4YSDA

Room temperature structure of copper nitrite reductase from geobacillus thermodenitrificans
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
299
structure length
299
Chain Sequence
b'NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 104
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysdA00
4P5SA 3ERXA 4A2GA 6PAZA 1WS7A 3H4FA 4A2FA 1M57B 1CUOA 1OCZB 4WTQA 5I6NA 1PAZA 3PAUA 2BW5A 2PPEA 1XMEB 1BQRA 3V9EA 1SHXA 4MFHA 1AG6A 4HCIA 4NAJA 1ADWA 4YSTA 3UADA 5I6KA 4YSOA 5FC9A 1AG0A 1NDTA 1OE3A 1MZYA 1AR1B 4E9XA 1A3ZA 2BP8A 4BWTA 2JXMA 1TEGA 2EINB 1MZZA 1OOWA 2VSMB 1WA0X 4UANA 5F7BA 4YSCA 2EIMB 2YQBA 4HAKA 4BDVA 2B3IA 2X87A 2YAMA 4CSZA 5I28A 5I5IA 4NB7A 1I53A 3WI9A 2XV0A 3FSWA 3QJVB 3NSFA 2PCYA 2CUAA 1J9SA 2BHFA 1BXAA 2HLEB 1BYOA 1OCCB 1RKRA 1SJMA 5D4HA 3TA4D 2H3XC 2W88A 2XV2A 4W9ZA 4X4KA 3HB3B 4N4YB 3X2QB 3NJKA 1CYWA 4UF7C 3GXUB 1GS6X 1AZRA 1W6LA 2HXAA 4JHUA 1PLBA 1CURA 3AZUA 1J5DA 2GIMA 3CDZB 1QNIA 1PZBA 4GP8B 4YSPA 2J55A 3ZX1A 2BW4A 4G7RB 3EHBB 2LLNA 2FWLB 2Q5BA 4YSAA 2Y1AA 1JOIA 4HIPA 4M4RB 1J9QA 4G7QB 2PPDA 4KO9A 2IDFA 1OF0A 1BEXA 3EH3B 2XLLA 2EIKB 1AAJA 1HFUA 2FQEA 4DP7X 3NJLA 1XB3A 2BO0A 3SBQA 3PCYA 1WA1X 2GC7C 1HAUA 1ZDQA 3QQXA 1PY0A 4A2DA 2BWIA 2XWZA 8PAZA 3AG4B 1EZLA 3NJFA 4G7SB 3PAZA 2HRHA 1ASQA 3UABA 3CDZA 3FU7A 1BQKA 3QJRB 1JZHA 2VM4A 3HEIB 1J5CA 3FSAA 3QPKA 2AANA 3S3BB 1V54B 1ZV2A 3RYMA 2WO2B 4GYBA 3SBPA 1A4CA 4A2EA 4YSSA 1PNCA 1ET8A 1E67A 3X1BA 2OJ1A 3ZIYA 1PF3A 1QHQA 2YAEA 5F7AA 3TBCA 4F2FA 3X1GA 2YARA 4DP9X 3ASOB 2QPEB 4BWWA 1GW0A 3DTUB 3FS9A 1ASPA 2AFNA 2FTAA 2XXGA 3MX0B 2TSBA 5AKRA 1W6WA 4DP6X 4BK5C 2HX7A 4GY4A 1B3IA 2AZUA 3NJIA 4HHWA 2GI0A 2IAAC 3L45A 1W8EA 2A3TA 5TK2A 4G70B 1KYAA 1N68A 2FT7A 1NICA 3T9WA 1BYPA 1IBYA 6PCYA 4BXSV 1JVOA 2UXFA 3IE9A 4QKTA 1IC0A 4CSPA 1SF3A 4YVNA 3DIVA 1ET7A 2VSKB 1PCSA 2PP7A 1AZUA 2VN3A 4DP5X 1DYZA 2VW4A 2DYRB 1KDIA 1RZQA 1PNDA 1NIFA 2IDTA 2UX7A 4YSQA 3IN2A 5I5MA 2XX1A 1NPJA 5ANHA 1GY1A 1T5KA 3OQRA 2XUWA 1JERA 3AG2B 3QJTB 4KO5A 3NYKA 3V9CA 1UATA 1ET5A 2DWSA 5B3SB 1GSKA 4UAHA 2Q9OA 2IDSA 1JZEA 2OCCB 2PLTA 5I6OA 1WAEA 1FWXA 2VMJA 4K9JA 1JZJA 1XB8A 4WKXA 5I6LA 1E65A 3OM3B 3WG7B 4BWUA 2FQGA 3S8GB 1TKWA 2ZWNA 3SQRA 1A8ZA 3ABLB 2Y69B 3NJGA 2J57A 4KNTA 2IH8A 3NP3A 3WNIA 4YSRA 3PPSA 1V10A 1PLCA 2PP8A 2I7OA 4RH4A 4AKQA 3KW8A 4L0PB 3C75A 2EILB 3NJNA 2H5UA 2ZOOA 5B1JC 2XU9A 4JHVA 4A67A 4AI7A 1FA4A 4E9VA 3S3CB 3WNJA 4FAAB 1JXGA 4GP5B 1L9QA 2YAPA 3NT0A 5B1AB 9PCYA 3JTBA 3TBBA 1DZ0A 2CBPA 3WKQA 1A4AA 1BQ5A 1JZGA 1AIZA 3SBRA 3T71A 2IDUA 3CVDA 1AS6A 2CJ3A 3FQ1A 3FQ2A 4A66A 1OE2A 5D4JA 3TASA 1NIDA 3IEAA 2YXVA 2PP9A 2H47C 3EH5B 4ZK8A 3NSCA 1AACA 1AZNA 4AX3A 1KGYE 1ZPUA 2YAQA 4PAZA 1M9WA 2MTAA 2FT6A 3X1EA 1NIBA 1X9UA 2IH9A 2I7SA 4DPAX 4E9TA 2YAHA 1BXUA 3NSYA 2J5WA 4DP8X 3TU6A 1MDAA 3FQYA 3FYEB 2UX6A 2UXTA 4HCGA 3X1FA 2GB2A 5IY5B 4HALA 4BXVA 2WO3B 5I5JA 3PLYA 3QJSB 2WSDA 1NWOA 1ID2A 2TSAA 2ZXWB 3ASNB 2HX8A 4N8UA 4Q89A 3T6ZA 1RZPA 1J9RA 5B1JA 1OCRB 2IWEA 1NTDA 3FT0A 2XXFA 4FA7B 4DPBX 1ILUA 1N70A 3FSZA 1SDDB 2RACA 4E9YA 4DP0X 1PMYA 3FPYA 2GSMB 3FU8A 3OD3A 1JZFA 3GDCA 3G5WA 5PAZA 2VW7A 1ZIBA 2VM3A 2DWTA 2XYBA 4KOCA 2FT8A 2BP0B 3NJMA 1SF5A 5B1BB 3EF4A 4F2EA 3UAEA 3H56A 1WS8A 1AANA 3AW5A 4KO7A 3T6WA 1YLBB 3T6XA 1GS7A 2BP8B 4KOBA 3NJHA 1OE1A 3UACA 1SFDA 4GP4B 1AOZA 1TU2A 1EHKB 2GBAA 5B7MA 4P5RA 2IWFA 1URIA 3UAAA 4GXFA 1PZCA 1L9RA 3OMNB 2BZCA 5E9NA 5I6MA 3D12B 1RCYA 2R7EB 3NJJA 2PPFA 2XX0A 1GYCA 2BP0A 3UGEA 2BZ7A 7PAZA 2OV0A 5B1KA 4EF3A 2B08A 1R1CA 2AZAA 2JKWA 2W8CA 3S8FB 1ETJA 3AG3B 3ZDWA 4AZUA 4E9QA 2GC4C 3FYIB 1E30A 1GY2A 2J56A 2QPDB 4YL4A 3H4HA 4JKNA 1AQ8A 1KCWA 1KV7A 1XB6A 1E5ZA 5B7EA 4HZ1A 2IDQA 2IWKA 2UXGA 4NERA 1CYXA 2NRDA 2DYSB 4A2HA 4DP2X 2PPCA 3ABMB 1MG3C 1NIAA 4E9SA 2CAKA 1NPNA 2XV3A 2ZONA 4KNSA 3FPXA 4ENZA 3BQVA 1JXDA 2R7EA 2N0MA 1MG2C 4KNUA 4E9WA 1SHWA 1L9TA 4G72B 2QDVA 3X1NA 2FQFA 1OCOB 2XVBA 3FU9A 3AY2A 3GYRA 5AZUA 1ZIAA 3QJUB 3PXLA 1L9SA 1JXFA 1NIEA 2DY2A 5B7FA 1L9PA 1VLXA 2FQDA 5I6PA 4YSUA 2YXWA 2UXVA 3FU7B 2P80D 1L9OA 3N55A 3WKPA 2HZHA 5LDUA 2X88A 1J9TA 1AS7A 3QJQB 3NP4A 5EHFA 1GR7A 2HX9A 4Q8BA 2CALA 5D4IA 3KW7A 5TK4A 3CVBA 4AKPA 1WA2X 1OV8A 1AS8A 7PCYA 3OMAB 3IBOA 4G71B 3FSVA 2GHZA 1NZRA 2MRYA 4HCFA 1KBWA 1TEFA 2AVFA 2YAOA 4M3HA 3ABKB 3CG8A 1AZCA 2E86A 2JFCA 2FNWA 1BAWA 3IN0A 1IUZA 1BXVA 1KDJA 3ABGA 3N2JA 4DP4X 1KBVA 1SNRA 1NINA 4QLWA 4TXVB 1E5YA 1PLAA 4DP1X 3OMIB 1ASOA 1FFTB 2PPAA 2FJSA 4YSDA 5I26A 1M56B 3U25A 3PAVA 1JVLA 2BWDA 2HRGA 2EIJB 1AZBA 1X9RA 3S3DB 1QLEB 3BVDB 1F56A 3AG1B 1NWPA 2PCFA 1HAWA 4KO6A 4A68A 4AKOA 4DPCX 2CCWA 4W1TA 3WIAA 1CC3A 3NSDA 2DV6A 1JZIA 1A65A 1SFHA 4E9RA 1ILSA 2YAFA 3ZBMA 2P80A 1GS8A 3EH4B 4HHGA 4PCYA 2I85A 5AFAA 4YVUA 2QT6A 1ZDSA 4F7KA 3CZUB 1IKOP 5A7EA 4YSEA 3CVCA 1KCBA 3T6VA 2QDWA 5PCYA 3MBWB 1PZAA 1SDDA 1A4BA 3JT2A 2VW6A 1IBZA 4BDVB 3DKHA 1V55B
chains in the Genus database with same CATH superfamily
2Y2YA 1T2JA 2FATH 2CMRH 3BE1H 3DVIA 3E1ZA 2EE6A 1AKJA 4FOMA 1BD2A 4P23B 4WUUB 5DRZB 5JLZA 1QPPA 4QXUL 5I1DB 4HPYL 4UNTA 5C9KA 1CO1A 3T09A 5BJTA 4JDTH 2YK1H 1CUOA 1CFNA 1UA7A 2WD0A 3FTZA 2I69A 3WAJA 1JE6A 1F97A 5AW2B 4M3JA 1WLHA 4HOXA 4PYHA 1QRND 3NJVA 3HG3A 5EORH 5D1QD 4KFMA 5BV7C 5IKCA 3F58L 1Z3RA 1EEQA 1FNGB 3G08A 2A4ZA 4Y19D 3OR7A 5T3ZE 2ERJC 2EACA 3ARDD 2QADD 2P3YA 2YPLB 4IOSD 5FO9A 2XTJB 2YKLH 5E8OB 4BDVA 3QW9A 1Q1JH 5HI3D 5DQ9A 1H3GA 2DWDB 2P7TB 2CIKB 1I8IB 3RTQC 2X2JA 3AREC 3S37X 4XP9L 4WGVB 4Z8FL 1BYOA 5GJTH 3BUBA 1CE1L 5E2TL 1JP5A 1QW8A 1G4MA 1P4UA 4UF7C 3GXUB 2FO4A 3EJSA 3K72A 3OLGA 4GW4B 5HVHC 4KV5F 4P04A 3HZKB 4MSWB 1H8OA 3TF4A 1Z9NA 3SY0B 1Z9PA 3FCTB 5F9WC 2NNRA 2CO6A 2XFGB 1K3IA 4FX5A 5HHNA 1SJHB 5AW6B 5JZ7D 4YSAA 3I9PA 4MASA 2JV6A 3ARGD 5DJ8A 2V4LA 1SYVB 3QULB 4IRZH 2CIIB 4CVZB 2IDFA 4C56B 5HYSG 3VB8A 4B3EA 1MCKA 4K8RC 3MV8B 2FNBA 4PD4J 5BQ7B 1WFMA 2DD8L 4U6VL 4OLXL 4LOVA 3OSVA 3SODB 4I89A 3VW3H 4OD1L 4FTDA 3SBQA 2ZG1A 3CMOH 3PCYA 4P2RE 1HCFX 4PJIF 3V7MA 3SZ6A 5DHVA 3Q8EA 4TVPL 4FCAA 2O5NA 4J3UA 4M1DH 2LGNA 4YEFA 3ME0A 3HZMA 2ZWYA 3HBGA 4L0YA 1XF2A 43C9A 5LAPA 3SIKA 4PTTA 1PNCA 3RVUD 5DMGD 1H3UA 3X1BA 1DQMH 4JB9L 1RPUA 1BM7A 3ZTJG 2Q10A 1XAKA 3AS2A 2ALWA 2H2PC 4B6ZA 4P23C 4DAGH 3NESA 4EI5A 1QA9B 4AQAA 3HA0A 2ILLA 2Y6SC 4M29A 4B53A 5KBNC 1OGPA 1ICTA 5DURB 2BFGA 3FFOA 2J5LB 1T4WA 4I18A 4MLSA 4ODBD 2YD1A 4FQXD 4UILH 4YX2H 3BVXA 2EO1A 4WKZA 4PGBA 2QGBA 4PJEA 3MACL 1ZK5A 1T5WB 2VDNB 3RY4A 2W0LA 5LXVA 4BXSV 3W0WD 1PL3A 3QFDA 4XH2B 4XXWC 4Z5RB 1CICC 2WY3B 3NFPB 4MDJB 4G43A 3VCLB 1NCJA 3KPNA 1RJCA 1KIRB 1DVYA 2WAQA 3TIDA 2V7HB 4C4KT 5C0ND 4P2RD 3HE7A 3QWRA 1TKWB 5MERA 2VW4A 3KXFA 1NIFA 2X6MA 4EZJA 1NAMA 5IUSA 5G5DB 1KFGA 3R4DA 4P05A 3C5ZB 4AQEB 4G6KL 1ITBB 5IM7A 3ILPB 3KPSE 4AQZA 5KVGE 2CXKA 4NYLB 2G2PA 4RWYH 1OW0C 1PFOA 1RUAH 1BVNP 1MI5E 4OSUL 3H0TA 4I3RL 4ICWA 5KSVA 2HFEB 4PJ7F 2AJVH 4PJAF 1R5WB 2PXYA 4M1GH 3MRMA 3KJ6H 4JE0A 1NCAH 2F5AH 2FL5A 2JELH 3SKMA 1L9NA 4JHBA 5F7KC 2VC2H 4V33A 1M71A 1XCQA 1A8ZA 4PJBB 4OJDH 1U8NA 2B3RA 3SE4A 3KPRA 3RY6A 2E74C 4TL4A 1IGYB 1HEHC 3MA7A 1S7XA 4KI1A 4L4VA 4PVLA 4YFLF 4LLYB 2FWOB 1LO3H 2V8LA 3MRCA 4FP8H 5BO0D 2KPWA 1MFAL 1OK8A 4L3FA 3O6ML 3ZKQD 3GB7B 1E2ZA 5GS3A 5L8LB 4NJAL 5ACZB 1U8IA 3ARTA 5CNHA 1ECYA 2O4EA 4KQ4H 3TWYA 3ZL4L 2JSFA 3QUKA 3AXLA 2X4RA 2XIBA 5BZZA 2H1PH 3F7KA 1UH2A 4K7FB 3HRZB 1EJOL 2W9LA 2Y9RT 3CHSA 35C8L 2V2WB 2O6EA 4IS6A 1PIGA 5IV2A 2QPSA 5GS1A 4HD5A 3KPSD 5IW1A 1OP9A 1NEZB 4Z3EA 4F93B 4NUJA 3FW6A 3RWEB 1UT2A 4HPOH 5GRJH 3P3YA 5DCCA 5EULV 4E41B 4X4ME 1MFVA 5K1VA 2OK0H 4XMTA 1QFHA 2EVFA 3NZHH 3P2TA 4A66A 5INCA 3DV4B 1ZT4B 4JFSA 2J5LC 3SY6A 2ED8A 3T2OA 4YHZH 1IGJA 3P4LA 3GUTA 1RIUH 3OL2A 2DL9A 2VRKA 3BZ4A 1AACA 3DGGB 4PV9B 4F2ME 3WTSA 4PAZA 2NLJB 3FCSB 2WC7A 2P4AB 3DOIA 1KTCA 2MTAA 1CDUA 2Q3XA 3EAKA 1ZCRA 3PJNA 1MCWM 1IFHH 1HWWA 4OZGE 4P2CG 5GSVB 4U1SA 2XWTA 4ZX4A 5CEZL 3VX0A 2DWXA 4L8CA 5J57B 2R1WB 1SEBA 3WN6A 3BEVA 1PG7L 3LH2L 4Z7VE 4GUPA 3HJ0A 3K6OA 1S78C 3T4AA 1YYLL 2BS71 2UX6A 5CEYB 4WW1A 4GBXC 1DBAH 1SGKA 2ZUVA 3RGHA 2JKSA 1MHHB 5LG1A 2WO3B 4LLDB 5I5JA 4ZD3H 3C5ZC 3V0FA 2GJRA 3BISA 4LT7A 1NWOA 4TNWF 3T6ZA 4ZO6A 4DKAA 5BCAA 1UM5L 1J9RA 2OX5A 4L3EA 3SYPA 2ZF9A 1NCUA 3P4NA 2NR6C 2E4TA 2N1KA 1CE6A 1E6OL 2E7CA 4YXLH 4G80A 4TVUA 1UYWH 2ZOWA 1KV3A 4DPBX 5IOKA 2X6CA 3FSZA 2WVSA 4E2OA 1DJZA 4P46C 1ZT7B 2A9NH 1RZFH 1QYGH 4QOKA 2Q7YB 3FCBA 4H0GA 3IJHB 3G5WA 4RAHA 1KXVA 4JLRA 3OGCB 2NXZD 3R7QA 4LSSL 3UYPA 1FZMA 5CP7A 5LNGA 1P7QD 2IIJA 5EDSA 1TSRA 2B1AH 3BQUA 2KHAA 4Y0GA 2FEEI 1TQBB 3EYQC 4EI6A 4N24A 2FIKB 2D73A 3OLDA 4UIMB 1OTSD 1CCZA 3DWTA 1FZOB 2C4XA 1W0YT 2VDLH 4QUOA 4JZOA 3D39A 2OMVB 4RISH 5GGQL 3N91A 4CA4A 2Q6WB 5EBWA 1NA8A 4I0PA 5C08E 3O6FD 3S8WA 5JQ6L 4R7NA 4KKLD 1U2CA 1N19A 3V5DA 1NL0L 5B7MA 2SEBB 5AB9A 4YBLB 5J1TC 2EIEA 3US0A 3PGFL 3HRZC 2AC0A 3L5XL 4MJIE 1KLFB 3DETD 2W65B 2OZ4H 1WICA 2BZ7A 3ARYA 3KYOA 4JGUA 3HVNA 5E5MA 3T4YA 3WENA 4WU5B 1WAAE 4UI2A 2E27L 3TBVA 4HJJH 5F88A 3WNPA 4ELMB 1QG3A 1E30A 1RV6X 3H2WA 4OIIL 3KZ8A 1J5OH 4N0YH 3HOGA 3QCUL 2DMCA 4PREA 4HZ1A 2IWKA 5IG7A 5JYMA 4FXLA 4EXKA 4M61A 5AVVB 4EKXA 1ZXKA 3QK0A 2GVYA 4K7PL 4LCCB 3PJLA 4PRBA 3VWKA 4GIPD 4OU3A 1WV7T 4NKDB 4WO4A 3CFNA 5GPRA 1YG9A 1JXDA 3GZPA 3WNKA 4BFKA 2BNRA 3CHOA 4RVBA 3SDDB 1GMEA 1Z9SB 5IFJA 1HILB 1XCTB 4LSUL 5LGHH 4IRSA 3GYRA 3ZUNC 5BPPA 4HS6B 3KL5A 3G6DH 4WUKL 5C08D 3PY9A 1M1XB 4JJOA 2IAMB 5E4IA 5AAMC 4AEFA 2VDRB 3PIQA 1F2QA 5C0EA 2A38A 1S9YB 3BUYB 4WFHD 3AT0A 5KAQF 4MJID 4YE0A 4Z7IA 4NQCE 3MFFB 4ZYKA 1JGLH 4OB5H 3ZDXE 5GZOC 1MFDH 4H2AA 1U6AH 4PJ7A 5C0AD 2FR4B 1ONQA 4PJAA 3NIFF 4I1RA 5CZXC 1A7PH 2X09A 1U33A 4JO3H 1E28A 4PWJA 4J8RA 3I50H 4JFPB 2GTWB 3A67H 1EPFA 2XJLA 1AE6L 4KWUA 2K6WA 1K72A 5EIIG 2V3EA 3FQXA 5IHWA 1Q9OB 2AV1B 2JFCA 4L3CB 7TAAA 2BRRL 2CU9A 3GMMB 2B15A 4XPFH 5DEJA 4DP4X 4P5TB 4HWEL 3MLSL 1HH6B 3EJJX 4RNRA 4QLWA 1E5YA 2XKNA 1FL6B 4XMLH 2NYYD 2VRQA 5A2FA 2HG0A 3BT2L 1FUNA 4LCIL 5D1ZA 3RWHA 2C7UA 3FO0L 3UZVB 5ITFB 2HKHL 4PJHF 5IP4A 3E6FA 3LIZH 1RZ8B 4F1ZA 1IAOB 2Y7QB 3BAJA 4YBLC 2HJLA 3VGGA 3ECQA 5HDOA 1ACZA 1T1ZB 4FJZA 4G6MH 4U2ZA 4I48A 1XFPA 5F70A 1AMYA 4CSSA 2LHAA 5DD5L 4M1CD 3R06B 2BSTB 1PIFA 4H1LB 4NQCD 1MCDA 3VG0H 3PNWA 5GHWH 4MXVF 2BM3A 4XZUA 1E43A 5IHZB 1UZ8A 5GZND 4LLQB 2CM5A 1Q94A 5DI8B 2G9HA 3A6CH 4G5AA 1BM3L 1E8XA 4QRRD 4Y5YA 3ZDYE 4F7KA 1BVLA 2CUIA 2G0LA 3NCMA 4LSVH 5B39G 5LN4A 1VJSA 2DLFH 2HJKA 2WP3O 2JMRA 4PVNA 5AD0A 2VGLM 4XN5A 2DB8A 5DZLA 2XZCL 3HRPA 1J0YA 3STLA 4Z7WB 1A4BA 1TYRA 2Y7MA 4LCCC 1FZKA 4OCMC 1Z3GH 4IOIB 5LQBH 1G7PA 4Q2ZB 2DQMA 2IQ9L 1WS7A 3JUYA 1NGZB 4FQHB 3SJVD 4NFBA 3SDDC 2QEJA 4M7LH 1H6EA 1PKQA 2X4UB 3NAAH 4Z7UF 2WQWA 4A37A 3LZFL 1NDGB 4YSTA 1X5LA 1S3RA 2X6BA 4S11A 1JGDB 4IBZA 1T04B 1QSVA 2OL3L 3L9YA 5CD5D 3CFDA 4E9XA 4EDXB 5INDA 3QSKB 3WEAA 5ICZB 3BXNA 2XZZA 1OLLA 1MZZA 4CBZA 4HISA 1R3LB 2M83A 2DQEL 4J6IA 4L8BA 3TC9A 3CN1A 1HXMB 4AIZB 3PWJA 1QP1A 3L1OL 3U9UA 2R27A 4ZS7L 3BKYH 2VSDA 2W07A 5H2BA 1KPUA 1MW3A 4ODWA 3VU2A 1CLZH 5SX4H 3GI8L 1LO5B 2CUAA 3GMNA 1R0AL 2VXVL 3HTLX 2YQ2A 3V0DA 5E2WL 4ZMLA 4O2CB 2BHUA 2X05A 3Q06A 5IIEA 2NNAA 1QRNB 1NANI 5D1QB 1WITA 1SOXA 2V0AA 3VJ6A 2H1LM 5C0IB 4R83A 1VGKA 1B90A 6TAAA 4Y19B 1YNLL 3MRQA 3NTCH 1ZA6B 4UWQB 5CLXA 2A9BA 5DJXA 2FLRT 1A1NB 2QADB 1FAKT 3ARDB 3GPSA 5K9JH 3ZX1A 3CVHB 4WGKA 2HLAA 3QQ9D 1GYUA 3FOMB 5ICYB 3VFNA 3TFBA 1WBZA 5KJ7E 5ID1A 3AABA 1F18A 3ZGIA 4JQIA 4ZPVA 2D9QB 5K9OA 1X5IA 3RBGA 2NY0D 1C5CL 4JFXB 5L0QB 4LSRL 1SUJA 1R3KB 2XTLA 3OKNB 5FOJA 1SQ2N 2IPKA 1OAYL 5D5MB 1QRKA 3U82B 4XAKE 5DD0L 4HC1A 4UT7L 3PAZA 4PTUB 1BQLL 3UABA 4OCYL 4BZ1L 4NUGL 1LO0H 3UP1A 1EFQA 3L2NA 1JTTA 3SHSA 4BGDA 3ARGB 3MZTA 4U6TA 3QFGA 4GYBA 4D9RE 1T0MB 3BI9X 3VXNA 4KNQA 4U3SB 5EN3A 2QVIA 3GTNA 1OT4A 2FHBA 1X5GA 2B7DT 2DZEA 1A02N 4HIJA 4U1IB 1KB5B 4WI8A 5C0DA 1E40A 5AL8A 1MNUH 2HX7A 4OJFL 5GGRB 4JG1L 4ZRGA 4FFWC 3QZNA 2GI0A 4UNUA 4OF5A 1F4HA 1FJ1A 3EXLA 2Y7SA 4G70B 2C4FT 1IL1A 4NP4H 1D5ZB 1EH9A 3UOAB 2RFXA 3MRFA 1J1OH 2CK0L 5C0FA 3HZVB 2WQUA 1DSWA 3IE9A 4QKTA 4U1LB 6CGTA 5ERWA 1X4ZA 3A6BH 2XFXA 1PSKL 4PFEA 4KDTA 3P40A 3UDWA 4C4UA 3FNKA 3H9YA 5D7SH 4XAKD 5KVDL 5J1AB 2F74A 3LKNA 2QKIA 4YSQA 4MCNA 3S5ZA 3UYRH 4PGEB 3AXIA 1EEYB 4FQXB 4Z0BL 1YYML 1QLRA 5HHME 4YZFE 4OZHA 3WEOA 5I18L 3K1DA 5J13B 1TSHA 4KO5A 5D1QC 4D9RD 3NYKA 5DJ0A 4JRXD 1MCOH 1ET5A 2WLJA 1KEML 4JFVA 3BOVA 4XPHL 5FYKL 5KS9E 3GSRB 5ALBL 2F18A 2OMZA 4PS8A 1G5GA 2B4CL 2Y22A 3ARDC 1FWXA 4N8VA 4P2RB 2ICCA 1MVUA 4KDVA 4PJHA 4WKXA 3T2NL 3SE6A 3GLEA 1DLHA 1DANT 3G9VA 1ZEAH 3GF8A 3R1GL 6FABH 1HJCA 4P2AA 2IFFL 3FU6A 5JOFA 1QBML 3MUUA 4KTEH 1YUKB 2VZUA 1CXKA 2WXPA 4ODXB 4CU8A 5J7CC 3LQAC 1DN0B 4BUQA 4UUJB 2ZKWA 4Q6IA 2YGVA 3ESNA 1A0QH 3FTGB 4LSQL 3QPXH 5BRPA 3FQTA 2EIZA 1YEWA 5EU3A 1JDAA 3C75A 2W60B 1TQWA 1BGXL 3S3JA 3LRKA 1OAUL 4JHVA 4AI7A 2Y36H 7FABH 4MZIA 1V7MH 2WZ0A 4Y4KB 4GOSA 3B4NA 1L0QA 3KH4A 4GP5B 2XKUA 4Y1AE 2P9RA 3MCG1 2ZX7A 4BKTC 1JNLL 4FFYH 1EBAA 2OR7A 1R3JB 3R8BB 4HH8A 4QHKJ 5EEWA 3TPUA 4UOW0 4N9GB 1A6TA 2IEPA 3PP3K 2JIXD 2P5WA 4PG2C 1XF1A 1UUSA 4G7VH 2PCPA 4ODTH 3MJ8B 2HCZX 3QO1B 3MCLH 1DQDH 1QFUH 1I7TB 3BGFB 1KXQE 1W15A 2UV3A 3BWUF 5T3XD 2YXVA 4MXQC 4NAQA 4NQDA 2H47C 2J8OA 3REWA 4PJDB 4N2AA 1IC7L 4JPQA 4EBQL 2ZUSA 2CDFB 2DTMH 4FNPA 2HMIC 3QUGA 3RVUC 1LMKA 5DMGC 5DYOA 5BO1H 2FX7H 1UXWB 5L7XL 3AUVA 3KPSB 2RCSL 4G8AC 3RJOA 1MCPL 5I1HH 2R2EA 2YXFA 4JQIH 3NSYA 1MIMH 4DP8X 2XHNA 1HESA 1ERNA 3O11B 2G5RA 3MKGA 3OKDB 4TULL 3WIHH 4UQCA 4A38A 2WQRA 1T3FA 4IOFC 1HOEA 1N8ZA 3IS1X 5BUPA 2X89A 3IXTA 4KK6D 4WI0A 3E8VA 5HHXH 4FQXC 1KJVB 1WC7B 4MAUH 4YO0A 2TSAA 4HC1H 4FHBD 4Y1AD 3EYSL 4XNXH 1KJ3H 1K4DB 3CFIC 2NQ3A 5AVRB 5J13C 1DBKH 1RP9A 3PV6A 1HHHA 4OQTA 3X11B 3EOTL 1FO0A 1QOKA 4JKKA 1M4KA 1UA6H 1IZKA 3AROA 5EF1A 1G4RA 5DJCA 1PAMA 1NFDE 5LNDA 1M2VA 5EUOB 1HHGA 1DQJA 5C3IA 3TEUA 4JDZB 5IB5B 1EANA 2OCFD 1FAIH 2CRIA 1INQB 3QS3A 5KVFH 2A73B 3KWXA 3SKUD 4NBZB 5PAZA 5E2VL 4X5QA 5FCUH 2VM3A 3GSUA 2XYBA 1I7RA 4KOCA 1KGCE 3V5HB 1CFBA 4NPKA 5L6YH 4TM9A 1U4EA 2G9KA 1RUPH 3QCVH 2FEJA 4FQQB 1IEHA 2Z6FA 5FS5A 2GHWB 5JUEL 1W8NA 1F8TH 1BVZA 3EFDL 1PZ5B 2A5UA 3NSJA 4Q58C 4JHAH 4MJ5A 2WBJD 3T6XA 3KPPA 1A1OA 1HIML 1OAZH 4M5TA 4N6QA 4ZS6C 4DN4H 4H20H 3W39B 4AUYA 3UJJH 4HMEA 3KGRA 1USQA 2UYLA 1BAGA 4Y4KC 4TLUA 2OSLB 4KZDH 1QLEH 3QHZH 5EWIL 3ZTJH 1MRDH 1JGVL 2NXZB 3MMEB 1I9IL 4A2MA 4HX1A 1P7QB 4L4TA 2H6PA 4J39A 3UZQA 4F2MB 1XZWA 5LHDA 3JV0A 1LXMA 4JW3A 2GFBA 2B08A 1R1CA 2A6DA 2AZAA 3BGAA 3D33A 4OZGB 5CS7A 3G7TA 1H6UA 2OMYA 4Y9BA 5IFHH 3V0JA 2IGLA 2Z31A 5IUCA 3BGFC 1KCWA 3O6FB 3KHQA 3NMEA 4NQUA 3ZE1E 3CZJA 4QHLB 2CKBA 1YN6B 2Z35A 3GMLB 3K7UA 4UTBH 5B7EA 5JMOC 3IJSB 4FKEA 4A2HA 1G6RA 2WV3A 2GBUA 3EGXB 4OR1A 3OWEA 5EOTA 1KGCD 2G4GA 2H9GA 5D7EA 5HDQL 4QD2E 4YHNA 5I23A 4BSVB 1A4KA 5FEBA 2V2TB 2N0KA 2VLKE 1ZHNA 3DARA 2AXWA 4WCYL 3VXPB 2G2NA 2WVVA 5BUGA 4Q6KA 1PZSA 2AEQL 3K6IA 1SUHA 4K15A 2XXMB 4RIRA 1E4HA 2XN1A 3KCPB 2DJ4A 4S2SB 2XWBB 1N5AB 4HUVB 5FA3A 4H2CA 2FK9A 3P9MA 4N5UA 2AEPL 3ZKMD 3MZGB 1MPAH 2AXJA 5ANMA 4BSWB 4P9HL 2X4QB 2JJSA 1B0RB 1J8KA 3WTXA 4FNSA 4HJIA 4HAFA 3HMXA 3UTZB 3T77B 4AYFB 2VR7A 4R26L 2VE6A 4NO3B 1CGTA 4G71B 1TQSA 1I7UB 1NZRA 3PHQA 5CEXB 3WTYA 4P3WA 3RKPA 2MH4A 1WG3A 5C08B 4PLJD 1UM6L 3IMUA 1EMTH 4JCLA 3TO2A 4TOYH 2EZ0C 3AGVA 1X9LA 2N3JA 3SB3A 4IKLA 5MENA 3BIKB 5GGTH 4I9WE 4X8GA 1BZ7B 1DSFL 1KDJA 1HU8A 1KBVA 2RB8A 4Z77B 3MXVL 4RAVB 4XB7A 2ZD0A 4MJIB 3ETBJ 1EHXA 3KM1A 2IGFH 4XVSL 5F7DA 3L1FA 4X7SH 4S1RH 4GSQA 4JGJA 1EK3A 2KS0A 1G43A 1ZS2A 3L95A 5G4OA 3EFFB 1BFOB 5LBSA 3TH3T 4DCQA 1P4IL 3VXSD 5DMYA 3VQ1C 5F6IB 4O02H 3T2QA 4Y2OA 4PRIA 4AG4L 4ZAKD 3FSOA 4HIEB 1KCSL 4N2EA 5DFAA 3IDIA 4QHPA 4KKAD 5AB1A 5ILTL 1OTSC 3QUML 1G7IB 1CBVL 1LWJA 2JTYA 3OKEA 3I6GA 3QQNA 2VLRD 5IESH 3II1A 1T80A 4NFDA 4FI6A 1K5NB 3O6FC 5A7EA 5D2NA 1NCTA 3UG3A 2I07A 3MRPA 4QRPA 3PQYA 1JI1A 2EKJA 1D7BA 4PS4H 3WMPA 3LKSB 4I2XE 1XSOA 4FXKA 3QEUA 5FO7B 3WL9A 1S9VB 2H32B 2EYTB 4M6NH 5MEPA 4CW1A 2NZ9D 1FH5H 1V55B 1KTDA 3VSQA 4EOWL 3DETC 2Y5TB 2A1WL 4HF5H 1ZANL 2OJZH 3BP4A 3UO1H 3H4FA 5DVNA 1BYNA 1M57B 4NQCB 4XMXA 5F1OB 1XGYL 2APVA 3EBGA 5DFVD 3ZDXB 3PAUA 4R5VA 4A1RA 4N3UA 5EPMA 3AXHA 2YFOA 4MXWH 2GUOB 4QRRB 3GEFA 4D8PA 4ZTPL 5I6KA 4NPYA 5A2IH 4GKZA 2E9GA 4MWFA 5HGAB 3EJTA 1XTMA 3T2LA 4UIKH 3OZLA 5EIVA 4GSDL 1KN4H 2DBLH 2Y2TA 4CKQA 3APMA 4O9HL 3ILQD 3ZZ1A 3TBTB 2MHAA 2YJQA 2WINB 3KLQA 3UMTA 5CGMA 2EIMB 4OM1H 2LU4A 3MNVA 1CTMA 3QI9C 3KNBB 2G75A 3WTWA 3D18B 2FGWH 3SJVB 4NQVA 3OZ9L 2GJZA 2R4SH 3QC5X 1A3RH 1LEGB 5I1EL 2ZPKL 3QJVB 4CADB 2J88H 2FEDC 1DUZA 3PWNA 1RURH 3D25B 2E75C 4NO0A 2VDMH 3D69A 4ZUTA 5TFSL 1Q72L 4XPAH 4ZXBA 3I75B 1U8CB 2Z64C 4N4YB 1SMOA 4Z3JA 1AZRA 3ES6A 3V52H 4HGKC 1G6RH 4U1NA 3T1WA 4G3YL 1YECL 3L9RA 1RLWA 5F7UA 1HNGA 5CKGA 4MCYB 4FA8A 2VL5B 3JTSB 2VDOL 2ZX5A 1UD5A 5TE6H 5MEQB 4OD3L 3F6JA 3C5XA 25C8H 2YRZA 4X6BA 5EN2A 3BYYA 4M4RB 2OM5A 4JR9L 3ZDYB 3ILDA 5JNYA 5JIPA 4ZUSA 2Z8RA 4XO5A 1H8NA 2WCPA 4RFNB 3FL7A 4PSPA 5IOPA 2ZX6A 3I3BA 3U4BL 2DICA 5C3LD 2XBTA 3BYTA 2CCVA 2EADA 3D09A 4Q97A 1ZDQA 1MVYA 3MBED 5DTFB 2I9TA 1YEIL 4MVBD 4Y88A 3AQDA 5GISL 5E8PB 5IVXE 2R56L 4KY1H 3WS6A 3RAJL 2WJ5A 2AJUL 3LZRA 3E8UL 1R5VB 3N9GL 2AS5M 1HTYA 1XCWA 2XA8L 1RMFL 2JKTM 3MJ9L 2X4TB 1NBYA 3OWRA 1YVLA 4BFIA 5EU6A 5C0RL 2DEXX 2J8HA 2WLLB 1S7WB 1I1CA 2NY0B 3OKOA 3TCXA 2BSRB 4QTHB 3UTTA 2NY1B 4JGMA 4ZFOA 2X1XR 2V33A 1W2KT 4RGNE 1LDPH 4IKJA 3Q5OA 4M1CC 3ARBC 4MNHB 4KPHL 1OGAE 4HS8H 4BRJA 1HNYA 5KSBE 4KJWD 3QH3A 4ZNEA 1BWMA 4G8EB 3W9DA 4H1LG 3ZLQC 1SXNA 2NT0A 1W8EA 3MQIA 1EO8L 3RHWK 3PHSA 5I8EA 4TSCH 3PU7A 2FT7A 6PCYA 2NUTB 1JNJA 3CWGA 5LBSH 1IC0A 1R24B 1TMCB 4OT1L 4S0HA 1QHPA 2J6EA 3CK0H 3FB6A 3G04B 3GI9L 4JO8A 3RB5A 5JORB 2ATKB 3HBZA 2XG4B 4Z95L 2D0FA 1TTCA 4H8UA 4PJBF 2C3VB 1EGJL 3GMOB 3QEQD 5DWUH 4MD5B 4BE5A 1EA9C 2XX1A 1NCBL 4Y5XB 2X28A 3S5YA 5C7XL 3FUFA 4GXVL 3LXCA 1F00I 3VRLE 4HXAH 4P2YA 5D70H 1NC2A 3MV7D 4OLEA 4LP5A 3VYPA 2YPKB 3QEGL 5ACLA 2Y07L 2PYEA 2VLJE 4JVUA 5CHNB 4ANUA 3H42H 1CQYA 1HHIB 4KFZC 2HT4D 4KZCA 3O9WA 2J1YA 4BIKA 5E99L 1MQKH 5B1CA 2WW8A 4HOMA 4RGND 1NLBL 3HJEA 4BCYA 3VMPA 2N7SA 3E6HB 1E65A 4KTYA 2EXTA 3EYUL 1OGAD 3WG7B 4GB9A 2BNQA 2FQGA 4P2OA 2EIBA 1XH0A 5I1LB 4P23A 2BOCA 5I1DA 3ABZA 2ZTBA 3LPOA 2H0PA 1LL1A 1HVXA 4YDLB 5F71A 4RFNC 4XHJD 2Y7NA 2YD2A 3VE0B 2PP8A 4UNIA 1IGTB 2YQGA 1CF8L 3LN4B 3C6LD 3EO9H 2C9SA 4FXTA 1P5UA 3MHZA 1TQUA 3F62A 4FQJL 5B1JC 2W0KA 1HHJB 1YO4A 1AHKA 4PMEA 1MFBH 4A67A 1R19A 4C83A 4XTRC 3L4CA 4F27A 5I15L 3W5MA 2K9FB 3V0IA 1CT8A 4TQ8A 3LQZB 5F0MB 1NEPA 1D6VH 5CN1A 1ZK9A 4BFJA 1EHLH 2GITA 1UQSA 5IQMA 2CBPA 4HETA 4Z7QE 2NY0C 5D72H 2NY1C 5JXAH 3RI5K 1AIZA 2CIKA 2P7TA 5FK9B 1I8IA 4LAQH 3TVMD 2XWJB 3BP5B 1KT2B 4MMZB 2ADIB 4XPGH 3FQ2A 4JO1L 2HKAA 2R0LH 2C4FU 5DD1H 1I1FB 3DDGA 1FV1A 5JW4M 1T2QL 2H26B 4JM4H 4UDUB 3EJZD 4HKXA 4OLVL 2BSCA 1BVKB 2APTA 4R2GC 4QJ5B 1VADA 3ULSA 4OGYH 3NIGE 3HZKA 4MSWA 1O0VA 3S35H 3K81A 1CZ8H 3FCTA 2BY2A 1J5IA 2IXQB 3X1EA 2AK4A 1DJIA 3QEHB 5C97A 1SJHA 4HUWB 1A6AB 4LRNH 2VSCA 3ESPA 4N2MA 4BH8B 4FHKA 2EDHA 1ZGLB 5DQDL 2JIXB 1EXHA 5AYUL 3QUXC 1RUQH 3QULA 5KS9B 3K91A 2CIIA 3EBHA 5I30H 1UXMA 5LJYH 4NZJA 2VLME 2IF7A 3D3VD 1UA3A 4EIGB 1U8KA 4GW5B 1R46A 3VH8A 1CGUA 3F8UB 4Y5XC 2C3GA 3F7YA 3KE0A 1Q8MA 5CJXC 2ZXWB 1YEJH 4MX7A 3KCWA 3QZWG 4HS3A 5BV7H 4W9EC 3GRWA 3U46B 3CFKB 4HJ1A 4X80L 4XRCA 3CBKB 4MHHG 4NRXB 4Y16B 4HK3J 5DRXB 1EAJA 4R9HA 1DANU 2XRAL 3U1QA 1E9QA 4MQXD 4XN1A 3OAYH 4JKMA 2C9PA 2QGDA 1L6ZA 2XCMC 4ODSH 4AEIL 2GSMB 3DX2A 2UZIL 4ZZFA 1VPOH 2VKXA 2AMGA 1N4XH 4NC2B 1AY1H 1C1EH 4A7VA 2R0KH 3WEBA 4TUKH 1QA9A 2J43A 4Y1AB 4HUNB 1QQDA 2VAAB 4CDHA 3ZZLA 5J6GB 5TQ0H 4JM2D 4U1HA 4YDLC 3PDGA 4TNEA 2CH8A 4ELMF 3CFMA 4X4ZA 1ZTXE 3QRFM 3X3GL 5ABDE 3SPVB 4FQLL 3LNFA 4KOBA 4LU5H 1E5UI 1T5WA 1Y6NR 4M7KH 3PWPE 4RESB 4NHCH 4P5RA 4JVWA 4XH2A 2VLMD 4LE8A 4DF9A 4M43L 2AJXH 4LSTL 3NFPA 4OCSL 1G9NL 5D7JC 2BZCA 2E0PA 1BJ1H 1RIHL 3UG4A 5TDNB 2V7HA 4HKJB 2V2XB 5D7IB 5FF6B 1H3XA 2WIMA 1GYCA 3T0VA 3ENEA 4J3SA 5AB0A 4CNIA 7PAZA 5G5DA 4MMZC 2WBJB 1WDAA 3UPAA 5A16B 1FL5A 2ENPA 3AG3B 4NWUL 2OMWA 3KAAA 4JFQA 5C07E 2GC4C 3B1TA 3ILPA 4YIQB 5AVYB 2ZWLT 4IMKC 1CK0L 1U8PA 3V0AC 5CSZB 2WB7A 2VAJA 1TLKA 3ULVF 5C9JB 1MFCL 5EC1B 1JHTB 3HUJE 1MWAL 3WJMB 2X0WA 5BOJA 3QT2A 3KLHD 1DP0A 1OGTB 1FRGH 3EHBD 3P4MA 5CEZE 3FPXA 4BZYA 5I66B 3OG4B 4ENZA 1E9OA 4NN5B 2F1AA 4HT1H 1TYJA 4N25A 3Q5YA 5IMLA 2VDKL 1F90H 4H4NA 1RK0B 2VZ3A 4UQIM 4EDWL 4QLRA 4HFWB 3FTXA 4IGBD 3FU9A 1T0NB 1N3NB 1NFDB 4G82A 1Q0EA 4JJ5A 4JK0D 1L9SA 1KENH 4HXBL 4LLYA 4ZUUA 2GJ6D 2R1YA 4BFNA 2UXVA 3GSQA 1IU1A 3NPSB 4JFWA 5E8DH 4YDNA 1SXSA 3N55A 4YNYA 5LDUA 2QJDA 5ACZA 4HKBB 1DQQB 1JV5B 4Y16C 4XNDA 5JHLH 2PETA 5TK4A 1RJLB 2Z3FA 3UFIA 1OCWH 1QHOA 3WSQH 4B97A 1OV8A 1E4KC 3WMQA 4R4FH 4ILDA 3OAZH 1CLOH 3D9AL 2NYKA 4Y7OC 5EA0L 2GHZA 2JWYA 3U48A 5C07D 4N8PA 1DE4B 4KK6C 4HJ0D 1NEZA 2G5BB 3WXWL 3VXTB 5HYJB 3L3IA 4XHQA 3RWEA 4MMXA 3R0MA 4ODUA 4E41A 1BLNA 1UWEL 5CZRA 1OTTD 4CDGC 1QI4A 1IJ9A 4XE0A 5E0FA 3GKWH 1X5YA 5JOPE 4LP4A 4FKHA 1AFVH 1UWYA 1F11A 3AS0A 3DGGA 4QAWA 1IE4A 5F89A 3CNKA 1YQVL 2CUMA 1NOAA 4WW2F 1T1YA 3FCSA 1VFAB 1E8ZA 3OPZH 4Z7WF 2H1XA 1ZGLM 1L3NA 3POHA 4MA8H 5GIRB 1T66D 1QABA 4D0DB 3FDWA 3ZE1B 3DOSA 1CFVH 1UOWA 1MFUA 3UIYA 4A68A 4YQXL 2HTKD 4W1TA 3U7WH 5I74B 4G1EA 4AYEC 2Y5EA 3D0VA 5CEYA 4OTXL 3SD5A 3K4AA 1MRCL 3T0ED 3O6KL 3QIWD 4NKOB 1MHHA 3ZBMA 4LLDA 3A23A 5DDHB 3FFDB 4HHGA 2WBJC 1Z32X 2YUWA 3KDMB 4CJ1A 3GRWH 3PGCA 3FCGA 4ZPTB 3CHQA 3O41B 1ZDSA 1T83C 4KUCF 1AJ7L 3LKRB 1YY8B 2D3NA 3TBYB 3VXSB 3SCMD 2CBQA 2R39A 1SVBA 3U6XS 4YPGA 4ZAKB 4ODHL 1A21A 4X6FA 1ZT7A 2Q7YA 4NN5C 3GGWA 1DBJH 3CLFL 3IJHA 1U0QA 3OGCA 1HINH 5JOPD 1BG9A 4M8QB 5DEFB 4ZSOB 1RY7B 5DWPA 1YYCA 1W16A 5JW4N 1PS3A 4P2QD 4F20A 2CLZB 1SHXA 1AG6A 4TL5A 2WTOA 4DIXA 2AJ3B 1X5JA 2FIKA 3PWLB 3MRIA 3N1GC 3NK4A 3QORA 4LLMB 4U1MA 1NDTA 4OCLC 5CU9A 5EUKB 1TZHB 4PS3A 1FZOA 5BZDB 1E3ZA 1LWHA 1EX0A 5B22A 2OMVA 3R18A 3NPSC 2VDNH 1BAFH 4K9EL 4JRYE 1XHHA 4NGHL 1XT5A 2ZUXA 2WXNA 3QA3B 3NN8A 4K07A 1JK8B 3TBWB 3UEQA 2SEBA 3PGDB 4G6AD 4MZ2A 4OGQC 3FT3B 2VQ4A 1ZLSH 2XQBL 5IREA 4EZMA 1MHPL 4BK5A 2Z4QB 1OPGH 4FNUA 2PKDA 1M42A 1WEJH 1ZVNA 2W65A 1P6FA 5T1DH 3TL5A 3SQBA 2ITCA 3KPOB 3V4VL 2IFGA 5I16B 1KLGA 3EDJA 1G1CA 2DJMA 3IDJB 5F8RC 1Q9KA 3X2QB 3ZE2E 2GK0B 3ZKMC 1DEEB 2QFRA 2PABA 3NCYP 2ZUTA 4ELMA 4C55A 2BCKA 4OFIA 4TUJB 3BE1L 2FATL 3WUWB 4XT1C 2XY2A 4TQEL 3WY4A 4YDIL 1LMIA 4N0CC 2YK1L 1E2VA 4XC1H 3EFOB 1SVZA 3NACH 1SY6A 1OSPH 4LCCA 2ESVE 5CLWA 1HNFA 2EDLA 2YKKA 1KEGH 2EEBA 2G0KA 2ZF8A 2YEVB 4ORGA 4HDIB 3RGVC 2RD0A 4UDTA 4L8SB 1E2WA 3WLWD 4X6CE 1HILA 3CSGA 4LNVA 4J3TA 5DUPL 2Z7YA 3HS8A 4LMQI 4QYOB 4MD4B 1M1XA 4Y4FD 1JRHI 5F93C 2IAMA 1EZLA 5E6ZA 4I9XA 4Q9RL 1EZVX 4G1MB 2YKLL 5C6TH 1LP9E 3HEIB 3WXVH 3FSAA 2R2CA 1I8LA 2EDOA 1FPTH 1KCUH 2JB5H 3SBPA 1BV8A 3CC1A 3MFFA 4FQPA 1ES0B 3CSFA 2FBJH 2FR4A 3RPIB 1FG2A 1HQ4A 5DSCA 3O6LH 4ZAKC 4LF3B 4JFPA 4BFFA 2A0LC 2GTWA 8FABB 3D4GA 3L2MA 3MOBH 4KKAC 4OKVB 3FS9A 3LMJH 4HP5A 1KJMB 3GRBA 1Q9LA 4IIQA 3FU5A 1H19A 4WNQB 4JCWA 3BIBX 3DVNB 2FJHB 4P5TA 4YJZL 2W9EL 3MLYH 1PG7X 1A3QA 1TJXA 4LSPH 3IXAB 5TDOB 2OMUB 3CU7A 4W6WB 1EDYA 3UZVA 4F37K 1FE8L 1OB0A 2PW2B 5ITFA 4YDKL 2MIZA 3OKYA 4BZ2A 3K71B 1E6JL 3GSOB 4HFUH 3M17B 2CZNA 5H94B 2EYSB 1GZHC 1C16B 1IAOA 2Y7QA 4FFTA 1TVDA 3MLUH 3L4VA 1U21A 2DBJA 4HUUA 2DYRB 4M1DL 5GRUH 5IW6B 1JGEA 1YC7A 4ZMZA 4K23L 3X17A 2WBWB 3AY4C 1A4JB 5FUOH 2BSTA 1HXYA 3B8SA 3QWNA 2ORBH 3THMH 2ZCKH 3V9CA 4WTXA 4L37B 3ILQC 4LLQA 5DI8A 1AR2A 2C9XA 4J3OD 3RVXC 3ARVA 4DAGL 1ZS8A 3DHUA 3M88A 3SBWA 4HK0B 3A6OA 4WW2A 3D85D 5DZ9A 5A7BA 1JYVA 2ZAIA 3L6FA 3HHRB 1SBSH 4QHMB 3QEQB 4PJGB 3D48R 4YHOH 5IVXB 3VFOA 3VQMA 1MUJA 1RD6A 5E9DA 3HZ3A 4WHYG 3DNKA 1A6PA 5AZ2L 2BMKB 4ABWA 3FF7A 1U8OB 2Y3NA 4JFUA 3NJGA 1NGZA 2P8PA 4PWHA 3RVWD 5IJKC 2JCCF 3PFQA 4XNMB 3MJ7B 1AZVA 1J0ZA 4F8TA 3MREB 1EJ6A 1V10A 1FCCA 3BD4A 3IDMB 2F1BA 2J72A 1J0HA 3NJNA 1NDGA 3CCHA 3D2TA 4PJDF 4DEPC 3KD4A 1JGDA 3ULUL 1V3KA 4RGNB 3CSYB 1H5BB 2ZE0A 3WNJA 1OGAB 3KDPB 3LNEA 4R96B 4TSBH 4WLCA 1JFQL 2Z91A 3PWUA 3T3PF 3NT0A 2EYRB 2F58L 5KANI 5KSBB 2CJUH 4AIZA 1O7SA 4XI5D 5GGUA 4DNLA 4WY7H 4DGIH 1A4AA 2VABB 2UY7B 2FHCA 1RUAL 4B5EA 3IDNB 2K7PA 3UTQA 3C6LB 1LO5A 4PY7A 3MRBA 4JDEA 4IYKA 3V0HA 2VISB 1UB5A 3GSNB 4K7PX 5AVQB 5EBMB 5HPOA 2R69L 2VITA 3LD8B 4LDLB 1QRNA 3IEAA 4M1GL 2IDCA 4PJ6A 3CH8A 1K8DB 1NCAL 2F5AL 1WZMA 2JELL 3GZKA 1GKEA 1FNAA 2MOQA 5TGBB 3TA3D 4HOWA 1FFOA 3HR6A 3VG9B 1FVEB 5EUOF 2QPUA 1A1NA 4YDZA 4IOSA 3HHMA 3CVHA 4EQ3A 3EJUA 1MSPA 3NZUA 1XH3B 3S2CA 1P4LB 2BJML 3HI6H 2J5WA 2EAEA 3TVMB 3CFTA 2VLJB 2D2OA 1MDAA 3CLWA 3FOMA 3FQYA 3IFPB 4TNWK 4WI6A 5HVFB 1WD8A 5KVDE 1TTBA 1UH4A 2VXQA 3S37H 4KJWC 3ETTA 1JZDC 4JFXA 5I0DA 4KQ4L 4XVUC 5EC2B 3MRGB 1R3KA 3OKNA 4KQ0A 1P1VA 3F2LA 2QTEA 2H1PL 2KZBA 2HX8A 3FN9A 2VDRH 4XVTH 3B6SB 2WLYA 1XF5B 4PTUA 2XXFA 2AGJL 3AU1B 4HA1A 1U42A 4WU7B 1JNNH 3JVGC 3ULVH 1RUKL 3SQOH 3ARGA 1TEYA 3NIDE 4CN4A 2R0WH 5I1GH 1Z9MA 4F33A 1RSFA 1PBYA 3H9HB 4QT5B 3LKOB 4OCXH 1CGYA 2BSBA 1AXIB 1OAQL 2WKGA 3K3QA 4PG2A 4NHUA 4YDVB 5EBGA 1KB5A 1YPZF 4R90H 5B38B 3VWJA 5LLIC 1OWRM 2NY3D 3FHAA 4KJYA 1I82A 2KZWA 3MLTA 1IFHL 1KYDA 1AANA 2ZOUA 3QRLA 3S96B 4HULB 2QSVA 3GINA 4Z7QB 2EXWD 1IKNC 4NENB 4DUWA 2HT4C 3DPDA 3OB0H 3QIUA 1JD9A 3MLRH 1V3LA 3EYFB 3SE3C 5FO8A 3VD5A 1D5ZA 1H5BC 5DXWA 1KPRB 2Y7LA 1FNSL 3GLDA 1RQ5A 5HHQB 1CR9H 2VR3A 1URIA 3IFOA 2OFQA 4U1LA 3ASWA 4XVJL 5FHAL 1GRWA 3IAPA 5JHAA 4XP1H 3MUGB 4B9PA 5BMFH 1GGBH 1CLYL 5JHDA 2ICES 2UZXB 1U3HD 4XHJC 4XWOD 2P8MA 3BJLA 2OV0A 3BWZA 4YXLL 1UYWL 1NANH 5CINH 4H1LH 3VQLA 3OHXA 1OZTG 3VFTA 3L3OB 4KJPC 5MP6H 3LD8C 3S4SA 3GHBH 5IB3B 1V05A 3J27A 3W0WA 4ZMQA 4K71B 2HFFB 3GSRA 3I02B 2W9DH 3VG9C 2BNUA 3N44B 2OTUA 2C26A 4NRZB 3B3IB 4P2RA 4UT6H 4KNSA 4BUHA 1CYGA 1F4WH 4NDMB 4PR5B 4N2LA 2DQDL 4TNFA 2FZ3A 1TVBB 4AJWA 3U1SH 5M94B 1LNUB 1ORQB 1DFBH 1NKOA 2VDLL 3IFLL 5DJYB 3TV3L 4RISL 2ADYA 4OBRA 4H44C 5L9DH 1JMXA 2QQLH 3O4LE 4ODXA 4AYBA 4EEEA 4XMUA 5KSUA 3TESA 1DN0A 3FUEA 4UUJA 5E7FA 2EDBA 5F1IB 3OJDA 5B7FA 3FTGA 2PUQT 5LAXB 1XL4A 3BPOB 3RA7H 1W0VB 2C1OA 4PWFA 5JHMA 4J3WA 4L48A 4XMKL 4BHUI 4KXDA 4UQ3B 1NAML 5FLUA 1WWCA 2CALA 3O0RH 5D4IA 4XBEH 4AJ0A 1IQWH 4ICXA 2ZXQA 5FWQA 2DDQH 1A5FL 4IGBB 3KYNB 5KUKA 1YEEL 5IQ7L 1R3JA 5F21B 4N0YL 4YEEA 4N9GA 5L8JB 1QFPA 5F96L 3EJYC 4KMQA 3PUCA 1N26A 2JCCA 3OXSA 5EFIA 1KCRH 2ENSA 1F2XK 3OMIB 5E2JA 4PJDA 3FTSA 3O4OB 5DZVA 2CDFA 4HCRA 3VM7A 1J8HE 5LGHL 1P9MC 1XGZA 1X9RA 4PRPE 1FC1A 1I8AA 4LEOB 4Q0XH 1TZ8A 1UXWA 5C07B 3KPSA 2X3AA 3BZEB 2OTPA 3FO9A 1YY9C 2YEZB 1FGNL 2YD7A 2VR6A 1OQXA 2VXQH 3O11A 4AIOA 4TTDC 4M48L 3TNNB 4V2BA 3GHPA 5IROD 3ZDXF 2I60H 5F7HA 3RFZC 1PX3A 1ILSA 3HUJB 3K0WA 4M5YH 4XX5A 4S1SH 4YXHL 3TH2T 5SV4A 1JGLL 4OB5L 5IJVA 5E4AA 1J1XL 1WC7A 1MFDL 4RAUA 1KIPB 3CMGA 5D7HA 4HEPG 2VR9A 4OD2B 4Z7NE 1A7PL 3GPEA 3L3OC 1K4DA 1XIWC 5F9OL 2G60H 3I50L 3KWUA 3SDAC 3CZUB 3X11A 4K2UL 1ML0A 4H26A 4NN7B 4PBDA 1NGQH 2E76C 3QIBD 1XR8B 4K71C 3SGJC 3ELQA 1J5HA 5EUOA 5E70A 4JFDE 4JDZA 4JY4B 4XPFL 5IB5A 3DKHA 2RHEA 3AC0A 3LRSA 2OBGA 1NSNH 3ERXA 6PAZA 3M7OA 3T0EB 2OSYA 4XMLL 3KVDD 3QIWB 4D0CA 1A3LL 1KB5H 4CU6A 3GIVB 4ZX6A 2AKRB 4IJ3C 4UINH 3DX7B 4JFZH 1X7QB 5T3ZH 1OO2A 3M07A 1A7QL 4Z18A 2FJFB 3ZSTA 2O6PA 4NAJA 3LIZL 2BOLA 2ZOLA 4PRPD 1FYHB 5E03A 5I73C 1H9DA 5AL0A 4ONHB 2VMFA 4BEIA 3SCMB 3BPOC 1R17A 4OIAA 4OI9A 4R0LB 4G6ML 5FDYA 4JDVA 1VCBC 4YSCA 5MI0C 5AWNH 1MHEB 1BFSA 1M05B 1UURA 2OSLA 2ZJSL 1FIGH 1BQHB 1AKPA 3ZDYF 1PQZA 3VG0L 3MMEA 4U6XA 2Q8BH 3QUYD 1P7QA 1VKXB 1W0WB 4P2QB 3IWVA 5BW7A 4JY5H 3A6CL 2XPGA 4F2MA 3ZYIA 1OCCB 2DLFL 1DO5A 1GJIA 1RU9H 3UC0H 3VI4A 1YPZA 3HPLB 2W95A 4OM0L 3ARFD 4X4KA 3LQMA 5E94A 2BIOA 4W9GC 1F58H 1IGCH 1XGQA 2HVJB 2FSDA 3QJFB 4JFDD 5CGYC 2BVUA 1QNIA 3GMLA 4LSDA 5GJSL 1IQDB 1WCQA 4RZKA 3O4OC 2CO7B 2KUTA 2DQHH 3CDYA 3TZVB 2BDNH 2EO7A 1NBQA 3B7UX 5CJ8A 2WQVA 4AM0Q 2FX9L 1J9QA 5DC9B 2XQYA 4KK8D 2UVFA 2XWEA 4DO4A 4I1PA 3VXPA 1ZLUH 2IALB 2KERA 4XNUL 3MO1A 2ADJB 1ZSDB 2J8UB 5DC4B 3K46A 5F6HJ 4PJ8C 3DC0A 5CJOH 2J44A 1D5IL 1T22A 2VKWA 2AEIT 3JV4B 4JRFA 4LLAA 2H0EA 3AG4B 1N5YH 4UAOB 1N5AA 4HUVA 3IM1A 2Z93B 4OGXH 1AGBB 2CGZA 3BKYL 3CDZA 4F9LC 3F7QA 1ND0B 3QPKA 5FGBC 1ETB1 3IKCA 2VZVA 2X4QA 4WRLA 4NN7C 1N6UA 1T66C 3LZLA 3STZB 3X12A 3UTZA 3T77A 1GAFH 2OJ1A 2Z7WA 2XWDA 3UX9B 4JAMB 4KBPA 5EBLA 5EOCH 2HTKC 3B1UA 1I7UA 3R19A 4JRYB 5JA8B 3QIWC 4G8IB 3MX0B 3WY3A 4LCWE 4Y4FB 5CM1A 1MW0A 4POUB 5IQNA 4HHWA 3BIKA 4XBGB 1OIOA 2LR4A 3HC0B 5HGBA 1BZ7A 4FLQA 4RFOL 4Z77A 3VXRE 3JV6B 4RAVA 4P49A 4MJIA 4JPVH 2K45A 3ISWA 1IGMH 3K2UH 3SKOB 5C0AA 1KCLA 5IB2A 4RFEA 3MRKB 2AQRA 5SWQA 5D6DC 1NCCH 1O75A 4P5MA 1P5VB 3EFFA 1BFOA 5KVGH 3DIVA 3K6SB 3DROA 3G5VB 4K5PA 5ADPH 2LFGA 3MOQA 1QBLH 3PPEA 4NN6B 2BOBB 1RIVL 1KUMA 1GZQA 2QVKA 4HJTA 5C09E 3Q5TA 2FH6A 5HYQB 2MCMA 4EAEA 4AGPA 4DZBB 4ZMNA 5I1IH 4OH2A 1OSZB 4WHTB 2IH1A 1P4BH 4S0TD 5K69A 1WCBB 3SYQA 5L2JB 3U2JA 4RETB 1U8QB 2IDSA 1DVXA 4X6CB 2Z65C 3FQUB 1CFSB 2ITDB 1LO4H 4P9MH 1XB8A 1AQKH 3KPQB 3ATBA 4KTDL 2MQ3A 3TZVC 4LCWD 1XGTB 1YUHA 3QJOA 5G55A 3KG5A 1S9VA 4JMXA 1U3NA 2WBXA 3S8GB 2LVCA 3D7PA 1LP9B 2Y5TA 4E5XA 3VXRD 3BSZH 4PLOB 1Z0MA 4XPTH 3DRTB 2YC1A 1A9VA 2BY1A 4NQCA 3G6JE 4PRAB 5DR5H 3KVQA 4HJEA 3OHMB 1J1OL 4ANVA 4AKQA 4RH4A 1ZTMA 5GZNA 2X4SA 3BIAX 4ECNA 3S88L 4CVUA 2GUOA 4FYQA 3A6BL 4BK8A 4QRRA 2WNKA 1CGSH 2WLMA 3S34L 2E7BA 1FNLA 3BKML 3WFEH 4F3FB 4GUQA 4UAOC 2R2HB 4CVXB 3M1BB 5D7SL 3FTUA 3L5HA 3VDCA 3D85B 4PG9B 3WUWG 2YGOA 3S3CB 4DVRL 4LESA 1XZ0B 3K2MC 4FA6A 1JXGA 2BVPB 2JKRM 4QXGL 3TBTA 2WINA 1YEDB 5D9SA 5C09D 1JWMB 2X9WA 3QHFH 3JTBA 1XEDA 1U92B 4KAQH 3VYOA 1P0SE 3KNBA 3MJ6A 4TLSA 5FDWB 3SJVA 1ZT1B 2DTSA 3RBSA 5JIIA 4X50A 5KS9F 3UTSE 3WLWC 2OL3B 2AF2A 2X4OB 1JZGA 1MCOL 5LCVA 5IMOA 1DJGA 4GAJH 4KKCC 3GM8A 3T71A 3FQ1A 2K0RA 1EZUA 2MNWA 1XBRA 3VYNA 4OLUL 3I75A 3TURA 4WEUD 3JWNE 3VFUB 4HZLB 4MNQE 3RNKB 6FABL 3BKCH 3ZHNA 2NZ1A 4KKNA 2VUOA 2W92A 3AWEA 1G7MA 4IBVA 1ZHLA 3IMSA 4NJ9H 3NCYS 2A6IB 1C12A 4CKVX 5MEQA 3SN6N 4QO1B 2L7QA 3F84A 1A0QL 4HH9A 2QKSA 1KNOA 5HPMB 3QPXL 5F9AC 5EZIH 4XO3A 5IGXH 4B7LA 2A7BA 2LU5A 1ZJBA 5ENWA 2W0FA 4LKXB 3BLBA 5FM5O 4G9FE 1VCAA 4LPVA 5DJ6B 5DK2B 4FG2A 1SM3H 4Q52A 5DTFA 3RDJA 3BO8A 3TA3B 5BRZE 1SXZA 5B1JA 5E8PA 3VRIB 1G84A 4OVUA 4BUGA 4X99B 2WWKT 3ROLB 4CAGA 5D1XD 1R5VA 3UTSD 1SOKA 1ANUA 2MCPH 4ISVA 4LVNB 1E5CA 2X4TA 2I5YL 5E4EB 2VN4A 3QQDA 5BS0E 4M3KB 3MCLL 4NZUL 4WWKC 4P4KC 3M45A 4XODA 2V7NB 1A2YB 5D7IF 4IBUA 1SN2A 4QTHA 3MGOB 1F41A 1MKFA 4N28A 1QKZH 3M6DA 1HSAB 2BP0B 2LV4A 4X7TA 3IJYB 1GC1C 4D8OA 3KYMB 3QZMA 3HI5L 5FKAA 1KFAH 1OARH 1U36A 2WZAA 4JPWL 3H53A 2CGRH 4OV5A 4XPBH 3SPJA 3DUUB 3BP7A 4JQIL 3MBXL 3H9SE 3NCEB 5LGYA 4IBQA 5E00A 1AGCA 3VB9A 3MI6A 4P5KB 2NW3B 3D4YA 1R24A 1TTFA 1NGXA 5HHXL 2C9QA 1GHFL 4MAUL 1XCXA 2KQNA 3RJQB 2ATKA 4G9FD 4HC1L 2V37A 2VN7A 4J23A 2D0GA 2NY3B 4OJYA 3V79C 2K3HA 2WN2A 4XNYL 5BRZD 3QXAA 5HHOE 3IDGB 4DO6A 1UA6L 3S6CA 3EO0A 5B1KA 3S8FB 3IJ7A 1XF4B 3JWOL 4HWUA 4YR6A 4N68A 1O9WA 4G6JH 2PTUA 4AZ8B 3MV9E 1X5MA 3P2DA 3HLKA 5BS0D 1N64L 3CFCH 1FAIL 4NERA 2JJWA 2ZSWA 4IMLB 5CHNA 3V6ZB 3LH9A 4Q9CA 2J12B 3B2VH 3QUZD 5FCUL 3B5GA 4XI5C 5C0BE 4HAGA 2H32H 3GQFA 4XCCL 3UROR 1RUPL 1IVTA 2ZONA 3QCVL 3E6HA 3QDGE 2VZ1A 4JPKH 3DXAE 1U3HB 1LDSA 5CZVH 1T7XA 1UCTA 3DX8B 4JHAL 4BD4A 3UPRB 4NOBA 3X1NA 3K6FA 5I1LA 4X9HA 1Z5HA 4J4PD 1H3TA 1EAPB 1U41A 2YQ3A 1I9RH 3MJGX 3Q9PA 2FUTA 3NIDB 3Q6FB 1XGRB 3UJJL 5I17B 3H9SD 3MLVH 3R4RA 4OCWH 1RZJH 2VJ8A 1JPEA 3ML8A 4JRXA 3MNWA 3VE0A 5A1AA 1IGTA 1W72A 3CBRA 3LN4A 1T89C 2O5YH 4K3HA 4EN3A 1MRDL 3VXOB 4ONFL 4I77H 3TA3C 2UZYA 4N85A 1SYSB 4G7YH 2X88A 1HHJA 1G7QB 3IJEA 1BIIB 3GSXA 3QJQB 4YAQB 1GR7A 4W9KC 3HAEA 3UBXB 3ARRA 3MV11 3FK3A 3LQZA 4LVNC 1WA2X 4H8HA 2R2BA 7PCYA 4WHYH 1CTNA 3VD7A 5DJDB 3P02A 1PY4A 1M6UA 3VI3F 2ATPB 3S5LB 3BPCB 1MEXH 3UTOA 1USZA 3MV9D 3HMWL 4O51A 3DRQB 4PW4A 4UTBL 3RTLA 4YHLL 3GZQA 1E8YA 5A2CA 2XWJA 3ZHDA 1LD9B 1J10A 1AGEA 1KT2A 2ADIA 3EYOA 2PR4L 3EW3B 4FZ8L 4M6OL 1WGVA 4GKSB 1IKFL 2H26A 4F9PA 4RMRA 5C0BD 1N10A 3MCKA 5DRWA 4QHNA 2EICA 1T0OA 1VA9A 2AXGB 4M62H 3X14B 2HRGA 1VFBB 3GK8L 1CBJA 2IXQA 3FQRB 4XN9A 3CD4A 1QNZL 3QEHA 3I9AA 5DHXB 4BH8A 4DW2H 4APXB 5ETUA 1AO7D 3AG1B 4IBLT 3OKLB 2W1NA 2Z4TA 4QWWD 4IKKA 5AVZB 1JGUL 3ZKND 1QEWB 5KS9A 3O8XD 2NY3C 1Y0LB 4NSKB 1MPAL 2KZKA 2A4CA 1BF2A 4JN1H 4WSJA 5AENA 4AVHA 3MRRA 4QR7A 4QYAA 4G11A 4JO4L 1N2RA 2OSXA 4GW5A 4MMYB 4PCYA 5F8QC 4IU3B 4BKLB 1G0XA 3FTWA 5DD3L 3BEWB 5JPNA 1AI1H 3TFKC 2D4DA 4ZFGL 2A77L 2YWZA 3SDXE 3LEYH 3ET9F 4YSEA 3U46A 5FM4A 2WWNA 1OD7A 1CFQB 3T6VA 4DVBA 3HN5A 3DJRA 4NRXA 4EVNB 4B41A 3SZKC 5PCYA 4KVPA 3A4EA 1RZIA 3UBXI 3HFML 4L4JA 1NMBL 3BAKA 2GQHA 3OBAA 2WXMA 4WFFE 4WTWA 2IGFL 4EIZC 3IAQA 4WIQA 2DLEA 2B4CC 4HWBH 4MFHA 5J6GA 3BRGC 3BHBA 3VGEA 1XXDC 3MR9B 3ZKXB 1KXTB 1RULH 3RP1A 2QHLA 1X7SA 4BWTA 4ZOAA 1IBFA 4H88H 3GXDA 3RKDD 1YEKL 2NY6B 4DESA 3L9EA 4JFEE 4NCC2 2WZ5A 5DHDA 1RP8A 4PU2A 1N6VA 2EKSB 3BH8A 3C60A 5FB8B 2M1KA 5KN5B 1QTYT 3LKPA 3ZJAA 1YNTA 3L7FB 3WKNA 5IESL 4OQTL 4HKJA 1MJUL 1FO0L 2PTVA 3HG1E 5D7IA 1M6OA 3K74B 4LCYB 5FF6A 4WEEA 5ESQA 4QY8A 3BVNB 2QV2A 2D7TL 3TO4A 4PRPB 3JTTB 4FFZA 4OIBA 4EUPA 5BVJA 1KYOK 5A16A 1W9XA 3L8QA 3L3GA 3G5ZB 1VEMA 4KK9C 5HDBE 2GIMA 5DS8B 2JJVA 2Y06H 4ZW6A 1O9ZA 3TT1L 4MZRA 5CSZA 3QUMA 2OJZL 3UO1L 2R29H 5I9QC 3CLEH 2YBRA 3CV5A 1I4FA 4AQ8C 5EC1A 2FWLB 3QUYB 2Q5BA 3KL0A 2Q2LA 2Y1AA 5DRNB 4KY2A 4MXWL 1AP2B 4Z7NB 5IBLD 2VMCA 1AXSB 1ETZB 3OKKB 4UIKL 1RK0A 5J89A 2A9MH 2DBLL 3ARFB 1LE5B 3ALPA 1U2YA 3DHJA 4HJSA 1T0NA 2YD3A 1ZLEA 4KJQD 1GYAA 2ZNXA 1U3JA 3QAQA 2DAVA 4G9DB 4ONOA 4JFDB 4ZT1A 1ZVHA 2BSEA 4OM1L 5DK3A 3H55A 4AMWA 2COVD 2ZCHH 4QHUB 2ETWA 4FG0A 4JFED 4M8VA 3DO4A 1D2OA 2WCGA 1KSRA 4PJXE 4GO9A 4RLDA 5AW1B 4OF0A 4UB0H 3QO0B 4HKBA 3AQXA 3I6LE 1I8MA 2J88L 2QZ5A 3MSPA 3HG1D 4JFOB 3AWFA 2NXYD 1CXHA 4A6YB 1QSZA 1KZYA 4XPAL 1RZKC 5CAYB 1JV2B 4R4ND 3DMMC 4JZJB 3INUH 2RA1A 5FECB 3IMTA 3HPJA 1EXUB 3DTUB 5IEKB 3V52L 1G6RL 1UZ6E 1MCLA 2QGCA 5ADOL 5B3JE 2FWSA 3VXTA 2TSBA 5HGHB 3BW9B 4FERA 1BSIA 4B0MB 2DMKA 4HGWA 5TE6L 1P84K 4B50A 4KGJA 1E5AA 1RZGA 5JTWA 4N8CL 3IDXH 3UGXA 3N41F 2P43B 4M7JL 4H8WC 1S5HB 1CDCA 2H6UA 1F3DH 4G8FB 4BELD 1JVOA 1GZPB 5AKSA 2J71A 5HVWA 3QFJA 2WNGA 4ZOBA 3D87B 5SWSE 5FYLL 2NY6C 4PJGF 5IVXF 5GIRA 2FIRT 1D7CA 2V6HA 4RBPH 1ZLVH 1ZPLA 1DVTA 2VZSA 1QUPA 4TQIA 2IPTL 2APFA 1KDIA 1P7HL 4G6FD 3VI3A 3WNOA 1NPJA 5C86A 2YFNA 1N0LB 3TWCH 2WYIA 2IC2A 3HMXL 5D1XE 1D5BA 4FXGC 4X4XB 3WDIA 2QELA 1AHWB 1CDIA 4RZCB 3I6LD 2X9XA 3BDXA 2X0UA 2E9BA 1E3XA 1KBGH 4ZPTA 4CVWA 3O41A 5F9DC 4LASL 1GOHA 1QASA 3LKRA 3BVWA 3BJ91 1BBDH 5KSBF 2AABH 3A47A 1LDPL 1CG9B 3UCQA 3VXSA 2KPNA 3NBNA 4HS8L 2ZKMX 1HE8A 4OZFG 5GQBA 3DHMA 3QUYC 2B16A 4L1LA 3RWDB 3QP3A 4ZAKA 3WN5B 3NABH 1TETL 2VXTH 4G42A 1TJMA 1HI6B 3F83A 4XNAA 2IH8A 2C3WA 2G3ZA 2XACC 4YSRA 4ZSOA 4DGYH 2VLRA 3D8MA 4NC1E 5LBSL 2AI0H 3O2DH 4AW4A 2CLZA 3HG2A 2P5EA 3CK0L 2EILB 1VIWA 4E68A 1NFAA 3FT2A 1NJ9B 5SWSD 3P0YH 2XU9A 1T7VA 2ED7A 1IBGH 2BRQA 4E9VA 4M7ZB 2HRPL 4LCWB 3GJFA 5T1JA 3VRLF 2R9HC 1INEL 4IRJA 3VD2A 15C8L 4L9LC 9PCYA 1J88A 2G3XA 1JK8A 1OD9A 4HXAL 2CPCA 3PGDA 4NM4L 3VXRB 4DQOL 4ALAL 1A7OH 2LLGA 2VUYA 4MCZA 2ZOTA 4HIHA 1TF4A 4JZJC 5ID0B 5CJBA 3RTQD 3SBRA 4W6XB 3H42L 2IDUA 2VJXA 2ZIDA 3CVDA 1VACB 3P3UA 1T21B 2Z4QA 3I74A 4GG8B 4P9HC 4LLUA 5I1KH 3LCYA 3L4TA 3DURB 1MQKL 1DVZA 4JJHA 3KPOA 5D4JA 5I16A 2K9UA 1I85A 1EGJA 1LQSR 2X44D 3COOA 1S3KH 1WTLA 2GK0A 2Y1ZA 3AJ7A 4GG6B 3OXRB 2EXYC 2EXSA 4KVNL 2YS4A 5C09B 4TUJA 4KVCH 1RZ7H 3FB8B 1NIBA 3KBHE 3KLLA 1HH9B 3EFOA 3RU8H 5HYSB 1GGIH 4J1UA 3VNYA 4W4NA 4YLQT 2BHZA 2OAAA 2ZUQB 2HWZH 3TU6A 3Q2NA 3CDGA 4K8RD 5AZEL 1GA2A 4KXBA 1MFBL 2Q76A 4HDIA 4W9HC 2VDOB 4L8SA 5HY9B 5IHUL 4OZIF 3PLYA 3WY2A 2OMXB 1UKSA 2WSDA 4K5LA 5LUMA 3HHSB 5CZKA 4TPRH 4Z7QF 1D6VL 1L0PA 1RZPA 3OAWA 4OF7A 2DLGA 5D72L 2YZ1A 3JBG7 1VZHA 4HUCA 1H3WM 5EF2A 2RACA 2D4FA 5JPMA 2BVOA 3RIAF 3DIFA 1PMYA 1QX1A 4DP0X 1ES0A 1L6PA 2R0LL 3PV7A 5DD1L 4JM4L 5KSAA 3GM0A 3RPIA 1IBBA 2EE2A 4J3XA 2H2PD 1A9EB 4JM2F 3WN5C 2BSSB 2YPVH 3BWSA 4OGYL 5BZWA 3TN0A 1U58B 4YC2C 5DUBB 4BQBA 3VDBA 3S35L 1ZLWH 1GGCL 1CZ8L 1EUTA 3MBEA 5CIPB 4B0MM 4DEUA 2HVBA 2Z8WC 2UY6B 3ATFA 1FVCB 1A6UH 4QXVA 2FJHA 1FF5A 3UTSB 3Q43A 1PKOA 1GS7A 4LBEB 2AW2A 3FRPB 3ULUE 1ULVA 2UZPA 4X6DE 4MDIB 5TDOA 4M7ZC 4YWGH 2OMUA 2X9ZA 2NQCA 2OQJB 2ZQKA 4FRWA 1CICD 2VERN 3N44F 3U4EB 2MNUA 2E8ZA 3B9DA 5FWRA 1MNNA 3K71A 1A7BA 1CL7I 3OMNB 3VXUE 3GSOA 3K1KC 3M17A 1YEJL 2VO8A 4WTZG 4UQ2A 4P06A 1C16A 1FLTX 5CP3A 3P3RA 1K6QH 4MNQB 5BV7L 2PMZA 1VESA 4MBOA 3CAFA 1QR1B 1BEYL 4DWHA 2CO3A 2P42B 5IW6A 4IKNA 4YLCA 2I9LB 1ETJA 3FONA 2D8KA 4WV1C 2KBGA 2J73A 3FYIB 4OFKA 2QPDB 3H4HA 1UJTA 5AOZA 1VPOL 4ZFOL 2X0VA 2Q86B 1CYXA 3U9PH 1YN7A 2PTTB 3QPQD 2K7QA 3CN0A 2R0KL 5AAPA 4BFOA 2EQDA 4TUKL 4G9FB 4PCTA 1U8JB 4W4OA 2X9YA 1S46A 3UGUA 2EUZA 4FCHA 5D7LE 3BAWA 4LEBA 4TNVF 5BRZB 3QEQA 4WEBL 4PJGA 1IIIA 5CMAB 5FKPB 2ZUQC 4C56D 1TZIB 4ZW7A 3BDBA 2L0DA 2WQSA 2CCLA 2MQCA 3ULUD 2LU3A 4M7KL 3MV7A 5BS0B 1J48A 1JRHH 3MREA 2J6EL 4NHCL 3E80A 5D6CB 3WGUB 3APDA 3NEEA 2AJXL 2F7PA 2XNAB 3VXUD 1QUNA 1YQ2A 4WI2A 3CSYA 5F7MC 2OYPA 3KGUA 1L4IA 3IK2A 1TZGH 5ECJE 5H37G 2ICEB 2BP3A 4XCYB 1OGAA 1S6NA 4R96A 1MY5A 4WI5A 1JXKA 2H3NA 4O02B 1I1YA 3HC2A 1FSKC 3DJTA 1UVQB 4ZMXA 3L3JB 1G87A 1E4XH 4GAGL 3X3FL 2WN3A 3WFDH 5AW0B 4AMKH 2VABA 1U8MB 3H9SB 1DQIA 2HTLD 1RERA 4JQVA 2AVFA 1OP5H 3DGCR 2VDQL 3GO1H 4H0HB 3HUJF 1JZ7A 1AZCA 5AUMB 1AOHA 2E86A 4H13C 2JQMA 4NCC1 3C6LA 4TN9A 1ZHBA 2FNWA 4UTAA 5DVPA 3V6BR 1RUML 2AHIA 4AYDC 3GSNA 3CBJB 3KWVA 4UMSA 5EBMA 1WUNT 1FRGL 2BFVL 2EC8A 1HCVA 3RDTB 1K8DA 5D7LD 2DJSA 2PPAA 1PX8A 3R7RA 5HHOB 3BZFA 5TGBA 5K59F 1FGVH 3QWOA 1L5GA 3C6EA 1AZBA 1FVEA 1IILE 2HJFA 2J2ZA 3MUZ1 1OT2A 1QSEE 2OKMA 1BOGA 3MV9B 4W68A 2DOCA 3P11L 1GSMA 1S78D 3IFPA 3JWNC 4NNYB 3TVMA 5IEHA 4GBXD 1FORH 1TT6A 5A6IA 4JPSA 3D6GA 2F8OA 2NW2B 4N5ED 5C0BB 3C5ZD 2NNFA 3FHQA 4I4WB 3NCJL 5JHLL 3MRGA 5GGVY 5KTEH 4AUUA 1OCWL 3WSQL 3DXAB 3U79A 4AGMA 4P3CH 5KVEL 2EE3A 3N1QC 2CUHA 4QRSB 3ZL1A 3VFMB 5CILL 5DC2A 1NGYA 1XF5A 3SPHA 1KCBA 1IFGA 5KWYC 4B60A 4LHQB 1RHHB 1JFHA 4QI3A 3N3EA 1F4XH 1TQCB 1MIEH 2L7UA 4P46D 5I8OH 3GKZA 1RJYA 3K8LA 5AALA 3W56A 2D3JA 3O8XB 4I5BB 1ZJAA 5DLLA 4QT5A 5BXFB 2FJGB 3NEXA 2OTWA 1JD7A 3D3VA 4B9KC 3GKWL 1KG0A 3BZ5A 1JUFB 4PJEE 1AFVL 4KMTH 2IANE 5I6NA 3N50A 4PJFF 1BLIA 5B38A 3P3SA 1KC5H 3N1FC 3RNQA 4OZIA 4LPCA 5F3HB 3OPZL 1JYNA 4MA8L 1BIHA 4AQOA 1QSED 1R5IB 3J2PA 4PGCB 2MTPA 2X1PA 2X5PA 2YEQA 4O2FB 5GGSB 3VFRB 1T03H 4BHUA 3MAWA 4X98A 4TRPH 3U2IA 4AYMC 4AK2A 3EYFA 1PW3A 3U7WL 1IEAB 1YMMA 4NS0A 4UU9B 1H3PH 1PJ9A 2R23A 5I6XC 3S98A 4LRIA 1MCNA 2ICEC 4TTGA 2DQCL 1MRFH 3DX6B 1IBDA 5HHQA 3A4FA 4ANKA 1A25A 1X44A 2ICWA 3IE4A 5CP3H 3V4UH 2CO4A 1ODUA 2EDKA 3D0LB 1YJDL 1QATA 4HBQA 3GRWL 4NQSB 4DFHA 5KYYB 3IYLW 4U1JA 2E7LC 1L7TH 1HSBA 2C34A 3GTVA 4PEEA 4JM2A 2J8UF 2HLEB 1RKRA 5D4HA 1LK2B 1PTZA 3EG9B 3Q2CA 2C7FA 2XV2A 2BVEA 2QHRL 1FI8C 3F7RA 2WK2A 1R3IH 3FBKA 4L23A 2Y1VA 3LS4H 5C0JA 3RDTC 3WFHA 5L8KB 1K4CA 1NAKH 4YSPA 2HFFA 3I02A 2JJTC 3OJVC 5BVPH 3UBXG 1UJ3B 1GL4B 1X4YA 4NBYB 2IAND 4MQ7B 4NRZA 1JOIA 3B3IA 4G7QB 3L1GA 4NDMA 5I1JH 3SDXB 5FFOA 1NC4D 2XN2A 3AS1A 5G4NA 4XAWH 4MYPA 3S5LG 2W81C 5DJYA 4RMVA 5ICXB 1N18A 4JRLA 2MKWA 1BAFL 2VDNL 3ATAA 5JIMA 3HLAA 2PW1B 3QWRD 2WXFA 1WAPA 4HBCL 1MWAB 4F7EB 1B0WA 2WHVA 4X7DC 4ERSH 1SVCP 2FECI 1B0GB 1FL3B 4Q9QH 1FBIH 1ASQA 2VDKB 2EECA 1W0VA 3TYFB 4H0IA 2BH0A 1ZLSL 2AP2A 5TF0A 5FYJU 2H8PB 1V54B 1EUUA 5GZOD 2AEWA 1WEJL 5T1DL 3HCVB 3W57A 1TQCC 1P1ZB 1M53A 3MRHB 3CH1A 2XBDA 3ZKNC 2PXYD 1M7DA 1Q4NX 1QBAA 3KYNA 4IGBA 5BUAA 1WZ1L 3FRUB 4N2KA 4IEFB 1NMAH 4BJLA 2FTAA 4UTAH 1BW8A 5IWLA 2GSIB 3IGAB 3V0VA 1XBDA 2GJ6A 3GSNH 3LV3B 4JFEB 3SOTA 4ZFFB 1OSPL 3H6JA 5I71C 3C2SA 5A3ID 4LLVA 1KEGL 3FN3A 4EIUA 32C2B 3WV0A 1KTLB 3HG1B 1FDLH 4X6CF 4K3DH 1Q9WB 4XP9H 1WF5A 2OXHB 5E2TH 1Q1PA 4GI6A 2O72A 3GXTA 2Z1KA 4HHAA 1OB1A 2V17H 2GAZB 2K4WA 4DN3L 1KY7A 1BZDA 4PY8J 1AZUA 2HH0L 3F3HA 1LP9F 5HDBB 4URKA 4ZDHA 1DYZA 1K8IB 3CFJB 3TNNA 5ANHA 3V6FB 4DOHE 4B9GA 2DQGL 3CZEA 4AIXA 3B2PA 4IBSA 4YHPA 4J3OF 1GVIA 3JQOB 3KGSA 5E1AB 5B39B 4QOKE 1G9NC 2ZWZA 3ECBA 3NFSL 4GO6B 4PJ5A 1UATA 1ZWIB 5L4FA 1KCVH 2EEAA 1R47A 3LN9A 1RVFL 1E4JA 1DQLH 2DH3A 4OLXH 5I6OA 3GD1C 4OD1H 1WFJA 4G8GE 3VFWB 3BKJL 4Y2DA 4BWUA 1R75A 4G6FB 4OGZA 1UGNA 3B9EA 3RIKA 4M6MH 3T65B 1SJEB 4PJXB 2XPYA 3T0EA 1BHGA 1QI3A 3H3KA 3GIVA 5ACMA 2OMTB 3NP3A 3DX7A 1UCBH 2GCYB 3RILA 3QG6B 5SX5K 2FJFA 4JB9H 2QL1A 4PGJA 2ARJQ 5C71A 4NM8L 2CM6A 2HAZA 2ZOOA 5ISZA 1A6VL