4YSDA

Room temperature structure of copper nitrite reductase from geobacillus thermodenitrificans
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
299
structure length
299
Chain Sequence
NVIAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTETGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 104
structure length 299
sequence length 299
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysdA00
1BAWA 2A3TA 1PAZA 3UACA 2H3XC 3G5WA 2XXGA 2N0MA 1EZLA 3FT0A 1J9RA 2RACA 1L9SA 2TSAA 2XVBA 3S8GB 1W6LA 2DWTA 3D12B 2IH8A 4DPCX 3FSVA 2BW4A 2VSMB 2IH9A 4M3HA 2YAHA 1E5ZA 2GI0A 2XX0A 1KCWA 2FQEA 1DZ0A 2X87A 1AZRA 1OE3A 3FSZA 8PAZA 3UADA 1XB3A 2HXAA 3U25A 1GS8A 1BYPA 1WAEA 4YSRA 1M56B 2FQGA 1J5DA 2QPDB 2VMJA 5B1BB 3T6VA 2FQFA 3NJMA 3X2QB 1BYOA 3OMAB 4HZ1A 1R1CA 3QJUB 4EF3A 1IKOP 2CBPA 4G72B 5PCYA 4E9TA 4DPBX 3FYEB 2EIKB 1AG0A 5I26A 2JKWA 1E30A 3NSCA 2H47C 2BWDA 2FQDA 3FPYA 4NB7A 4UF7C 5I6OA 1AAJA 3HEIB 3L45A 3FS9A 1BQRA 4RH4A 2YXVA 1PNDA 1SJMA 2BP8A 2I7SA 4GYBA 4BDVA 2AFNA 1EHKB 2PPDA 4KO6A 1M9WA 1AZUA 4L0PB 2GC4C 3CDZA 1AG6A 2VW6A 1AQ8A 5B1JA 3CVBA 1X9RA 3QJTB 1CUOA 2YAEA 5B1KA 3SBPA 3FU8A 4W9ZA 4N4YB 1I53A 4K9JA 1JXFA 2XV0A 1BEXA 5I5IA 1XB6A 4HHGA 2WO2B 1W6WA 1AACA 3NJLA 3IN0A 2PLTA 3AZUA 1NIAA 1IBZA 2J57A 2EINB 4BXVA 2X88A 3ABKB 3QJRB 3IN2A 1A4BA 1PLAA 1OV8A 2VSKB 1DYZA 3OM3B 3UAAA 4W1TA 2YAQA 3FU7A 4GP8B 4G7SB 1YLBB 4YSCA 2Y69B 4JKNA 3ZBMA 4M4RB 4F2EA 2GHZA 1BXUA 1KV7A 5F7BA 3T9WA 3MX0B 2UXTA 1A8ZA 4KOCA 1OOWA 1NZRA 1ET7A 1PF3A 1OCCB 1TKWA 2IDUA 2XLLA 3SQRA 4E9VA 5B7EA 4BWWA 2AANA 2ZWNA 3ASOB 2R7EA 1F56A 3V9CA 5A7EA 3N2JA 3PCYA 3KW7A 5B3SB 2OCCB 2VW7A 2PCYA 3NJJA 1ILUA 2CAKA 3FQ1A 4CSZA 4MFHA 3TBCA 2W8CA 2YAOA 3NYKA 1L9OA 1WA2X 4NERA 4E9QA 1ET8A 2UXGA 1OCOB 1OF0A 5TK2A 3X1EA 2EIMB 4YSSA 4AX3A 5ANHA 1L9TA 1WA0X 3X1BA 3FPXA 2MTAA 1XB8A 1PY0A 1TEFA 1NWPA 2CALA 2VM4A 3PPSA 3WNIA 4BDVB 3DIVA 1JZEA 1NDTA 1A4AA 2XWZA 3UABA 3OMNB 2IWFA 1OCZB 1JZJA 5I6LA 1A3ZA 2Q5BA 3RYMA 2DY2A 1JERA 3T6ZA 1JZIA 1OE2A 1MG3C 1UATA 2EILB 2WO3B 3S8FB 1SDDB 2DWSA 4YL4A 1JXGA 1BQKA 1PZAA 4A2FA 1V55B 3H4FA 3NJNA 3OQRA 4QLWA 2YXWA 4PAZA 4WKXA 3TU6A 1KYAA 2FT8A 4YSPA 4GXFA 2EIJB 2XYBA 3FSAA 4DP5X 1PLBA 3WG7B 1E5YA 1BQ5A 4NAJA 1JZFA 6PAZA 3AY2A 5I6NA 1ZDQA 2Q9OA 4BK5C 1FA4A 2XX1A 1SHXA 4X4KA 4CSPA 2P80D 2FT7A 3EHBB 4DP6X 2PPEA 1MZYA 4DP7X 2QDVA 2GBAA 2QT6A 3FU7B 1HAWA 1ID2A 4P5SA 1KDIA 2FJSA 4G71B 1GY1A 2IAAC 2GC7C 3S3BB 3ZX1A 4UAHA 3ABLB 3WKPA 3N55A 4DP1X 2CCWA 4YSDA 3DKHA 2BP0B 1GYCA 1AZCA 1A65A 2YAPA 4Q8BA 9PCYA 5I5MA 4AKOA 2UXVA 4HHWA 2IDTA 4A2EA 2HZHA 2UX7A 3IE9A 1J9TA 3NT0A 3S3DB 4GP5B 4A68A 4G7QB 1GS6X 1CYXA 4KNTA 1KGYE 3PLYA 1GSKA 1KDJA 2B08A 2WSDA 5I5JA 1RCYA 2CJ3A 4DP9X 1ZIAA 3TASA 2FT6A 3ERXA 5I6KA 2IWKA 4BWTA 2AZAA 2IDFA 4YSQA 2NRDA 2H5UA 3NJGA 1NIEA 3QQXA 1NIFA 1MG2C 3NJKA 2I7OA 1NTDA 3H4HA 4JHVA 3ZDWA 2VW4A 2XXFA 2PP7A 1GS7A 2XV3A 4E9RA 1CYWA 3NJIA 4KO7A 3X1NA 1AOZA 1PMYA 3BQVA 7PCYA 5AZUA 1AR1B 3KW8A 4E9XA 3T6WA 1WS7A 2JFCA 2ZXWB 2QPEB 4YVUA 1ZPUA 1PZBA 1TU2A 3GYRA 3WI9A 4HAKA 2PPCA 3ASNB 2IDSA 4AKPA 4E9YA 4A66A 3WKQA 1AS8A 1J9SA 1NIDA 3T71A 4YSAA 1SFDA 2CUAA 1SNRA 3T6XA 3QPKA 5AKRA 2J56A 4GY4A 3V9EA 2B3IA 4JHUA 2I85A 1V54B 2PCFA 5I6MA 4A2DA 3TBBA 2AZUA 2MRYA 2YQBA 1MDAA 4P5RA 2Y1AA 4A67A 4FAAB 3HB3B 3MBWB 3NJHA 2BWIA 2BZ7A 1AS6A 1FWXA 1NIBA 1RKRA 2W88A 4HIPA 4YSEA 1VLXA 2HLEB 1GR7A 1AANA 5F7AA 2BP8B 3SBRA 4GP4B 2GB2A 3X1FA 2HX7A 4AZUA 3CVDA 4DP0X 1URIA 1KCBA 3H56A 2OJ1A 1E67A 3CDZB 4A2HA 3FQ2A 3WIAA 2PPFA 5AFAA 4KNSA 1KBWA 3IBOA 3AG3B 1NPJA 1JVLA 2VM3A 3AG1B 4HCIA 5I28A 5PAZA 3S3CB 1V10A 5FC9A 1A4CA 3GXUB 5E9NA 2BO0A 1JVOA 1NINA 3TA4D 4KNUA 4E9SA 2BW5A 3CVCA 4QKTA 1AZBA 1AZNA 3NP4A 1SF3A 2BZCA 2UX6A 4N8UA 5TK4A 2HX8A 3NSFA 5I6PA 3OD3A 3FYIB 2PPAA 1AIZA 1ETJA 1IC0A 2OV0A 4E9WA 5D4IA 2PP9A 3PAZA 1JXDA 1QHQA 4UANA 3EH5B 3UGEA 2GIMA 4A2GA 4F7KA 1N68A 3EH4B 1J5CA 2IWEA 4YSUA 1FFTB 4Q89A 3CG8A 3FSWA 4KO5A 1PLCA 2BHFA 1QLEB 2DV6A 5D4HA 4DP2X 2XUWA 4G7RB 4YSTA 1ADWA 2HRHA 2YARA 4ENZA 3C75A 3ZIYA 1J9QA 1L9RA 3BVDB 1IBYA 3NP3A 2R7EB 4KO9A 2DYRB 3IEAA 1HFUA 1ASQA 3EF4A 3JT2A 1ZV2A 1OCRB 3NSDA 2XU9A 1CURA 2YAFA 3ABMB 1KBVA 1X9UA 3DTUB 1ILSA 3OMIB 4F2FA 4BWUA 1RZPA 4HCGA 1SDDA 1WA1X 5B1AB 5B7FA 1BXAA 4ZK8A 1E65A 1MZZA 5B7MA 4KOBA 2HX9A 2FTAA 2P80A 3WNJA 1JZHA 3X1GA 1ZDSA 4HALA 2LLNA 1NWOA 4HCFA 2DYSB 1M57B 1ET5A 1XMEB 3AG2B 2TSBA 1PCSA 3CZUB 1TEGA 2XV2A 1SF5A 3QJVB 6PCYA 4DP8X 5B1JC 4DPAX 4DP4X 3FU9A 4TXVB 2HRGA 7PAZA 5LDUA 1RZQA 2E86A 1PNCA 4FA7B 3SBQA 2AVFA 5EHFA 1T5KA 4AKQA 3PAUA 1CC3A 1ZIBA 3PAVA 2ZONA 1WS8A 3UAEA 1ASOA 1NPNA 3FQYA 3JTBA 4PCYA 2J5WA 2ZOOA 1L9QA 3ABGA 4BXSV 2VN3A 1W8EA 2IDQA 3EH3B 2BP0A 5D4JA 3QJSB 2GSMB 1PZCA 1IUZA 3NSYA 1JZGA 1AS7A 1ASPA 1SHWA 1JOIA 2FNWA 2UXFA 1NICA 3AW5A 2FWLB 1B3IA 3AG4B 4G70B 3GDCA 2YAMA 2JXMA 4YSOA 1GW0A 4AI7A 1SFHA 2QDWA 4YVNA 1BXVA 3PXLA 1QNIA 1GY2A 1OE1A 3NJFA 4WTQA 2J55A 3QJQB 5IY5B 2PP8A 1L9PA 1N70A 1HAUA
chains in the Genus database with same CATH superfamily
2QVIA 3LEXA 4GSDL 2J2ZB 4GI9A 2RAMA 1JGUL 4KH9A 1EAQA 1OGPA 3MNWB 2X53A 2OM5A 2YS4A 2RACA 5EU6D 3QFJD 2WKOF 1S7RA 5LWYL 4OQTH 3QC6X 4AL8C 3D87B 3OL2A 1M2OA 1S5IH 4KRMB 3QORA 4L1TA 1UXMA 3U9UA 4XCEB 3WJMB 3CHXA 3RVTD 4JN1L 5FHAL 2XWXA 3WELA 1U42A 2ZKMX 3QUMB 4Y2LA 1I1CA 1J5DA 2FQGA 2H32A 3E6FA 4LKXA 3HAEB 5EUOF 2PYEA 5IF0B 1EEYA 3D3VD 4IRZL 2J5LC 4NRXA 3WXWL 3NH7L 2CRIA 3GXTA 3GI8H 2NY0B 3HCVA 3MTRA 3NN8A 3QFJE 5EU6E 4WI2A 3US1A 2ZUSA 1G6RA 4JDZA 3IDJB 3FHEA 4I0PD 2Z0BA 2F68X 2HYMA 4JDTH 1FZJB 4G8GB 3D4GA 1WIUA 5KVGH 4XMKH 1SBSL 1XIWA 4P48A 5JIHA 1OKEA 4O2FA 5B38G 1WBYB 1MHHA 2M26A 1LE9A 3GIZL 4FYRA 2XVLA 4J27A 3MBWA 3RUGB 3FT3B 2KH2B 3PQYB 3D3VE 4Y5XC 4F91B 1F4AA 1EJOL 2WQAA 4A6YB 3WBDA 5DDHB 1MF2H 1JN6A 4FG0A 4NQDE 3HPLA 3HZYA 1DVFB 5DR5L 5EFIA 4EJ1C 3W57A 4O51A 4X6EA 3GJFH 4J23A 2GC4C 3CDZA 5LJYH 3L6FA 4RWYL 1E4WH 2MOQA 4HUWA 3OLEA 3PQYD 3KGTA 4K9JA 4PGDB 3RL2A 4UQDA 2DQUL 2CWRA 3V6FB 5DC2A 1PJWA 5FUCC 4ODUA 2F5AH 1R5IA 3QT2A 3RWGB 1XF5B 3VXMD 3ARGA 3MRMB 4ZOEA 3GMMA 4MJ6A 3IKCA 4YK4B 1IBZA 3HMXA 4TVSa 3DTXB 4XMWA 1DQIA 5IEHA 4A1RA 5DRNA 1KBPA 2A9DA 3LV3A 4MZRA 5D7JC 2WSPA 4DQOL 1VF5C 5IGXH 4LDLB 5CEZD 3VD0A 2DWEA 2ZE0A 4QXGL 4W1TA 1JHTA 1T2QH 4KK9D 3GSNL 3CSYA 4GP8B 3WJLC 3VG9C 1Z9NA 2AV7A 4NQXB 2PXYB 2JIXB 3HFMH 4W9GC 3WAJA 4YGAB 4DTGL 3VXME 5HDQL 4H88L 2AJ3B 3PHQB 4Y5VC 1C1EL 3MFGB 3KPSD 4WFGD 1H15B 3ECVA 3L3KB 3MZGB 1XTMA 1QASA 4X2UA 3ARFD 3CXDL 4LVNC 3L5JA 3MX0B 4PJEE 5AALA 4NI3A 4UM8A 1IC5L 3K8MA 2PXYD 2C9AA 5CEZE 2VABB 4GG8A 5D1XC 3BAKA 4L3EB 2D7QA 4B3EA 1E5CA 2WCSA 4YX2H 3FBKA 1SJXA 3RZCB 3WUWA 3QUZC 4ETQB 2AXHA 5CU9A 1J8HD 2Q7NA 5E2UL 5IBTH 1NGWA 4W93A 3KPSE 4WFGE 3RFRA 1TJIH 4WNSA 4ZFGH 1VDGA 1N0XH 2FJFB 3NYKA 2FJHA 3MV8B 2QADC 5SX4I 3P4MB 3GZOA 3ULVD 3GSOA 3HRZB 3GZPA 5D55A 3X1BA 4YSSA 8CGTA 1QBBA 5FX3A 3BPCA 3B83A 4BRVA 4YDKH 4GG6E 4TV3A 1R5WA 4IGBD 4EZJA 3EYVB 1MUJA 4NJ9H 4HC1L 4W9HC 3BW9A 2HFGH 1J8HE 2WO3B 3CN0A 4FG2A 4N2AA 4TSCL 3RA7L 1MJJA 3VMNA 1PZAA 3V6ZA 2WYTA 4G6KL 2IJ0C 3FT1A 4TVPL 3SE9H 3TU6A 1I9RL 1VZHA 3VSUA 5C0BA 3ALWA 3FB8B 3IRCA 3M1BB 3QH3A 2EIJB 3ULVE 3KYKL 2AEPH 1A3RL 5I2IB 4UCFA 4XCNA 1KJVB 2NXZB 3CBKB 4BFRA 2DAVA 3IDNA 2Q86B 1SYVB 3P4NA 4XH2A 2NX5B 1JRHI 2VZOA 1QPKA 3QFDA 1SHXA 4UIKH 3KWUA 3SDDD 1RP8A 3IJEB 1YDPB 2YBGA 4IMKA 4XNXH 4DP7X 1V3LA 1IAKB 1G7HB 1YPZB 5E51A 4N5ED 2DQFB 2V9QA 1NCWH 4PJGE 2VR5A 4E42B 1BM7A 4P3CL 2MH4A 3D4CA 4NO3B 3V7MA 3MCYA 3N55A 4NNYA 5EC2A 1SVBA 5KYUB 2Y4SA 1JD9A 2EVGA 5I0DA 2JWYA 3GUTB 2XG5B 4AM0B 5KVEE 3OSVA 3CLEH 2W91A 4D94A 1BMZA 4K9EC 2EKJA 1QD0A 1KCRL 4JR9L 4YIQA 3FQUA 4WV1B 4IKIA 4Q6IB 2Y6SD 1XH0A 1DQTA 1KDJA 1QSED 2VXQH 2JKXA 1U2CA 2RA1A 1YECL 4N6RB 4RMTA 1LEKA 5GQBA 2ARJB 1F18A 1XR8B 1YYLL 2F7RA 1PU0A 1N4XL 3V4VB 2FHCA 5BV7B 3GDBA 3ERXA 2CXKA 2Q87A 1MJUH 5CD3B 2AXFA 5IBUG 4ZMXA 4RISL 5IESH 4D9RD 2NRDA 2JE8A 2QVKA 1XCTB 3ARSA 3IRZA 3PDOA 3K91A 2DM4A 5IR1B 4B0MM 1M6OA 2MPAL 1SOXA 3OB8A 1NAMA 1E4JA 2JJWA 4I3GA 3ZK0A 3HC0A 4RBPK 1OAJA 1CIDA 3QUYC 1QSEE 4XVUC 4KO7A 1WDAA 5AZUA 4IOIA 3RJOA 5I73B 1QAWA 1UJTA 5JW3L 4MJIA 2BSRA 2WW8A 5SWZD 5KSVA 4D9RE 4GAAA 1IVLA 2WANA 2H0JA 4NAMA 4NEHB 4CBZA 1IEBA 1OZUA 2GJZB 1S78C 4S1QH 1RIVH 3TYGL 1NIDA 1UADC 2RIKA 4JY6B 2CUAA 4H2CA 1F58L 1A1MA 3DX8B 3IYLW 3BP7B 4FI8A 4A2DA 2PWGA 3V5KA 5JA9A 4MB1A 3RI5F 5E23A 5F1SA 1P2CB 5SWZE 1EJ8A 4N8VA 4PWIA 3KPMA 4BD4A 3H0TA 5E6ZA 3LH9A 2HVKA 4PH8A 4UQCA 4HKXB 2V5TA 3L4VA 2LAGB 1AS6A 4PREB 4XE0A 5BOJA 4LSUH 3EKCA 5F9JB 4XVJH 5J56B 4L8SA 2NY6B 4XNUH 1ZCRA 2HX7A 1D2OA 1URIA 1ZT4A 3Q8AA 3IMBA 3FUNA 3LPGA 2OSWA 3TESA 4FCAA 3EYFB 3IDIA 3L4CA 4ZFFB 3FQ2A 1MWAB 4HUKB 2WZPD 3DK0A 5B8CB 3L7FB 3N5AA 4PI2A 5BZXA 3VD4A 2VM3A 1MW2A 3ECBA 3QIBC 2YA0A 5KOVC 4N20A 4PTUB 4E2OA 3M17A 2HRPH 3OWEA 5BMFH 2F1EA 1NINA 1UJ3B 1BA9A 4KXBA 4U1HA 1H3VA 2C3GA 3CVCA 1G7QB 1B0RA 3HE6C 5G2NA 3BQUB 2FR4A 2HX8A 1MLCA 2RCSH 3U2IA 3RUGF 3MLPA 5ACZB 4PLOB 4YC2B 1MDTA 1WBZA 1XZ0B 2RQEA 5CJ8A 5CLXA 5B4MC 1SMOA 5D4IA 3G5VA 2G60L 2AVGA 2G3MA 5EU4A 2NXYC 5F72S 4IRSB 3TVMC 2NTFA 1MVFA 2KLRA 3PAZA 2IQ9H 1BIIB 2BX5A 2JKSA 2B59A 3JWOL 4J4PD 1TZHB 5DJ8A 4JM2B 4IDJL 3IS1X 5ITBL 1KBGL 4NQED 4KXAA 4D8PA 1W9XA 2LVEA 3BSHA 2BRRL 3BN9D 1K8IA 4R3SA 5H94A 4LDCA 4KO5A 1AR1C 3GTVA 2HH0H 1I3RA 1C5DA 1FYHB 2M2DA 2GBUA 2XJKA 1CZ8L 4NZ8A 3T0ED 2XN2A 1SDAB 4GNKB 1K2DB 1QKZH 2ICCA 2YMXH 3NFPA 4JM2D 4ODSL 3C75A 4KVNL 5IVXA 1LJMA 4CVXB 4PWJA 4XPGL 2F19L 2WYZA 3ARBB 1A0QL 4NQEE 2CDFB 1H5BA 3EFDL 4HCRL 2OMVB 5J9PB 3O4LE 3BUYA 5DHYB 4RGMC 2YD5A 2A4ZA 2G2PA 3QIUC 4X6DE 5JHDB 1EHLH 4NNPL 2GSIB 2OQJB 4Y5YC 2O61A 4LSRL 2JJSA 3T0EE 5JHLA 1TZAA 4O02B 4LSSL 1KSRA 2YRBA 5CP3H 2WMPB 4AYDC 5KTEL 1KCVL 1SM3L 5B7MA 2P8MA 5I1DB 2CRYA 5EOCL 4XOEA 3OPZL 2P80A 2XRAL 1LO3H 3N42B 2RD0A 5F1IB 4EBQL 1MFUA 3UROR 2ATAA 3RWCB 3F84A 4HCFA 4GAJL 1JDAA 4HLZG 2OR9H 3EGSA 4HG4K 3A23A 5DEFA 3D9AL 3D06A 4KTEL 1E6JH 3BD4A 4U1KB 2BS8A 5DHMC 5CGTA 4HUVA 4MMZC 1YEKH 1LXMA 4TXVB 1N8ZB 4LT7A 1JWMA 5GRJL 1NUNB 1T5KA 3ZO9A 3PAVA 2J8UA 4XN5A 2CMRH 1JGEB 5I0WA 4R8WH 1BW8A 1W72H 4I0KA 3VWJC 1NPNA 5FYKH 1IC4H 2W9EL 3FQYA 2VDPB 4KKBC 4BUHA 4NP4H 3VXSA 3BPOC 1GAFL 4MD0B 4PRPD 4K94H 3V6OC 5JDSB 1CFTB 3QUXA 2CHDA 2MCG1 1X5XA 4KZ0A 2HA1A 2YPLA 1C5CH 1ORQB 5EB9A 1HU8A 1UXWA 2OTWB 2ATKB 3GS4A 4YDLC 1N5YL 2NY1D 4M6MH 5CSZA 5D1ZB 3EJUA 5KANI 4YSOA 3FU0A 4LHQB 4KKPA 5B21A 3NIGE 2CO6B 1U3HD 1T89A 4WTQA 1CICB 2I9LA 1L6PA 2YD4A 2JI1A 3GJFA 4ODXA 4PRPE 1WE5A 3H9ZA 3MU3A 3KCPB 1DBBH 2XWBB 3G5ZB 5HHVL 2PYFA 5DYOB 4KY1H 1ZRUA 4H8WC 3ZSSA 5DQ9B 2ED6A 3DJZA 2BERA 1UEMA 3U0PA 4JFPB 4DPCX 5E2JA 1YPZF 3V8CA 2LQRA 3FT2A 4NENA 4H5SA 2Z93A 4DUVA 1D9KB 2HKFH 3D33A 5GS1C 4HP5A 1RZKH 2VM9A 4M1GL 5CJQL 2IOMA 4F24A 1XB3A 1OTUD 2F1AA 1N26A 4YSRA 2WNXA 1Z66A 5CCHE 2VR9A 1V05A 4LMQI 1QSFA 1LP9E 4G43B 1JK9B 1IKOP 2NSQA 2XIBA 3PWUB 3PWJA 2BSED 1A9VA 4QHMA 4WI0A 2DM7A 1ZHNA 3QDMA 4WI9A 3K8KA 4XN8A 5L4MA 1N6VA 3TYFB 1MEXL 4LQ1A 1EAPB 4GUPA 4AMXA 4Y9FA 5BZDB 1PD6A 2GK0A 4NN5B 5C0CB 4NB7A 5H35A 2X4TA 3LHPL 1MRDH 5GS0L 1Z32X 5E6IC 1VEPA 3FS9A 4FA8A 4GO9A 2P49B 2YXVA 5HGGS 4GYBA 5C08D 5TPWH 5LQBL 2K6ZA 5J5EA 3VTTA 1TZGH 2Y3NA 4EUPG 1IAII 1AZUA 4WY7H 1FYTB 4ZTPH 5C0CD 1N7MH 2VW6A 3RIKA 1IE5A 3IJHB 4Z95H 1H8SA 1AQ8A 3G6JB 3UYPB 3T2OA 5HVFB 4Z0XB 4WO4A 3K72A 5I19H 2BVEA 3BZFB 3PIQA 4FXGA 1XH2A 2VQ4A 3IMWA 1BEXA 2AF2A 4MB4A 3GM0A 5EBWB 5C08E 5KSAC 3M07A 1XGPB 1VGKA 2W0LA 3GXNA 4Z7UB 1INEH 5HY9A 2J57A 2FHBA 2Y7NA 4LEXH 4TRPL 2ED9A 2HG5B 1F6AB 2UYLB 5C0CE 3VXNB 1NLDL 3X14A 5HPMB 1IKNC 5ADOH 3MN8A 4YZFF 2FAUA 1Q72L 4HJGA 5KAQF 4KVCL 4EOWH 4MKMA 5AZEL 1QZNA 4HX1B 4NP9A 4UTAL 2V2TA 4PUBL 1MAMH 5I1KH 4OLVL 4TQEH 3SE4C 1OXYA 4YDIH 3EJQA 2ESVA 3JV0A 4UAOB 3ATFA 5C0NC 4IBTA 2V7NA 2XN9A 3TLRA 1FLRH 4ZD3H 3G6JE 4NKIH 4QIRA 1RURH 1THCA 5DJ2B 4LVOC 4X5XA 1S8DB 3BP4A 4KPHH 4G6MH 3QZPA 3Q8CA 1WHPA 2JKNA 4OZ4A 4XOBA 1DQDH 2CR3A 3N1PC 4EI5B 2EH8L 1P5VB 1NBYA 5LXGH 1PF3A 3B5GA 4MJJA 3WTVA 2ZX7A 4P2QB 5LN8A 4MSWA 1O6SA 3LZOA 1YMMD 2DI8A 1V5JA 4NO0A 1OAYH 5ERWA 4WGKA 2PCYA 3LVEA 3FQ1A 1ZLSH 4ZMWA 5KYYA 3P4OA 4K07A 5D2NB 4OZIA 4P2OB 1L9OA 1C16B 1IFHL 1T7WA 2IEPA 3V0VA 1GZHC 4AX3A 3HLAA 1MCLA 2BC4A 2NY5C 4K7PL 1A6VL 1UWXH 3UO8B 4ZXBC 2IPKB 3LRKA 1P6WA 3L2NA 2VXQA 1OTTD 5B8CA 1YMME 3D85B 3FZUD 1HH9A 2X42A 2F08A 1EZSA 2EXYC 4EN3C 5K9OB 5DMJB 1QPXA 1UATA 1KF9B 3A4FA 3CVHH 2QQKL 4JM2F 3TO4A 2I25N 3I6KA 3MRRB 2NPLX 4G1MB 4G7VL 2W0FA 4DGIH 4EVNA 3EDEA 1DLFH 3NJNA 4X9FA 4WKXA 2NCMA 1XMWA 2OMYA 2FT8A 1AJ7H 4GB9A 4XVSL 5SWQA 1JZ4A 4PJAB 5K39B 4XC1L 4WSKA 5EZIL 3CFQA 4AEHL 2E27H 4NDMB 2G3XA 4Z3TA 4UTBA 1QRKA 5AKVA 4H0IA 5I18L 3FCGA 4BK5C 2F7OA 4JHAH 5F9WB 4JL2A 4FQQB 1IT9H 4R9HA 4PS3A 4X8JA 2QT6A 3FU7B 1U8IA 3P11H 4YAQB 5DYFA 2FJSA 2K7PA 5DK0A 4DT2A 5D93B 2IAAC 3CPLA 4RA0C 3TCTA 3UTSE 4DN4L 5LG6A 4XO3A 3Q8EA 3Q13A 3QRLA 4AL8H 2C8NA 1DP0A 2BP0B 3N42F 3AROA 1E9QA 3UEQA 3D0AA 3I02A 2UX7A 3GEWB 2OMZA 1A64A 3PFQA 1JV2A 4PJAE 4YDVB 5E6SB 4Y1TA 3S3DB 3VNZA 4DO4A 3IPFA 6TAAA 4JFYB 4NUGL 4L1LA 1R34A 4S1DC 2WHVA 1T7ZA 4GXVL 1R0AL 5DVPA 2HJKB 3FRUB 2ZG2A 2EICA 2A9MH 2D9CA 2IBBA 3SDCB 4PS4H 4JG1L 4MCMA 4DGWC 3NESA 3NPSB 1KY7A 1NIEA 3MLSL 4NO2A 1P9MA 4NQCD 5A6IA 4LRNL 2OKMA 3Q44A 1NGZA 2WIIA 4ZFZB 1AHWC 4NT6A 2X70A 4PJCB 3TTSA 1KJMB 2FYYB 3S7GA 3D52A 2DQ6A 2Y06H 2ZAHA 2AITA 3SDCD 1OSZA 3ARPA 2IAMA 4KTGA 1TYRA 3M86A 1KPUA 3KW8A 2F74B 3P0YH 2NYYC 3WTTA 1HZHL 2H2PC 3QA3B 3SCMB 3UBXG 3S96B 4IOFC 5K9JL 3FRPG 1H6FA 2HLAA 2GUYA 3D0LA 2NZIA 3IE4A 3BGFC 5JPMA 4YGVA 5L6YL 1S9WB 3MUY1 4NQCE 1NC2A 2PPCA 2Y7MA 2Z8RA 3NZ8B 2ZAIA 3ASNB 2XKSA 4XP5L 5EBLB 5J6GA 1IGTA 5L4IA 5KUMA 4N2HA 1NFDA 3MOQA 1AS8A 3FQXB 4OUUA 3SJVB 6FABH 1X5YA 3F62A 1U4EA 3IDMB 4U6XA 5AOLA 4NQQA 4NI6A 4AIEA 3SCMD 3WY4A 4Y4HA 1HQRB 2P24A 4JY5L 4N0UE 1EAJA 1I7ZA 1T22B 1CFNB 4NRYB 3OSKA 4GW1B 1S7SB 4DN3H 1D7FA 4P23A 4A2MA 4H8QA 3BC9A 3N85H 4QO1B 3WXVL 1ZANH 1SOKA 5IW1A 1N5AA 3HB3B 5T1LD 3MXVL 3GBML 2NW3B 1RKRA 4DJMA 1P4LB 2F7QA 1KIPA 1ETZA 3TM6A 3BHBA 1Z9PA 3VXUD 3KWWB 2ZPKL 1Y7VA 4ADIA 1ZT7A 1M71B 3H2QA 2GB2A 2ZCKH 4PJBA 2G30A 3H85A 4R4FH 5JHBA 4MXVE 1MIMH 3BZEB 4CDGC 1P84J 3RDTB 3T4AB 1M3IA 2ICWA 2PPFA 3AQZA 4IEFA 1AO7A 4KJYB 3IFLH 4WEUD 3NOIA 4A7SA 4M7KH 5BO0D 1KPVA 3QJZA 5KJRH 2CLRB 1TFHA 2OZ4H 1UYWH 5FC9A 4BCZA 5IVZB 3VXUE 2O72A 3O8XC 2AJZA 4FQPA 1XBDA 4YHNB 4PP1D 5TDOA 2MCPL 1NOFA 3U1PA 3AFLA 1KTDA 3C87A 3RDTD 4PVNA 2QHRL 4X9BA 3QPXL 5CD5D 2ZOWA 3BGAA 5DHEA 4FFVD 1KJ2L 4R2GD 3PHAA 1HN1A 2DQJH 2AEQH 1QTSA 2EYRB 1JGVL 2FBOJ 3DOIA 4RIRA 3LNFA 5D9SB 1YNTB 1AD9B 5HVGB 4OY9A 2VLRD 3UGEA 5ID0B 4UOQA 2VQ1A 1TLKA 3ZE2E 1BVOA 1N68A 4QTFA 3G6JF 4PM1A 4FYSA 4EIUA 1J48A 4EI6B 4K5OA 1CL7H 4R5XA 1DBJL 1W72A 4YPGB 5D6CA 1ZHLB 2G3ZA 5K9QI 2KKQA 4PJDE 3QVAA 3STZA 4OIIL 1IGML 3GXIA 4ODHL 2IH3A 1OIOA 3G9VA 3MCLL 5E08H 4OJCA 4LVHC 2IQAB 5J06A 1QPPA 4Z7UF 4YWGH 1I3GL 2VLRE 1RJZA 4TUJA 1BLNA 4F8QA 4R0LC 2WVTA 2ZSVA 4DESA 2EIDA 3L4YA 5CCKL 1IM3B 5E0FA 4AQ1B 5CBAB 3TIDA 3WS3A 3BJ91 1OM3H 5JLZA 1JPTH 3HR5B 2VDQB 4XPHL 2XU9A 3MOBL 5DMKB 2AEIT 2WWOA 1OK0A 5AL8A 4BWUA 1C5BL 1OT1A 3OHMB 4MB3A 5B1AB 3CU1A 4L23A 2EO7A 2ZF8A 4AXWA 3L5WB 3IJ7A 1OOAA 4NUMA 4MNHA 4DZ8B 4UINH 4O5LH 3O3AB 5FB8A 4RAVB 1D6EA 1FLTX 3CLFH 1QEWA 2R0WH 5C09B 1X5IA 1W0WB 1M57B 3DIFA 2TSBA 5DVLA 5F97E 1AZZC 5AVZB 5ABDE 3JWDL 1HCYA 2FWOB 4K9EH 2WQRA 4MNQA 5B1JC 3RY5A 1UEYA 4FNQA 2Z9TA 4LASH 4Z7VB 1TR7A 3RTQA 3EFFA 4LKCB 5I0VA 1RUKL 2AVFA 5E8OB 4XB3A 2Y7SA 4BSJA 1HEJC 2IAND 4XMUA 4Q97A 4ZQKB 4HHAA 3IPEA 2Y7LA 4OLZL 1NC4D 1LO5B 3BVNB 2NQCA 3N41B 2E7LA 3KLQA 4CW1B 4P59L 5C0EB 1AP2B 1CT8B 3MNZB 5GJTH 4QRSA 4FTVB 4FZEH 1SEQL 2AI0H 1H9DA 2VN4A 2JELH 1NICA 3HZKA 4U1MB 3FQTB 4GAGL 1HVXA 5E2VH 2IANE 1U8CB 2L8AA 4NKOB 3CH1A 3ZYOA 5FK9B 1UH3A 1U33A 3KPRA 4WF7A 2ZCZA 1BXVA 4PJAF 3V4UL 1F90L 1TYEB 3O2WH 1S9YB 5JO5B 4DCQB 2CLZA 2XZAH 2N7BA 3IMTA 2XQYK 3IU3A 4NBXB 3W5NA 3IGFA 1KBBA 4HGKC 5AZ2L 5I8EA 4LCIL 3DMMB 1UOWA 3UZEA 3K5RA 1BAFL 2F53D 5GGSB 3QCTL 1FL6A 4EIBA 1TQCB 5FECB 2FATL 2VLLA 1LVEA 2PTTB 2TSAA 4PJHB 4FQLH 4MAYB 1W6LA 4XB8A 4LLQA 3KR3H 4Q0XL 2K78A 1UM6L 1GMIA 5FYLH 1TETL 1XGUA 1LM8V 4HQQL 2YOAA 2OL3L 1HTYA 4TYUA 1FSKC 4IJ3B 1O7DE 2OSLA 1BYPA 4TQHA 3RAJL 1M56B 1EERB 2F53E 4FKHA 2OYPA 1WLHA 4OCSH 4K7FB 3HE7B 5D7IB 2UUDK 2FQFA 1A7PH 3IXTA 2HCZX 5C86A 2IG2H 3FN0L 5FHBL 2NR6C 4QTHA 2EIKB 2D7TH 4M5YL 5MEQB 3RIFK 4V2CB 4PJ9D 3VDAA 2QQNH 1T03H 5INCA 3RB7A 3NSCA 4TNWK 2HFEA 4N8CH 4PLJC 1A6AB 1KCUH 1QFPA 3WSQH 5KSUB 1E28A 4UILH 4HPOH 2K6WA 2AQ2A 4AYFA 2DL2A 4PJHE 4ELKA 3C6LD 4JFEA 1OAZH 1YQVH 2PCFB 4UV7L 4MMYA 4JO5A 4F2MA 3O2DL 4L37B 5H4ZA 3TZVC 5DJ6B 3A0OA 3KH3A 4PJCF 4GKLA 2FGZA 1ND0B 5D2LA 4XMPL 2XWCA 1PLGH 1OB1A 3V10A 1T4KA 3L3OB 2VLKD 1E3FA 3QI9B 3CFCH 3UPRA 3WN6A 2O6FA 3WN5C 2KC0A 3ELQA 3ME0A 1KFAH 2CKBA 3GB7A 4KZEH 4LU5L 4HUCA 4G8AC 5I0YA 1QBAA 3M6DA 3N06B 5ILTH 5A1AA 1K5NA 2FRGP 2V3DA 4PG9B 1MHEA 5LNEA 3K0YA 5TH2A 3CVHA 3C5JA 2VE6B 5LNDA 4ZS7H 1BVZA 4B9ZA 2XFGB 1J0JA 5I74B 4J39A 3SOBL 2VLKE 3MUJA 3QIWD 2PTVA 3QP3A 1A6ZA 4ONHA 1CDUA 3RIAK 5DHVB 5G4NA 3RVTC 3DPBA 5F7KC 1XXDC 4PJ5A 4Y16A 2QVMA 3MGAA 4G9FA 2BXYA 1FPTH 4PRIA 4Z3EA 1V27A 4G83A 4GAFB 2D2OA 2J4WH 1TVBA 1GIGH 1T04B 3ZL2A 4OFPA 1JV5B 2AJXL 1RJYB 4L05A 5FA3A 3BLKA 4LKXB 5SX4H 2PYEB 4I0PC 1RULL 1NZRA 4M7JH 5DJAB 1Q9LA 4NRXB 1F5WA 3DUSB 1BVNT 1AIFA 3D0VA 3IMUA 1T5XB 2VUYA 2E3VA 2O1AA 2DQCL 4FFYA 4JDZB 4PJDF 5A7EA 1F56A 4PV8A 2BSTA 4GW4A 3LN4A 2NY0C 4PW4A 3U9WA 3ULUD 3QWOA 2DTMH 2X10A 4MFHA 3LY6A 1KPRA 2YJLA 4GKZA 3UJIH 1RZ7L 1G7PB 5T1JA 4KRPB 3EO1A 2YK1L 4KAQH 2IC2A 2AJYH 2NSXA 3SE3A 4DZBB 3NA4A 4HGWB 1I7TB 5E5UB 1P4UA 5FGCE 4EO5A 5KUKA 1G9MC 3BVUA 3RPIB 5F7DA 4GUCA 1SY6L 4YHYB 1N8OE 2Q3ZA 4W6YB 2JH2A 4RETB 2Q7AA 3RYMA 2P5PA 3CMGA 2OW7A 3ULUE 4C4BA 4OKVA 5I16A 2FX9H 4HUWB 3SE6A 1DVFC 1JRHH 3P2BA 2C7FA 3PJSA 3U0TB 1TYJA 3RL2B 4GMSH 3KPPB 3MLUL 2ZJSH 4ODUB 5FDWB 3MC0A 4DP5X 1E5YA 1JBJA 4NOFA 3IETB 4G6FB 1VHPA 4LCYB 1P7QD 3EFOB 1HQ4A 4JUTA 1XVSA 5DQJA 2JKJA 3CFKA 3NG5A 4MJ6B 1FG2B 5ANMA 5CINH 1JFQL 1FG9C 1ZA3B 4KK9C 5DC9B 3GMQA 1FNAA 2WUCL 1QBLL 2Y5QA 5HJ3B 1CFQA 3JWNC 4M56A 3CU7A 4YK4C 3U9PH 4JLRA 1MZYA 5TJWK 1HAWA 3O3DA 3VD3A 2B2XH 1KDIA 5BRZB 3GIVA 4DETA 1OAUL 5CLYA 3MZTA 3NQIA 4QI3A 4RGOH 4ONFL 5KW9L 3QZLA 4E0RA 4H8WH 5EF2A 5AYUL 4XAWL 3F01A 2BOBB 3QQ9D 2PXYC 1R4XA 3ZR5A 2MTPA 3DVNA 4NQVA 1YYMH 3BO8A 4GQRA 2EVFA 3QG7H 5EDSA 1BV8A 4P4RA 1NEUA 1MIEL 3UBFA 4P2RA 4Y89A 4CMHB 1BD2B 3FOMA 3HZMA 3WLWC 4I4WA 2JK5B 5HD8D 1NGQH 1PEWA 1KGYE 3DYMA 2J73A 3BUBA 4HZLA 4FNTA 2IFFL 4UB0H 4HF5H 4XO9A 4PLNC 1KWGA 1Q9OA 4JZOA 2C1PA 4Z7VF 4E36A 2K4AA 5DT1L 3Q05A 5GGRA 4GQ9H 4Y5VA 3TV3H 4TL5A 1BD2D 3C2AH 5KS9B 4NKMA 4YDZA 2YD6A 4N1EA 3SE8H 2EYTB 1NIFA 2BY3A 2PWDA 3BPCB 2JJVA 2BIPA 5I1LA 4HJJL 4M6NL 1JDCA 2IV8A 5EWIL 3KGSA 1TSRA 3L7EA 2OZ4A 4JRYA 3HRZC 5D1XA 3T65B 1AQKH 3VH8G 3N41F 5GGQH 3BW9B 4TS6A 1MCJA 4N0CC 1QR1A 2CPCA 4LOFA 4RMWA 2R4SL 3LRLA 3QUZA 4IBUA 1SXSA 1KEMH 4J6IA 2FECL 5KJ7E 2KL6A 4AVHA 1KTBA 2OMWB 1R75A 2AJVL 1ORSA 4TLKA 3ZPDA 1HWWA 4OD2A 1RI8A 2QSQA 3FH8A 4MGXA 4KX7A 3BSZH 3P0VH 4M29A 1MFCL 2BFVH 4Z1PA 1T7YA 1CR9H 2BNRD 3IFNL 1S7UA 3QDAA 4WI8A 4X7EC 4XCNB 4XHQA 3OJMB 3NACH 3KPOB 2DF3A 4UT7H 1X5HA 3ZKXC 3FU6A 4RRPG 4ZFOL 3P4NB 2R39A 3CGTA 3SZ6A 4XH2B 5LAPA 3FQNB 2NXZC 4M48L 2Y23A 3MCKB 4XBEL 1LO2H 3MLWH 4R7DA 1MXDA 4PJHF 1T80A 4A67A 1U2YA 3S9DB 1U58A 2WAHA 4BZ1L 3NJHA 2BNRE 1FWXA 3KDMA 3SKJL 1A66A 5KBDA 2Z8SA 1AANA 1VACA 3GF8A 4FG6D 1JWSA 4PRNA 5F7AA 1WV7T 4NNYB 3P9MA 4H8PA 2HTKD 5D1ZI 5TFSL 2Q6WA 3BMWA 4FMKA 1WZAA 2Y6SC 4YHLH 5CEXB 1WFMA 2OJ1A 3F5WB 1XQ4A 2JVUA 5INDA 1KLGA 3D08A 2I69A 3W0WD 5D7IF 2F0CA 4YIQB 3ZDZB 4WENB 1BDYA 4BK8A 2GG1A 4HOMA 1F2XK 1BJ1H 1FVDB 1V10A 4QRAA 2TRYA 2VH5L 5E1GA 1U8NA 2FX8L 5F71A 1XGTA 5IQ9A 4WV1C 4Q6IC 5IHUH 4ZMNA 1W0VA 5JW4Q 1S9VA 5DHXB 1KXQE 1ZVYA 1XCQB 2H26A 2X4NA 5T3ZD 1TZOA 3C8KA 5B3JF 3FYIB 3PDOB 3K4ZA 5BV7C 3W0WE 1M6OB 3HNVH 4E9WA 1NAMB 4ZMPA 4F9PA 3O3BA 2AEWA 1WCQA 3X12A 1IQDA 2C4XA 1LGVA 2NY5H 3LH8A 4BH8B 1RHHB 1XF4B 5IT2L 4KX8A 4AIXA 2X4SA 2YD9A 3N40F 4AM0Q 4TLUA 2W07A 3BD3A 2VCOA 3LQAL 4QMEA 3TA3A 4F7MA 4MJIB 1T7VA 1LEGB 1JPFA 1Z5YD 2BSRB 4MJHA 4Z18A 2DPKA 3CG8A 3MRHA 5TQ2L 5T3ZE 3L1EA 4CSTA 1AE6H 3DOSB 5KBNC 2K1MA 2WGNB 2BHFA 5I73C 4BA8A 1BX2A 4OFYA 3F12A 4HWEL 2XBTA 5EN3A 3MRQA 5D4HA 2ARJQ 4KZDH 2VDRL 3Q0HA 2VWEC 5F93C 4X7TB 4MXWH 1EV2E 5LBSH 4ENZA 1GOGA 1A1MB 1U92B 5J6SA 1PSKH 3QXDA 1IBYA 4XVTL 4RBPH 4ZI8A 3FUFA 1QA9A 3QUYA 3U79A 3QR1A 1HXKA 4TTDD 3OKDA 1MNUH 3SDYL 3QO1A 3VCLB 1SYSB 4MQXC 1WT5C 4N8VB 1QLFA 3K71B 3H0TB 3OKNB 3CZGA 1KBVA 3CVIL 1X9UA 4V33A 3V6BR 1CQYA 5JOFA 1JD7A 3K2IA 4EQ2A 1BXAA 4U6HB 3IGUA 3T04D 1GGCH 4KMQA 1J88A 1DVUA 1CF8L 3ATDA 3B9DA 2HAZA 1UHVA 3FU5A 1ZDSA 3FFDB 3NEXA 1OP5K 2NY6C 3CD4A 3IDIB 2VMFA 5T33L 1VCBC 1ET5A 5D1QD 3DPDA 5IBUB 1ZGLM 1KGUA 3B8YA 6PCYA 1SOSA 1TJHL 3M17B 2BDNL 4TNVF 3L3GA 4DPAX 4MAUH 4NZRH 4PGBA 4U1HB 1UD6A 3DLQR 3TIEA 5ES4B 3WGUB 1QO3A 2H0PA 1MLCB 1A7NL 1UJ3C 5EU5B 3DHJA 3ML8A 5MP6L 3RWEB 4X80L 4B9FA 1WBZB 4FHBD 3WL9B 5HYJB 3MUZ1 3NCMA 4Y2DD 3Q01A 3G5VB 1BAGA 4R84A 5D1QE 1L4IA 1ZV5A 3BQUC 4R83A 3T77B 3VU1A 2E7DA 3ZE0E 1JF1B 3TCLA 2NTFB 3MHZA 2ZWKA 3OAYK 4YC2C 1S3KH 2GY5A 1E4XL 3QQDA 4Z7WE 5ACMA 4P2AA 4U1IB 3QIBA 5IB1A 5D72H 5GISL 4LLAA 5TF0A 2FNWA 4IRSC 4F93B 4D8PB 3ZKSD 5LB1A 1K8IB 1QYGL 4R3SB 1T83C 5JQHC 1HINL 1OLLA 5HYJD 4OI7A 3MBED 3DGGA 3MNMA 4JM2C 1C5DB 3H55A 3PWVB 1F4WH 2DQHH 3HE6A 1E27A 5IQNA 4LLMA 1E3ZA 1OK8A 4KC3B 1Q0YL 1WF5A 3G5YA 4OCWH 2DQTL 3GHPA 3T8XA 3THMH 5IVXB 4C47A 3KXFB 5GRVL 4I0CC 3PWLB 4F57H 1HAUA 2VDLH 1M7DA 3LDBB 1NBVH 2Z7YA 3MUGB 3TVMA 1OVZA 4MQ7A 4A63A 2XFXA 1H0DA 4RLDA 3ZHLA 5C0AA 3RGVD 4HWBL 5HYJE 4DOHE 1FAKT 4JPQA 1N6QH 4ZX6A 1F8TH 2C9SA 3ARBC 4YHKL 1PZUB 1KIUA 3QEQD 5E03A 4C56A 1Q90A 2JJTA 1KCWA 2X09A 3L54A 5CJOL 3LH2H 4PB9L 4AGMA 2VDOH 1NEPA 2P8MB 4K3DL 3LB6D 4WWPA 3ZO0A 4NZTH 1ZAGA 3F58L 3IU4H 3B9KD 2DD8L 4DNLA 3S3SA 2J72A 4WEBL 5LCVL 1LWJA 3N0AA 3MACL 3B7TA 1TTGA 1FP5A 3EGSB 3QJUB 1YC8A 3A47A 2UZXA 4HT1L 3CBRA 5PCYA 3QEQE 4HKBA 4XBPA 2B4CL 2XKUA 5T1DL 5DEZA 3V5HA 1IAIH 3QIUA 2VAAB 2AJSH 4QPEA 4Y5YA 1K8DB 5A16B 1RSYA 1X7QA 2RB8A 5FUOH 3GBEA 4Q2ZA 2FJUB 4GQPH 1VRSA 1QTYT 2CRMA 5HGBB 1AAJA 2M1KA 3BT0A 5KS9F 4RAHA 2O6DA 3VAEA 1AGFA 5KBPA 1HCZA 1KWKA 1HESA 1CBJA 1HXYB 2E75C 5CGBA 1FNEA 5GGTL 5I23A 4CILA 4JFFA 1EHKB 2PTUA 4AIZA 4Y0GA 3JV5A 3VXSB 1MFDL 4UYQA 4YFDB 4M8QB 2WKGA 5AOMA 4DFIA 2FO1A 1PCXA 4OCYH 5F96L 1SQMA 1UXWB 4R7LA 5BZZA 3EOBA 5CCGE 4W9ZA 4MMZA 4MTMA 2XA8H 5CSZB 5LBGA 3WKNA 2D0HA 3C5ZB 4BSWB 1CO1A 1XWVA 2CD0A 1ID5I 1KTKE 1XB6A 1IARB 1BREA 2WO2B 3LN5A 3MO1A 5D1ZC 2I9LB 3H1ZA 3VWJA 4WTZG 1CE6A 2GY7B 4ODXB 1CFVH 1JTOA 3NZHH 4GSQA 2ZX5A 3A6CL 3BLBA 4HKZA 4CU6A 3V6OA 1Q1JL 1I7RA 3C5ZD 4Y1AA 1EAOA 3KWVA 3OV6A 3P9WB 2CKNA 3EOYG 4EDWL 1DQMH 4YHML 2LGNA 1AKJB 1JUFA 1QFOA 4MZIA 1OTUC 4YSCA 1YEEH 4NENB 4O9HH 5FDYA 5I1HH 4U3SA 3LKSA 5IREA 4M6AA 2YWZA 2W38A 2JQMA 5IOKA 3MJ8A 3NFNA 1J0HA 1KJ3L 1OF2A 1KTLA 3B9AA 4XNQA 2V33A 3VFVB 2YPVA 1D9KC 3AY4A 5GS0D 5EIIG 2XKNB 4LL4A 2IDUA 1QSFB 1AKJD 2DIEA 3MA7A 5ISZB 2NUPB 3BP5B 3ZDZF 4XWGH 1MQ8A 1YNLH 5HHOD 2XWDA 3ETBJ 3BVXA 2R7EA 3PWPA 1SXCA 1FGNL 1ZHNB 3CAFA 3QDMB 5I8OH 3NTCL 3KW7A 2RALA 5TTRA 5AVYB 1KUMA 4CSZA 1I1FA 1A5FH 5GS1A 4U6YA 4K73A 1I9JL 4GIOA 3F7RA 1L9TA 1WA0X 4BKLB 4ESKA 4HSAC 2MTAA 1XB8A 2CHXA 4NN5C 2JKRM 1TQBB 1KYOJ 2DDQL 3LTVA 4HBCH 5HHOE 1NCBL 4NJAL 4F3FB 1OCZB 1DUYA 1DVQA 2XZCH 3IFPA 3S88H 2Q5BA 3QZBA 2DY2A 1DE4A 1URZA 4XGZB 5IMLA 5KVFH 1AGDB 2AK1H 1U8HB 2GT9B 1ZTXH 1ZS8B 1J1XL 1SDDB 1YEFH 2Z1PA 1BQKA 4A2FA 3EDDA 4JRFA 3OQRA 4QLWA 1MRFH 2BNQA 3K72B 1CLCA 4NUQA 3IS0X 2F18A 1FO0H 3IBEA 2JB6A 3CFNA 3MV9A 3WG7B 3H42H 4P57B 1OANA 5E6IA 3FB5A 1ONQB 4K8RL 5FYJU 1YY8A 3HHMA 4CRPA 4JG5A 1GA2A 3HOGA 1UB6B 5L9DL 2WJ7A 2NQ3A 3K80A 3P3YA 4BSVA 3IVKA 1F3DJ 3UX9B 5DF0A 2CDEB 4I1PA 3BSZA 3GZKA 3ATBA 4FX5A 4YDJA 5CILH 5IOPA 3S37L 5KN5A 2V2TB 3JBG7 3BVVA 4OCNC 3FULA 1Z5LA 1CLYL 4NWTL 5D7SH 3RGBA 2FZ3B 1U30A 2XN0A 3CZEA 2XN9B 5KSAA 3LKQA 1INQB 1UCBH 1T6WA 2V8MA 4DF9A 2X4OA 2UZIL 5F7WC 3T2NL 3DKHA 3F04A 4Z7WF 4X5XB 2FJGA 1JG9A 4UAOC 4BIKA 2VYRE 3H54A 4HHWA 4LLYA 2DQGL 3OR6A 1KB5H 3HI6L 1AY1L 1TPXB 3VI3A 2O5ZL 1IKNA 2DQEH 4NC0B 3KMDA 3W9DB 1WAPA 5E9DD 3PLYA 4A04A 3V0HA 4EI5C 2DRUA 1UURA 1T0NB 3B1UA 2L7QA 1LEIA 5I5JA 1E2VA 3EOTH 4NO0B 1FAIH 3AXHA 3SE4A 4LQFL 4YXHL 5KYYB 5IIEA 4EUPB 2IOIA 4YDMA 4Z76B 2AQPA 1OTTC 3HLAB 2GJPA 4RX4A 3HI5L 5D2NC 1WICA 1B0WA 3MUHL 1FFNB 1CU4L 3NJKA 2H7WA 4P2OC 4JHVA 4M8UA 4H26A 4H25B 5E94A 1DEDA 4OJFL 1OGAB 1II4E 2WLNA 5E9DE 2NDGA 2YZ8A 4NQUA 4Z3FA 4NPKA 4HS6A 5DU7A 2WXJA 3D48R 4FXLA 4OZFH 5E7FA 5AOJA 1I31A 4X4YA 3F7YA 1MFBL 1XGYL 3LJ3A 1WWAX 1LDPL 3I6KB 3GI9H 3O2VL 4N9GB 1MHCB 2ZCLH 2MKWA 5HGDA 4YVUA 4LEOA 4PB0H 3T1FB 1OGAD 5SWQB 2FEJA 3AADB 1FZKB 4KY2A 5FA4B 4E9YA 1GZHA 3PAYA 3RWJA 1G9HA 3VXRB 4FRWA 3VX0A 5KSBE 3D25B 1IGIH 3H6AA 4AE0A 2EUVA 1UGKA 2J56A 4ZYKB 4ZXBA 4JK0D 4UZSA 1HDMA 5IB5A 3Q9QA 4OQTL 4JHUA 5FYJL 4DEPB 5F0JB 5FEBA 1S5IL 2ENPA 5I75C 3BP6B 3DVGB 5IM7B 3K6SA 4JFDA 3EO0B 4UT6L 3OKKB 4JFOA 5F9WC 2WUBL 4F5CE 3TWYA 2ZUUA 4XVOA 1OD9A 4W9DC 5LBSA 1M42A 3ILDA 4P9HC 1RIUL 1YA5A 2V9TA 3GI8L 4WFED 2W60B 4F7EA 1SXBA 4LDOB 1IVTA 5D93C 3LRSA 2OXHB 3DETC 4JDTL 1E67A 1E9QB 4BEIA 3QDGA 2OMZB 5KVGL 4FQXD 4XMKL 3PXJA 3WIAA 4BK5A 4KNSA 1G94A 3H9SB 5I8CB 2CK0H 4L4TD 3MXWH 4TPRH 1YSOA 4PJIB 4H0GA 4HCIA 1MFEH 3S3CB 2PO6D 5C3TA 3QUMH 3K4DA 5LGJA 1J0KA 2YFOA 3M88A 3WNMA 4WFEE 4C54A 4KNUA 3HAEH 4KJWC 3T3PE 5FGRA 3QBTB 1DO6A 3CTTA 5DUMH 3ZRSA 4CADA 5TK4A 2NZ9D 2HJLA 2OP4H 4GAYA 3DRQB 4YXKH 3VYOA 5EUKB 1U91B 1T6BX 2A74B 1JI2A 3BDXA 3LXUX 2J6EH 3CUPA 3SDCC 5IKCA 4L4TE 5DEGA 2X70B 5EC1A 4B53A 4NGHH 3NPSC 4HMCA 3VD5A 1G9MH 2F5AL 3VNYA 4MA7H 3ZHFA 4UT9L 5C6PB 3N43B 1QSVA 2R27A 3LKRB 3OKOA 4LLVB 4WW1B 4YSUA 4RFNB 3TXAA 4A6YH 3DX7B 3EHBD 1LMKA 1N59B 1GZQB 3FTXA 1QBMH 1TOXA 4QOKA 5A3ID 5IGXL 5J6GB 2COQA 1IGTB 4HA1A 3SCMC 4Q9RH 4X5RA 3U6XA 3DX6A 2UY7B 2YARA 3Q2NA 2E8ZA 4U6XB 2R23A 3ZMNA 1AHWA 5LGYA 2D31B 3HPJB 4HH8A 2VLJA 3NP3A 4PJXE 2DYRB 1FFOB 4A38A 5CFHA 3U36B 3X3GH 1I7ZB 4P49A 4UOW1 5D5ME 5ENWA 2LABA 4P23B 5EORL 1WWWX 1MFMA 1XGQA 1D5XB 3WE6A 5MERA 3GKWH 1N5AB 1J12A 3JWNH 4M1DH 2GHWB 2H6OA 3OMIB 4P5MA 1KJ2B 2CRZA 1KIPB 4ZG1A 4HCGA 5AVSB 5BVPH 1YEIL 3R4DA 4GKSA 1ZT7B 4KMTH 5C71A 1XEDA 3B2VL 1U93B 3S36H 1BOYA 3HB3C 4ENED 2HX9A 4CC1A 4GRWB 4PJBB 4NHCL 1P4IH 2VZTA 2FNBA 3X1GA 1PVHA 2V5SA 4I1RA 2LLNA 3B3IA 4LSQL 1O9WA 4KKAC 4ZFGL 4ZMTA 2GFBA 3G5XB 4PJ8D 4PJFA 3CZUB 3SEPA 4TVUA 1C8PA 1KPVB 1ZY9A 3QJVB 3O9WD 2WXQA 5DC0A 3RDTC 3T4AC 4S11A 4B96A 1DCEA 4XBGA 1UT9A 1TTCA 1ZXQA 3MQIA 5TDOB 4D0CA 4EDXB 4O4YH 1KTDB 2WKOA 4NJ9L 1F0LA 4E41A 2ATPA 2DYPB 1L6XA 2P44B 4LLWB 4F8NA 1WS8A 1DSWA 4DK6A 3UAEA 2GBVA 5J57B 1M4KA 1BZ9A 4RIRB 1TCRB 5IHLB 3FRPB 3HC2A 2VC2L 3SE9L 5IW3A 2Y0SA 2GJ6B 1GJIA 2ZOKA 1AR2A 3FW6A 5KVDE 3C08H 2RHEA 5EUOA 2VQ1B 5EF3A 2AEPL 3KG5A 5D7LD 2DWDA 2OCJA 5JMOC 2UWEB 2FCBA 3O8XA 2OMUB 4YR6B 2CR6A 3O6LH 1JGDA 4Z23A 3L1GA 5GS3A 1IM9B 3STZB 4MJ5A 4UIKL 5I1CH 1VFUA 4MNGB 4RRPM 1JZ5A 3DURA 4XP4H 3B7UX 4ES9A 2VR8A 4XNXL 2IIJA 1FVEB 3ZTNH 3AGVA 4TUJB 3VRLE 1U8JA 3EBAA 3JVGC 3V0WH 1OSPH 2FLMA 2O5YH 5T1KB 3TN0B 3G5WA 5D7LE 3APMA 4ILDA 4LBEB 2Q3XA 1V3JA 2YEQA 4PGEA 3TIDB 1PZ3A 3KPQB 4AVIA 4KDWA 4JO2L 3I84A 2AGJL 3G6AB 1E4HA 3FSVA 2BW4A 2KZBA 3GMLA 3GSRB 2AK4D 2HN7B 3IWUA 4PRHD 3UAJD 2XX0A 4AEIH 3CLEL 4MDJA 4AQ1C 1KMGA 1A6UL 3QRGH 3BX7C 3HC3H 2X6VA 1KCLA 1DN2A 2X87A 4FQCL 3RPKA 1AZRA 4X4MA 1UD2A 3TN0D 4AXWB 2FE0A 2OTUB 1OD7A 1QFWI 2VXQL 4NIKB 4L1DA 2BSCA 1QEWB 3HHSA 4JO1L 3EJTA 4DIXA 2A99A 3NJMA 4R0LA 1IX2A 2AQRA 4GEJA 4KI5D 3DIFB 2G5BA 3HZVA 4HEPG 1B6UA 2YEZB 5IZ7A 1USZA 3K4AA 3L08A 2AK4E 3OF6A 2MPVA 1A4JA 1TU2B 3PU7A 4N0YL 4PRHE 2WVVA 5IESL 2HPTA 2YLHA 3BAYA 4GOSA 3G9AB 4IRJB 3CXHJ 4K71B 1ED3A 1H3GA 2CUHA 3RTQB 1T66C 5DWUL 2B16A 1HKFA 3P30H 4S1SH 4N25A 1RZJH 1MCOH 4LCUB 2MHAA 3S6CA 5AOKA 3KYOB 4KI5E 4Q14A 1SJMA 5DSCB 5JMRA 2ENSA 4WKZA 1LK3L 2AFNA 4BFOA 5GZOD 4NRZB 1M9WA 5AW6B 1T1WB 3B2UD 3V4VH 5BV7H 3K2MC 1U8QA 4OGQC 3ZVVA 5AAPA 1NLBH 5M94B 1A4KA 3UTQA 4OLXH 2GVYA 4S1QL 4AQOA 5B1JA 1MY7A 5B1KA 3SBPA 3VFMA 1AXTH 2VSCA 3K2UH 4JDEB 1FFPB 1JXFA 3FBQA 2QGCA 3KPRB 5EZJB 4APQD 4HPHA 5LKNA 3KYNA 2H1PH 5A2CA 1IGFL 3E3QE 3TJHD 2ZKHH 4HUUA 4YNYB 1IQWH 1DQLH 2OMNA 3VVWA 4NPYA 2HG0A 3IU3B 1M2VB 3AZUA 5DRWA 1XSIA 3B3BA 2R56L 2AXJA 2VN6A 3OHXB 4BXVA 1HYSD 4JQVC 1WUZA 1JZDC 1HHJA 4LSUL 3QJRB 4XVJL 3IN2A 2VLLB 4Z7NB 1FO0A 3DMMC 5ICYA 1ITCA 3BXNA 1PKQE 3TT1H 5FO8A 1R9FA 4LLQB 3NSXA 4NZFA 4F7PA 3MRNA 3WFCL 4FLRA 1TQCC 3VWKD 4N86A 3DSNA 4H8UA 4ZTEA 1XGUB 3R18A 3W2DH 4MAYC 4DKFL 5DJYA 4JX0A 3MRLA 1YYCA 3LZPA 3QDHA 2FO4A 1UB5B 1F41A 4I77H 4P46A 2QLYA 3U30B 2HRPL 5JPNB 4MDRA 4IJ3C 2XLLA 3CX5K 3SQRA 1NBZB 3IXTB 3B9EA 3DK2A 4FP8H 5FOJA 4Y8DC 1L0QA 5DD6B 5F7LB 5FYKU 3D1MC 1L5GA 1UVQB 2RCSL 2ZWNA 3ASOB 5BZWB 2AQNA 3HE7C 4PJIF 4ADJA 4G8EA 1FVCA 4UM9A 3NJJA 1N2RA 3QNFA 3ZQXA 2RFXA 4Q9QL 4NS0A 1BOGA 4YE0A 5FV1L 5HI4C 2I9TA 1MWAH 2IQ9L 4PJXF 3TNNA 5TE4H 2UVFA 5GSRA 3FONA 2CGZA 4ELKB 1KB5A 2WLMA 1Z2KA 5FIEA 4Z7QE 2MQ0A 3LPWA 3K5SA 4NZJA 4P5KB 3RVWD 1TEFA 1J05A 1GH7A 4P5TD 2WC7A 2X4QB 1JZEA 2VDKL 1A4AA 2UUDH 3B2DC 2IWFA 1S9KC 3B43A 2OMBA 2HH0L 3SKNA 5DS8A 3SB3A 2KDGA 3EG9B 4HIHB 5MI0B 2EILB 2NR6A 1OB1B 4J3OF 3QDJD 3S3PA 1S9XB 1QKZL 2Y2YA 4YS4A 2AXWA 3N43F 4PEEA 5J89A 4FFZH 4JQIA 4N2LA 2BHYA 2CO4A 2CKBB 3ME0B 3FTVA 4P05A 3L3OC 4PBDA 3QI9C 1SJEB 2R4RH 1K5NB 3C60B 5A2IH 2PR4H 2W1NA 2O4EA 1A25A 4ELME 3L1OL 1EHLL 5TH2B 1VSCA 3ENEA 3UERA 2EC9U 2WTRB 3I3DA 4BELD 4FNLH 3QDJE 3HG1B 4N6QA 4X4KA 4FABH 4FS0A 2EH7L 1AZVA 4G6AC 3RWIA 1DVXA 5CZXD 4MBOA 4ONHB 4R4BA 2F58L 4U1GB 5EIQA 5JXEC 1BVLB 1SN2A 2RTTA 4Y16B 2ZUYA 2A1WH 4IU2A 3WN5A 5C0RH 4U33A 4PRIB 3HS0B 3LS5L 5EO0A 1N3NA 4F27A 5B39A 4O00A 3WKPA 5IB4B 3VSTA 1TVBB 5GRXG 3OG4B 4G1EB 1DCLA 5FA3B 1AVAA 1S7WA 4PJBF 3UIZA 3N6YA 1TTAA 4AKOA 1G5GA 2UXVA 4XPBH 2BIMA 1QUPA 5EU6A 1UKSA 4O02H 4ZTOL 5HI3D 3HN3A 5F8RC 2NY4B 2DH3A 2FEEL 2CMRL 2J2ZA 5JW4R 4BQBA 3LZQA 1XBRA 3QS3A 1OAXH 1IC4L 4N2DA 3MNWA 5ABZA 3QWOB 2E5EA 2WBKA 2VR7A 4HXAH 2AKRB 3B6SB 4PWHA 2FT6A 4WK0B 3KLKA 2G0LA 2IWKA 2FGWH 3EO1B 5AW9B 5TQ0H 1F1DA 2BFGA 1C5CL 5F88B 4N2BA 4WDIA 2F8VA 1DQJB 1I3VA 4XCEA 3WJMA 2LE9A 1NMAL 3FO9B 5FOBB 4R7VA 4KRPC 4V1DB 4I0PA 2PETA 2J5LB 4M6ML 1XDTT 3CZKA 3QUMA 2XWJB 3UZVA 3HAEA 5CNHA 4Y19D 5IF0A 3DI3B 4YHYC 5I16B 2SODB 2MNUA 3FCTB 1NL0H 2UWEF 2X0VA 2ZXWB 1UXLA 3GTTA 4XPFL 2R1YB 2VDPH 3I6GA 4R26L 2DJSA 4TUKH 1YEJH 3IDJA 3REVB 2J6EA 4HAKA 5JOPD 1FZJA 1OSYA 1Z3GH 2LU5A 4G8GA 2H2SD 2DQDH 3DBXA 4KY1L 4QHPA 4YSAA 1HQ4B 4OCRH 5DQJB 5I1EL 4ZUWB 3ARXA 5ANMB 3RUGA 4HAFA 2E9IA 4UQ2B 3RFZB 3GMQB 1V54B 2J44A 2VQUA 3PQYA 1LO4H 4Y19E 1PAMA 2BSDA 4HS8H 4QXTA 5IB3B 3V0AC 1RZKL 4WHCA 4XOAA 2R9HD 1DVFA 4A7GF 4DGVH 5L8LB 3O3DB 3QQ9C 4L5FH 3VXMA 3GIVB 3LVTA 3SOTA 5JOPE 1EZVY 4ZT1A 1JNNH 3K7UA 1BXXA 4IKJA 3FCUB 3BYTA 1FC2D 4PGDA 3TWCH 3VRIB 3V6FA 4NQVB 5HD8C 2V17L 4XPAH 1S7TA 4JHWH 2NY3D 3LQZB 3RWGA 3S34H 3HW7A 2WVUA 5E4OA 1JPSL 2XIIA 3DTXA 1RY7B 3X17A 1BHGA 5I28A 1Y0LB 3WMQA 1HS6A 4CMHC 4B60A 4DGYH 1FUNA 4NYLB 1TXKA 3ARFA 2A6KB 1CXFA 4B7LA 2UVEA 5GGRB 4OBSA 3EGXA 4LSDA 4QKTA 4KK6C 4ZFOB 1X5KA 4ZNEE 4NQXA 2PXYA 1T0PB 2JIXA 4WY7L 2EUXA 4ZTPL 1SRDA 1UT2A 1EGJL 4GG6A 2AJ3A 3PHQA 5EO1A 5I1LB 3F00A 4AGPA 2QKIA 3U83A 3KEHA 4IKLA 2ISDA 5HBBA 1JAEA 5AW8B 4L48A 1QHOA 4K0OA 3MX0A 2PKDA 2G4EA 1J1OL 4Z9KB 2VOTA 3JYCA 1E5AA 1KGIA 2VABA 4NHUB 2JI3A 4D3CH 2QTVA 3W56A 1CLOH 4LEXL 1G0XA 4WUKH 3ROLB 2VUKA 3LCYA 4S0TD 1S7UB 5ADOL 4MXQC 4EOWL 4S2SB 1Q8MA 3EDJA 3QQ3B 5C0GA 3RNQB 3OAZH 3P4MA 4TQEL 5CIPB 3HRZA 4AY0A 1A7QL 4NN6C 2X40A 1TJXA 4P8QA 1FE8H 1E2ZA 4POZD 3PGFH 4Z7NF 3UCQA 4AJ0A 1ZV2A 4NKIL 1RURL 3EYVA 4PJGA 2IBZX 5GHWL 4WWKD 3FCBA 1U58B 4G6ML 1JHKL 3I50H 2H8PA 3KDMB 4MLIA 5LXGL 1MN4A 2MJWA 4NNXB 4QRPB 1JWSB 1GKEA 1QATA 2AAVA 1E9PB 3P9MB 4AYSA 1P4BL 4YFEA 1I1YB 4QHNB 1G84A 4HLJA 3EJZD 4Y4FB 3M1BA 5E4AA 1S7XA 3RU8H 2IO5A 5INDB 2QVFB 3BIAX 5I2IA 1BEYH 1KLGB 1M7IA 5CWSB 1KJVA 3P2DA 3FTYA 3EH1A 1SF5A 4D0BB 4Z6AT 2A0LD 5IJCC 3WYRA 3DX3A 2A4EA 3C9NB 2F8XC 3S5YA 4Y4FD 4MCZB 1W0VB 2HRGA 3IJEA 5CU5A 3SYQA 1S9VB 2EVJA 1JJUA 3N50A 2H26B 3QORD 2QELA 2ZXQA 1IAKA 1TZIB 1YPZA 4AUYA 4EI0A 3C8KB 3PV6A 1JWUB 4E42A 2BCKB 1IC7H 2APVA 4XC3H 4NO3A 5GRUH 4DGIL 1DJZA 1DLFL 3ABGA 4DEUA 3O3BB 5KYUA 1FDLH 1L7TH 1W8EA 5KVEL 3CXFA 3H8NA 4YBLB 4AM0A 3INUH 2X4SB 4K15A 3B34A 4PFEA 4LEEA 2W07B 1U8OB 3TA3B 3LNEA 1MJ7H 3QXAB 1JPFB 4PCTA 4WV1A 4Q6IA 4MWFA 4PU2A 3MR9B 2Y7QB 1XIWD 5I1IL 2QDWA 4N6RA 4OW6A 4HPYH 1CGTA 2ARJA 3PREA 4ZUSB 5IHHA 1DL7L 2X0WA 3V4VA 4Q9CA 2PP8A 4TTDC 1RIHH 4Z0BH 3FXIC 1DJIA 5CD3A 4OGZA 3RB5A 4JB9L 3QXDB 1UWEH 3WTSA 1XCTA 2DIBA 2AV1B 2MQ3A 3QUYB 2ADJB 5IR1A 5DZAA 3OKDB 4Y9BA 4UYPA 4DEWA 5CMAB 4DVBB 1PJ9A 2D7NA 2PW1A 2GI0A 2DMBA 5JOFB 2DM2A 2QFPA 5HGAB 5CEYB 1CJYA 2WBJB 2Z35B 3BUTA 2IXQB 1E6OH 3M45A 1LQSR 3ARGD 4ZS6C 4P9HH 1PD0A 1MQKL 3GRWH 4GSUA 1JF6A 2D0FA 3X2QB 2R0LL 1BYOA 4U2YA 3GXMA 3LIZH 3B5HA 2A9ML 3RWFA 4PS4L 1L9MA 2VERA 4XXCA 3HLKA 3DX8A 3VI4B 4E9TA 2CBOA 3L1FA 1WT5A 3L4XA 1WFJA 3BP7A 2W5PA 4U6TA 3GO1H 3ESNA 4X6FB 2DEWX 3ZT7A 4J6RH 4WGWB 2DEYX 3QS2A 1P2CA 1YUHA 3LMJL 3TIEB 5DQDH 3ECWA 2Y72A 2ZIDA 2Y06L 2G2RB 1RZFH 4HKXA 2WZPA 4PREA 1SUJA 2YD8A 4HFWA 3P0YL 1OP5H 2OJZL 1FNGB 2CM6A 1CTNA 2PPDA 5GRZA 3UO1H 2BY1A 3MLVL 1XR9B 3WDJA 4ZFFA 3EYFA 3G08B 3S35L 4WGVB 1MWAA 1AGEB 1CUOA 5AD0B 5J12B 3BAEL 4KQ0A 3L7FA 2XTJD 1I53A 2X6BA 3CZSA 3FO0L 4JFVA 4PTUA 3U82B 5CJXC 3HE6B 1E27B 1KLUA 1FL3B 3VI4E 1UJ3A 3G6DL 3OAUL 4UZGA 4DN3L 4R96B 4BINA 3LNGA 3N85L 3KWTA 2QKSA 3BQUA 2Q20A 1NIAA 1M7DB 3WFHA 5ACZA 1YQ2A 3BGMB 3OAYH 2NTSP 3V7AG 1H0DB 5H37H 5ESAB 1EO8H 2CBMA 1UA6H 4F8OA 1PZ2A 4IRSA 2XTJE 4BH7B 2EE0A 4JRXB 5ICXB 1BIIA 3T0EA 3H7BA 3NA9H 1E90A 1KIUB 4QF1B 1YLBB 3POHA 4R4FL 1MIML 4JM2A 2IOOA 5C0BD 2VXSH 4B5EA 3UYRH 3IFLL 1O6VA 2NQDA 2CO2A 3O0RH 5KJRL 1QI5A 2G3NA 3BKJH 5FCSH 2OZ4L 2Z0UA 4LPWA 4RQQA 4XP9L 4Z77B 3T2LA 3L48A 3MRKB 1B2WH 2YSSB 2HJFB 5LGHH 1K2DA 4HJ0D 1Y6KR 3MROB 5HDBB 4YHZL 1W8NA 4HKJB 4CVXA 4G42B 4UNUA 3RVUD 3V5HB 4XX1G 2CDFA 1CDIA 2VW7A 5C0BE 2OMVA 5J9PA 1HOEA 2DQJL 4YO0B 1X7QB 4UIMB 2YAOA 3UTTD 1HILB 1UA3A 2HKHL 2DMGA 2Z1KA 2IGFL 4A7TA 5EPMB 4O02A 2HPOA 3B2MA 2Z64C 3ARVA 4XTRC 5JNYA 2ICEC 1FNEB 2WMPA 2X2IA 3NK3A 3BI9X 4JFFB 5K59E 2J1YA 3GQFA 5GRYA 2KMWA 4KHTL 4UU9B 3LEVH 3T6ZA 1MG3C 1LE5A 3RWCA 5E08L 3BDYL 4YXLH 2Q2EB 5I15L 1NSNH 3MLYL 2YXWA 3UTTE 1Q0XL 4TM9A 2COVD 1PG7W 4W6XB 1UXSB 3FQRB 4U1KA 3TBWB 2DZEA 4AV0A 2E7MA 4PRPA 3HTLX 1OM3L 3C5ZC 2HT4D 3VQLA 1JPTL 2W65B 3DYOA 5FKPA 5AL0A 4XX5A 4BBWA 4IJTA 2OJEB 1W91A 4Y7OC 1ZDQA 1JGEA 3WFDL 1FA4A 3BPOB 4LOEA 1XGRB 1I7RB 4Y1AB 2Y9RT 3QCVH 1VJSA 1QRND 1BIHA 2A6DB 5IK3B 4MD0A 1ID2A 5JDSA 1JUFB 3QWRA 4ETYA 3CLFL 1ORQA 5HHPB 2R0WL 3LKSB 2ATKA 4B9CA 1E50A 5DC4B 2IPTH 1V8HA 2ADYA 2N4IA 1E4KC 5FGBC 1USQA 5E2WH 1IBBA 2QSVA 2E7HA 2P3YA 5FW7A 1V7NH 1XSJA 4QTIL 3AUWB 1MCRA 3E80A 4PJ7B 5HYQB 5IHBA 2TRHA 5A2AA 1LP9A 2VDQH 2FEDD 3APCA 4A2EA 2FX7H 2XG4A 2YWYA 4TULH 1UM4H 3BIKB 1QRNE 3ESMA 5BRQA 1SQ2N 5JTWA 2VUOA 2V5YA 3JQOB 3QEUB 3KCPA 1GYWA 3PWPB 2OS7A 2XWBA 4QHUA 4FGMA 3KS0H 4UZUA 3G5ZA 4NCC2 4OAWB 5CF3A 1XCXA 4O2CA 2Q10A 1I1FB 1F3JA 5DQ9A 5IFHL 4U6YB 1ERNA 1T4WA 4KROB 3FO1B 4YN3A 5GJTL 3KM2A 5DRXA 2XY1A 3AAZB 4FZEL 2YR3A 2OYLA 1D9KA 5D71H 2JELL 4L9LB 2BSEA 3ZDWA 2XXFA 3SQBB 1OW0C 2PP7A 2XWTB 4FI6A 4K8RD 4B3VA 2HTLD 1TQBC 3LXAA 4AZ8B 2EEAA 4G43A 4X5WB 2JFCA 1CIUA 4FFWD 2BNQB 1JK9A 4YHOH 1FCGA 3PWUA 1W8OA 4L4VD 1JTTA 1J87A 3GYRA 4KJPD 3N3EA 2JCCE 2JB6B 4JPVH 5TF1L 1V3MA 3TYFA 43C9B 1BMGA 4PIRF 5AB1A 4Z8FH 1EAPA 1T2XA 4A66A 4TLTA 1YY8B 2V5MA 5BZDA 3CFDB 5HDLA 3T6XA 5C0CA 3B1TA 3KR3L 3E7JA 5FO2A 4WEEA 4MJ4A 2F8OA 5FYLL 4BSVB 4XHJC 1WUNT 2VLMD 3CC5B 3UBXI 4YDJB 1RSFA 1HJCA 4D9QD 2JKLA 4L4VE 1ADQL 3S48A 5EIIB 5EIVA 2B3RA 4OCSL 1DJHA 1Z5LB 5GRWA 3G6JA 2VO5A 3UYPA 1A7PL 1KXVC 3SBRA 1BM3H 2F5BH 4Z0XA 3R06A 2WTPA 1KENH 3BZFA 3AQDA 4RMUA 4J8QA 4AZUA 3FO2A 2Q8BH 2FJGB 4R5VA 5DMIH 3AVEA 5CP7B 1X9QA 1MREH 1HX0A 1DSFH 4WFHD 4NUJB 5EBWA 4ZAKB 1T03L 3R1GL 4WIQA 3VI3B 4N8CL 3IBOA 4Z7UA 1KCUL 4D9QE 3WSQL 5E8DL 2EXWD 2OPCA 4YMPA 3NAAL 3VI4F 4OVUA 1F6AA 2UYLA 2BVYA 4QD2E 1OAZL 1YQVL 2BO0A 2VRAA 5HPMA 1F4YL 4OIFA 3V52L 1A47A 4N0FB 3TO2A 3U48A 4OZGE 5TE7H 2BOCB 3DJTA 4UWQB 1NJ9A 3EYSH 4WFHE 1IZJA 3NIFB 1PLGL 1FNFA 4K55A 4ZMLA 4OV6F 2HVJB 5EEZA 4PWFA 4ZSOE 2ZG1A 5E94B 4NPJA 5F89B 3PG2A 5DJ2A 3UIYA 1BZDA 1S8DA 4UANA 1FQ9C 1GCYA 2XBDA 1KEGL 4GSDH 3TBTA 3F7YB 4EI5A 4PWEA 4KZEL 1P5VA 2QR0B 3EUUA 1JGUH 5ILTL 4G82A 1SXZA 4P2QA 3FH7A 2BIIA 4ABQA 3OZKA 4QRTB 5F7FA 2X4UB 2BXZA 4IHBA 2D8KA 1PZ5A 2CHWA 4GXUN 4HXBH 5T5FA 3WJJC 4YSTA 1GOHA 1HKLL 1B6DA 3CFEB 4HJTA 4OGAC 2YXMA 4P2OA 5D2NA 1DR9A 3EZ8A 1C16A 4ZXBB 5FHAH 3S5LA 5IVNA 3U6RB 2Y3AA 2W0PA 4EIGB 2ORBL 1FPTL 1ASQA 2IPKA 3MREB 5A40E 4DEPC 2J4WL 3NH7H 2YPLD 1MCSA 4MB5A 2XQ0A 3D85A 2ZXEB 2IPUK 4Q6KA 4RFOL 1AGBA 1RUAH 3MKKA 2F1BA 3ZDXE 4M7JL 1HCFX 4QXUH 2J8UE 5T3XH 2YBRB 1P7HL 2C3WA 3MJ6A 4JKPL 2GAZB 1KC5H 3FNKA 2E6QA 2BSBA 1LD9A 4M93B 4PJAA 2R8SL 1I8IA 1UG9A 5DHVH 5K39A 5HDOA 3DBSA 1EJOH 3ASWA 4UDTA 5KVGE 2IMMA 2YPLE 2L04A 5HHMD 4H8HA 2GIXA 5HDBF 5DR5H 2A5UA 2AJYL 1JYWA 2E7CA 5TE6L 1Q0EA 4DP4X 2EDXA 1YN6B 4CADB 4WCYL 2X38A 5EHFA 2HJLB 2DLFH 3GRWA 3REWB 3LIZA 2VZ1A 2FX9L 3CUPB 1JRHL 5IKCB 5HHME 5DEGB 5EC1B 4AYEC 2FVNA 2UZPA 3DRTB 3MJ9L 3EH3B 2BP0A 2DJUA 3Q9PA 2ZJSL 2A74C 1HZKA 2EECA 4W70A 1T5WB 4LP4A 3WAKA 3CZJA 3AB0B 2ENQA 3L81A 5A3IC 3OKOB 4QXGH 3AG4B 4NQCA 3VDCA 3W37A 4J3OC 5AQ0A 1EJ6A 3VXOB 2MNJB 3BKMH 3ULSB 4DTGH 2HJKA 3FRUA 4RFNC 1DBKH 5HDQH 4W4OC 4WNQA 1C1EH 1NCTA 3DX6B 3SDCA 3IAPA 3O6ML 4B9YA 5A6LA 2B2XL 5HYFA 2ZYHA 4RGOL 1ESOA 3CXDH 4MVBC 1CMOA 3QJFA 1QFWH 3ES6B 3KHQA 2A9NH 4GW5B 3T3MB 5K9KA 4JPKH 5ENWB 4ZFZA 3U4BL 4FYTA 1TLMA 4PJCA 3FT0A 4LSPH 1J9RA 2PNDA 2BVPA 2FYYA 1XGQB 1UZ8A 2DWTA 4K3HA 1YYML 3KJ4B 4L3FA 5IJBC 3QG7L 3S35X 3ZMEA 4I2XB 2EKSB 3HMXH 4WO4D 4P23C 4GRLB 1MCHA 2F74A 4MAZA 3TF4A 5E99H 2VC2B 3D39B 2GKIA 3SCMA 1P6FA 4EAEA 2D3NA 4J1UA 1LNUB 3V0FA 5H37A 4PJ7F 3NZ8A 4H44C 4RGND 4TOYH 4HF5L 1IKFH 3T0XA 2OR8A 4IBZA 5EBLA 3B3IB 3DUHA 3OTTA 1ODAA 2GIYA 3D18B 4GQ9L 4KKZA 4GRMA 3IDMA 3TV3L 5DUPH 1DSYA 4G72B 3IM1A 4S1RL 3C2AL 4NM4L 5KZCD 2JCCF 2BVOB 3NDYE 3SE8L 5FO9B 1MCBA 4PPTA 2R0ZH 3MRFA 1CG9B 1BJ8A 1CFNA 4NRYA 4GW1A 2P42B 1DTUA 2XVKA 3FFCB 1ULVA 2ESVD 4G6KH 4QO1A 4TVPH 3EYUL 2ATPB 4RGNE 4H40A 2NW3A 3DO3A 1NUDA 4J28A 1P4LA 4FL4B 2W59A 4FF9A 3ZYZA 3KYKH 3KWWA 1WSST 1PNDA 4BDVA 1A3RH 4Z7IA 1M71A 3ZHKA 2ZWLT 4ZW6A 3GLDA 4KO6A 3Q1SL 4L0PB 4OF7A 3P0VL 3PGDB 1N18A 4XT1C 1YUKB 4OF3A 2OLDA 4OM1L 1AG6A 5CGYD 4ZW5A 3BZEA 3RDTA 3T4AA 3QJTB 4APXB 1YMHB 1LQBC 4KJYA 2LTQB 2ESVE 4G2AA 4UT7L 4XZUB 2DN7A 4FQJH 4PJDA 5L88L 3PDGA 2ZAGA 1PTZA 1NANI 2D3LA 4MJ5B 5IVZA 5I5IA 1CI3M 4ODTL 3SD5A 4YHNA 4P3CH 3QUHA 3P9LB 1WWBX 1RLWA 4RAUA 3LEYH 2WNKA 2QV4A 4OFKA 3UAJC 1I7UA 4OZGF 3JWDC 4JJHA 4L1HA 3E8UL 3NRFA 3IJYA 2ID5A 1KCRH 3ZJAA 3HKFA 1AD9A 1FH5L 4OTXH 4U1LB 3O4OB 1M1XB 1K4DA 1M9SA 4N68A 3TO4D 3TN0C 5ID0A 3B2XA 3O3EB 1TO4A 4HWUA 1LMIA 4PY8I 3TONA 3KJ6H 4ACPA 4MDJB 1UM5H 4LRIC 3Q2WA 2OI9B 2KUTA 4L8DB 1YYLH 5MENB 4K23H 5EF1A 1N4XH 4X6CB 2OYMA 4YPGA 2DS4A 2NY2B 3DSFH 4RISH 3F3HA 4OGXH 4F1ZA 4JFQB 5G5DB 3JVGA 1OCCB 2CJUL 3VI3F 5CO1A 5IBLD 2AANA 4JFUA 4JKLA 4IW4C 4N85A 3BZDA 1XAUA 2K0RA 3HNVL 4UV4L 4LHUG 4TQ8A 1KGCD 3IKKA 5CBAA 2MEJB 5I71B 4YE4H 5C97A 2GCYB 5K69A 3CFIC 1WZMA 1ET8A 4BGLA 3TTYA 4IRJC 4ICWA 2EIMB 3B2UC 4K71C 4Q9BA 2L4OA 2QPFA 3APFA 3RTQC 3NIFF 3VFGL 2V3FA 5C9JB 4S0HA 3PPSA 3TYGH 3L5WA 5D7EA 2XWZA 3GHEL 3DUUB 5A6MA 1OP3K 1OPGH 3O3AA 4XO8A 4JO3H 3PE9A 4RAVA 1OE2A 1A4KB 3QQNA 4APQC 5C09A 1KGCE 3BZ5A 2IANA 3VFMB 4W6WB 4MXWL 2XY2A 4PD4K 4PRAA 5LBSL 2I5YH 5GZNC 4XWOD 1NAMH 2D7OA 5C0FB 1TJGH 4FZ8L 4YSPA 1EMTL 3CFJB 2J1WA 3FN9A 1B90A 3DOHA 2KHAA 5F7HA 4Z7VA 1CK0L 3QEGL 1CQKA 1IGYB 4LAJH 4LKCA 2MMXA 4NPYB 4HJ1A 5J13C 5E8OA 4YQXL 4WU5A 3AY2A 1HNFA 4NCDA 4JGMA 1DJXA 3MRJB 4Q6YA 3H53A 2BLFA 1TFPA 5L4JA 4LAQL 5ICYB 3BXNB 3BVNA 3NK4A 2IAMD 3OHXC 4CN4A 1QLRB 5C0EA 1AP2A 5AB2A 3MNZA 4H13C 1GY1A 1T20A 2I32A 3DSNB 3D2UD 4M5ZL 4UNTA 3KZ8A 4U4BA 2YC1B 2VDKB 3EJYC 3FQTA 5DJYB 2ENJA 4DP1X 1NC2D 2CCWA 3VJ6A 3NFSH 1PIFA 4JREC 1U8CA 4NKOA 4R7NA 4P46B 3VU2A 4M03A 2ED7A 4YBQD 5DURB 3F2LA 4MAUL 3GHBH 4NZRL 5CUSL 1S9YA 5E95B 4DCQA 5JO5A 4G3YH 1UD8A 4XN2A 1TQTA 5FS5A 2Y1ZA 3U30C 3TFKD 1XGZA 2VSDA 5JPNC 3DMMA 1L5GB