CUAA 1J9TA 1A4BA 1QLEB 2HLEB 3WG7B 4A66A 3S3BB 1SDDA 2FNWA 1A8ZA 4MFHA 4L0PB 4YSOA 1PCSA 3T6XA 4A2GA 5B3SB 2YXVA 4YVNA 2GI0A 3QPKA 3S3CB 5I6OA 1ILSA 3AG3B 7PAZA 3ABGA 3NJKA 2IWKA 3WNIA 1JZHA 4KO9A 1DZ0A 3FSZA 1B3IA 1V10A 3EH4B 3EHBB 3T6ZA 3UACA 2BO0A 2HXAA 2JFCA 3X1GA 1J5CA 1BQRA 2HX9A 1BXAA 4GY4A 1MZYA 1X9RA 1JOIA 1PLBA 1PZBA 2PP8A 3GXUB 2IDQA 2XV0A 4JHVA 4HIPA 5I6PA 3H4HA 5B7MA 4DP9X 1M57B 1HAUA 1NZRA 1OCRB 3L45A 2EIJB 1TEFA 2GC4C 4A2FA 4YSTA 3TU6A 1PLCA 1FFTB 4YSSA 1HFUA 2YAEA 5PAZA 2VW7A 1QNIA 2XV3A 2BW4A 3AG1B 3DTUB 3V9CA 3BVDB 4DP0X 1NWPA 5AZUA 1OCCB 2W8CA 5I6KA 1BYPA 3FS9A 1CYWA 3MX0B 4HZ1A 1OE2A 1L9RA 2I7SA 4YSUA 3EF4A 1JXGA 2FWLB 3TA4D 1URIA 1L9OA 2XX1A 2UXFA 3NSDA 2VN3A 1MG2C 1PNCA 4NB7A 4DP2X 1AACA 1ASQA 2AVFA 3ZBMA 2HZHA 4G70B 4YSEA 1SFHA 4BWTA 2P80D 1AZRA 1SJMA 3JT2A 1JVLA 1JZIA 3CVDA 3OD3A 4G72B 4DP8X 1AANA 3ASOB 3SQRA 4JHUA 3UAAA 1ZV2A 3S3DB 4BDVA 3FSAA 3CG8A 1ID2A 4EF3A 2DYSB 1BEXA 3UABA 3NJNA 1GSKA 4E9WA 1E67A 3QJSB 1SF3A 2QPEB 3CZUB 4G7RB 1KDJA 2GHZA 5D4JA 3V9EA 4A2HA 3OM3B 1ADWA 4YSPA 2GC7C 4E9QA 1FA4A 5B1JA 1AS6A 1CYXA 2BWIA 2OCCB 1VLXA 1GY2A 2ZONA 3G5WA 2XU9A 2YQBA 1CC3A 4KNUA 2ZWNA 5AFAA 2H3XC 1X9UA 2NRDA 3AG4B 3OQRA 1GS8A 3X1FA 3CVBA 1NICA 2QT6A 1GY1A 1KBWA 4DP1X 2XX0A 3AG2B 4DP5X 3GYRA 2IDUA 1TU2A 1AG6A 1ET8A 6PAZA 1BQKA 2YAQA 3FU8A 2BZ7A 2TSAA 2ZOOA 2XLLA 3D12B 4DP7X 2H47C 2FQFA 1AZCA 2EILB 4Q8BA 4HCIA 4M4RB 3ABKB 4YSDA 3FU9A 1L9QA 1QHQA 4F2FA 3H4FA 4BXSV 1T5KA 1AIZA 1RZQA 2UXTA 4GP5B 2VMJA 1JXFA 3QJVB 4E9RA 1HAWA 4QLWA 1NPJA 1WA2X 3QJTB 2Q5BA 1OE1A 3CDZB 3NT0A 3KW7A 2R7EB 4P5SA 5AKRA 2X87A 2AFNA 2DV6A 1WA0X 1A4AA 4E9XA 3UAEA 4W9ZA 1A4CA 4G7QB 3T6VA 3FPYA 2CCWA 2YAPA 1NDTA 4X4KA 4A68A 4AKQA 3H56A 4UF7C 1J9SA 1E30A 1AZBA 2BP0A 3X1BA 3X1EA 3TBCA 2EIKB 3CVCA 3NJGA 1EZLA 2CBPA 2FT7A 2IDFA 2IDSA 3U25A 2DY2A 4BXVA 1M56B 4KOCA 5ANHA 1EHKB 1N68A 2XWZA 3WKPA 3QJQB 3FSWA 3ABLB 3SBQA 4M3HA 2FQDA 4K9JA 1E65A 3FU7A 3IE9A 3OMAB 4HALA 5I5JA 3WNJA 1TEGA 3NSCA 1OF0A 1SHXA 2PCFA 2MTAA 5EHFA 3S8FB 4E9SA 1MDAA 5E9NA 1CUOA 9PCYA 1ZIBA 2HX7A 4Q89A 3FQ1A 2CAKA 1PF3A 1SNRA 2BP0B 2YARA 1TKWA 1NIBA 1JVOA 1WAEA 3N2JA 1KYAA 3GDCA 2Y69B 5B1KA 4GP4B 1IC0A 1AG0A 3IN2A 4KO7A 4HCFA 1KCBA 3NP3A 2OJ1A 1NIEA 1ILUA 1GR7A 5I6NA 1L9PA 2FT8A 4AX3A 1MZZA 3UADA 2WO3B 1OOWA 1PAZA 3N55A 1ZDSA 4NERA 4AKPA 1KCWA 1AS7A 3FQYA 4KNTA 3NJMA 5I5MA 2JKWA 3SBRA 1L9TA 4GYBA 5PCYA 7PCYA 3X1NA 2P80A 2CJ3A 3RYMA 1BQ5A 4E9VA 1L9SA 1PZCA 1NIDA 2PPEA 1IKOP 2YXWA 1ZDQA 1NPNA 5I26A 4YSAA 3OMNB 1PMYA 3ABMB 2IDTA 1W8EA 3TASA 2W88A 2VM3A 4YSCA 2YAFA 2MRYA 4BDVB 2FJSA 3QJUB 1J9RA 2AZUA 3KW8A 1NINA 5D4IA 2UX7A 4AI7A 1BAWA 2VSKB 3FT0A 1BYOA 3NSYA 5TK2A 3AW5A 3FYEB 2GIMA 3TBBA 3HEIB 1OCOB 2PPDA 3S8GB 1NTDA 5B7EA 2IWEA 1V54B 3NYKA 2UXGA 2VW6A 2J56A 1F56A 1NWOA 1XMEB 3ZX1A 1E5YA 4N8UA 3T6WA 1CURA 4ENZA 4HHGA 1AR1B
chains in the Genus database with same CATH superfamily
5EBWA 4WU7A 2H26B 2Y3AA 4JY4B 4BZ2L 3UC0L 5SWSA 1S9YA 1JXKA 4OI9A 1UD3A 3JTSB 4DVBA 2FIKA 1YEEL 1QABA 4QRBA 5FHAL 3TIEA 2RH0A 4KRNA 2Z0UA 3O2VH 4P07A 2VDNL 4NNXB 1BQHB 5EOCH 5K9QG 5HPOA 4NQDD 3O11A 5T3ZE 4U6XB 5E99H 5EU4B 1YMHB 3IT8D 4XPHL 1ZIAA 2B16A 3NH7H 2FL5B 3LNHA 3HHMA 3NJJA 4P3CL 1WFTA 2PPCA 2GCYB 3BIAX 1ZHKA 4RA3A 5D96B 2PCPA 3KLKA 2D03H 2ICWB 4QEGA 5IFJA 1I8LA 3JYCA 2XXGA 4XBMA 4M8UA 3KWWB 2XN1A 2AJXL 2VISB 4TSAH 3Q9QA 3IVKB 4GAGL 4A7UA 5IY5B 4KVPA 2ZOKB 1CFVH 1IAII 3HLAB 3UZQB 3FBKA 2CO3A 4D0BA 4AH2A 4L1SA 3U48A 3VFSA 5AAWA 3CHQA 3VFPA 2IBZY 3VSUA 1X6LA 3QZMA 5J7CC 4M1DH 4GMSL 1FWXA 4IEFB 2C5DC 4LHQB 5LCVH 4B5EA 1WFOA 3DX6A 1MCPL 4P2CG 4OTXL 3FTGB 2FLRT 2ZYRA 5SX4H 1TO4A 3EDJA 5CEYA 1YN6A 1CLOL 2J1XA 4RBPH 1TNNA 4GKZB 3X13A 1CBVH 4HKBB 1YEJL 3DIVA 1P7QA 2Y1VA 4HISA 1JAEA 5F1IB 3TWCL 4N8PA 3ZN6A 3QQ4A 3UC0H 4LLMB 3X14B 4R4NC 2GAZA 4CC1A 4PVNA 4DFHA 4YSRA 5I18L 4M48L 1XFPA 3SDAD 3TA3D 2VDNH 4FA8A 4F7KA 4CN6A 4P5RA 3ARGC 1MKFA 3PIQA 4NFBA 1NIFA 4HCRH 1KJ2L 3MRCB 4DQAA 4X5WB 4ZD3H 4P05A 1EPFA 4N0YL 4UOW0 3HMWH 4RSVA 4J2XA 2G4EA 5F9WC 3VU1A 1IQWH 1HHJA 1N7MH 1TVBB 2OJZL 2YSSB 1J0KA 4I5BA 2A9BA 1RFDL 1HL4A 3RDTD 1ZSHA 5IT2L 1Q90A 3BKJH 1L4IA 1A1OB 1DSFH 3APFA 3HRZC 3STBA 4A6YA 4PJ5A 4L1TA 3BI9X 5IB3A 3LQAH 1NCJA 1IIKA 4P0DA 5T1LA 4F9LC 3BH4A 3W2DH 1KB5L 4PJFB 4FFZL 2WBJD 2CO2A 1QRNA 1AY1L 3OLIA 4JANA 1DJGA 1FN4B 5JNYB 3NACL 4KV5E 1CGVA 2VDNB 4U49A 4XMXA 5DJDA 4XO8A 3KWUA 4Z7UB 1J8HE 2D8KA 2AXWA 3PAVA 3SHSA 1J88A 1IBBA 3RX7A 5CZXD 2YBRB 5DDHA 5FDWA 1KPRA 3EFDL 4OQTL 1MNNA 1NCUA 1MSPA 3D39E 4YSQA 4Y1AB 5HHXH 4OZIF 1AO7D 2WINB 2VE6A 2IXQB 1GS6X 3V7AG 2WZPA 5E56A 1GZHC 3ULVH 3MRRA 4HKXB 1I7TB 4DO6A 4W9EC 1W6LA 5AW8B 3MLRL 4X6DB 1F4YL 4Y16C 5TDPA 4M7KL 4XCYB 1IC7H 3AUVA 2AGJH 3ARQA 2CGRH 4HD5A 1KTJA 2ITEA 3N04A 1D6EA 1RUKL 2W07B 3IJYA 4MDIA 4FNUA 4QRSB 5I17B 3WHXA 1I8LC 3GSNL 3DJ9A 4UT9L 4QHKJ 5D93C 2K6ZA 4MASA 5D7JD 1RP9A 5D1ZB 1XZ0A 2CPUA 3GSRA 5DZJA 1JYXA 2EUVA 4QNPE 4CVXA 1FE8H 2OQJB 4A66A 3B7RL 4MKTA 3HR5A 2XA8L 1UADC 2OYLA 2Q20A 5I8EA 2E9BA 3G5VA 1NC4B 4PRAB 5DK2A 1WIUA 4WSGA 4A2GA 5JQIB 2Y5TB 4OJFH 1JFHA 3S3CB 1EMTL 3BDBA 4OAWA 4F8NA 4FG6C 4B9JA 1G7HA 1TJGL 4KO9A 1SVCP 2FDBP 5C07B 3T6ZA 3TA3B 4KJQD 2BO0A 3NAAH 2GK0A 4AIEA 3N3EA 4LAQH 2YEQA 1BQRA 4FQ1L 2OMYB 4GY4A 3BUPA 1N4XL 3EFDH 2IBZX 4M1DL 3AXLA 4BH8A 4Y5VA 1JYVA 5IW1B 4JQXC 3RPIB 3HIZA 3PWNA 2H0EA 3H4HA 4HIPA 5GRXG 3DURB 4UNTA 1PZ3A 4MJIE 2NUPA 2HB0A 1MHEA 1DVUA 4HFUL 1PQZB 4A55A 4YC2B 5DHVH 4Z78A 2VGLM 3POCA 1BP3B 2OL3H 1PLCA 2NZ9D 3KH4A 3RAJH 5IVXF 1XD0A 4IBZA 5E9DB 2EDYA 5D71L 3MUGB 5E8EB 3ARGB 3V5KA 2ZWKA 5JOPD 1KWGA 3B8YA 5EV7A 5CJQH 4FLQA 2EXTA 3BUBA 1QFUL 2H6UA 3VFVA 4Z1PA 1X5AA 3IJ7A 3NCJH 4AXWA 4BBWA 3EO0B 3D85D 1PBYA 1XZWA 1OF2A 1RU9L 5SV4A 1E42A 2D9CA 1DE4B 3L3IB 4ECNA 3KYMB 5BV7H 5JW4N 4LZKA 2CLVA 2WIIA 2PN5A 4C56E 3NSDA 2QKIA 2DBLL 5CCKH 2CBQA 4UNUA 5JORA 1XXDC 1B88A 1J1PH 3O2WL 5G5DB 2EXSA 4ABWA 1AACA 4MGXA 2NZ1A 2CR6A 5J0BA 3EOBB 4NZTH 5DVOA 3MRQB 2K7PA 1BDYA 4KQ0A 2AXFA 1OM3H 2DJUA 4GKNB 3DTXA 3DXAB 3L7EB 3MCG1 1KB5H 1PEWA 4XOBA 3ZVVA 3CDGA 2XKNA 5I30L 4EF3A 1OPGL 4JKMA 4XXWA 1E4KA 2X4PB 3AT0A 5JXAH 2EYSB 1NFIA 3MV9B 1TZ8A 1JPEA 3EDEA 3NJNA 3WKNA 4Y16A 2R2HB 4OGYL 2AXGB 3CSTA 3FQWB 3O6LL 5KJ7E 3C5SA 3CZUB 1S7XB 3GNMH 1NCNA 2M2DA 4LVHB 3WFZA 7CGTA 4LLQA 5AVXB 1URZA 1QR1B 2BHYA 2GSGA 1RSYA 5DT1H 5ELIA 1U6AH 4ZD3L 2E7HA 5CJQL 3LPFA 4H1LH 2H0PA 4XCEA 4G3YL 5EO1A 3VM5A 3VXPB 2ID5A 1BMWA 4X6DF 1NBVH 2EP6A 2ROYA 1JF5A 1JHLH 1O75A 3K2IA 3QCVH 3MNWB 2Z8WC 2PO6B 3QZWG 1YEFL 2NRDA 3P9LB 4NQEB 3RX9A 3WS3B 3ZO0A 3D4ZA 5JIMA 2EKSA 2QT6A 4PB9L 2Z92B 2H8PA 2E9WA 2XX0A 4WCYL 2Y22A 2FBOJ 3QXWA 4MQ7B 2X0UA 1DQLH 3OKNA 1JK8B 2EXWD 2DI7A 1ZK9A 1A7OL 3GHPA 1HJCA 1RERA 3X3FH 5F0JB 3WDJA 3BZ5A 1OP5H 3T65B 2R4RL 3KPPB 3ZKSD 4O02L 1KACB 4NP9A 5D5MA 4AQZA 3VSTA 4L8BA 4FA6A 5HHOA 3OLGA 1H3UA 4BSVA 5FYKH 1F02I 1XH1A 2QTVA 3H9YA 1DQMH 4TSBH 3TA3C 4F9LA 3CZFB 1R5WA 2C9PA 4P59H 5KOVC 4OJFL 1UCBL 3E6FA 1MJ7L 2MOVA 3MRDA 1BPVA 4YHPB 2Q3ZA 1GXEA 4J8RB 3CHPA 3P4NA 5E6UB 3RDTC 3IJHB 4W4NA 1U95A 4X4YB 3WL9A 4BRVA 3NAAL 4LDCA 1LD9B 3TEZA 2KERA 4L3ED 4FQ1H 1HOEA 4FYQA 4XNUH 4DN3L 3BJLA 1MFNA 2GBUA 5CP3H 2J44A 3MLSH 3HHRB 3JTTA 5BRZB 3BSZH 1X5IA 2Y07L 3W39B 1A6TB 5FYJH 3EYFA 3JV6A 4TNFA 1X7QA 1KXQA 2AJYL 4F58H 4OZFA 3T04D 4HKZA 3BVXA 4WENB 3BO8A 2LU3A 5JXEA 1DEEA 3CAFA 5DCCA 1OLLA 2FQDA 3V7AE 1IEAA 4U1IB 3OMAB 4U6XA 5IGXL 4HJEA 1Q9KB 1A6VH 1MF2H 2ZF9A 3U4KA 3BZDA 2BJML 3ARBD 4ZMOA 1WCBA 4OCWL 1HXMA 4G6KH 4PV8A 4Q9BA 4QCIA 4WUUA 3ZUNC 1DEDA 4Q89A 1D2OA 1E9OA 1TKWB 2CAKA 2BP0B 5TPWL 1U8KB 5E6IC 3SYQA 3NDYE 1JGUL 1WICA 3NCJL 2HAZA 4LGSB 4UI2A 1KIUB 2EO7A 2HTLD 1JRHL 5MHSD 1MCRA 1XGUB 5FYKL 3IGAA 2DIEA 3ULAB 2OJ1A 4CAGA 2NR6C 5I6NA 3ES6B 1L9PA 2RHEA 2Q86A 1FV1B 1KGUA 3BPLB 5D6CA 5LWYH 1AS7A 3DUUB 4MJ4A 5DZVA 3ZKMD 1KTBA 3F12B 5KG9B 2BFVH 4PRHA 2QKSA 3FB7B 2CJ3A 4FNSA 5DTFA 4E9VA 5BZXA 4ZJ9A 5T1MA 1XH3A 2V9TA 5E8DL 2LVCA 4LIQL 5DZAA 5J8OA 3AU1B 2YXWA 1HX0A 1D2PA 3LSOA 4JO3L 4MYPA 3ABMB 1PMYA 2Y23A 2CNZA 4YO0A 2IDTA 2AJ3A 1Z9PA 5EORL 4JGMA 3HI6L 2W88A 3PP3H 4TQEL 1A6WH 1LO4L 3NIDF 1NM9A 2OMNA 4DEWA 8CGTA 2MRYA 4CMHC 1ITCA 4MD5A 4BDVB 1BVKA 3CFKA 2WY3B 4EI5B 1V05A 4RX4A 2AZUA 3PIQB 3TEWA 3O45A 2AV1B 3LH2H 3V0JA 3ZTCC 4IIQC 2BVOA 4XCNA 1ROWA 3W11D 3MGOA 1FDLH 3RIAK 2APSA 1JZ8A 5G2NA 5CUSH 3IS1X 5HHVL 4ZXBD 1DJWA 1GMEA 5C97A 4YHIA 2JIXA 2PYFB 5DRWA 3MUUA 4NCC1 5F88B 1RSFA 3KPMA 4GUCA 3AQDA 3N5AA 2H3NB 4P2OC 4KJQC 5CD5D 2VUOA 1YPZA 1FVEA 1THCA 4Z0BL 3D9AH 4LLUA 1CXKA 1SOSA 5LWYL 1CXHA 3QUXB 3CXHK 2VN6A 4KI5F 5K39A 3V10A 4ZFGH 4G7SB 1AR1D 4FQPA 4JAMB 5CINL 3G04B 4Y1AE 3I6GA 5B21A 4YXKL 3VGBA 2NT0A 1BFTA 3D39B 4NRZB 4R5XA 5ESQB 4CSPA 5C0FB 3L3JB 4F9PA 1F11B 1BAGA 3TONA 1E5CA 5DRNA 1AZNA 1MFMA 1R3LB 5FDYA 5IBTL 4TUKL 2Y2TA 3RTQB 6PCYA 1HCZA 4PJGA 5GGSB 2OI9B 4MAYB 1NANI 4NN7B 4WHTB 5DJYB 5LN4A 4TKWA 3CX2A 5HJ3A 3GMMA 2BSTB 1G0YR 4ZFQA 3VWJB 2CM5A 3KM1A 3ARDD 3A24A 5IVZA 4KO5A 2DQIH 5JPMA 5JW4M 1MELA 4WCYH 1A6AB 1XIWB 1QOKA 3MBWB 4PMFA 5B38G 4JFOA 3B9EA 1XF1A 3P4MA 3CXDL 5BRPA 5CP7B 2R69H 4E41D 3WLWC 3MRKA 4WJ5A 1DTUA 2DM4A 2W0FB 3FDWA 4LCWE 4P2OB 4GW1B 3WTWA 1QEXA 5TPWH 2AMGA 2CO1A 5DQ9B 3LKRA 4MMXA 4N0UB 4HPOH 1LO2H 3NA9L 2MQ0A 4X8XA 4Y16D 4P59L 4Y4KB 3QWQB 3BQVA 3MRPB 1N9PA 5DJZA 1PG7H 3CSYB 2NLJA 3KPOB 5DQDL 2FWOA 1DDTA 5EUKB 3WGVB 2J73A 5E2UL 1HE7A 1OK8A 4KNQA 4GXVL 3ZIMA 4JFFE 5IBLC 4BK8A 4G8FB 3PL6D 4D0DA 1NDGA 2DDQH 4JPIA 3GI9L 4NKOB 5CIPA 2EVJA 2NUPB 2DOCA 5ESVA 5L2KE 4QGYA 1A6UL 3LNIA 4C58B 4R4FL 2FEEL 3BPCB 1A7QH 3WJJC 1H3GA 4POZD 4L4TE 4YNYB 3AGVA 3O41B 3B2PA 1JPTL 4JO2H 4YDJB 3UXFA 3SGKC 4WW2A 4AYGA 3TYFA 1GIGH 1IAKB 2VWEE 4NOBA 1QACA 1PDKB 2KZBA 4LLVB 3DHMA 1GCYA 5CILH 2IG2H 1ZHNA 3HAEA 3MLZL 2IPKA 1AGCB 3BN9D 2QPFA 1F6FB 3BUTA 3SCMA 2G2RA 5D7HA 4MMYA 3TJEH 5F1NA 2PPAA 1QW8A 4LVNC 4DPBX 5ACZA 4IHOA 5I75B 4Z76A 3KWWA 3ZE2E 3HAEG 4L8CB 2XWJB 3IVKA 1EHLL 6TAAA 1TQTA 1KYUA 2FL5A 2G30A 1K72A 2YD1A 3CVIH 4HXAH 2VLKA 4NN6B 5MP6H 4LP8A 2OX5A 1P84K 3QWNA 2JELL 2J5LB 3KPPA 2TRHA 1ID5I 3UAJA 1EXUA 2WQXA 2XYCA 3NUKA 5DQDH 4F8QA 1KXQE 3H9SB 3A6BL 4WTZG 3SDXB 4YFLI 3TVMB 5GS0L 4W9IC 5AVVB 4CSZA 5HHOE 4XWGH 3P9WB 2NW3A 3IJSA 4LEOA 2AZAA 3MXVH 3JVGA 1NDMB 4J3OF 4HDIB 4YEFA 3LKQA 2OP4H 3QDME 4TUOA 3U1QA 5E7FA 4I2XB 2HVKB 1TDQA 3WFCL 2VKXA 2WGXA 3IDNA 1A6WL 1LO4H 2Q76A 3IDJB 2AW2A 3QHTC 3SO3C 2BP5M 1T7VA 4NYLB 1XWVA 3JWNG 2UWEF 3ESNA 4LMQE 1DN0A 4LEBA 5FOBB 4M5ZH 5I1JH 5JHLH 1NSNH 2YEZB 2WBJA 3VYNA 3TNMB 2GSGB 1ZLVK 1BM3H 3O2DL 4PGEB 3AFLA 3GKZA 3VWJC 2A83A 2O93L 1AXSA 1NGYA 4Y2DA 4M43L 1B3IA 4QXUL 2AEOA 6FABH 3CV5A 4JN1H 4NQCB 4X98A 5DZPA 2P1YA 5DJCB 3NTCH 1BXAA 1G94A 2CPCA 2N01B 1EHLH 2DLGA 3RURA 5L88L 4PGDA 2OMUB 1LK3L 1XR9A 2N1KA 2X42A 1J10A 4QIRA 4APXB 5KYYB 3J8F7 4FI8A 2Y72A 3UZVB 1CD9B 1KIPB 1J11A 4G43A 1MI5A 4GSRA 2WYIA 4ZQTA 4IBLT 1A22B 2IGFL 1T0MA 3QG7L 4HJIA 4NBZB 5FFGA 5TF0A 3V0FA 4FTVA 3GMPB 3EH1A 1BIHA 3QFJE 3ZTDC 5JQ6L 1H3TA 3BKCH 1OGPA 1A7PH 2O4EA 2R2BA 1JNNL 3HB3D 4FKKA 3ZTNL 5L9DH 4HSAC 1L0PA 4K73A 3V9CA 3TF4A 3GRWH 5DFWH 1NC2B 3VD5A 3MJWA 1BQLL 2P45B 1CI3M 2DQHL 1FFRA 3D8MA 3WJJA 2OW7A 4YFEA 5T8IA 2DWEB 1FN4A 3FN9A 4X7TB 3X12A 2HJFB 3QQ3A 2X44D 4OLVH 2YO3A 2GFBB 1L9OA 3D30A 4JG0L 3VD7A 2QGEA 4J3WA 3GI9H 2VR5A 1SBSL 1KBGH 2VDKH 3NCYS 2VRQA 4YWGL 4J5VA 2JCWA 3GSXA 4E2OA 3FBQA 1IAOA 2YZ1A 1ZEAL 1HHJB 5DK3A 3VDAA 1SJMA 5JPMC 3MNMA 1M7DA 3ASOB 1KLFB 2VABA 2DLEA 3QDAA 4PR5A 3FRPA 4OLEA 3S3DB 1CWVA 3FSAA 5F7DB 3BD5A 3VJ6B 2P24A 3GDBA 1BLNA 2OR9L 5DC0A 4MNGB 2IH3A 5IW6B 2ED6A 2EE6A 2K9UA 4WLCA 3CE1A 1O6SB 1RLWA 2YSTA 2W9DL 3HHSA 4WO4B 1OQXA 5GSRA 3KPRB 2QPEB 4JL2A 5I1HL 4HX1A 3IFNL 4JM2B 4AV5A 1M42A 5BXFB 3D7PA 3QRGL 4XBGB 3ME0B 4NM4L 1BOYA 4Q4IA 4XMLL 3MV7E 4P23A 2YK1H 4XMPH 2YHGA 3VD9A 3E2HB 4OT1H 4Z7UA 4HKXA 3GJEA 5GHWH 5BUGA 4X80H 1IIIA 1QSEE 2A73B 2EDMA 3MA9L 4JLRA 4OCYL 2X89D 4U3XA 4DCQA 5DUMH 4FMVA 1BEYH 3WENA 5D55A 1NICA 3RDTB 3PJSA 1KGXA 1XH3B 4WV1C 5C0BA 5C0ND 4DP1X 2ICES 3GYRA 1NGXB 2O30A 2KL6A 5E4EB 5E2WL 1TU2A 1Z5HA 4FNPA 3TT1H 1PZDA 1SJHB 2YC1B 4BCXA 4XCYA 5EOTA 1RZJH 2DLTA 2E4FA 2NCEA 3KH3A 2Z31A 4M4RB 2W91A 3Q8BA 4JQIA 2V17L 4MXVF 2HVBA 3VDBA 3HRZB 2BS9A 5AKSA 3MRLB 3SGKA 1KELL 2CCLA 3BGMA 5B38A 1F8TL 4NC1C 2WKOA 1XCQB 4IIZA 4LKXA 2ED8A 1LNUA 4OUUA 1XAUA 4Z7VF 5JLZB 5F7HA 2D7TL 3K71B 4L2LA 3QDGD 4LCVA 1QVOA 2R7EB 3CFCL 4R26H 4YDVB 5AKRA 5B39A 3CUPA 1ZGLM 2CDFA 5HHMD 5EF0A 1Q0XL 4PW9A 3CVIL 4WQOA 1Z66A 4P2YA 3GKWH 4HMDA 4YAQB 4BD4A 1KC5H 5MP6L 3GBNH 1VA9A 4ZNEE 2PXYD 4AGLA 4GSQA 4AKQA 4U05A 4JM2C 2WVTA 1XSJA 4OJYA 5T1DH 4DK5A 4U1LA 3BWSA 3X1BA 3GIZL 2WXMA 4GW1A 2P26A 4AL8C 4JRYB 1N8OE 1W72A 4OKVA 3B2VL 1NEPA 3U25A 1HEZA 3JWDH 1AVAA 1F90H 2XTJD 4KOCA 4JHZA 4CMMA 4DTGH 4QI3A 4IGBC 2HTLC 1FI8C 3HLKA 1NPUA 5GS1A 1D7FA 3A4EA 5HDWA 1UVQA 4RDQF 3PNWA 4FP8H 4WWNA 4UTCA 5E9NA 2CSPA 2MNWA 4WK2B 1BFSA 9PCYA 5GZOD 4PP1D 2GHWB 1PF3A 1KB9J 4LPYA 2BIHA 3OVUB 4XOAA 2PR4H 4B9IA 3RVTD 1IC0A 2WQWA 4L9LC 1JXJA 2X3AA 2MCMA 2BVEA 4HHAB 5H94A 1WISA 2AEIT 1YVLA 4OVUA 1BAFL 4QAWA 2FT8A 2QZ5A 3P9LA 4GUPB 3MRNA 3DO7A 1PAZA 2BDNH 4LLVA 4M3JA 3ESVF 3VRLF 1N19A 3U6XA 2JKWA 3HLAA 1OZTG 1I3GH 4HJ1A 2GW5A 3DOSA 3V5HB 1T66D 5ECGA 4ES8A 3VH8A 3FAWA 3IJEA 4JDVB 5DFVD 2ZX9A 2PWHA 4LCUA 4RLDA 4E68A 1ZDQA 1CD1B 1N64H 1A2YA 5F7FA 5A2BA 5I8CA 4L05A 3NJVA 4E5XG 4RAUB 1MFEH 2WQUA 1IARB 5I1KL 3HOGA 3HNVL 1KTCA 2HKHL 3S37X 1A6PA 4BFKA 4Z7OF 3CVHB 3CDGB 2YLHA 1PIFA 4RIRB 1X7TA 4H26A 5IHUH 1D5IH 2UX7A 1OP9A 4NUPA 15C8L 4HJTA 4DESA 4W6XB 1IM3D 1BAWA 5LXGH 2XFGB 4RGOL 4A38A 1H15A 3FYEB 1MFCL 4FFYL 2X4NB 3BUYA 1AQKH 1I8KB 2F1BA 2LGNA 2WPGA 1UT2A 3RZWA 2AK1H 5DUML 4HGMA 1MCBA 3A3YB 3O11B 2QMJA 3SOBH 3C12A 1CF8L 3OKKA 1I4FA 4O5LL 5D1XC 4X5RA 1PCXA 1XDTT 3NG5A 2K8QA 4EJ1C 2A6KA 1TZHB 1YN7A 4ENZA 2OTWB 3HN8A 1RD6A 2Y6SC 3C6LB 2IANA 2NSQA 4PGEA 3D3VD 4HULB 1VF5C 4EI5C 3ENEA 1UZGA 4BWUA 3SKOA 3TWYA 2EO9A 3MV7B 1I3GL 4HSQA 1RK7A 3B34A 1Z6JT 1HXMB 3VGHA 1MLCA 3QO0A 3QQXA 4LCYB 2WNXA 2WKGA 2FQEA 5HY9B 5DJCA 3DJRA 2Y06L 4JJ5A 3ZK0A 4AENA 3VW3L 4JG1H 5LO7A 4DEUA 5I16B 1X5FA 3AWEA 5I1HH 3Q01A 3QWRA 1SY6A 1UD2A 2XN9B 3HE7D 5EB9A 5FKAA 3CC5A 4NM4H 4XMLH 4XTRD 5I1KH 1Q0XH 1YY9C 2D7PA 4KITB 2HT3D 1O7DE 5AB1A 3IRZA 4JY5H 4EI6A 4FADA 3QIBA 3BKJL 1KIUA 2NY5C 2WXNA 5DRXB 2BSDA 5SWSE 3VFMA 1OCWL 5CF3A 1GW0A 5C07A 3OHMB 1QI3A 2Y7NA 1UWYA 1QFWI 1XSIA 3HI5L 3HC0A 4AK1A 3UTPD 1S5IL 1JYNA 1NDMA 5A7EA 2ZZUT 3RWJB 4RRPA 4UT7H 2X0WA 2PO6C 3GHEH 4UT6A 5HDBF 1QPXA 4I7ZC 2NY3B 1KGIA 1K3IA 3HBQA 1KYFA 5C9KA 1JPFB 1XF5B 5AW5B 4HWBH 1RZKC 2HT4D 5SWZE 4OZGF 1KYOK 3T1FB 3CHSA 5HHXL 1G43A 2KZKA 1VEPA 5EOCJ 4AJYV 5C92A 3MJGX 1GJIA 3P4OB 4AL8H 3GQFA 1ZWIB 5I8EB 5A7BA 1BJ1H 3IPBA 1IEBA 4G71B 2PW1B 3FB6B 4UIMA 3MYZA 4F8LA 3VW3H 3EYQC 1XIWC 1T5XB 2BSSA 2CZNA 3CQPA 2OA9A 3BH9A 4PJFA 3RWGA 2XETA 2WVVB 2NMSA 4K5NA 4AGPA 5CAYB 4YVUA 1EFXD 2Z93A 3WEXB 1UC6A 2WHVA 1SEQL 1ESOA 1KT2B 4G6JL 4G80B 4KQ3H 3MO1B 4PJDA 5D96C 2ATAA 2VXQH 4G8GE 2R51A 4WFFD 4I88A 5AW6B 4XZ4A 4D7PA 5L6YH 5H4YA 5DMIL 1AKJB 4UANA 1R3HA 3VFUB 5GJSH 1RZ8A 3ZGHA 3BRFA 4HU8A 3KR3L 4KVCL 2QBWA 5CBEA 2BNRB 5MHSE 5F7UA 5EBMA 2E56A 4JFXB 1DFBL 3Q2VA 3MLXL 3NP4A 4DKFH 1L9MA 4RRPG 3S5LG 2XG5B 4EQ2A 3QUMB 1L0XA 1MHCA 2R29L 1CGTA 4X8JA 2YUXA 2X4PA 3HRPA 5TE6H 4JM0A 3WIFB 1UM6L 1E3XA 3RTQA 4L5FH 2BMKB 3ML8A 3PJSB 3WXWH 1W0YT 4JM4L 1N4XH 5GGSA 5L7XL 4HPYH 2G5UA 2B3RA 2XUWA 3K8LA 3OAYK 5FA3A 3US1A 3IF1A 4GRWE 3WLBB 3IAGC 2FBRA 4U31A 3ATAA 5HDQH 3KHQA 1EWHA 1GGTA 4P2QE 2Z31B 4M4RA 1MCOL 3L3OC 1KTLB 1YDPB 4PWGA 4WFHD 2VDQL 4NZRH 4ZW7A 5DJYA 3BPOB 5T1KB 4F3FB 5JORB 1U8IA 2WQSA 3QS3A 3B2UD 3QYCA 4KGJA 5DJ2A 2BS71 2ZXWB 5TDNA 1OP5K 5K9KB 3EO0A 4JN2A 2EJ1A 3B9KB 3W0WE 4ODWB 2WLNA 4UQ2A 3QJFB 4IMLB 1MCWM 4W1TA 1KCVH 4IRSC 3O4LB 1QFUH 3FO2B 1TJHH 2ALWA 4O4YL 2EQDA 4QRUB 5EN3A 1TZOA 3IEAA 3VFWA 3CFJB 4WEBH 2C4FU 2Q2EB 3CIQA 3S3BB 4L8DA 3RPIA 1U8JB 4EXKA 4OFPA 1P4IH 3S6CA 1A8ZA 5KS9F 3K2UH 3BFWA 2EYRB 3BEWB 4Z77A 3R1GH 4UBDC 4Z0XA 2W0LA 5A16A 4PYGA 5IHUL 5IROD 5I6OA 1SUHA 3GTTA 4EUPG 4YHZL 5CJOH 4LLDB 3BLKA 4GJTB 4NWTL 3SZ6A 3MV01 1BQHA 2IGTA 3V4PA 4NKDB 2LAAA 3A47A 3FCSA 3IDGB 1NGZA 4JGUA 3D05A 4X4YA 2Q10A 1EZSA 3C08H 4CC0A 2V2TA 4UZUA 3ZTJH 4O5LH 3ZPDA 3HI5H 2VLRE 5FA4B 3SCMD 1RZIA 3CU7A 3N1GC 1TYJA 4DKEH 2BZDA 1HAUA 1NZRA 3MNWA 1QKZH 3LHAA 1K5WA 3WOVA 2XWDA 4YSTA 7TAAA 2XN9E 3MLVH 4O58H 2QADD 4AGMA 3WUWB 3P2BA 2X1PA 5FS5A 3TBVB 3CN2A 3RWDA 5HYEA 3Q6FB 5FB8B 1BGXL 5ANMB 2BPBA 4MLIA 4Z3EA 4W9FC 3BVDB 5ICZB 5AZUA 3FS9A 4ADJA 4TRPH 4HFWA 4W9LC 1CYWA 1MH5A 3B9KC 5D1XD 3HBPA 1NCWL 1L9RA 4AC4A 4N0CC 3E80A 5JPNA 1HQRB 1VFMA 1PD0A 2CRZA 4M8RA 2E8YA 4CC4A 3HFML 4CNIB 1G87A 3I9IA 3VXMB 3GD1C 3MRIB 5IJKA 3EBAA 1WFMA 4D94A 4GRLB 5CJOL 3T0EC 1A7NH 1KY7A 3LNFA 4ZMPA 1XF2A 2V2WA 4MAYC 3QIBC 4LPVA 1UB6A 2JKIS 2HZHA 5TDOA 4ZFOA 2ITCA 4PV9B 4I18C 2VMFA 4OZIE 4QHMA 1P9MC 2J3SA 1U21A 1NLDH 4Y2NA 1M7XA 1UG9A 4XMTA 4H5SA 3T6QC 3VXRA 2GBTA 1WE5A 3B5HA 3WFHA 3BQUA 3JWNC 4JMXA 2HT2D 2DYSB 3W1ZA 4S1RL 1IGMH 4Z23A 5FCUH 4OR1A 3WFEL 4OCMC 3LS4L 1LEIA 2BXYA 2OI9C 3QXDB 2N56A 2J21A 2ZP0T 1EEUA 4PJ5B 5CGYC 3ETBF 4QHKI 3OM3B 3NIFB 1MNUL 1ZT7B 1YCSA 4RGND 1OAQL 2NY0C 1DN0B 1UQSB 2C7FA 2J4WL 5FHBL 3KEHA 1QW9A 4PP2A 4EPSA 2OCCB 1G7IB 3BSZL 3HE6D 4R7XA 2ZUXA 4ZAKA 4LCWB 3TTSA 4OFQA 4EZKA 1OZUA 1XEDA 4FTVD 4W68A 2C3VA 5KJ4A 1QA9A 1TMCB 3RILA 4J4PD 1UACL 1NC4D 2ZWNA 2H3XC 3MJ8A 2G3MA 4HJ0C 5FGRA 5C0CB 3WO3B 4LOEA 2VDPB 4PP1C 1FP5A 4JDVA 2VRKA 3O6FC 4HDIA 2B1HH 3DK2A 3Q6GH 5IGXH 1P6FA 1L0QA 3WTUA 2ZOOA 1G9MH 2CO7A 4HUKB 1WD8A 4WEMB 1CBVL 1TJMA 3SE4C 2AK4E 1G4MA 3CC5B 2G9HB 2YD3A 3D18A 3GZKA 3NPSB 3QA3B 4EZMA 4FZ8L 5IUSA 3WGUB 4KK8C 2E4TA 2JJTC 3PWLA 4OV6F 4EDXB 2CR3A 4JL1A 1QRKA 4E9RA 4JPVH 4W9HC 1AE6L 2QSCL 2W07A 5INDA 1GGUA 2HJLB 3Q8AA 4JM2D 4R96A 4MZ2A 1NCAL 2GJRA 3TT3L 3V2AR 5L8KB 3VACA 4AIZA 2VRAA 2J71A 4X6DA 4C54A 1CXIA 4E9XA 3RVVC 4B50A 4PJ7B 1T83C 4O00A 5JW4R 2BSEA 2NY4B 1EJFA 1A4CA 3VXRE 4X6CF 5CBAA 2JQAA 2VDPH 2F68X 3NZ8A 4XOCA 2NCMA 4NO0D 3H56A 3UZVA 1N0XH 1X5HA 4IBVA 2N3JA 2BP0A 4MJ6A 3AS2A 4EUPB 3HI6H 3MREB 4TNEA 5KSAC 4FTVB 1PYWA 1FYTB 4P46A 2OQJA 1ZA3B 5EDSA 3MV7A 4YE0A 5JPNC 2VC2B 2JLPA 1YA5A 2CLRB 2CJUH 3I02B 3ZRFC 5B3JF 2AABH 1TJHL 5BQ7A 5EO0B 3FTZA 3ILDA 5CEXB 2X5PA 3OGCB 1FNLA 4WEBL 4E9SA 3CHXA 2D73A 1C1EH 4UQCA 3QEHB 3RL1B 3BHBB 1P4IL 4F8OA 1NCCH 4PRHB 1TOXA 2I9LB 2P8MB 4MNQE 3C8HA 1TMQA 2SODB 5FW6A 4NQXB 1IQWL 3KBPA 4GRLC 1EMTH 2Q8BH 3ROOA 4PRIA 3GT6A 4XNQB 4XN8A 4BZ2A 2VZTA 3V5DA 1G5AA 3KL0A 1ILUA 5IT2H 2Y36H 2V9RA 4C56B 3BQUC 5K9JL 3SGJA 4XXWC 3FQYA 1OTTC 2A0LC 5F6IB 4X9BA 3FH8A 5ES4B 4H4NA 3KGUA 4RZKA 3PGDB 4KZ0A 4J3UA 2C9QA 4TNWK 1JUFB 2F54B 3F7RA 1OF2B 1NA8A 2K6WA 3MUGA 3PWVB 4NPYA 3VXMD 3KG5A 4G8IA 2CLVB 4PJAA 1CDIA 4IOFD 4U3SA 4WI2A 5FYLH 5HGAB 4FJYA 4JKLA 2YLKA 3MRMA 2Y7QA 4I48B 3OLDA 2HWZL 5FUZH 3TEXA 1JPSL 4HIEA 3DPBA 4WO4A 3D07A 5HJ3B 3EYQD 5DRWB 5JDJA 3VWJA 4Z3FA 1X4YA 3F04A 4YSCA 3SKMB 2X3BA 2CLZB 5KVDH 3FRPB 3V0EA 2NNAA 2R15A 4RWYL 1VKXB 1ZWIA 3CK0L 2AABL 2QLVB 4DO4A 2GSIA 5KUKA 2ZCZA 4AVJA 4ZW5A 4QXGH 5FFLA 1KJ3H 3VG9C 1OAZL 1R3IL 4H0GA 5DMGC 5AVTB 2ZCHH 3KJ6L 2YIHA 3BH9B 3ILQD 5HDBB 1GC1C 1LHZA 3QT2A 4N28A 3AROA 4L8CA 2FZ3A 1CFNB 4JAMA 3KDPB 4MJHA 2ZX8A 1W0WA 1AZVA 3J27A 1U91B 2YPVL 3NYKA 5DHXB 4HV8B 2OMXA 2PYEA 1E5BA 3GJEB 2W92A 1S7XA 3IMTA 1IILE 3NPSC 2DQGH 1K4DB 3OSKA 3H53A 5GGQL 4M62H 3G08B 1JZ7A 3VQ1C 1CURA 3HUJA 4BSWA 1H8LA 4C4KO 3UBGA 5GS1B 3E9TA 5IMLA 5EC2B 3V4LA 1IGFL 5JIHA 2WBKA 1H6EA 1KFAH 4PJ9A 5DO2C 1M9WA 4U6HB 5A16B 3W81A 2Q0ZX 3RJDA 1QR4A 3L4UA 4YDJA 2X4RA 1KB9K 5MEQB 4HBQA 4MTMA 2DQCL 2N0MA 3ARDA 4PD4K 1XCTB 5D4HA 1CJYA 2P5WB 3H3BC 2Y9RT 5FYLL 4XZUA 3UZEC 2R83A 3BPCA 2XCMC 1K6QH 3SCMB 5HDOA 1WHPA 4JE4B 1IKNA 1BXUA 3W9DA 4X4MA 1QP1A 4F92B 4PB0H 4JO1L 3IF1B 5FHBH 1S3KL 1U6AL 4JZNB 3NA4A 4HCGA 1U58A 3M88A 5DEFA 5DYFA 1X5GA 5KW9H 2XBTA 3FOLA 5C09D 3QJXA 4AYFA 5MENE 1KJ3L 4HG4J 2FJHB 1IFRA 3CBKB 1R3IH 2H2SD 4KROB 4R90H 1NCIA 1RUML 4H1LA 2BRQA 1VFAB 1YY8B 2R4SH 2R2CA 1TQBC 1ZVSB 1SEBA 2VR3A 1CGYA 1IFHL 3ISRA 4LPWA 4RBPK 4UQ2B 1JXDA 3TVMA 4PIBA 1UKQA 1OTSC 3GUTB 4FRWA 1M3JA 1TG8A 2O5NA 3D5OF 4ZFZB 3PL6B 2DPKA 4GAJL 2R4RH 2KKQA 5BW7C 4KBPA 4LDEB 5EEXA 2EC9U 4LP5A 3ZZQA 1E0OB 1WF5A 3DBSA 3BN9C 2Y6TE 4WW1B 4ODTH 3KPQB 4Z7OB 3H9HA 1TZIB 5J89A 1WDAA 5BQ7B 1SJVA 1AQ8A 3RZCD 3KPSE 5GGTH 4J6RH 1FZOA 3MZTA 3PAZA 1L6ZA 2CRYA 2Y36L 1HH6A 3KLDA 2YS4A 1GJWA 3Q8CA 1ZHNB 4CVWA 2X9WA 3CZJA 1QWUA 4L8SB 5EU7C 3LX9A 4HKZB 1TVBA 3LXCA 4JFFA 1T83A 2GJ6E 3C75A 2PTVA 4PRID 3DBXA 5I1IH 1MHPL 5JO5A 2C4FT 2RD0A 5LBSA 3LRKA 3S97C 3VTAA 3MV9E 4RAUA 3FTVA 4FA7B 1GZQB 1YNTF 4HOWA 4P48A 4Z7QB 4YHNA 1I1CA 1NFKA 3DC0A 2OX5B 2DLFH 4K7PL 4BHUI 4LCUB 3NJLA 4A2EA 4M6OL 4JMNA 1WEJL 4KXDA 1HHIA 3RTQD 2P5EA 1RZFH 2AQRA 4FNTA 1EZVX 1N18A 1ZJAA 4IGBB 4OF3A 3S37H 1AQMA 2IH3B 5IW6A 1EGJL 3BZ4A 3DGGB 2XZQH 1NBVL 1NJ9A 3IJSB 4FXGA 2R0KL 1EFXB 3DIDA 5GZOC 4JY6A 1R5VA 5JHDD 2Q8BL 5JHDB 2X4UA 4IU2A 4XE0A 2VUKA 3QISA 1F4WL 3NESA 5CO1A 5D7LA 5EZJA 3T0XA 3TN0A 4NRYB 1FSKB 5IREA 2YAMA 4ODXB 4JPKH 1E27A 1QHOA 3HC0B 4JJOA 3QZPA 4ZDHB 4JKNA 2ADJA 2P8PA 1CK0L 4YLCA 3CZKA 4YJZL 1SF5A 3UTSB 2OSXA 4LPXA 3O8XC 3UG4A 3NZSA 3RU8H 5EU6A 3QYNA 3CTTA 4PJFF 5CJ8A 4YFLF 1UD8A 1JERA 1U93A 2LVEA 3TYGH 3WNKA 1YN7B 4JJ5B 3ZL1A 4JZJA 3MBXH 2XN9D 4L1BA 1S78D 4WKZA 2FE0A 4G1MB 3RVXD 5BJTA 1A6ZB 4Z3JA 4BZ2H 2ZXQA 5E1GA 2VXVL 2V7HB 4P3DB 1MW3A 3QI9B 4L0PB 4EQ3A 3SDDB 2RR3A 1SLWA 3V6OA 3B56A 4EIBA 1SJEA 4GT7A 4K9EC 2OXGA 1FYHB 7PAZA 4HIJB 1SBSH 2VDKL 1J5OH 1PLGH 4ZSOB 5AZ2H 5I16A 3FTXA 3G04A 1CTOA 2F53D 4JFQA 3D3VE 1F97A 5A6IA 3J07A 1QSZA 3OAZK 4AVIA 2AMUA 4XP9L 4FCHA 1Q8MA 4HMEA 1CFSB 4KX7A 4TVUA 1WCQA 2AEPL 3RX5A 3TP4A 4Y1SA 4MA7L 3ULUH 1W72H 2EDFA 1ZV9A 5FWRA 4ALAC 3MCKA 3K1DA 1TENA 5C0FA 2VT0A 3ZL4L 4WUKL 2A73A 3FT1A 1ZKAA 4H8UA 3VFUA 2HRLA 3EGDB 4HXBH 2NXZB 4Z7VE 4G7YL 5E7BA 4RAVB 2HJLA 4Z7IA 4BZYA 2R1XB 1MQ8A 2Q7YB 5HYJA 2R23B 1IEHA 1YG9A 1S7UB 2HFFA 2YFOA 4WW2C 4CADA 1M3IA 3LEVH 5L0QB 2J6WA 4XC3L 4BRJA 3KGTA 4ZW6A 1UA3A 4HK0A 4ZTPH 1NBZB 1DSYA 4XP1H 5E2WH 1I9JH 3QWOA 4XGZA 4MMZA 2P5WD 5D7KE 4A6YL 2J20A 5ECJE 4MNHB 1J8RA 4PI0A 5G4OA 3UTTD 4F2MB 5ITFA 5ALBL 1F00I 5GZND 5ISZB 4FG6D 3QJFA 4ADGA 4G70B 2EDBA 3DROA 1ED3A 1T7ZA 2B5IB 4Q9RH 1O6TA 3B3BA 4XMKL 1D6VH 2OR7A 3UYOD 3ZHLA 4HLEA 3AGWA 3VFWB 2BSCA 5HVGB 3SQRA 3KNBA 1ZVNA 3K74B 4KKNA 1HKLL 4XB3A 3P9MB 2EECA 3V6ZB 2AQNA 3R18A 4Z7NB 5IBUB 2ZSVA 1ZPLA 1EZVY 5C0BD 3IDMA 3ZYJA 4D9LL 1K8DA 3K80A 3VXTA 4E9WA 3FO2A 4GO6B 4MXQD 2AXGA 1GGBH 3GMOA 4PUBL 4MA3A 4LLDA 1B2WL 3GBNL 3TYFB 1HEZB 1ADWA 1G0XA 2BNQB 4ZUVA 5IMMA 2GC7C 1XH0A 2AJXH 3C5ZC 4Z77B 4FFYA 4XCEB 1P1ZB 2VZSA 2WXRA 5B8CB 4GXVH 4KXBA 1UGKA 5EIIB 1B4TA 3QDJB 2DZEA 3PNWB 5LAXA 3Q5OA 2MKLC 1QLRA 1WGVA 2PO6A 3BLBA 2EDOA 4NQEA 1TPXC 3WS3A 3GMNB 4LBEA 1KZQA 1UA6L 3FB5A 4LLWA 1C16B 4GG8B 2XKSA 3V6OC 4CDHA 5AZEL 4L37A 1EFQA 2ZPKL 1P2CA 5E6ID 1Q9WA 4AYEC 4LQFH 3OSVA 1UM4H 4NUJA 5I71C 1GCFA 1DP0A 1F2QA 2EILB 5HVWA 4XVUD 5D2LA 4X83A 4YXHH 1IGCH 5CSGA 3R0NA 2WOBA 2Z8RA 3CZSA 2EC9T 3C9NA 2B1OA 3LNDA 1P7BA 2YQ2A 3F83A 3EADA 1QSFA 2VXVH 4ONFL 3QJVB 2D9QB 1HAWA 2FIRT 1Q94A 1NCGA 3O3BA 5AUMB 4P4RA 4HIXL 3QEQA 3S37L 1VHPA 3AS3A 3MCLH 3VFOB 3NABH 3O0RH 3CDZB 3NT0A 2NY0D 1X5JA 4OI8A 5TQ2H 2X6BA 2X87A 1EEZB 3KLHD 2GITA 3H9SA 1CDJA 1WA0X 2F2HA 3EYVB 3MV9D 3NCMA 4N0YH 3FRUB 3SDXA 2KLRA 3BX7C 5E6YA 3TFKD 2Q76B 1KJMB 1T5WB 4XPFL 4E0RB 1XF4B 1O5DT 4PRHD 1RPUA 2CCWA 2JELH 4UT6L 3UX9B 1UURA 3G9AB 4I85A 2B8OT 2Z7ZA 3GXDA 5F3HB 3KVPA 3L6FB 1EZLA 2IDFA 4AC2A 3LB6D 5C6TL 3DUSA 3OR7B 2P5WE 4G9DA 2AEQH 2DI8A 5ABAA 4TL4A 1I3VA 4M3HA 3BUYB 5IOPA 5IJCC 4K9JA 3CSGA 4LKCB 2X4OB 3KYAA 4GOSA 4FI6A 4C57C 1SHXA 5I1JL 1RUAH 4E41A 4U7SA 4X6EA 2PXYA 4FQHA 4HYTB 5TH2A 4OLYH 3GBMH 2CK2A 5ANMA 4X0NA 5BMFH 2KQMA 4CL7A 3HZYB 3TXAA 1RURL 2JIXD 1J0JA 3RWIA 2DH2A 3US9A 5DEGA 4XR8C 5JHLA 3OZ9L 4ETQB 5HI4C 3L4TA 4ELKB 2ZWSA 3DGDA 1C5DB 1XGQA 3QAZB 4NERA 5DQJA 5A2IH 1PZ5B 4HUUB 1MI5E 4G8GB 4QHMB 1L9TA 2LU4A 4W4OA 5LN8A 1QBLL 4K3EH 4Q9RL 4X7TA 3X12B 1L9SA 3L3HA 2X7LB 2PPEA 3L9RA 1C8QA 2GFBA 3PXHA 4ERSH 4TNWF 3O2WH 1HEJC 5T1JA 3W3BA 3E8UL 2CCVA 5E08H 2EDDA 2X2JA 2P7TB 3EOTL 2BCKA 4WSKA 2NY2C 3PFUA 1TVHB 5CN1A 4F91B 3NOIA 2XN2A 3NCCB 4KXCA 1GGBL 3RKDD 1NC2D 1UD6A 3DI3B 3G6DH 3SBWA 1IC4H 3SODB 2CBOA 4LARH 2E27H 5D1QE 2IAMD 5D5MF 5HYQA 3OC8A 5DJ8B 2QQLL 3ARED 2IANB 5AW4B 1T2QH 1FO0L 1OPGH 4LHUB 3K6SB 2E46A 2K7QA 3QUHA 1MJ8H 3NSYA 4ZNCD 3VNYA 1DUZB 4DNLA 2PPDA 1MLCB 4ANVA 3VFGL 3V4UH 3NCFB 3R8QA 2A6JB 4PP2B 4PS4L 4MSWB 1I82A 3VWKD 1ZS8B 2YGVA 4P57B 4X7CC 5AZEH 1DUYB 2BC4B 3BAWA 4HHGA 1RK1B 4YHKH 4HWBL 5BZZA 4MNGA 2QQQA 4HUWA 1KMGA 3QDHA 3GSOB 4N86A 1AKJA 2D3NA 1N0LB 2VLLB 2VLKE 2FO4A 2WVUA 3QO1B 4KJYB 4NXKA 2BVUA 2Q7AA 2X12A 4OV5A 4QHPA 5KVFL 4YE4L 1TQBB 3NIFF 3TFBA 1W0VB 3WN5C 4YDIH 4FF9A 3QNYA 1LE9A 3MV8B 3ZDXF 5KSUB 3AQYA 3I02A 5ESQA 5BQDA 4UQBA 4KTGA 4ZMQA 4A04A 4P5TD 1BXVA 1B2WH 4PG2A 2WNGA 4GRWF 3QIUD 1MDTA 5DMYA 3PHSA 4ZMLA 4EDWH 3AZUA 2UUDH 5FYJU 4HUXB 2IF7A 2PCYA 5C7XH 1DO6A 2NY6B 3SY0B 5GS1C 4WWKD 1NOAA 3UEZA 4ALAH 3VGAC 3PP4L 4GT0A 3L48A 1EQWA 5CR1A 4U1SA 2GJZA 1SJHA 2CK0L 4KJWC 1J8KA 4MB5A 4M1GH 1BEYL 4KX8A 2VDRL 2PXYC 3BT2H 1E4JA 2D2CC 4PJ7A 1YECL 2X1QA 3BKCL 1WV7T 4U1KA 2FJGA 1HL8A 5FM5M 1H3PL 4AM0A 4MDJB 4XP5L 5F71A 1MFBH 1U41A 1LP9A 4IDJH 5ADOL 5IB2A 1Q1JH 2BHUA 2JK5A 4M02A 4YZWA 4CVXB 1I8AA 1PYWB 2YA0A 4LIQE 4ELDA 3ZQXA 2XWBB 1U8HB 4L9LB 5INCA 1QQDA 3FU6A 1UWEL 4FQ2H 3CBRA 2XQ0A 3CH1B 1B3JA 4GQRA 3FT2A 3QC6X 3T4YA 3VU2A 2VM4A 4BGLA 1A3RL 2D7QA 1F6LL 2FVNA 4KZCA 3VGGA 1FNGB 4RGNB 3PJNA 1BHGA 5TDNB 3F7QA 1I1AD 3P0VH 3ECBA 4FMFA 1MFAH 3C2SA 1I3RB 1X5YA 1NQBA 2AF2A 3G6AA 2BJMH 4JFQB 5CD3B 3SB3A 3M1BB 3APNA 4BCZA 2EDKA 1UH4A 5C0NC 3PGFH 3WKQA 1NCBL 4PWKA 4XVJH 4U1JA 4NENB 3GPEA 2F54A 4NPYB 4R6UA 4UT6H 1J9CT 1JWSB 3O2DA 4XNQA 3RVXC 5IR1B 3VXMA 3LZNA 3TEYA 1M6OB 3LKPB 1SOKA 2BMKA 4CKVX 3VUAA 4BKSC 5DD6B 2AAVA 3Q8EA 2QVKA 1EJOL 4FKEA 1RZ7L 2GBAA 3F7KA 4PS7A 2KC0A 5C0DB 3T0VA 3BSZA 2WN2A 1IL1B 1YO4A 5EWIL 2MFNA 4NKIH 5T1KD 3KLQA 3CDCA 2ERJB 2P28B 3IN0A 4PLJD 5C09A 3MVSA 2P43B 1BJ1J 2GJPA 4NIKB 1CMOA 5IKCA 4BCYA 1L5GA 2HRHA 4LHJB 5KVMC 3MGTB 2VZOA 2CQVA 5J5EA 1RPKA 5EORH 1U58B 4O2CB 1R33A 3TWCH 3W5MA 4B97A 2XJLA 4MS8C 4NQDB 4U1HB 3D51A 3WFDH 2WWMD 1QPKA 4ZS6C 2IH1A 2CHWA 3FUMA 4DSYA 3VFVB 1N70A 5I2IA 4L4VD 3CVHA 2O5XH 1GS7A 2HKFH 3SE3C 1OWRM 5C0CE 5ICZA 4CNIA 1E4HA 3B83A 3HZKA 3M17A 1JNHA 2TSBA 4NO5B 1FDLL 4KDVA 5GGUA 5I1LB 2IOMA 1G6RL 3WDHA 2YOCA 3P77A 4JRWA 5D2LE 3NJHA 2Z1PA 1N7ML 2OJZH 4AEEA 2WTPA 4TQIA 5CSZB 4EOWH 3LKQB 3RB5A 3N40P 4H26B 4Z7WA 3WUZA 3EOBA 4J4PC 4TNVK 1MF2L 4JS7A 5E94B 3RWEB 4K23L 4XPHH 5EH1A 3AY4A 3FF7A 1JWUB 2J1ZA 2X4RB 3H7LA 4OBSA 3GC3A 4AIXA 2ZNXA 3ARDB 1X5LA 2BY3A 4JZNA 4KK5D 3B7YA 2XPYA 3FUFA 3H1ZA 1EANA 4PRDB 3REWA 5DJ6B 1EERB 1MREH 2A5UA 3W38A 4HJGB 3QHZH 4D8OA 4LCYA 3CFDB 1ETZA 2JFCA 2MNJB 3DV4B 1RJZB 3STZA 4H2CA 4PY7B 2FGWL 2MIZA 2NDGA 4ZOCA 2DQUH 3A4FA 4PG9A 1V3MA 3RUGA 2XZAH 1SY6L 3H2PA 1NLDL 4NQQA 4JHAH 4P5TA 4KRPB 3V4UL 5IBTH 4PS4H 3N42B 5I6PA 1OW0A 2WMPA 1M57B 5FKAB 1JF1A 1JPGB 1JK8A 1Z32X 3T4AB 3ZT6A 3ARBA 4XP5H 2L7UA 2M26A 3Q48A 1KIPA 4BM7A 2B1AL 3OZKA 4WNJA 1F4YH 4JO3H 2NZIA 4MWFA 1G7IA 3LZLA 4XPAH 2ZUYA 4U0RC 1JDAA 3DRQB 1GYVA 1WWWX 3BWUF 3UTZB 5H37H 2BW4A 5DZLA 3RFZB 5KAQG 4I9WD 1QI5A 3MOQA 1Y7VA 5AKTA 1OM9A 3AM8C 3DTUB 3ZXAC 3F5WB 1W91A 3FQRA 4YDIL 2W8CA 3KPRE 5T3XL 5L8JB 2PTTB 1BAFH 3EO9H 1K5NA 1OGAB 3RWJA 3VYOA 2ITCB 2VDLL 3MX0B 3B2MA 2ITDB 4TUJB 1HHIB 4XXCA 1BJ8A 5IK3B 3GZOA 2OZNA 4YHYB 4UTBA 1YEGL 4KK6C 3MJ7A 1JV5A 2QR0A 3EJQA 1SYVA 2I9TB 2DIJA 2W95A 3QEGL 4LBAA 2EE2A 1Z9LA 1DBKH 1D5BB 4IHBA 1PG7L 5JO5B 1EHXA 3EFOB 4NB7A 4LASL 1QO3A 2VE6B 3IMWA 3NZHH 1IGTB 3HZ3A 1MFEL 1F6AB 1CICD 3D2UB 3SJVE 3BUDA 3BAXA 1UOKA 2WB7A 3C60A 2P80D 1AZRA 3JT2A 4L48A 2NYZA 1RZ7H 5DVNA 4UMGA 1BVLB 5ADOH 4JQIL 4BQCA 1JUFA 1MEXH 3IPFA 5SX5K 4G1MA 4A7SA 5EWIH 3GB7A 4JHUA 5BRZA 3UZEA 5KVEL 2MQCA 4NKMA 4UM8A 1D6EB 1A6TA 3MRFA 4B9FA 3ZDZB 4JGJA 3TT3H 4XNBA 1JPTH 3L3OA 3QQNA 5IWLC 1MHHA 1GA2A 1AQKL 2KQNA 5J13B 2IALB 3QSKB 5DWUL 5GSRB 5EEZA 3OGCA 3OPUA 4G7RB 4K5PA 2DWYA 4BFEA 1A4JA 4PBDA 2WVVA 3POHA 1QLEH 4P46B 1O7DC 1VFBA 3GMQA 4Q52A 3VXUE 1A1OA 4A6YB 3HZMA 3ISYA 4P23B 1AS6A 4HA1A 4FFWD 3WY4A 1E27B 3L3KA 4WSJA 3SDDA 4YDLC 1F86A 4POZC 3TC9A 2EYTA 4KJWD 3K2KA 2BNUB 4JCLA 4U6TA 5E2VH 4PJXF 4KNUA 1RU9H 3MUZ1 1GS8A 1SEQH 1KB3A 3L3HB 1VPOH 2MCPH 5IQ7H 4XX5A 4PI2A 2IDUA 1DQQB 4B53A 1XBDA 4JFXA 3ALXA 4F24A 4QWWC 4MVBC 2BZ7A 5CM1A 3SGEI 4OZHF 4A7TA 3GUFA 3L5XL 3KR3H 3MRBB 1QTYT 1VJSA 2YD0A 4PJBA 2AS5M 3RNQB 2VN4A 4C47A 1L9QA 1B0IA 3HE6A 3MRGA 5GGTA 4NKIL 1D7BA 5AWNL 25C8L 4XBEH 4J28A 3V0HA 5KSBE 1SN5A 1H3WM 4BQ8A 2FJUB 1CQKA 3GFUA 1X4XA 1P6WA 1NPJA 3LCYA 3T09A 5LKNA 3UTTA 3QJTB 4HEPG 4LPTA 2Z8VC 1TR7A 5I30H 1OT4A 4QF1B 2DL2A 3RGBA 2VITA 3JQOB 3KW7A 2WLMA 4XRCB 4QOKD 2UY7B 4QRTA 4LF3B 5D7LE 5IM7A 4J12A 2BVPA 1NBZA 2KDYA 1IBHA 2W81C 4MDJA 4HMCA 5GGVL 3CFJA 1LWJA 3OG4B 2DQUL 4UOJA 4UTAL 4G7QB 2VCOA 3VXSA 2UV3A 3FPYA 3GSRB 4OAWB 4ENED 2XZCL 2YAPA 5E70A 4GW4A 5LHDA 4JRYE 4F8PA 1OKEA 1EUTA 4Z0XB 2I9LA 2P8MA 2JXMB 3OKLA 2CBPA 4MKMA 4F7MA 4U1GC 1IGJA 5K59F 4UILH 4YDMA 3RVUC 1U33A 3S5ZA 1JN6B 2R9HC 2B20A 1N12A 1SGKA 2WVSA 3WKPA 4XPTH 1T1XA 3FSWA 3ABLB 4NUMA 4EOWL 5DUBA 1SDYA 2DWDA 2LU5A 3MLZH 3BFQG 1ANUA 1W0VA 1NLBH 5D7IF 2BCMA 4ZFZA 1UKTA 1BQHG 4UUJB 1G1OA 3S8FB 4EN3B 4NZUH 4U1NB 1FFQA 7FABH 2UZIL 3HI1A 4B96A 3AQZA 5KYXB 1ETA1 3GSWA 5EN2B 3TL5A 1WAEA 4WI9A 4AVKA 3N2JA 2YFNA 4L3EE 5B1KA 2H26A 2EDTA 4WW1A 1I7ZB 2IADA 4YHZH 1TZIA 3DHPA 3SKJH 3KLLA 2GK2A 1CLZL 1NCDL 4F1SA 4LCIL 2PMZA 1SHSA 1QLRB 3KPSA 5D4QA 3UADA 4Z18A 1NFDF 4DO5A 5IV2B 2QTEA 4PWHA 4XVTH 1UWXK 1JRHI 3U46A 4G6AC 4Q6IB 3TO4C 2G60H 2X6AA 5M94B 1Z3RA 3TBVA 4H44C 5DLLA 3U30C 1EDQA 2DKMA 2HYMA 1N59B 5IVZB 4WGWB 3AREC 1MJJA 1K6QL 3SDDC 2XWBA 3WY3A 2CHZA 1MIEH 3ARBC 3ECUA 3FOLB 1YMMA 4ZFOL 5TE4H 5HP5A 1U91A 2EUXA 5L7XH 4NRXA 2AJYH 4IK6A 4Z95L 5BOZG 4PJHF 4KUCD 3MYJB 4U0QB 3OKDA 2F61A 2BNQA 3GNML 4FQCL 4ZUVB 5DURB 4AJ0A 1G9NH 2VMDA 3G08A 1E4WH 2VDLH 3O6FA 1NCWH 4B41A 1KSRA 1M6UA 4ODSH 4FKHA 2JKTM 4NI6A 3IDMB 2NY2D 4PGCB 4M5SA 5BZDA 5FGBA 4YPGB 5HPMB 3FQTA 3LY6A 6FABL 1YN6B 3MOBL 1NMCB 2FX7H 1BBDH 2W1NA 4NO3B 1DL7H 4J8RA 3L6FA 5F7WC 3H42L 4I0PA 3G9VA 3QJOA 3MV8D 2JJTA 3ORJA 3THML 3ZDZE 2GI7A 5IQLA 5J6GA 3WV0A 2APXA 4LVEA 2I27N 2XTJB 1XF4A 2HLFD 3ET9F 1G7PA 4D9QD 3QGVA 3K0YA 2A6IA 1Y07A 2APFA 3ALPA 1KXVA 1QD0A 3U7YH 2NX5D 1JVKA 4ODTL 1Q1PA 4PJCE 1JFQH 2OULB 1G7LA 2LU7A 1BOGA 3DUSB 2PXYB 4FQHB 1YNTB 1GZQA 5GRWA 4OGQC 4LIQH 2X4SB 4FQQB 3QG6A 3VWKB 2YMOA 3I6LE 2FB4H 3QIUA 4X4XA 2HN7B 4KTYA 1ZD6A 5HHMB 1BFOA 3ZU8A 2CIIB 1BZ8A 1J8HA 3VVWA 3TZVB 3ZQWA 4EUPH 1XB6A 2V7HA 3KL5A 1MVUA 3WMSA 3P0YH 4ZMVA 1MIMH 3QWRD 3V0AC 1TIUA 1U8KA 3AJ7A 3JV0A 2I7OA 3OKMB 3OMIB 3PWPB 5B1AB 4EI6B 3FKUS 4LCCB 3T65A 3CDZA 4ELMA 1FIGL 1XX9C 4K94L 3LPGA 4JANB 4IKNA 2EEFA 4JFHD 2BIQA 3RGVC 1Q38A 1VIWA 1MRDL 2CRMA 3SN6N 3HB3B 1LO0L 2RTTA 2FQGA 2RALA 1T6VN 3AMLA 3H9HB 4QD2E 2NW3B 1JZ2A 3VGEA 4ES9A 4Z8FH 1MG3C 2K6YA 4IM8A 4DP6X 2B1HL 5G55A 5AVRB 4EN3C 2DMHA 1P5UC 1U8OB 3F12A 2R29A 2UXVA 1AO7B 3CCHB 4PJAE 4TMPA 3FH7A 1TFPA 3IDNB 4DP4X 4CUCA 5I23A 4IRZL 4E41E 3ECQA 1FG2B 5F1KC 1KLUA 2QSQA 4PM1A 4LLAA 4NO2A 2F5AH 5ACLA 2E6JA 2P42B 4NN5C 1IEAB 1QNZH 4JPVL 4NAJA 4U1IA 3MFFA 1FAKT 2XRAL 1ACCA 2YD7A 2WUCH 3DVIA 4JFPA 3LIZH 4E9YA 1FHNA 3MU3A 4M03A 5L2KD 1X7QB 4AM0B 2IQAB 5MEOB 2G4GA 4LSTL 2PW1A 1INEL 1RJLB 1FVCB 1H6UA 4PS8A 2FX8L 4RGMB 1QSEB 1ZK5A 4JZJB 5AAMA 3E3QE 1CDHA 3HC4H 2VSMB 3SE8L 2XZCH 1RZKH 5DA4A 4KO6A 43CAA 2Z1KA 3V0DA 3V4VA 1WPCA 3L5HA 3T4AA 1BVNP 4WHYH 1MCWW 4N0CD 4WEUD 2V7NB 2C9RA 3PGCB 5E2TL 3WFBL 3IWUA 5C0CD 4YLQT 4NNYB 3F62A 3C5ZD 1HDMA 5AW9B 3W56A 3HG1B 1MCKA 2AHIA 1XGPA 1RHFA 4PHXA 2CALA 1S7QA 3DYMA 5IROC 4LCWD 5C2BL 3VG0H 3BIBX 1NCHA 3WNNA 1OOAA 5T3XE 1H8SA 4H0HB 3TN0B 4A67A 4X5LA 2ZOLB 1MNUH 1G6RB 4QTIH 1IT9H 1FPTH 1JP5A 1NC2A 2F8OA 2BNUA 3DNKA 4JFWA 1OO2A 4N25A 3B2XA 1BA9A 3DX2A 3MX0A 4JVUA 4TVPE 3UGEA 1AAJA 2C9VA 2IPUK 1NKRA 3MLUH 3GMPA 3BH8B 3QPQD 4FE9A 2ATKB 2J55A 3QNFA 3EG9B 1Q72H 2Q3XA 4P9HL 4HIEB 4DZBB 1SLVA 3LRSA 3I75A 1U9KA 1OT1A 1WZ1L 2BY2A 3G5XA 4FNQA 1RKRA 1QTSA 2AJZB 1NEZA 3Q06A 1ORQB 3T2OA 4G8IB 3VI4E 2EVIA 4QHNA 4MDIB 2SEBA 4R2GB 1OALA 4RAVA 5HYIA 2ZX6A 5AW0B 4TYUA 1NC4A 4P2QA 3PPSA 1KULA 1BVKB 3CFKB 3GSOA 3Q2CA 2B14A 3DPBB 1DFXA 1AD9A 5CSBA 3U7AA 4MVBD 5SWSD 1FL5B 4FHKA 4Y8AA 5CGBA 1XGYL 2VABB 4U3HA 4CADB 5DYOB 1WH0A 4KDTC 4XCNB 5I1EL 1ZHLA 3EH5B 3SDCB 5E6IB 2BC4A 3QNYB 1YJDH 1YQVL 4GG6F 1E5ZA 4YHMH 5AB9A 2B9BA 5TE4L 4JHWH 4LSSL 2FB4L 2Y5TA 3LMJH 5C0JA 5KSBB 1ZHBA 1MQKH 2Z4QA 4JFTA 4FQXA 3SZKC 1EBAA 1G9NL 3L3IA 2EVGA 3KHOA 4YN3A 1QSFB 2GI0A 1HI6A 1KXTB 4ZOBA 4TUKH 1DJSA 1I9JL 2NSMA 1OQOA 3AG3B 3TJEL 2IWKA 5H35B 1C5BH 1ACXA 2XXMB 2Y06H 5D7SL 3NK4A 4JLRB 3DVGB 1AGDA 2GITB 2BDNL 3DRTA 4Y4FA 2EYSA 1X9RA 5DEZA 4PJDE 4RRPM 3BP6B 5D8JH 4PJ9B 1BLIA 1E7VA 5C0BB 4WHTA 4Z8FL 4KQ4H 5D1XE 1YNKL 4DVBB 1OP3K 4GKNA 3L45A 1TEFA 5L4IA 3HG4A 3CNKA 4U1JB 1NMAL 5DRNB 2DEXX 4X7FC 5HYJE 4XPBL 1AJ7H 3DX8A 3ARPA 2WZ0A 5GS0H 5DVLA 3BZEB 4OCXL 3PV7A 5DD1L 2QADB 4NUJB 5EIIA 4CU6A 3BAIA 1KCSL 5KYUA 5G4MA 5IEKB 4TLUA 5ISZD 2C3XA 3TPKA 3OLEA 4FLRA 5HVFB 3UTTB 3GHEL 2F7PA 2GTWA 3HAEB 3KYMA 1ZXQA 1ZTXE 5KSVA 3K1KC 3X11A 4D0BB 2HG5A 4PB0L 4NQTA 5DF0A 3IFOB 2QVTA 3FT3B 1ES0B 1FJ1B 1WLHA 1X9LA 3F6JA 3NVQA 3P3SA 2XX1A 5CKAA 2VN3A 4XNMA 3SE8H 4NFCA 3O2DH 1CT8A 5IHZB 1MJJB 3D39D 1V27A 5DMKA 4ANWA 4KKAD 5DD6A 4HJSA 4BSJA 5T3ZH 2OJEB 3ZBMA 2NXZD 1R5WB 4DK3A 1LO3L 1XGQB 5TQ0H 1UUSA 1N2RA 2J88H 5JTWA 2QHRL 1HH6B 2ZF8A 3D0LB 2FWOB 2VUYA 2WLJA 3CXHJ 1LK3H 1OAXL 2E7MA 3GO1H 5D2NA 4G11A 2ZAIA 1S9YB 5JW5B 1NUGA 3FTGA 4LEOB 1ID2A 1JWUA 4N2KA 1OLZA 5CLYA 1C08A 3GI8L 4L18A 1XBRA 2FLBT 4MJID 4N90E 4J2QA 4JPIB 4EIZC 3REWB 3RIAF 4YC2C 1AGCA 1KDJA 2CIKB 3OB0H 5LBGA 2VLJA 1CDYA 2A38A 1M2VB 3OR7A 3AS1A 1ZRUA 4HOZA 4H0IA 5HI4D 1CYGA 4JDZB 4Z7UF 2XG4A 4CMHB 1GY2A 2BNRD 2K0RA 2LABA 4BA0A 4ZTOL 3HZKB 2ZT9C 3S4SB 3HC4L 4HS6B 2IPTL 4AE0A 4E41B 4NUQA 1EO7A 2AEQL 1U92B 4HH9B 2W9EH 1ETB1 3QHFL 5F1NB 3Q7JA 3N1QC 4I3SL 4R97B 2HH0L 3N42F 3CZGA 5J9PB 2YBGA 3WELA 3V4VL 4DN4H 1GRWA 1Y0LA 5HJBA 3FU8A 4JFEA 5J13C 1EXHA 5FO2A 3U0PA 1ZA6B 1HWWA 2EDEA 2YJLA 3N91A 3IK2A 3LXUX 2VXQA 4HCIA 5EU3A 4EKXA 1SLXA 1Z9OA 1QEWA 4MXWL 4K7PH 1A3QA 1RAMA 4POUB 3O2VL 3V55A 4A63A 4MAYD 2UXTA 4M8QB 3RJOA 1XQ4A 3V0WL 4QOKA 4UMSA 1BM3L 1OAXH 4V33A 4YXLL 1KCVL 5DO2D 5FUCE 2BOLA 3JV6B 5EUOB 1LWRA 5T1MB 1JZDC 3BT0A 4UAOC 3Q5TA 2DD8L 4LSUL 3LZFH 1L6XA 3D50A 1IGYB 1P4BL 5D2NE 1WWAX 4PRNB 2ORBH 1KENH 4B9ZA 3HUJF 3VNZA 4OFYA 3ETBJ 4X4KA 3NBNA 3INUL 1A9BB 1T6BX 3ARBB 5I1AA 1BVZA 1CB4A 2N1TE 1GTNA 2B0SH 4FG2A 4X5XA 3RBSA 3UO1L 4NN6C 4NO0A 3OZLA 4KDWA 3LN9A 1CR9L 4Q56A 3KCPB 3L95B 3RWFB 1LK2B 4MD0B 2YEVB 2D4FA 2ZP9A 3FSOA 5AG8A 3QIWA 1HTYA 2E75C 3EUUA 2NY3D 1KCSH 1GAFH 4AOFA 5LUMA 2Z6FA 1OGAA 4R97C 2XACC 2R59A 2YA2A 1P5VA 3ZKQD 4EN2A 1FL3B 4PR5B 4FYTA 1RIHH 1BIIB 2FNBA 4O58L 4XP6H 1TSRA 4M1CD 2DB8A 1BZ7A 2ESVB 4LLUB 1AGBA 1GJUA 1SHMA 3IN2A 1FGVH 4KO7A 3PWPA 3W5NA 1E50A 2HPOA 2FLMA 2O6FA 3MPCA 1C5BL 3L2MA 4JB9L 5FM5O 1RH8A 5HDLA 4LOUC 1OOWA 12E8H 3C6LD 3OHXB 5F0PB 1OPOA 2R2BB 1R47A 4HQQL 5E8NA 4KNTA 4FZEL 4NRZA 5A2AA 3TOPA 2VIRB 3C60D 5SWZA 1WTGT 2WOYA 2AEPH 3DETD 3MAWA 3PXJA 4M6OH 1N8ZB 1WEJH 5KANI 2VYRE 3BAYA 3ULVE 3VA2C 1Q0EA 2IV9A 4LRNH 3MGOB 5C86A 3LEXA 3BRGC 2FSDA 1H3VA 1OTTD 3GS4A 3IGUA 2B0SL 2GTZB 1EAOA 1W8EA 3DPDA 3VQ2C 3BMVA 3W2DL 8FABB 2GJZB 3B2UC 3SY6A 4JRXB 2IO5A 4KROD 3IDIB 2CUIA 1VFBB 3T3ME 2CUHA 1KTDB 2X70A 1KJ2B 3DV6B 1DUYA 4H13C 4FGMA 1BD2E 5C09B 2BIOA 1T22A 4Q6IC 3TO4B 1D9KA 3CN1A 2EVFA 3JUZA 1VESA 2JCCF 4P5TC 5G5DA 1UZ8B 5E6ZA 1SQ2N 3ARXA 1OW0C 2WXGA 3HEIB 1N3NB 5CCGE 1CVRA 1XR8B 4MX7B 3FTYA 3JXAA 3O4LE 2X09A 2WIIB 1MFBL 3UG3A 3L3KB 3PAYA 4N2NA 5JQHC 2HSIA 3WIIH 3S3JA 1W2KT 5D7JC 1HL5A 2AI0H 5EZIH 1JWSA 3LEYL 3PDOB 3DURA 4ATTA 4Z7UE 2J88L 5DUBB 3UAFA 3AM8A 5LLIC 2XWXA 1IGIH 4PJGB 1NFDA 3M1BA 1G7QB 2AV7A 4KRMB 3R8BB 1MN4A 3GO1L 3HB3C 2C3WA 2V3EA 3PHQA 5EF2A 3WTXA 1I8MA 4PCYA 4Y5YC 5E9DA 5KYXA 5D7IB 3LRLA 1R3HB 3P69A 5IVXE 3O4OC 3RVVD 3V5KB 1A0QL 3DX7A 2VR6A 2KZWA 2WXQA 5CJXA 4PUBH 4R5VA 1BM7A 4H2AA 5EBMB 4BK5C 1PX3A 4F57H 4LSUH 5JIDA 1JZEA 3FFDB 3WN6A 3GKWL 2JKLA 1I9EA 1TJGH 1IM9A 3ULVF 4XN9A 3W82A 1R3KA 4HS3A 5J1AB 1FL6A 2G2RB 4G1EB 1KUMA 1L7IL 4LESA 1NCAH 1YMMD 3FT2B 1C5CL 3QDGA 2D7OA 5H8DA 1RJZA 3CPLA 3N85L 4N90D 5GRYA 1FNGA 5K9KA 4FFYH 4LOFA 4OBRA 4MJ5B 1AY1H 5DFTA 1YEHH 3KYKL 2ZPKH 3H8NA 2E6PA 4GP8B 3BD4A 2WCPA 4GXFA 3QH3A 1JZGA 3WKML 5EZOH 1RULH 1CBJA 4UV7L 4QJ5B 1BZDA 2F54D 3F7PC 5TGBA 3H2WA 3OJ2C 2JCCE 3FUDA 3SYPA 4YK4C 2DQMA 2OCJA 5D5MB 1YNLL 4DEPC 2WSPA 3FF8A 4X9YA 4XP6L 2ZXCA 1I1AB 4FXLA 3KYOB 4JRYD 1DQJA 1KLGB 4EKJA 1JK9B 3ULVL 2PWDA 3ILEA 2FYYA 2HKFL 5JMOC 3MLRH 3HAEH 4OCNC 4AW4A 4KK8D 3CZEA 3DHJA 3PCYA 4NKOA 4FEIA 1P5UB 2AITA 1QTPA 4FNLL 5FEBA 3K46A 4XBPB 2XKUA 1W6WA 3MGAA 3UTPE 3VO0A 3CFDA 3WXVH 5J11B 1P4UA 4MRBA 2QHLA 4MRCA 3F65A 1GKOA 1RZGB 4X6DE 3Q2LA 4QYAA 1FC1A 2N59A 1IAKA 1HZKA 4IK7A 3U1SL 2PP7A 2VW4A 3Q13A 4OZHB 1T20B 3HE6C 1CR9H 3L3DA 4NM8H 1YYCA 5FM8A 4BIKA 2HVJB 2HVKA 4QTHB 4Q6IA 2VR9A 1HK6A 1TTCA 1T7XA 2OR8A 4WWKB 3SYCA 5BS0D 4U6VH 2NY6D 5BVJB 3HNVH 1XD1A 3A6CH 1ML0A 5CN2A 1QRNB 4UT7L 3H7BA 1MY7A 4UM8B 5IIEB 4F5CE 3BIKA 3MRJB 1M05B 2LOEA 1RULL 3KPRD 3QO0B 1ZVYA 1BQSA 4FC3E 2F8XC 1SY6H 4Y1AD 4G8AC 2XXCB 4ZQKB 3FO1B 1QSED 2JJWA 5I6LA 4JB9H 5IK3A 3WTYA 2AK1L 4HU2A 1NCTA 3DYOA 5EA0L 4P9ML 4PJCA 4PGZA 5KBNC 3IMSA 5CZVH 2XIDA 4NGHH 2G75A 3QE5A 4LU5H 4HQQH 2BFGA 2WBJB 1MRCH 4G8EB 3SIKA 3TCXA 4M9OA 4O2EB 1SMOA 2L7JA 1BCIA 3EHBC 3PAUA 5IB1B 5I6XC 4PWEA 4PRBA 32C2B 1YMME 3ECWA 4BWWA 4LRNL 4NQUA 3ZSSA 5HBBA 1U4FA 1YEEH 2CDGA 3KYNB 4WRLA 5FHAH 5EU5B 2D2OA 3NABL 3O0RL 3BO8B 2I69A 3QBTB 5HYJD 1BX2B 1AXIB 2COVD 4BQBA 1G5GA 5DRZB 4LSRH 2IAND 3K7UA 1IC4L 1PCSA 2VLJB 3QI9A 4P3CH 5J1TC 1JZ3A 4OCSH 1QZNA 3DOIA 4XO4A 5AL8A 4YVNA 3HNSL 4OZIA 4GKSA 5F0MB 1AQHA 5EBLB 5FUOL 3WNPA 5IVNA 3T1FA 4ZUUA 3O45B 3WNIA 2FSEB 4HIIB 5IG7A 1DZ0A 1PG7W 3L9YA 4FL4B 2NOYA 5FUCC 2OAAA 2CIIA 1OB1A 3PWPD 1CU4L 3G6JF 1B4RA 4WZ9A 4UZSA 5IVOA 1EJ6A 1YPZB 1ZXKA 4HAGA 4Q9QL 5T5NG 3BRDA 2HP4A 1AIFB 2WXIA 3DJTA 3EYOA 5K39B 4HJJL 1RV6X 3ZUCA 3ILQC 3RB7A 4R84A 1FORL 4OFIA 4F58L 4NQCD