4YSDA

Room temperature structure of copper nitrite reductase from geobacillus thermodenitrificans
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
299
structure length
299
Chain Sequence
b'NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 104
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysdA00
4CSZA 4X4KA 2BP0A 4YSEA 2GHZA 3PAZA 4BWUA 2HXAA 5D4JA 1BXVA 2CCWA 3AG4B 3EF4A 1M9WA 2LLNA 3T6VA 2ZWNA 5B7FA 4HHGA 2FQFA 2UX7A 5AKRA 1AIZA 2I7SA 3ABGA 4NAJA 2GI0A 1JVOA 1NPNA 1KGYE 1NWOA 2H47C 4YSUA 1OCZB 1RZQA 5I5MA 2Y69B 4AKPA 1BYPA 1HAUA 2HZHA 2DY2A 4YL4A 2IWEA 2UXGA 3IBOA 3AG3B 2GSMB 3IEAA 1MZYA 1VLXA 4YSOA 5I28A 4A68A 2N0MA 4GY4A 1AS6A 2QDWA 4G7QB 4KOBA 1FFTB 2VM4A 4GP4B 2FQEA 1OF0A 4BK5C 5EHFA 2IH8A 3RYMA 2XYBA 2JXMA 1ILUA 2AVFA 3ZIYA 2PLTA 2UXTA 3WNIA 3FQ1A 1JZEA 3N2JA 4E9QA 1KCBA 1ZDSA 3QJVB 1IBZA 5I6NA 1CUOA 1NZRA 2Q5BA 4KO7A 1A4BA 1BAWA 1XB3A 1L9OA 1OE2A 1ET7A 1RZPA 1JZFA 4KNSA 1BXUA 5F7BA 1NPJA 3OMNB 4UANA 1PZAA 3ASNB 3X2QB 2EILB 1WAEA 4BDVA 5FC9A 3DTUB 1AZCA 2FQDA 4HIPA 2UX6A 2CAKA 2IWKA 1NIEA 2DWSA 1E5ZA 3QJRB 2HRHA 1J9TA 2XV2A 1AS8A 1KYAA 5AZUA 2VN3A 1M57B 1WS7A 5I5JA 3QQXA 2ZXWB 1BYOA 1OCCB 3CVBA 1WA1X 3MX0B 2GC4C 2WO3B 3FT0A 4EF3A 3FU9A 4Q89A 3UACA 2JKWA 4G7RB 4P5RA 3T6WA 1CYXA 3ERXA 1E5YA 1EHKB 3FS9A 1GS8A 2A3TA 3FPYA 1OV8A 1PZBA 2H5UA 4DP5X 3ZDWA 4DPCX 1OCOB 3C75A 4HALA 2I85A 1N68A 2DWTA 5B3SB 5I6OA 1JVLA 1A8ZA 4K9JA 3DIVA 4FAAB 1SHXA 3GYRA 1AQ8A 3T6ZA 1MG2C 3X1BA 2CBPA 1CYWA 1KV7A 2FT6A 4YSAA 1PCSA 3CG8A 4N4YB 1KCWA 2J55A 4NB7A 4BWWA 4A2HA 1URIA 2EIMB 1SJMA 2ZONA 3FQYA 1TEGA 3V9CA 3FPXA 4KNUA 5I26A 3NJNA 4TXVB 2HX9A 2OV0A 2QT6A 4MFHA 1AR1B 3PAVA 4KO6A 3S3DB 4W1TA 3L45A 4A66A 2YAPA 1AANA 3FSWA 1W8EA 2X87A 2HLEB 3CDZB 4KO9A 4PCYA 2OJ1A 3T9WA 3EH3B 4QKTA 3TASA 1L9SA 3AG2B 1JERA 3CVCA 3OMAB 3UADA 1V55B 3EHBB 3CZUB 3UAAA 1V54B 3BVDB 1SDDB 4BXSV 2QDVA 1TU2A 1W6WA 1KBVA 1GY2A 3FU8A 4YSCA 3JT2A 3X1GA 1AS7A 1JOIA 3EH4B 1ET5A 1ILSA 1PF3A 1L9RA 1IBYA 1KDIA 2Q9OA 2YAQA 1OE3A 1V10A 2PP8A 3AZUA 2Y1AA 4GP5B 3OQRA 6PCYA 4FA7B 3WKQA 2PCYA 3S3BB 1SF3A 1A4CA 2AANA 2YAMA 3UABA 1W6LA 1NDTA 1NIAA 3FSZA 2YAHA 1F56A 5D4HA 3U25A 5D4IA 4A2DA 1B3IA 1X9UA 3NSYA 2YQBA 2CJ3A 4YSRA 1HAWA 2PCFA 2VM3A 2W8CA 2QPEB 1NIFA 4KNTA 4G70B 1L9QA 2ZOOA 1HFUA 4G72B 1ET8A 3NJHA 5I6KA 2NRDA 4NERA 1PLBA 3H4FA 3OD3A 1L9TA 4QLWA 5I5IA 2PPCA 4YVNA 3HEIB 3TA4D 1KBWA 1WA0X 2MTAA 3OM3B 3SBRA 4UAHA 2QPDB 3UAEA 5I6LA 1MDAA 1SHWA 2XUWA 2GBAA 3X1NA 2W88A 1ZPUA 1M56B 2H3XC 4YSPA 4L0PB 1ASQA 2P80A 4DP4X 4G7SB 2PPAA 1EZLA 1ZIBA 5B1JA 5B1JC 2BO0A 4JKNA 3S8GB 4F7KA 4F2EA 1JZJA 1ZIAA 1KDJA 4DPBX 1PLCA 2PP9A 1N70A 3V9EA 3H56A 3NJMA 4GXFA 4JHVA 2VW4A 3UGEA 3NSFA 1NTDA 4ENZA 4WKXA 2BHFA 3ABLB 1PMYA 1SDDA 3TBCA 2YAOA 2FWLB 2BWDA 1OE1A 3S8FB 3NP3A 1A4AA 3NJGA 1OCRB 2YXWA 3T6XA 4DP6X 1AACA 3AW5A 4DP8X 5I6PA 2PPFA 3N55A 1ASPA 5ANHA 1E67A 2YAFA 2IWFA 1BQ5A 1A65A 9PCYA 1WA2X 1JXDA 1TEFA 4A67A 2FT7A 3IN0A 3BQVA 5LDUA 1QLEB 3ASOB 2GB2A 2J5WA 1J5CA 1L9PA 4HCFA 3T71A 1JXGA 2BZ7A 1JXFA 1PY0A 3TU6A 4HZ1A 2IDFA 2VW7A 4DP9X 2XX0A 3EH5B 5B1AB 2JFCA 2J56A 1IUZA 2UXVA 3X1EA 3MBWB 2XVBA 2VSMB 2FQGA 1OOWA 3PPSA 4GP8B 1SNRA 3JTBA 1SF5A 2YARA 4YSQA 3GXUB 2FT8A 3QPKA 4P5SA 1JZHA 2IDUA 3D12B 5IY5B 1GS7A 3KW8A 3NSDA 3GDCA 1FA4A 3ZX1A 1NINA 2EIJB 4DP1X 4E9YA 4E9SA 1QHQA 2MRYA 3ABMB 2IDSA 3QJSB 2BP8B 4WTQA 3SBQA 5B7MA 2TSBA 2WSDA 3AG1B 1PAZA 2BW5A 2B3IA 4AI7A 1BQKA 3HB3B 4E9XA 2VSKB 3QJTB 4E9TA 2DV6A 1YLBB 4A2EA 5TK2A 2XWZA 4E9VA 4E9WA 2IDQA 1I53A 1GR7A 2GIMA 2FJSA 1AZNA 1NWPA 2YAEA 2E86A 2HX7A 1J9SA 2R7EB 4A2FA 1MZZA 1AOZA 6PAZA 2CUAA 5AFAA 3NT0A 2YXVA 4JHUA 1AG6A 2EINB 5I6MA 2B08A 3NYKA 1ID2A 3DKHA 4M3HA 3SBPA 5PAZA 1GS6X 3NP4A 1SFDA 1GY1A 1ASOA 5B1BB 4DP0X 1IKOP 1RCYA 3G5WA 3WKPA 3WNJA 4HCIA 1J5DA 1AZRA 1RKRA 1NICA 1ADWA 2GC7C 1ETJA 3S3CB 1ZV2A 4G71B 1MG3C 4HAKA 4AZUA 7PCYA 2BZCA 2P80D 3NJIA 3OMIB 2XV0A 3QJUB 4HHWA 1XMEB 1PZCA 1AG0A 3FU7B 3NJFA 4AKOA 3NJJA 4BXVA 1NIDA 1DZ0A 4M4RB 4DP2X 3CDZA 2PPDA 3FYEB 4DP7X 3PAUA 4YSTA 1XB6A 2XV3A 3IE9A 2HX8A 1ZDQA 2BP0B 1FWXA 4YVUA 4PAZA 1BQRA 1R1CA 4AKQA 4F2FA 3FSAA 2EIKB 4W9ZA 2XU9A 3KW7A 5F7AA 4AX3A 3PXLA 3QJQB 4ZK8A 2IAAC 2XXGA 2CALA 3FYIB 7PAZA 4BWTA 2IDTA 2FNWA 2DYSB 2TSAA 1WS8A 1TKWA 4CSPA 2BP8A 2J57A 1E30A 2FTAA 3ZBMA 2IH9A 1AAJA 2AZAA 3NJKA 4DPAX 1PNDA 1BEXA 1E65A 5B1KA 1QNIA 2OCCB 3ABKB 3PCYA 5E9NA 3WI9A 1JZIA 1GW0A 2XLLA 5A7EA 4YSSA 5TK4A 2WO2B 1CURA 1AZUA 4E9RA 1IC0A 4A2GA 1J9QA 1A3ZA 2X88A 2BWIA 3FSVA 3PLYA 1T5KA 4KO5A 3NJLA 1SFHA 2I7OA 2VW6A 3H4HA 1JZGA 2R7EA 1PLAA 1DYZA 3NSCA 3CVDA 4UF7C 2HRGA 3X1FA 1GYCA 2RACA 2AFNA 5B7EA 2UXFA 1BXAA 4GYBA 4YSDA 1GSKA 1X9RA 1NIBA 4KOCA 3TBBA 3IN2A 2AZUA 4BDVB 8PAZA 2BW4A 3WG7B 4HCGA 1CC3A 2PP7A 1J9RA 1XB8A 2DYRB 2VMJA 3AY2A 4N8UA 4RH4A 2XXFA 3FQ2A 3WIAA 1PNCA 2PPEA 3SQRA 1AZBA 3FU7A 2XX1A 4Q8BA 5PCYA 1UATA
chains in the Genus database with same CATH superfamily
4LHUA 2Y24A 4UU9A 1TSHA 4BCXA 1J05B 1SMAA 1MUJA 1M1SA 3O4LD 2QADB 3PAZA 5DJ8B 1KCKA 1NM4A 4LCYA 2MCAA 5IHBA 2HXAA 2J72A 3ARFD 3GSVB 2W59A 4NPYB 1FN4B 3T2QA 3CHRA 3S4SB 3VH8G 1H9DA 4NQXB 1PD1A 4X9BA 3EOTL 3EOTH 3B9VA 1KGYE 1E6JL 1EXGA 1NDMB 2BC4A 4JFEA 5GHWL 2FIKA 4YSUA 4XWGL 1MCOL 5L0QB 1SYVA 1RZQA 1HOCA 1KY6A 1ZV9A 4E2OA 2L0DA 4HIQA 5JYLA 3K71B 4FQ1L 4G8IB 2QVTA 4OQTH 5EEUA 5C8JB 4G7VL 4MLIA 3X14A 1W2KT 4Y16D 3IYLW 3VUAA 4P5TB 3ETBF 1OF0A 3MRMA 1SBSL 1SBSH 2UWEF 1JNLH 4HAGA 1J48A 3RGVD 3VU2A 3MJ7B 4N5EC 2AJUL 4QXTA 2Q3XA 2OX5B 2P5PA 3MKKA 3QXDB 3WELA 3RLSA 1ACXA 4W6WB 2Y5TB 3PS6A 3FUKA 4QHPA 4P57A 1L9OA 3R19A 1TG8A 4GIOA 1MCNA 1R17A 3EJYD 4JFFE 3QA3B 2G75A 4X8CA 5GJTL 2FBJH 2G4EA 4GRMB 1T2XA 3QJFA 3MRFA 4HBCL 2X4RB 4DK3A 2RALA 2GJ6D 1BPLB 2JIXA 5EEWA 3IMSA 4UTBL 3QCUH 4DN4H 1B3JA 2R1XB 1ZVSA 1T2JA 5KSAC 4NQVA 4JKMA 2WY3B 3F7LA 2V9UA 3VACA 3WIHA 2AV7A 4HQQL 5CLTA 4UTCA 3IPEA 4FNRA 1HH9A 1YMMD 3GMQA 1Q9KB 5FM5M 1CI3M 3IDMB 4Q89A 3KWTA 3PHQB 5IMOA 3WD5L 3KLDA 3WD5H 4PGJA 4Z1PA 4CA4A 1WBZA 1C08B 3CHXA 4HIXL 1KTLB 3HN8A 3NIGF 3R7RA 2E76C 1UH2A 4YK4C 2IANE 2GK2A 3Q2NA 5JHDD 5JW5B 4R84A 4PJCF 1QFHA 1JN6A 5JW4Q 2BIMA 4KC3B 2LTQB 1NA8A 2APTA 5B39B 3ZIMA 3LX9A 3TO4C 4Y16B 4U1GB 4BE5A 1AC6A 4KJQC 5CZVH 1TZGL 1QOKA 4AVJA 1QI3A 2F53D 4PGCA 2YXFA 1VGEH 4A2HA 4NT6A 3C6EA 1SJMA 3C5JA 1F11A 5ICYA 4NHCH 4PG9B 1QLFA 3U9UA 1XIWA 1E7VA 4S1DD 4WKZA 4EUPG 5DI8A 4MFHA 1YN7B 5HDBB 4Z6AT 3HAEG 4YWGL 1I9EA 3ULUE 4A04A 3N44B 1IAOA 4A6YA 1PYWA 4TNEA 2X87A 2UYLA 1BZ7B 2MQ3A 3RWGA 3H8NA 1MLBA 1RPUA 3BVWA 1V55B 1FNEB 1Z9LA 4LF3A 4BXSV 3OAYK 5EF1A 1EEZA 2JELL 2GTWA 4QTHA 2AKRA 4QY8A 3CVHB 3CSPA 1UGNA 3C5ZC 3UTSE 1ILSA 4J3OD 1A9BB 1YMMB 1AGCA 2HA1A 2ROYA 2X7LB 1OE3A 2CPUA 2HFEB 1V10A 1UTDA 1J18A 4EI5C 1A3LH 1B90A 1MFCL 1MFCH 1O0VA 2JKSA 2PYEB 2YWZA 3OQRA 1QFWL 4Z8FH 3S3BB 4MA8H 4K7FB 1F45A 5E2UL 4CNIB 2F68X 5K9QG 1PG7W 1G9NC 3TCXA 3NCYS 5TDOA 1T89C 3UC2A 1ADQA 3T0XA 3VX0A 2CQVA 1UT9A 2K3TA 3II2A 3RFZC 1DDHA 2NY1C 4WTZG 3TA3D 2YQBA 1IU1A 1D5ZA 2CR6A 3OJDB 5E8OB 2VM3A 1RIUL 1RIUH 1YAZA 3UMTA 1JL8A 2VR8A 3MRBB 1NIFA 3VI4E 1EJFA 5KAQF 1IVTA 3VXNB 4S1QH 2F53B 4O58H 2PW2A 4P07A 1L9TA 1P5UB 4CMHB 2XY2A 1L0YA 1URLA 3QO1A 4ICXA 3NCMA 2EEBA 4LCWA 1PD0A 4N1CA 4UAHA 4LMQI 2N1KA 1BP3B 5FLVA 1JFHA 5LAXB 4HJIA 1HDMB 1AE6L 1AE6H 4P3CL 4P3CH 1E4WL 3ZE2B 4U0RB 1JPSH 4FF9A 5KBPA 4NC1C 4KX9A 4DVRH 3BLKA 2J8UB 4JKNA 1A4JA 4AEIL 4AEIH 4WI2A 1U33A 4OLZH 4DPBX 1TQBC 2LV4A 2EKSB 2P48B 2A9AA 3FH5A 3OKMB 5C0GB 3H56A 3RWFB 1UWEH 3NJMA 3QEUB 1NOLA 4GT0A 1LO2H 4N1HB 4Z3FA 4YHLL 1A66A 1UD2A 1TQTA 4TYUA 2L04A 3ILPA 1JYXA 5D9SA 2QHRL 2QHRH 2G3XA 1A6AA 1L0PA 3DUHA 3MV8B 4ALAC 3TBCA 5DEGB 4MA1C 2NT1A 5D6CB 5EUOA 1ODUA 3O2DA 2WBXA 4GRLB 4DVBA 3LVEA 4RFEA 1N4XH 4MQ7B 3HPJB 3VXOA 4LOUD 1OCRB 2D7PA 5FDWA 1HZLA 3FO0H 2WLLA 2NLJB 1XHHA 4DP8X 3NCYP 2IWGA 4Z0BL 2YIHA 1N8ZA 2ZNWA 3HC0B 4OGQC 4L4JA 4LU5L 4LU5H 3NZUA 5KYYB 5F44A 3KWWA 2YO3A 4YHYB 4F33A 2BVPB 1CDUA 4G9DB 1GYAA 1RJLB 1OZUA 3V4VA 4IGBA 3RWEA 2A73B 4IOFC 3MV9D 2YA0A 4G8EA 3TA3B 3VFPA 3MTXA 2J5WA 2DMGA 2YLKA 4WWNA 5CEZE 5IB1A 4KAQH 3F04A 1NGZB 2G9HA 3QPQC 2BY3A 3HN3A 1CGXA 1PLGL 4B7LA 3OHMB 4DP9X 1KPVA 5EU6B 2GI7A 3CIQA 2JFCA 2AQ3A 4XVTH 1KB5A 4ZMWA 1ZGLB 4MJID 5L4IA 3G7TA 4OJCA 4FCAA 3V6OE 4QGTA 4Q2ZA 1GJWA 4W68A 2C8NA 3EOBA 1N67A 5E51A 4PJ9A 2V7HB 2WNGA 3MUHL 4A55A 2WWKO 4EZMA 1T6WA 1LEIB 3F7RA 4GOSA 1BIIB 4HJ1A 2HP4A 2J8HA 3D12B 5IY5B 1GOHA 1KG0B 1CMOA 4D8OA 3FOMA 3L3HB 1CXEA 2C26A 1XH2A 2IH3A 2EDOA 2MRYA 1WGVA 1JSYA 1HQRA 2TRHA 2RQEA 3BP6A 4IRJD 3SBQA 2D2CC 4E5XA 4PGZA 2OMVB 4RETB 4O02A 5KJ4A 2H0JA 5E24E 4IBQA 2Q3ZA 4ZUWA 4D7BA 5JYMA 4OLWL 3VGAC 4WWKB 1KGXA 2J6WA 2WM0A 3KWXA 3SE3C 3C9NB 5JOEA 1BEYL 2O6EA 3CFEB 5TDPA 5KJ7E 3L5XL 4Q52A 3QCTH 5T5NF 3CZGA 1CD8A 3SN6N 1NCUA 3U0PA 1D2OA 4JZNA 1DZBA 4Z7QF 2DYPA 2EUWA 5HPMB 1NDGB 5JHAA 4LDCA 3M17A 4GXUN 4O5LH 5CBEB 5C0FA 3FT3B 4XBEL 3BJ91 3LQMA 1MKFA 3EF7A 2GT9B 1GS6X 1NLBH 1NLBL 4LASH 4LASL 5AB1A 1G5AA 2DB8A 3PJSA 3HE7A 5FA4A 5HYJA 1IKOP 4CGTA 3P9MA 1CICD 2BIPA 4TVPL 2F54A 3CN3A 4WDIB 3AMKA 4YBLB 4ONFL 5T1LA 2MOVA 1SPDA 4WY7H 1A21A 5CKAA 3HC4H 4MJIB 2B39A 3HZKB 4NIYE 2Z92B 4P23C 1MDTA 5DMGD 3W9DA 3ULUC 2X5PA 1BX2B 1WCBA 3QZPA 5D5ME 2PCPB 1BM7A 1TR7A 3OAZK 3L9YA 3PWUA 3C6SA 1FZOB 3QG6A 4XBGB 3QDGE 4ZO9A 4YSTA 3CXFA 2Z34A 2HX8A 3PU7A 4PWKA 2F15A 2OR8A 2O30A 4M7JL 4H8WC 4M7JH 5IG7B 5C0ND 3T2NH 1VKXB 1DP0A 1LNUB 1QPPA 2ZTBA 3PNWB 1CZ8L 1CZ8H 2R23A 1TXKA 3KW7A 3PL6A 4HA1A 4DQOH 3HA0A 3NIDF 1R0AL 1MH5B 1R0AH 3ZL4H 1QR4A 2WTOA 2ADIA 3BEWA 1PY4A 3FYIB 1XF4B 1NANH 1CIDA 2IDTA 1WIOA 2QTEA 4K8RD 4FJ6A 4MNQB 5CSBA 5DD5H 5IVXB 5KJRL 5GGUB 3L7EA 3O6FA 4FXLA 4HDIA 3T3MB 2VNCA 3KJ4B 1HILA 2GAZA 3KBHE 4DOHE 4EJ1C 5BOZG 5FM4A 3SDAC 4P5MA 1TIUA 4IRZH 1IVLA 2ZG3A 4MDIB 4PWGA 4IHBA 3LKPB 1PJ9A 1RZJL 3O6ML 1CR9L 1CR9H 4PQXA 3UO1H 3UO1L 2QJDA 4OGYH 2VDLL 2VDLH 2VOTA 4OGYL 5HYSA 2H6UA 3OR7B 5DZJA 1WE5A 4YDIH 3LH8A 3DA0A 5HGBB 3DV4B 2QELA 5IZ7A 2MQ0A 3DDGA 3NSCA 1FO0A 3WJLA 2OM5A 2Z31C 5HHNA 1E8ZA 3DROB 5DQJB 4L4VA 2A6KA 5DJYA 1NCJA 2F74A 4M6NL 1AHWC 3CH8A 2BVQB 3MV01 4R7LA 4BDVB 4PJIA 4KK8C 3BESR 2QQKH 2VE6B 5C07D 4NM8H 4NZFA 3BVNA 4AJYV 3Q8BA 5E9DD 1MAJA 32C2B 4H1LB 3SODB 2VMJA 3FUMA 3D34A 2BCKB 3TVMD 2NZ9D 2IV8A 4PJXA 1CF8L 1CF8H 1EAOA 1QX1A 2NPLX 4Q4EA 1KEML 4TQIA 3O45B 3RDTC 3V0AC 1K8DA 3EIFA 2DQIL 2H7WA 2AP2A 1GKEA 3V95A 5I1JH 3G04A 4Z7IA 5ADOL 3VWJB 1QSFD 2GHZA 4DKTA 5ADOH 1EZVY 2WBWB 4NAMA 1RZKL 1RZKH 1V5JA 1EFXD 1I8KA 2UY7B 3S37L 5DO2C 3S37H 4OJEH 3J27A 4ZPTB 1VFUA 4OFYD 5KS9A 1F86A 1JVOA 4R2GB 2IOMA 1E27A 1JS4A 2WKGA 2WOBA 2WIIB 4XOEA 1QEWB 3IPFA 4NKQB 1NBVL 1YVLA 3BIKB 4RZKA 3SDXA 4JFYA 3ZHFA 4X80L 4X80H 3WL9B 2DBJA 2HKHL 1YEEL 3P4MB 3FSOA 4UQIM 2EXSA 1U9KA 3U46B 1PU0A 5LGJB 4RVBA 1A1MB 4IBWA 3DYPA 1NUGA 1Z5LB 4KOBA 2IPKB 2VM4A 3ECQA 1JUFA 1I1AC 2GQHA 5IQ7H 3US1A 2DM3A 2E7CA 5IMMA 2A4ZA 2JVUA 3H9SA 4HKBB 4PY8I 2GG1A 3MRNB 4HWUA 3VXRD 1RULH 3N2JA 4C58B 3ZRFC 2ESVE 2IH1B 2EXTA 1IQWL 4NQCE 1GC1H 5D7JB 4ZMNA 4G7YH 4KO7A 5MP6L 2CDEB 5MP6H 4HUXB 3MYZA 3QIWA 5J6SA 2UY6A 3V6OC 4LCCC 4JM2A 5ENWA 5C07B 5I0DA 3O8XB 4JE0A 4IIZA 2FECL 1PZAA 4XCCL 1GH7A 2AJSH 2AJSL 2BNQE 3TIEA 2C1OB 3HS0A 4QHKJ 2VMCA 3WXWL 1DDTA 3DIDA 2OW7A 1RSFA 3ROLB 4N0CC 3NZ8A 3Q2LA 1OALA 5F1NA 5C0AD 2EYTB 2DMBA 3PUUA 1UD6A 2VN3A 3U9WA 1QSFB 5BS0E 3QQXA 4F8OA 4D0CB 1S9WA 3CGTA 4GINA 3H6AA 1HXKA 4QR7A 5GRJH 4MAYA 4EF3A 2R4RH 1A25A 3B2VH 3B2VL 4FFZA 4MCYA 4TL5A 4UQAA 1DJXA 1PVHA 1XMWA 3P02A 4PRPD 3RWCA 3BUIA 3EGSB 3VH8A 4AQ1A 1EHKB 3VXME 2H1XA 5KSBE 5FYLD 2X38A 3CPLA 2D4FA 4TNVK 3CE1A 4KI5F 4YR6B 3LKSB 1PZBA 3LN5A 5EOCJ 4DP5X 1EEQA 3MQIA 5AALA 1L6XA 3DYMA 3OKEA 4TTDC 3IBEA 4GKLA 3DMMB 5AZEL 5DA4A 3SPVA 2DQCH 1FC2D 3JUZA 4RESB 1CU4L 3DVFA 5C09D 1KV7A 3NTCL 3NTCH 4RFNC 4BH7B 3TLRA 2E7LC 1KN2L 1V05A 3VFOA 5JHBA 3HRZB 2X9YA 1G94A 3QG7L 3QG7H 1NCWH 4P4KA 4PJBE 3VYPA 1ROCA 3V9CA 3GMOB 1KTRL 4PVLA 4XP6H 5SX5K 3K91A 4AWJC 1BVKA 4MCZB 2H2PD 5CWSB 3V4PB 3HCVB 2VISB 1G6RH 4Y19E 1TPXC 3L45A 3WLWC 2BMKB 2YN5A 1DVTA 3D4YA 3I6LE 3QDJD 2PYFA 2VLMD 2AQ1A 1W8EA 4TSAH 5FO7B 1OIOA 3SYOA 5I8KL 5I8KH 3QXTA 4ELKA 5KWYC 2FWOB 5C08A 1BMGA 4Y4FA 2ZCLL 1U2YA 2KERA 4H5SA 3FTXA 2W0FB 5KZCB 3UL4A 3NK3A 3L17A 4WQOA 4Z7VA 4HIJB 4ZTPL 1GGUA 3QI9B 4F2MA 1YEWA 5BRPA 3JT2A 4FQXA 4HXAH 2EDMA 3VDBA 4JDVB 3SZKC 1FZMB 3QDMA 4P8QA 4N2FA 5DJCB 4L29A 4G80A 3DRTB 3BE1H 3D3VD 4JG0L 4JG0H 2AHIA 1FHNA 1K4CA 4K3DL 3I9AA 4WW2B 4XODA 5A6MA 3BZ4B 1QRNE 2EC9U 4P2QE 2EO9A 2LAAA 2AANA 5D6DA 2BNUB 4MJ5A 4C4UA 2YAMA 4OF0A 3L1OH 1BYNA 2AVGA 1KCVH 3ZLQC 2BNRA 3ZHDA 2WSPA 4TSBL 1F56A 4WGKA 3FCUB 3K0YA 2EIDA 4H8QA 4X6FA 4F7MA 4G1MA 1EZVX 2JB6A 1QA9B 3KGUA 1IE5A 4M4PA 4F58H 4ZMOA 4U1SA 1MVFA 2NSMA 3TPKA 4S0TD 1U42A 4MDJB 5C09B 2BSSB 2WXNA 3JV0A 4FZEH 4N5ED 5EN3A 5DHYA 5A2LH 2MSPA 1AGFB 3H4FA 5LUMA 5F8QC 2PPCA 5KOMC 1F00I 3HG1B 2L4OA 3T77B 5DYFA 3VG0L 3VG0H 1DBJH 3TZVC 2QQNL 4L3CB 1P7QA 3C5SA 4EUPA 5DFVD 3F7PC 3KYAA 3UAJC 1J8HD 1UKTA 3ECUA 4YSPA 2HKAA 3HAEA 2QQLH 2APFA 3NZSA 1JTTA 1BREA 2R83A 4H8PA 3R8BB 3S8GB 1OGTA 1DJIA 4NDMA 4OCYL 5GRVK 4TVPE 3DX3A 1XGYH 2A9BA 4PR5A 5KSAD 2MIZA 4RNRB 5A3IC 4M56A 3TP4A 2UZYB 2EDDA 2VW4A 3KXFE 3BAKA 3IPBA 4K2UH 4K2UL 3FK3A 4MKTA 1TJMA 2XZQH 3BPCB 5F7KC 2XJKA 2BIIA 1CBVH 2XRAL 3BDBA 3R4DA 2FWLB 3BWAB 3PQYD 5CINL 4AVHA 2XC8A 5HDRA 3D3VB 1O9ZA 3FH8A 3IDJA 4Y8DC 4QF1A 5T1KB 3RWDB 2ORBH 4K4KA 5B8CC 3OPZH 3PRZA 4RGOL 1SYSA 3MRRB 1FVDB 4FFWD 4P04A 3HI6H 3S98A 4KMTL 4KMTH 5E4EB 4L9LC 4G43B 3SE8L 4Y5XA 4YC2C 4XPHL 4KZCA 5CNHA 1DQML 1S6NA 5LDUA 1U0QA 2F5AL 2F5AH 4WTZA 1XVSA 4KJQD 1KYOK 5D1XE 3QPXL 3QPXH 4I87A 3MV7B 5KW9L 5KW9H 3QR1A 1JF6A 1UURA 2HKFL 2OTUB 4JJHA 3KPPB 4ODVH 4ODVL 2IADA 4NO0B 4B50A 1A7NL 1A7NH 3RNKA 4OF7A 1RZ8A 3MUGA 2V9TA 3S88L 3LXBA 3S88H 1LP9E 3QXVA 1I1CA 1XSJA 3F84A 1U92A 2MNWA 3M88A 1NEZG 4PG2C 3V7AG 4EZJA 4Y5VC 5CF3A 1PEWA 2YARA 5JPMC 4ZOEA 4MA3A 3ZT5A 3EBGA 2MTPA 1IJNA 4HT1L 3JTTA 3ZYOA 2EVGA 1A8JH 1CWVA 3ME0B 1ONQB 2R0ZL 5GGVH 1W0YT 1K5NB 2DIBA 5D7IB 2J88H 3RVUC 1XF3A 1FNSH 4DERA 2FEEI 3C5ZA 4LSQL 4J3VA 4XGZA 2BP8B 3N04A 5B3NA 2WVSA 3V0WH 4A7TA 5A40E 4Y4KC 3I9GH 5G2NA 4LGRB 1FCCA 2YS4A 4OCNC 5CIPA 4CMMA 4GFXA 4EI5D 4JRYA 4LEOB 2K7PA 3DXAA 4P2RD 4ZUUA 2DV6A 3FU0A 5EIIG 3QFJD 1I53A 5IFJB 3KM1A 3KPNB 2A4EA 4L4TA 2DWEA 3EG9A 3GJFA 1OP5H 3SY0B 4AV0A 5D1ZI 1CPUA 1NCAL 1HHIA 3BRGC 1H15A 2EYSA 1N5YL 4V1DD 5CLZA 4Y9BA 5E0FA 3IAQA 3S5LG 4PTTA 4A2FA 3BZFA 2ZSVB 2EEFA 2X12A 3K72A 5F7EL 3KLKA 4OI7A 5L7XL 3Q6FB 4WJ5A 4GXVH 3KPRD 3ZHNA 4PP2B 1MNUH 1L9NA 2OMXB 2H9GB 1RHFA 1X6NA 1UZ6E 2ROXA 3U30C 1JVKA 4QMEA 1ASOA 5CZRA 5EZJB 1F41A 3G5WA 2FLMA 4HCIA 2FYYA 4LOFA 3TT1H 4RGMC 4KTYA 2CIKB 1U95B 3CK0L 3CK0H 4I5BA 4FQQA 3RTQB 1P7KB 5K1NA 1BHGA 7PCYA 3C08L 3QJUB 2Q8AL 1IE4A 2UZXA 3D87B 2R8SL 2R8SH 3RU8L 4FMFA 3RU8H 1J9CT 3AT0A 2WLHA 1MFEL 1MFEH 4DPRA 4M4RB 4PLOB 1RUAL 1RUAH 2XBDA 3ZDYE 4QHMB 4URTB 3PAUA 4MVBC 1E8WA 2A6IB 4LLDB 1R9FA 4HUKB 4KXBA 3BXNA 3U4AA 2JLLA 1ZE3C 1MCSA 4WLCA 1MFUA 2FHFA 3NCXA 4MQXC 3OKLA 4F27A 1BXXA 5DVLA 5JA9A 4RLDA 4Z7WF 1TCRB 2OK0L 1MHPH 2X4QA 2OK0H 1EBAA 4I3SL 5F21B 4YHNB 3UYRH 2XXGA 3GBML 2CXKA 3U4BL 3U4BH 1F4YL 2ADJB 3AU0A 2MOGA 3TO2A 1M3IA 1AIFA 2BY1A 3BCDA 2IF7A 4JG1L 4JG1H 1XBRA 1DBBH 4JRXE 4RMWA 2OCJA 3IXTB 2OCCB 4JO2L 3QFJB 2WLYA 4JO2H 1BBDL 4NO3B 4TVUA 1BVLA 1OB0A 2I60L 4OZHF 5I1HH 3I75A 3T4YA 1JZ2A 4JKLA 3LN4A 3LZOA 5E5MA 1ROWA 3STLA 4QLRA 4G6ML 4JPIB 3WY3A 3NGBC 1JGDA 3MREB 4ABVA 3POHA 3MLSL 2TRYA 3MR9A 1PQZA 3NAAL 1CT8A 1ND0A 4NNYB 1OO2A 4LFHD 2Y2TA 1FNGB 3LQZA 5TPWH 3EH2A 3FQTB 4MZ3A 2VDNL 3FN0H 3FN0L 5DRXA 4I18A 4U1KB 3RVTC 2CO7B 4LNRA 5AQ0A 3KDMB 1IFGA 3UBXG 4H25A 1IIKA 1CFTB 4ONGH 3U7YH 3U7YL 3GZPA 1KEGH 4H44C 5EF3A 2DEXX 2KS0A 2VLJB 5AVWB 5BJTA 1WO2A 4LLMA 3N43B 2VTFA 5HHXH 1IAIM 4TLTA 2Z93A 1BDYA 4Z5RB 4Z77A 2JCCE 1X5GA 2GCYB 1N0XL 1N0XH 3FU7A 3N9GL 2FH6A 3MODH 1R3HB 2Z4QB 3BQUC 3V4UL 3V4UH 1YC7A 5IJVB 5DHVB 2F7PA 3LV3A 3D06A 2YA1A 2HWZL 2HWZH 5JMRA 1CG9A 2OJZH 2ODIA 3GKZA 3RY6A 1SM3L 1SM3H 4R5XA 4A7VA 3W9EA 3IXAA 1A6ZA 3ABGA 5F0PB 1KCSL 1KCSH 2AAAA 2KUTA 3MRKA 4KTEL 4KTEH 2O61A 1R5WB 2P7TA 3QEQA 1A4KA 5CXPA 4IKNA 1TVHB 5DRNB 3L2MA 4WI3A 4ENEC 5JMOC 5FX3A 4KI5C 4P46C 4QUOA 2IAND 2R29H 1LQSR 2IWEA 4BFRA 1E6OL 5C9KA 3R7QA 5KVDE 2Y23A 4PWFA 5IV2A 1LILA 1W16A 2WZ5A 1ACYL 5DS2A 3BVTA 1CXIA 2PTUA 1ML0A 4JKPH 2ERJB 1QLRB 3OXSA 4GP4B 3CFBB 4DO5A 5D1XC 2NY5C 1TJHL 1TJHH 4ADIA 4DK5A 2XYBA 2EACA 2JXMA 4J8RB 4YEFA 5DEFB 1A22B 2Q2EB 2HTLC 4ZPVB 5G55A 2VLLA 2WUBH 1FGVL 1FGVH 1O6TA 4AZ8A 1RZJC 2AS5M 5TD4A 4U33A 4P23D 4RMUA 4UNIA 2CUIA 1A4BA 1FE8L 1FE8H 2WMPA 5HDLA 5JR1H 3ZE1B 1UB6B 3OQ3B 3P2DA 3TBVA 2F7RA 5I8CB 4LESA 1BVZA 1N6VA 2G5BB 3CZJA 4M62L 2XDHA 4M62H 4YDJA 1M2OA 3PREA 5J11C 2D3NA 1MJUH 3KCPB 4LLYA 1JGIA 3X2QB 4ZSOE 3VM7A 4RAUA 4K3HA 4QOKB 4GRWH 3ARDA 2IWKA 3NIFF 1XSOA 5CILL 3I6GB 5CILH 4XNBA 3WBDA 5KYXB 4DHLA 4V2BA 3JTSA 3PDOB 4Z95L 4Z95H 2MNJB 5I5JA 5GS1C 4A2MA 4DSYA 1Q94B 1DCLA 3UTSD 4LVNB 4PRNA 4XRCA 2XQYK 4XPTH 4XPTL 5SWSB 1SJVA 1IGTA 2ZXCA 2DL2A 1NH6A 1FZKB 1Z0NA 3BSZL 1GGIL 3BSZH 5HYEA 2EDFA 4RMRA 1FVCB 1RJCA 2YSSA 3KYMA 2H41A 4MQSB 3SDAD 4J3BA 5C0BA 1C5DA 1TO4A 1OP3K 3ZN6A 4Q14A 2DWTA 4XMVA 3HMWL 1RZKC 3RVWC 5TF1L 5TF1H 3SB3A 4K9JA 3FC8A 4HEPG 1KGCE 1SHXA 4RDQF 2D03L 1A1NB 3RKDD 2WXPA 2I9LA 1MRDL 1MRDH 4JFXA 4QRFA 1HINL 3SDYH 5J4MA 1VFAB 4N24A 4YSAA 4ZYKA 4NZRL 2KZWA 4HEMA 3D85D 3KBFA 4WK0B 3ZXAC 1RK1A 4XN1A 4L05A 2FD6L 2FD6H 4OF3A 4XZ4A 4MD5A 1Z9NA 3GGWA 1X4XA 3AM8C 4K9EC 4R96A 3VXUB 3TFKC 1HHJB 4W1TA 2VO5A 5GGRB 5DVKA 1RUKH 2BRRL 2BRRH 1BBJB 3BH9A 4FNQA 5AKVA 3G6JF 4CRPA 3DVNA 4MXQC 1A2YA 2FJGA 5ELIA 5KVGH 3TBSB 4Y2NA 4K5MA 2ZUQB 3ZKQD 5I1GH 1BFVL 5TDNB 4I88A 1RFDL 1RFDH 4UIKH 4UIKL 3RDTD 2FO4B 4FRWA 4HIEA 1AY1L 2C34A 1IZKA 5T3XE 4M61A 3TXAA 4U3SB 3AJ7A 3SKOA 1LEGA 2CHXA 1FLRH 2HVJA 1HHKA 1H5BA 1EDHA 3V2AR 2C9PA 1L9RA 4CC1A 4CBPA 5E5LA 4Y4HB 3BP4A 3KWUA 1AKJD 4PJDF 4XXWC 2Y06L 2Y06H 3Q05A 4MS6A 4PJGF 2EVIA 3BW9A 4XNZC 4PJCA 4XN4A 2CDGB 2F8VA 3B1UA 1W6LA 4E9LA 3AREB 4M8QA 1JGUH 1CTNA 1F18A 5FKPB 1NIAA 4ESKA 5D2LE 4J2QA 3FSZA 1RH8A 4EIUA 3AS3A 2BXZA 4NKMA 2P5EA 3VI3F 1HAWA 3V0HA 5CBAA 4KMQA 3H7BB 1EXUB 1ZTXL 1FIEA 2ZICA 2L7QA 3L1FA 4N0FB 2RTTA 1Y0LA 4FP8H 1HFUA 4YGVB 3J2PA 1ET8A 1XGTA 2Y1YA 1L4IA 3GSWB 3KYOA 3GT6A 1SRDA 1ZTMA 3D85B 4GQ9L 3HZ3A 1G7HA 1YN6B 4IBTA 5K33A 3HEIB 4PGEB 1JNNH 5BO1L 3GC3A 1A1OB 2J12B 2R2EB 4TNGA 43CAA 3WO4C 4ONHA 4GNKB 1M56B 1KB9J 3WGUB 3MRCB 1YEIL 1YEIH 5KSVA 3HNSL 3HNSH 3VFRA 3L95A 1WFOA 3HI1A 3E3QE 3NABH 2E75C 3NABL 1USQA 3B3IB 2NX5E 3MCLL 3JVGC 1ZIAA 1PD6A 1Y18B 2V0AA 1FL6B 1U8JA 1FVEA 3BN9D 4IU3A 4N0CD 1LMIA 5HBBA 2NY3C 3R1GL 3WFHB 3M8OL 1AFVH 3APFA 3LMJH 3VJ6A 2OZ4L 2OZ4H 2PXYC 2LU3A 4WV1C 3UIZA 5ID0A 4P59H 5K9OB 2FEJA 1QSEE 2HN7B 3PJLA 5IQ9A 2BWDA 3W1ZA 1HZHH 1T22B 3S8FB 3DNKA 1SJEB 1ZT1A 3MV11 5E6IC 4AIEA 4XCEA 2BVUA 4GRWF 3N40F 3BWUF 2EADA 1AKJB 5LQBH 3GIVA 3VA2C 1VIWA 2IGFL 2IGFH 2YRZA 1O7SA 3G5VA 3O3DA 1HH6A 2G60L 2G60H 4MAUL 4MAUH 4Q56A 1MFVA 3ETSA 4H26A 5INDB 2I07A 4D8PA 2ZCHH 1FRGL 4NKOB 4TTDD 4EMZA 4AH2B 3RZCD 3AS2A 1BSIA 2E47A 3FO2A 3KL3A 5FOBB 2LQRA 2K4AA 4PRHA 4OUUB 5JDSA 4QWWC 1NUDA 4DCQA 4S1SL 4S1SH 1V27A 4MSWB 4PM1A 4EN3C 3UCRA 4AW4A 3CSTA 3GB7A 4DFIA 2WVVB 2VDPB 4OQTA 4XMPH 3IDGA 1P6FA 2JSFA 2YD5A 1PY0A 3SCMD 5LNGA 2IDFA 3N0PB 2XX0A 5CN3A 5FGCE 3MBWB 3GEFA 5D5MA 1F3JA 2KLSA 5DVNA 3NPSB 1XCTA 4TQ8A 5GRUH 4KUCD 4CKVX 5DJXB 1DVFD 4UDTA 5CEYA 4TLKA 3BUTA 3HUJB 5IFAL 3QDGD 5IJBC 2EUXA 2E46A 4FADA 5IKCA 4WSJA 2GBVA 5ANMB 4MNGE 1NINA 2EH7H 5EUKA 2QKIA 1LM8V 4QRPE 1XL4A 1R5VA 5HJGA 4YZFE 2NW3A 4RIRA 5B7MA 3LNEA 2BFVH 1HWGB 3CUPB 1OQOA 3B2MA 4UTBA 3B56A 3LVTA 4G6JH 1FL3A 5FS5A 2EQDA 4L48A 4XAWH 4HSCX 1RU9H 2WWNA 4JEGB 4AM0B 4OLUL 4OLUH 1M7IA 4H20H 4OV5A 3THML 3THMH 1LO4H 1NMCB 3RL2A 2Q8BL 2Q8BH 1MY5A 4PCTA 4CW1A 3VXPB 3BUBA 4FQHB 3RZCB 4Q4IA 2R1YA 5CHNB 2X3AA 2CCVA 1CLZH 3B8YA 2VLKB 3HFML 3HFMH 3T09A 3MLXH 4IOIB 2BHZA 4JFQA 1NUNB 1GHFL 1GHFH 2LU5A 2AABL 2DJSA 1S7TA 2YD6A 1S7UB 4TULL 4TULH 1DANT 4F9PC 3ARWA 5FB8B 2V33A 2QSQA 3IFPA 3VWKC 3QORB 4LEEA 3TZVD 3UAFA 5IVOA 1U8OA 1ZHNA 4LKCB 3VNZA 3MNZA 5A16B 1X5YA 1XAKA 2BOCB 2JKLA 4BKSC 1NGQL 3D0AA 2WQ8A 3WS6A 2JIXD 4KV5E 4X4XB 4P48A 1NEZA 3V8CA 2C9QA 4PJAB 3ASWA 4OM0H 5HXMA 1DVFB 4OFKA 4AL8H 4DP2X 4LHUB 2GIYA 2WZPA 4BRJA 1Q0XH 5I6XC 4N9GA 5I9QC 1DQLL 1DQLH 1MUJB 3B5TA 3TCLB 4F7EA 1JGEA 4JMXA 2WTRB 4LCYB 4YBHA 4UAOC 3E38A 1CGVA 4B53A 4UOJA 2WN3A 3W56A 1ZT4A 3TV8A 3CQFA 1ZVHA 4HWZA 1E90A 3HHSA 4XNMA 3QJQB 3W11C 2WJ5A 1AJ7H 5IHUL 1A7QL 4JFEB 2FIKB 3BGAA 2JTDA 2HG0A 2YBRA 5ACMA 4CL7A 5EDXA 1CL7I 1P5VA 2VCOA 1HXMA 2VN7A 2ZD0A 3UCQA 1HOCB 2WP3T 2UUDH 3KBPA 2EIZA 3WS3A 3QC6X 3O0RH 3LPGA 1KUMA 2B8OT 4NN7C 4JW3A 1BEXA 1E65A 1VFBA 6CGTA 3EJRA 1RZIA 1PZ5A 2C9AA 3PCYA 1P4LA 5EIIA 5FIEA 1KLFA 4M1DH 5TK4A 3EO1A 3VD4A 3V7MA 1WYJA 3MRMB 5HTSA 5GGVY 2NR6C 2X1PA 3MLPA 4DKAA 3S5LA 5IUCA 4I2XA 2ENJA 3RX9A 4DEPC 4QXTB 4XXDB 4PIBA 2AK4E 1XIWD 2VL5A 1DYZA 4YDKH 3OZ9H 2AXHA 4NKIH 3WKNA 2OXGA 2JJSC 4GEIA 3JWDH 1YJDL 1YJDH 3S5YA 4NQCA 3BX7C 2H0PA 5JPMA 3A4EA 3GXNA 2G75B 2GEEA 5DC2A 4QGYA 2ESVD 2H1LM 2PABA 3QJFB 3F7VA 3MRFB 3RL1A 4CU6A 4BK4A 5I1KH 4YN3A 1ED3A 1A14H 2JIXB 3VMPA 3BKYL 3BKYH 4HS8H 1ZVSB 3AY2A 3T1FA 2WLMA 3T8XA 3RVUD 3EYSL 1LXMA 4NQVB 1ZA6A 3E3QC 3SQRA 5GS0L 2CJTA 1NGYA 2AV7B 1MCQA 4WO4C 1G4RA 1KIRA 5K69A 1HH9B 2R51A 3GMQB 4N8VG 1B0IA 4TQEH 1WUZA 5G4OA 4Y2LA 5IMOB 1RY7B 3BKJH 3BKJL 4Y4KD 1CFNA 2D7QA 3A47A 3IKKA 1WBZB 1E3XA 1DBKH 2CKBH 1QFOA 3C6LA 4NUMA 2XTJE 4OJDH 4DGVL 5HVHB 2CJUL 2DLHA 1RK7A 4TOYL 3L4WA 4QAWA 3VXMD 1QABA 1XZ0A 2OMBA 5J6GB 1JN6B 4KZ0A 1MRFL 3NCJH 5HHOE 5L2JA 5FGRA 3QWRD 1LHZA 2GJZA 5A43C 1KLUA 1QD0A 3IBOA 2KH2B 4IRSC 4X6BA 3BGMA 1YEJL 2JKXA 4E41E 1SXAA 1MFBH 3S96A 4OZIE 4G2AA 4PGCB 2VR9A 3SJVA 4PJ7E 1P4IH 1OTTC 4NT6B 2GITA 4PW9A 1Y6NR 1FFTB 1VGKA 3C5JB 4YBQC 1F11B 4FCHA 3TTYA 2JB5H 5JIPA 1B9ZA 3M46A 4AE1A 4KX7A 4FNSA 1QLFB 4UM9A 1XIWB 4GG6E 4WKZB 5FUCE 5DI8B 3RYMA 3T4AB 3QIBC 4K3EL 4K3EH 1IAOB 4A6YB 3OSVA 3EDEA 3Q6GH 7CGTA 1PYWB 2N0KA 3NFNA 1IBZA 2BJML 2ESVB 2UYLB 2QKSA 3CN1A 3LY6A 5EO1A 3NDYE 3RWGB 4OLYH 2DLEA 1NOFA 2XIDA 3NG5A 4Y19D 2QLYA 1MLBB 1ZTXE 1F1GA 1CFSA 2FNBA 4KNSA 3UBXA 1UHVA 3G5XA 2NY7L 2NY7H 4KJPD 4LF3B 4OCXH 3ASNB 3R06A 1UWYA 2RIKA 3FAXA 3F83A 1EEZB 5H4ZA 1NC2A 1N6QL 1IAIH 4FE9A 1SXBA 2GTWB 5CGBA 3VXSE 4QTHB 5L2KA 4X83A 2AKRB 4A7UA 4MQXD 4QY8B 1AQMA 1NIEA 3ARXA 3ZJAA 3JUYA 3AWFA 1UD4A 2DM7A 3E9TA 4XR8C 5DWUL 1B6UA 1A02N 1WS7A 3LNDA 2X3CA 1E4JA 1BJ1J 4LPTA 2GY5A 2WO3B 2XZAH 3FT0A 4A63A 3BKML 3BKMH 5FYKL 5FYKH 5GSRA 4P5RA 1G1OA 2NY0B 1XGZA 1QRND 1C16A 3FS9A 1M71A 1ES0A 3QRGH 3L16A 3L4ZA 4OIIH 4P2QD 2YFOA 4FHJA 4YHIB 4DQAA 3TBYA 1DDHB 1YEGL 4IGBD 4YIQA 5JHMA 1D5ZB 4RDQG 1IKFH 1ZWIA 4R4FL 4ZOAA 4FI6A 1RJZA 1HSAB 1A47A 1MW0A 4X50A 1IGCH 3EDJA 2RMNA 3PNRB 3UYOD 4XT1C 2BOLA 1E4KA 3A3YB 2PW2B 3NMEA 1OAZH 1U4FA 2CK0L 1TJGL 3QO1B 1KZYA 2DQUH 1KYFA 4LCWB 2V17L 2RJMA 2DD8L 2ITDA 3DX6A 2W0KA 1OK0A 1W9XA 1JK9B 2OR7A 2P8LA 3RVTD 1FNLA 2FL5A 4BZ1L 4BZ1H 1ZANH 1TLKA 1U3YA 1T7XA 2FSEB 3ZYJA 3PAVA 4KO6A 4U0QB 1A4JB 2DPKA 1NGPH 4HFWA 4PJFE 1GCYA 1FP5A 5T5FH 5T5FL 1T7WA 5E6ZA 3CDZB 2FWSA 3N41B 4YGAB 2EEAA 5J56B 4KKNA 3RIFF 2DQEL 2HFTA 3KLAA 4MMXB 2CSPA 3KEDA 3RB7A 3T9WA 3VSQA 2VYRE 2EVJA 1WEJL 1WEJH 3ILPB 3OMAB 3UADA 5D9SB 3BQUD 4IJ3C 3CZUB 2WYTA 1A6AB 5F0MB 3BVDB 3SE6A 1TZIA 1TU2A 4OF6A 5EUOB 2ZG2A 3FONA 1E2WA 1X9QA 3KXFD 2Y72A 4P9HH 4P9HL 4ZRGA 3DOHA 3HVNA 5T1DH 4DVBB 5MI0C 3VXOB 3PHSA 2YK1H 3EZJB 1IM3D 4EDXA 5EZIH 2R0KL 2R0KH 2WLLB 4HPYH 2BK8A 3NCFB 2YHGA 1N8ZB 4J27A 5ACZA 2W65A 5AVZB 1RUPL 1RUPH 5IR1A 4ZXBC 3GPSA 4M43L 4M43H 5T1MA 3KWWB 4LPUA 4P46D 5AW2B 4F33B 4Z7NB 5LGHH 2EDTA 3V4VB 2A7BA 1NDTA 4FMKA 4IGBB 5DUPL 1R33A 3RWEB 4G8EB 4P0DA 1FFOA 1ZHKB 4B9FA 4NNPH 2VZUA 3IJ9A 1PDKA 5AW6B 3A24A 5IB1B 3FO1A 3LQAC 1QPKA 2G9HB 1F13A 5F3HA 1ZLUK 2PCFA 5E4IA 2O72A 4PV8A 3QULA 2ALAA 2Z9TA 4HEPA 4JPKH 1KPVB 4M3KB 2VO8A 2AEOA 1XGQA 4IRZA 4RFOH 5AOLA 2J1YA 3A6OA 1KB5B 3ZR5A 5L4MA 4UOW1 4ZMTA 2HTLD 3ARSA 1PLBA 2EIEA 2YMTA 4NGHL 1GW6A 1PKQE 4NGHH 4NN5B 4XTRC 2E3VA 3EOBB 4CUCA 3TA4D 2MTAA 2OMZA 1OSEA 4QRUA 1R3IL 1R3IH 4W9LC 3DHJA 3OGCA 1I1FA 3FOMB 2YC1A 3GS4A 2HTKC 1CGWA 4F7PA 1JHTA 4JFDE 4W4NA 2IH3B 2N7BA 2F6AA 2ZT9C 3DJZA 4LLQA 5MHSE 1HQRB 2WQXA 3BP6B 1IAMA 4E5XB 3LPPA 2E4FA 1XTLA 4FXTA 4O02B 4M8RA 1Q1PA 3FTWA 4L18A 5AG8A 4PWEA 3VVVA 4NOBA 4ZUWB 5F9JA 3RX7A 1S7XA 3OBAA 2J1KA 1JGLL 3PWPA 1QBAA 1IM3B 4YMPA 2YKLH 3NP3A 2LAGB 1XF5A 3LRSA 2A74C 2J21A 5TDPB 3KVDD 4PPTA 3FJTA 1FSKC 3OKDA 1ASPA 3U0PB 4XBPA 3DC0A 5GIRA 1KACB 4JZNB 3LH2H 1L7IL 2R56H 2DYPB 4O2FB 1KNOA 3M1BA 3ZSTA 3GSOA 4YFDB 1NBQA 1V3MA 4X9YA 3M17B 4IKJA 2H6PA 4LARL 4LARH 5CR1A 5C0FB 1MCPL 3OJ2C 2O5ZL 2WNXA 4G6FD 1QLEB 2IAMC 3MN8A 5HYJB 2BSBA 3PJSB 5FA4B 3HE7B 4I89A 3P9MB 1VJSA 3UZEA 3O3BA 2F54B 4BH8A 3P3TA 3ATDA 5T1LB 4ZNEA 5DC0A 3TN0C 5FUCC 2ZJSL 2ZJSH 4R3SA 5HD8C 2C4FU 3W9DB 2EP6A 1P6WA 1WCBB 3DUUA 3TFKD 4ZW5A 2FEEL 3ML9A 1INDL 1INDH 1TVDA 2VSMB 1G7PA 3PWUB 1HCYA 3C6SB 3K4AA 1K6QL 1GJIA 3BOVA 3JTBA 3QG6B 1SF5A 2OMYA 3EBIA 4MXQD 3H85A 4NP9A 3SDDD 5BZWA 4ANUA 1SOQA 1NCCL 4ABWA 4MMZC 2R23B 4R26L 3PL6B 1C12A 2AXFA 2W07B 3GS7A 3MO1A 4W9IC 2B1OA 4L1SA 4U1IA 4JHWH 5B4MC 1QSZA 4CSTA 1MJ7L 3US9A 1E7UA 3RY5A 1LVEA 4XCNA 4DH2A 3GM8A 3L7EB 3VO0A 2G2PA 3O6FB 4HDIB 3UP6A 2NZ1A 3LXCA 1HILB 2GAZB 3U9PL 2LOEA 2VR6A 1SJHB 4QHNA 4P5MB 4JDEA 4JRXD 4JB9H 5FGBA 5AW0B 5FWRA 1T4KB 3MNVA 3QZMA 1RJYB 4D9QE 5HYSB 1A5FL 2CWRA 2R0LH 2J4WL 2J4WH 2R0LL 1XGPA 2R1WA 4Y1AE 4FQLL 4FQLH 1NAML 4LIQL 3WN6A 1MCBA 5IBUB 3LJ3A 3O6LH 2YZ1A 2KC0A 4HG4J 3EJJX 1AXSA 4XC3L 1FO0B 1MAML 1MAMH 1Z3GL 5AFAA 5HHNB 1HNFA 4KY1L 4NCC1 5IB3A 1Z66A 4L4VB 3VAEA 2X4NA 4DF9A 3KR3L 3KR3H 1DUYA 2A6KB 2ENPA 3DJ9A 3V0DA 3H55A 5M95B 2F74B 4QO1A 4ECNA 5D71H 3PJNA 2WJ7A 3UTTA 5L6YH 2EDBA 1W72H 4IDJH 1SFDA 4PJIB 1E5CA 4NSKA 3H2PA 3DURA 5HHME 3BVNB 2KL6A 1KBKA 2CMRL 3NK4A 4PEEA 1HE7A 2BPBA 2YEZA 3ZMNA 2NXZC 1NC4A 2HFFB 3CVIL 3CVIH 1IGIH 3FF8A 1TTUA 3VD5A 3MCG1 1AG0A 2UVEA 4BUGA 3SDDB 2AJZA 2YPKA 3U82B 3QH3A 1E3FA 1K8DB 5FUOL 3BUQA 4O4YL 2WWKT 2OLDA 3W5NA 2NY3D 1G6RA 4I0KA 3CZKA 5AKSA 2PXYD 3ARGC 4KWUA 3EGXA 3D5OF 1I8KB 4MAYD 4O2EA 5KS9B 2B4CL 2B4CH 3G6DL 3G6DH 1E27B 4XB3A 3WKYA 5E6ID 3C5XA 2QSVA 4X0KA 2XN9E 3SDXB 4TUKL 4TUKH 2TSAA 4Z9KB 1TKWA 4GKOA 1GPOL 1GPOH 1CCZA 1BAFL 1BAFH 1E30A 3H53A 4C57C 1IC7L 2WKLA 1SDAB 2GHWB 2FTAA 4BQ8A 1VHPA 5BO0D 1A7RL 1I1YA 1IBHA 4DPAX 1G0XA 2Y1VA 5IP4A 1CO1A 1WAAF 5B1KA 5CCGE 1FLTX 1A7PH 4QEGA 3AT9A 4IW4C 3ABKB 5ES4B 1L6ZA 3KLSA 1YYLH 4NQEE 5CR8A 4AK1A 4OH2A 5EDSA 1AZUA 3SHSA 5I24A 1KN4L 3HS9A 4L1HA 4R97B 5I1CL 5I1CH 4YDLC 1JUFB 3FSVA 4PLKC 4EN3A 2L8AA 4M7KL 1BQSA 5F1IB 3S2AA 5DEZA 1LWJA 3BIBX 4KKQA 5IMMB 2CRMA 1SVBA 5F88A 3QQ3A 1IKNC 2A9NL 4I1PA 2VN6A 1N19A 3X1FA 3HE6D 1VZGA 1VEPA 1EMTH 2XIBA 3QIWB 4ELDA 2UY6B 4Z7OE 4FA8A 5ENWB 1QBLL 1SBBA 2KLTA 3TIEB 3HS0B 1MIEH 2V8LA 2DJMA 3GFUA 2K45A 5T3ZH 1QG3A 1XEDA 3NZ8B 4KRNA 5F1NB 2DBLH 3FFDA 4Z7WA 3QDMD 3EBAA 1S9WB 3Q8AA 1WAPA 4GAAA 3Q48A 4OVVA 4MAYB 3K1KC 4MCYB 1UCTA 1UH4A 3E6FA 3RWCB 3VH8B 1OW0C 3GD1C 2F8IA 3NH7L 3NH7H 4AQ1B 2XICA 3ZDXB 3CPLB 3MBED 5IB2A 1F4WH 2VLRE 5AKRA 3T2PA 3LN5B 1NPNA 2P5WE 3QJXA 4OZHA 3OKEB 4Q74A 5IQMA 3HZVB 4H2AA 3E80A 1IM9D 4M1GL 3U6RA 5DZAA 3SPVB 3UTPE 5JXEA 2WC7A 1P7BA 4G9FE 3DUSB 4N0UE 3UTZA 2VDMB 4IBVA 3P4LA 2GIXA 5EZLA 2N0MA 1KGCD 1UFGA 4ELME 3QUML 3QUMH 3VFOB 4KDTA 4H8UA 5AAWA 2R2BA 4P2OA 1FNAA 4MZIA 1D9KC 2ZF9A 2FATL 2FATH 2YGQA 4GQPH 5I15L 3VWKD 1BVKB 4WAFA 4GLRI 1D5XA 2AITA 2O5YL 2O5YH 3IDNA 3GMNA 3ZIYA 1HEZA 3FCGA 2A9CA 2PLTA 2UXTA 3CFDA 4RMBA 2BY2A 2WZ6A 2PYFB 3QJVB 3QJZA 3UERA 2VXQH 4ELKB 4ODUA 1I8IA 3DVGA 2VKWA 4RGNE 2APWA 4PFEA 4Y4FB 1KWKA 2OMTB 1UM6L 1F1AA 2ZXQA 3GRWL 3KS0H 1NPJA 2HT2C 3NA4A 4H5SB 3QJOA 5LGKA 1UWGL 1UWGH 3DYOA 4TUJA 1WAEA 4Z7VB 2WBJD 2EYRB 4AGNA 1KJMB 4G5AA 4AEEA 4F2MB 2FQDA 5DD0H 4FQXB 4HIPA 5I17A 1YJDC 3QDMB 2DLGA 3QJRB 4PJ5A 3DJTA 5T3XD 2HRHA 2O6DA 4G80B 2KT6A 4L29B 5D7LD 3MROA 3ML8A 4AJ0A 2ZOWA 1JE6A 1CGSL 1CGSH 3KDPB 4FLSA 5F7HA 5MEPA 1K4CB 4M48H 4N8VA 1JI2A 4F57L 2PR9A 4F57H 2ZXWB 4J4PA 1FC1A 1SY6H 4MJ5B 5J06A 4HWEL 4MJJA 4HWEH 4MMYA 4JFZL 3HKFA 4JFZH 3VXTA 1KC5L 1U3HC 5GS0C 1C1EL 1GS8A 3GLZA 3WKML 4X6FB 4I0PD 1OL0A 5FHBH 5FHBL 4G1MB 4F7MB 1SEQH 1HE8A 2JB6B 4K5NA 3WHE1 5C7XL 5E6YA 1M9SA 4BSVA 1IM9B 2NR6A 4Y5YC 5C7XH 3TNNA 3ZDWA 4GSRA 4LPXA 4U1SB 1AO7E 2LR4A 5DFWH 4PJHF 2EUZA 5HVFB 2B1HL 2B1HH 1ANUA 1BLNA 5DHYB 4RA3A 4FAAB 5HI5D 3CXHJ 4LP8A 4JFWA 4Z18A 3FUNA 4YLBA 1CDGA 1MHHB 4S11A 3IGAA 2J55A 1P7QB 4PWJA 2DIEA 4PJ8C 3C5SB 4EUPB 4IBSA 4GO8A 4HGWA 3HAEB 4KNUA 3S36L 2A0LD 1OF2A 1XTMA 3S36H 1VPOL 1VPOH 5D93C 2ZAIA 4FABL 2CU9A 4IMLA 3LHAA 1KXVA 2P26A 3OL2A 3S3DB 4GSQA 3EW3B 1OGTB 4NDMB 4Z7UF 4RQQB 2ED8A 2FJHB 4PR5B 3QZOA 1ITCA 3SGJC 5HVGB 2NX5D 4XMWA 4YHML 3TASA 3DK0A 4GI6A 3V5HA 3FTVA 3H3PL 3H3PH 3CVHL 4WO4D 3KLHC 2G0KA 4X6DE 1H3PH 5ADPH 2NSQA 3WJJC 2P8MA 1OGAE 5D7LB 4AK2A 3NJXA 4ADGA 2AI0H 5JIIA 4LSPL 4XP4H 1I9JL 1I9JH 4J1UA 4QF1B 3QIUD 1QSED 5CSGA 1PF3A 1SYSB 4ZAKC 1NCOA 1N2RA 5GRYA 1IBYA 4Y1TA 3FUJA 5KANI 1T1ZA 4N2CA 4ZMVA 3UC0H 1ZHLA 4JHAH 4Y5XB 3LEYL 4WO0A 4AC4A 4IRSD 5E9AA 3QAZC 1DO6A 1I3GH 3HLAA 5D8JH 1F02I 1Q0EA 1WF5A 2OMNA 3L3DA 3Q8EA 1JD7A 1OTTD 3BH4A 3C60C 2H8PA 3WFZA 2IADB 4YXKH 4N2NA 3QIBA 1GL4B 4PCKA 3RNKB 1BM3L 1BM3H 2AK1L 1RZ8B 3AACA 3MUGB 2VDQH 4KJYA 5J12B 4POYA 4L3FA 2F9BT 4TF4A 1EHXA 4RRPM 4LIQE 3TJEL 4J3TA 3SDCA 4MA3B 2OPCA 2D3LA 5ILTL 1TZHA 3GUTA 1MFAL 1MFAH 3AB0B 1TYEB 3JTTB 1V3KA 4ZO6A 4M5SA 3UAEA 4KDWA 3D0LA 2C3GA 3TESA 5D70L 5D70H 4I77H 2IGLA 2Q20A 3AT8A 1XF3B 2EICA 3RRQA 3FQXA 2J20A 1AR1C 4KHTL 1A9VA 3RUGE 4NNXA 1NFDF 4MNGA 3V0VA 1WV7T 3OKNA 4J3OH 1WJ3A 1AP2A 5AVVB 1T0NA 5CIPB 4CMMB 4QRPD 2CG9X 4EI6A 4HISA 3DXAB 3SKJL 4ZUUB 4QTIH 2XWDA 5TH2A 4DAGL 4DAGH 3HTLX 4Y2DC 3M7FB 5D7SL 4CADA 3QIUB 1DEEA 3CLFL 4PJGA 2P43B 3KD4A 2NY1B 2J5LC 1UEMA 2DWEB 3EG9B 1RUQH 4P2AA 3GJFB 1HHIB 1H15B 1M2VB 4XMLL 2EYSB 4NP4L 4NP4H 2VABA 1XZWA 5I6PA 4PTTB 1UZ8B 3BZFB 5ANHA 2COVD 5F7FA 1WTLA 4PSRA 4ZW8A 3K72B 4P9HC 4MS8C 4RCAA 4HLEA 5BPPA 1HL9A 3VI3A 3S6CA 2X6VA 4JQVA 2OP4L 4UQ2A 4KUZL 1S5IL 4KUZH 4WJ5B 1TJIL 1TJIH 4RBPH 1G5GA 1N3NA 4KKAC 1X6LA 2RD0A 3BPNB 2IQ9L 2IQ9H 3W0WA 4KQ3L 4KQ3H 2Q87A 1JRHI 2GB2A 5EU5A 4X2UA 1A0QH 2BS9A 3B6SB 1L9PA 2FYYB 4HCFA 4FZ8L 4FZ8H 4FG6C 1GGBH 1NJ9A 5HHVH 3WAKA 4Q58C 4I5BB 1DJHA 1KGWA 1WVZA 2B7DT 3QUYC 1LO3H 5TE7H 5IJKA 2EDNA 2UZXB 3UH8A 3X1EA 5FF6A 4X6CF 3BPLC 3T3PB 3RJQB 1HL4A 2VZ1A 5IK3A 4KY2A 3BXNB 1CDCA 1VA9A 3ULVE 3CC5A 4JVPA 4TQPA 1KCLA 2IDUA 3P0VL 3P0VH 3IJHA 3OKLB 4IHOB 4M03A 3UGXA 4MA1B 4CC4C 4EZLA 4Y9FA 2Q1EA 3ZDZB 1GS7A 4NX0A 5EO9A 2X4QB 4G59C 4Q9CA 2QV2A 3BDXA 4ODBD 5IOPA 3OLEA 1WZLA 1HHGA 4I9XA 3QJSB 4X4YA 3DECA 3TO2B 1AIFB 4R4BA 3HHRB 5DZLA 3OKOA 3N91A 1CF1A 4ZXBA 5GZNC 3DX8A 2BINA 3VG9C 4OT1L 2KZKA 5F96H 4Q6KA 2ALWA 1A6PA 2MCPH 1BVLB 1D5RA 5F7DA 5AZ2H 3GNML 3GNMH 2WVTA 5CUSL 5CUSH 5AAMA 3T4YB 4ZO8A 5TK2A 3LN4B 5E5MB 4GMSL 4GMSH 3STLB 4F7TA 2R9HC 1P1VA 4FQ2L 4FQ2H 2ZYSA 5BZZA 2WCGA 3ZE0B 3MR9B 1PQZB 3QSKB 3RDJA 4LCUA 4JY6A 1CT8B 5AVSB 1BLIA 1EDQA 1ND0B 2AXJA 3BSZA 4N5UA 4QI3A 2D7MA 5CGYC 3O2WH 2GFBA 3Q3GA 2NY4C 3LQZB 5DJDA 1OM3H 4FFYL 4O9HH 5E2WL 5E2WH 5DRXB 3VD1A 4I18B 5I6MA 5HP5A 3V5DA 1MREL 2X70A 4LNRB 5BUAA 4NLAA 3HBGA 3NP4A 4XCYA 3Q06A 5B1BB 3RWHA 3WKPA 1TFPA 4OD3L 4OD3H 4DKDC 1ORQB 5HPOA 1AZRA 1IEBB 4L1LA 5GRZA 5MEOA 2CLVA 2Z93B 3KPSE 1K9TA 4WUKH 3ARDD 4Z77B 1UXLA 5BRZE 2HTKD 5C3TA 3FU7B 1CDHA 1UM5H 1NIDA 4UT7H 1CL7L 4KRMB 4U1NA 3K2KA 2PO6D 1MI5A 1QUPA 2OMUA 1L7TH 1H3GA 3UPCA 3RKPA 2PWEA 4OIFA 1KTDA 3LV3B 4L0ZA 3VGAB 1CG9B 3QUXD 1FUNA 4HK3J 4FEMA 3WEXB 2Z64C 1LDPH 3W9EB 3IXAB 3WTXA 1S7RA 1A6ZB 1LWHA 4BD4A 5J13C 1MCWM 2CM6A 3QEQB 1A4KB 1U8IB 2JQMA 2B1AL 2DTML 1S7VB 2ZWZA 2XTJD 2G5RA 2FNWA 1WFMA 1D5MA 3N1MC 5HHOA 2NNAA 4OM1H 3BHBA 4JQIL 1PNDA 3ZPDA 4J3OF 5ICXA 4O2CA 1Y1DA 2WXKA 3AUWB 4L1DA 2BP5M 5IV2B 5EBGA 1IBDA 5D1ZC 5I74C 4OZIA 2IAMA 3OXSB 3OJVC 4E41D 4B9PA 4XXCC 2I7OA 2DWXA 2JXMB 3P2BA 4L3EA 3PHOA 3DRQA 2C3XA 3OAUL 2VLLB 3DSNA 4E36A 5IJCC 4K0OA 1NM9A 5IMLA 2OJEA 4OZGF 4AZ8B 3TN0D 1RUMH 4NQDA 5HD8D 5C7ZA 2AERT 2V4LA 2V2XA 7FABL 2WMPB 3MU3A 7FABH 1UACH 3TBVB 4TKWA 5I66A 1IARB 1NIBA 4YDJB 2N56A 4KOCA 5DYOA 4LLYB 1AQDA 3AUVA 8PAZA 4NO2A 3GO1H 4XC1H 25C8L 3V9FA 3ARDB 5AYUH 5JPNA 5HDBE 4ANVA 5LO7A 4JCMA 5C0EB 4WI8A 1RZ7L 1RZ7H 3ZQ9A 2XXMB 4ZZFA 2ZXAA 4GAGL 3JTSB 3TX4A 2P8PA 1BAGA 5E5UB 2BIOA 3BH8A 3VXSD 2ZKWA 1E8YA 2X6MA 5D96B 2EO7A 1GZPB 2DI8A 3ETBJ 3BAYA 3GMMA 3QUXB 3MGTA 4PRNB 4XRCB 4X4KA 4K8RH 4WFEE 2BSRA 4PSPA 1IGTB 4GFTB 1JNHA 1BXVA 5IM7A 3WN5A 2DI9A 3EF4A 5AL8A 2YSSB 1F6FB 3KYMB 4C4KO 5JTWA 1CIUA 3N41F 2UX7A 5H94B 3HMXL 1T0MA 5C0BB 3IRCA 4XNAA 1C5DB 2Y2YA 1NL0H 2BRQA 2OZ4A 3FH7A 3ESVF 3VRJA 1YMME 4M5YL 2K6ZA 2VIRA 2Q76A 3BI9X 3AU1A 3TEUA 3REVA 4AKPA 2PYEE 1N7ML 1N7MH 1ZRUA 5IQLA 2DY2A 2UWEB 3QWOA 3D7PA 2B4CC 3L3JA 5IB4A 4TN9A 3FFCA 4JFXB 5DT1H 2GBUA 5DT1L 3MPCA 5K39A 5ITBL 3CSBA 2FCBA 4GY4A 4OBRA 3QHFH 2I27N 4WNSA 3VQ2C 5KTEL 1RK1B 5CP7A 4MD5B 5H8DA 1F6AA 3HIZA 5G4MA 3GGWB 2ZP9A 3BFQG 3KAAA 4WU7A 4R96B 3FUDA 3DO7A 3WEOA 2XACC 4KKPA 1GYUA 3BH9B 2NYKA 2F53E 3DVNB 3JWNE 5I6NA 1A2YB 1EA9C 4F1ZA 5DZNA 1QFPA 2NXZD 1BAWA 2E6JA 5BUPA 5JQ6H 4K23H 2OMWB 2CIIB 4X99B 4HIEB 2FX8H 1ITBB 4M61B 3ZE2E 1MWAL 1MWAH 2E74C 1R4XA 1IILE 1IC4L 2Y7QB 5JUEL 1FQ9C 3SKOB 5IEHA 4ZBJA 4U2YA 2A77L 2J8UE 3ARGD 1EXHA 2WYHA 2HVJB 5EC2A 1HHKB 1H5BB 1O7DE 3DX9A 3PWNA 3NIGB 2XQBL 4D94A 3UBGA 1RMFL 1RMFH 1YQVH 2C7FA 2X10A 5EO0B 3ISRA 1H8NA 2YEQA 1FF5A 4HWNA 3W2DH 3IRZA 2ED7A 3TH4T 2DW5A 1FV1A 3BW9B 4NRYA 4KFMA 4PJCB 2MCG1 2TAAA 4JNXA 3MV8E 4M8QB 4YOKA 1HXYB 2B20A 2QADC 3R8QA 1E5YA 4N28A 3M45A 1GGYA 2X89A 3OAYH 4JGNA 4CN4A 1O5PA 4PI0A 1KIQA 3CZFA 4NXKA 3CLEL 3CLEH 4NKMB 2P5EB 3VM5A 3BD4A 3FT4A 1T2QL 3T04D 1F42A 1ZVYA 4ODWA 2IPUG 5L0QC 5I6OA 1Y0LB 1M53A 4MLSA 1XGTB 4I1NB 3KYOB 1N0LA 4JE4B 5EOCL 1CB4A 1REIA 1G7HB 2YD0A 5E2TH 4FJYA 1I75A 3V4PL 3FB5A 3AY4C 4LSTH 4X5QA 1RURL 2G3ZA 2KPNA 4XN7A 3KLLA 43CAB 2ZIDA 2DTSA 3FBQA 4ONHB 4P5TC 3VFTA 1MCEA 1EVUA 5KSVB 2AV1A 2HSIA 3BDYH 3VFRB 3L95B 4TXVB 2HX9A 3HI1B 2VDKB 1A6VL 4MJ6A 5EU6E 1EAQA 3BAJA 1KBBA 5IESH 2F08A 3HVDA 3FSWA 1U8JB 2A6JA 4IU3B 1VENA 1RI8A 4QRRD 4JFDD 5AUMA 4LSVL 4LSVH 3KE0A 4JN2A 4OLEA 3VJ6B 5MHSD 3AAZA 2AQPA 5I23A 3IJ8A 2NZIA 3GSXA 4WSGA 2LVEA 4PD4K 4PJDE 5ID0B 2A1WH 2XOTA 4J39A 2VXTL 1OW0A 2D0FA 2D3VA 5IQ9B 1I8MA 4N2BA 1ZSDA 4X9IA 1ZT1B 3X1GA 4DUXA 4XCEB 3VMNA 3W37A 2K4WA 2IBZX 3BUYA 1BZ9A 1JOIA 5IHWA 5FYLH 4P9MH 2CO6A 1N8OE 1PIGA 2EC8A 3MZTA 2L3BA 3FTSA 3G5VB 3O3DB 1HH6B 1XV8A 1MRCL 4H26B 4BSWA 2I07B 4GUQA 4D8PB 4F37K 5DD6A 5C92A 1SF3A 5E00A 3FO2B 1X4YA 1T0PB 5BV7H 4ANWA 4PRHB 1TCMA 1UASA 5JDSB 1UM4L 1UM4H 2DQHH 4DCQB 1EHAA 3TURA 1NGXA 2E6QA 4UT9L 1OCWL 3OGOE 3IDGB 5KBLA 3IJSA 4HCRL 4HCRH 3SOTA 3LNFA 1D9KD 1U41A 2PW1B 3WV0A 1TPXB 2Y07H 3SE9H 4XH2A 4WZ9A 4G72B 1I7RA 5I6KA 2LTQC 4R0LC 4MDRA 2XKUA 3ARZA 5TJWK 3QZWB 1F3JB 4Y16C 3GMLA 4U1GC 2ENYA 1XCTB 4YVNA 2VR4A 2OAAA 1U30A 1ID5I 3WIIL 4PUBL 4X8GA 3WIIH 4UDTB 5CEYB 3SIKA 3TM6A 3X1NA 2HT2D 3FT9A 3NACL 1EJOH 2CO3A 4B0MM 2ITCA 4KZEL 2ZWSA 4MJIE 5IKCB 3FTGA 4QRRB 4J7RA 4LPCA 5B1JC 4JFDB 2QKIB 2AEPL 1YPZF 1JZJA 3EJYC 1R5VB 5FYJU 2BHUA 2WAHA 4JJ5A 3MLUL 3MLUH 1TFHA 4RIRB 1R3LA 4WFGE 4XN2A 4DN3L 4DN3H 4Z7AA 1XH1A 1WP6A 4GXFA 1BF2A 1FL3B 1OAKH 2YUXA 4K3JH 4PRIA 3CBRA 4Y8AA 1NTDA 4G11A 4PJXF 1DQJB 2IEPA 1W8OA 1M7IB 5I16B 2VL4A 4OV5B 4HJJL 1U3HD 3RL2B 4ZFFA 5GS0D 3F05A 5A2BA 3LZRA 4BZ2H 2J25A 4DGIL 4CW1B 2GJRA 1NKGA 1YEHH 1C8QA 2G30A 3Q5OA 4MNQE 5IVXE 3ECWA 4L1BA 3IFNL 3IFNH 1QBML 1QBMH 2R1YB 1TVBA 5EEZA 1L9MA 1ZLSL 1QWUA 1ZLSH 1IAKA 4D9QD 1BQ5A 4Y1AD 3T3ME 3GIZH 4ZQKB 4JFQB 2VZ3A 1T20B 3SEPA 1EUUA 4GI9A 1MY7A 1OPGH 1S7TB 3I2CH 5KVFE 5DK0A 2ETWA 3IFPB 4KVNL 4KVNH 3X17A 2J1ZA 5CGTA 2FUQA 1J5CA 5CCKL 5IIEB 1U8OB 1ZHNB 1X5IA 3MNZB 4PJ8D 2ITEA 4IIQA 1Z9SA 1NQBA 3N5AA 1NEZB 3FF7A 1OSZA 5HHMD 1OZTG 3IFLL 4PJEF 1JV5A 2XVBA 1Q0YL 3G08B 4X8JA 3BGFB 4KRPB 1P5UC 4CMHC 2P9RA 1E0OB 4N9GB 2N3JA 4F7EB 1JGEB 2CZNA 1TTFA 5JO5A 2W9DH 5D72H 5SWQA 5KYNA 4XCFL 4S1DC 3MYJA 3ZZSA 3FKUS 1ZT4B 5ID1A 4OY9A 2WYZA 3NSDA 4HWZB 3KMDA 4XNMB 4U0RC 3O4OB 1UEYA 4FD0A 3K6IA 3N1QC 3ZX1A 3C6LD 2PMZA 3KPOA 4JM2F 4KKLC 4G6KL 1F3DH 5EEXA 2YBRB 2H0FA 2IDSA 2ARJA 4GKNA 1P5VB 1UKSA 5L88L 1HXMB 3OAZH 4FQIL 4FQIH 1OGSA 1JV2A 1N59A 1UYWL 2AAVA 4JO1L 3R0NA 4QNPF 3WS3B 2HT3C 2HH0L 2HH0H 2TSBA 1EIBA 3U2IA 2IPUK 1CN4A 1VFBB 2XN9D 1RZIB 1PZ5B 2DM4A 1UJ3A 1XXDC 1P4LB 3PP3K 4NO5A 1KLFB 4AIOA 5JNYA 1T1YA 3EO1B 1BOYA 1ZA3A 4Z7QB 1EPFA 4ES9A 1CDBA 2X44D 4QJ4B 4GRLC 5I18L 4APQA 5I18H 2NXYB 4K7PY 2FJSA 2WUCL 2WUCH 3EYUH 3C60A 3EYUL 4NQSA 2J73A 3S5LB 4WIQA 5BQ7A 4I2XB 2HX7A 5EC1A 1OP4A 2VL5B 3L08A 3I85A 5IWLA 2OXGB 2ID5A 4GI8A 3GXPA 3DX7A 3HC2A 1J5OL 3ARBA 1J5OH 4GKZB 4YHYC 5JPMB 4ES8A 3QJHB 1B88A 3TA3C 3DKHA 2B5IC 1MFDL 1MFDH 3F7VB 3BUPA 2EZ0C 5LBSH 5EULV 1GY1A 1ED3B 2B2XL 5I0VA 4JZJA 2FO1A 2VMDA 3S48A 1IBGL 1V8HA 1CLYH 3CHQA 1XSIA 3IT8D 3LZQA 4S2SA 3T1FB 3T8XB 2DWDA 5C0DA 3SPIA 4U4BA 4WFHE 1ZA6B 5DGQA 1JXKA 4NENA 1NBZA 4F8PA 1AR1D 1NGYB 4AVKA 3NIDB 3QAQA 1IGML 1IGMH 2QMJA 1KIRB 2D7TH 5CJQL 3FAWA 3BP7A 4BZ1A 5C07E 1LJMA 1WBXA 1FWXA 1G7JA 4HUVA 4PAZA 1CFNB 3K2UH 4UZSA 1ECYA 5EG6C 4URKA 4Z78A 5T5FA 2EVFA 3C6LB 4Y2DA 4F93B 1VAHA 3HRPA 1R34A 3TNMA 1KGUA 4AENA 4HUWA 2Q6WA 4NRXB 4ODSH 1XZ0B 4G8FA 4J3OG 1OM9A 5L2JB 1G9NH 2MQGA 2VLRD 1QSFE 2XN9B 4F1SA 1R3KA 2GJZB 4Q7DA 4ZUVA 1KLUB 2Q3AA 2P5WD 4X6BB 3ZBMA 1GJUA 3BGMB 4AV5A 1PGRB 4XPFH 4C56A 1OQXA 1X7QA 4X7FC 3IS0X 4MS8D 3GWJA 4YDMA 3S96B 2H32A 3NFPA 1QFWM 4HUUA 3SJVB 4XMUA 2WOYA 1P69B 4DFHA 3U30B 1VGKB 4KKAD 2O26U 4G9FD 3BP5A 4QXUL 4AUUA 4UM9B 4AVIA 3Q9PA 4Z76A 4PVBA 1OEZW 4JPWL 4JPWH 4XX1G 4JR9L 4JR9H 2DQGL 5BVPH 5BVPL 1SGKA 1DFXA 3GXFA 4L1TA 3NFNB 5DRWA 2Z35A 3F65A 2DMHA 5EO1B 4PN6A 3VMOA 3QUYD 2HG5A 3WE1A 1SDYA 1AHKA 1Q8MA 1UUSA 4OTXH 1CFSB 1Z9OA 2JI1A 1AD9A 1BXAA 3MJWA 4YSDA 5B7EA 4F8LA 2K1MA 3G5XB 4DNLA 4UQ3A 2F1BA 1NGWA 4Z3EA 5LGYA 3R06B 4CC4A 4Q0XL 1NC2B 1WIPA 3WG7B 4RGND 5L2KB 3LEXA 1J9RA 3QVAA 4YBLC 4JRLA 2WXFA 2DYRB 4W9FC 5K93A 3GHEH 3QQDA 3CHPA 3CZSA 3QC5X 4HWBL 2XX1A 5AB9A 3TWYA 1UATA 5M94B 2J3SA 3BAEL 3DJSA 8CGTA 4JK0D 2X4OA 2DQJH 5T8IA 1T7VA 5GSRB 1F8TH 5GZND 5GGTL 1TZ8A 1YEKL 3MRGA 5DQ9A 4PY7B 1C16B 2PNDA 1M71B 1ES0B 1YNLH 3CJJA 1JZ7A 2B3RA 2LLNA 4NWUL 5DXWA 1NMAL 1NMAH 4JANA 3SOBL 3TBYB 2LLLA 4YIQB 2FQFA 2VQTA 1AIZA 1WAAA 5F7MC 1DQTA 5HHPA 3HW7A 1ZWIB 3EYOA 2R9HD 1RJZB 3MRHA 4K5OA 4GLRH 1ZLVK 5GS2D 4Q6IA 2QVKA 4EQ3A 2UXGA 1P0SE 1WH0A 1IEHA 4D9LL 3KJ4C 1AR2A 2NY4D 4ZT1A 5F89A 2QBWA 4UQDA 3DX6B 3GLAA 5F97E 2FK9A 3BO8A 1WISA 2P8LB 4M00A 4EOWL 2WINA 2ZP0T 2IH8A 1XWVA 4OCSL 4LVOB 3OWRA 5C09E 4HFWB 4K7PX 5KVEE 4JGJA 3TONA 3O9WD 1DJZA 3P9LA 4GSXA 5EF2A 3KLAB 3HG1E 4UI2A 1RLWA 1CICC 1F4XL 3EBHA 3FULA 3LD8B 3MRLA 4LZKA 3KYNA 4LAQH 1FGNL 1OWWA 1TZIB 1TU2B 4XO5A 5T33H 4B95C 3H42L 1BG9A 3FONB 4NQUA 5SX5H 1D7CA 4Q97A 4X6DA 3ES6A 3GSQA 4TPRL 4G83A 5H37H 5CLWA 3M6DA 1ZXKA 2ZKXA 4JHBA 5SV3A 3ZK0A 4JDZA 4EDXB 5HYIA 4NJ9L 1J9TA 1G4MA 2B0SH 1OGAD 1KENL 5C0CE 5ACZB 5JW4M 2W65B 4WNQA 1M57B 5IR1B 1ZEAL 1SXSA 1ZEAH 5BOJA 1EO7A 5T1MB 2PTTA 5HI3C 1LYQA 3VFSB 1M1XA 2F7QA 2WZ0A 3IFOA 1IFHL 3VWJC 3D2UA 4PU2A 2IGTA 3CWGA 3LCYA 5D1ZA 2VXUL 2YWYA 1PDKB 1LWRA 1JPFA 3D3VE 3QEGL 1OAQH 1J0ZA 3CN2A 1PX3A 1OTUC 4W9GC 5F3HB 4GBXA 2PCFB 4R2GC 4PV8B 3DI3B 1IT9L 2D9CA 4IM8A 4L8SB 3ZTNH 4DPCX 4AQEA 4B9ZA 1M7DA 1XGQB 3A67H 5H35A 1F97A 2DAVA 3OAWA 1TTRA 2FHCA 5CEXA 2Y5QA 4MB1A 3BAWA 2VC2H 1QVOA 2VDLB 4HOWA 3T6QC 1KBPA 5DURD 5AW1B 15C8L 2Q86A 1KYUA 1PCSA 2ZF8A 2WXMA 5GQBA 5B3JF 5I19L 5ESAA 3UOAB 5I19H 2VZTA 4HS3A 4FQPA 2OMZB 2D7OA 3ULUH 2ICWI 4QRUB 3MV7E 2EIMB 1EBPA 5BUGA 2NY6D 5HJ3B 1JF5A 2ZWLT 4Q9RL 2APVA 1FHGA 1I1FB 3H7LA 5IROC 4JO3L 4M5ZL 3O9WB 4WUUD 2ATPA 4F7PB 3GI9H 2JF1A 1JHTB 2UVFA 4LLQB 4OFPA 3HOGA 3U1PA 1RIVL 1RIVH 1W72A 4FKKA 1MXDA 1SXCA 5D7JC 1USZA 5JW4N 5F9JB 3NUKA 1Q9OA 3IU4H 1S7XB 5DS8A 5FCSH 3SKNA 4RISL 4RISH 4I1RA 3V0IA 5HDQL 4ZDHA 3O8XC 4OJYA 1T5XA 3PWPB 5D7IE 2N59A 4MCNA 3TVMC 4LQ1A 4MJ2A 2NZ9C 3FUFA 5DDHA 3LRSB 4WENB 3QHTC 4XPBH 5H2BA 3DV6A 4LDOB 2BDNL 2BDNH 3IGUA 4HKXA 1HC1A 3A4FA 1NKRA 4XBPB 5AB0A 3FB6B 4HPHA 2ICCA 3LKOB 1KNOB 1B0GA 1QYGH 2WP3O 3M1BB 6FABL 2KBGA 6FABH 3WKQA 1KB3A 3MX0A 2AQQA 5GGSA 3APCA 2H6PB 4HFUL 4HFUH 3SYAA