4YSRA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 16.6 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
molecule keywords Nitrite reductase
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 96
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysrA00
3S3BB 2GB2A 2BP0B 5I5MA 1AOZA 1OCZB 3OM3B 1MG2C 3UAEA 2DWSA 1M56B 4DP0X 1SNRA 1GW0A 2TSBA 1J9RA 1M9WA 1JERA 2YXVA 3SBPA 2Y69B 2I7OA 1A8ZA 3PAZA 1KDJA 3ZIYA 1E5YA 1WAEA 3AG3B 1PZBA 1SFDA 1MDAA 1OE2A 3FQYA 1BQ5A 2CBPA 1SDDA 1ETJA 5AFAA 3BVDB 2BHFA 3SQRA 1KGYE 3QJQB 3X1NA 1NIBA 1JZGA 1DYZA 4PCYA 1FWXA 3FU7A 1XB8A 1URIA 1I53A 2GHZA 4AKPA 2X87A 1NIFA 3FT0A 4A66A 3ZX1A 1GS6X 1ET8A 4YSSA 1OF0A 3EF4A 1GSKA 4YSQA 4A2GA 1JZFA 3NJIA 7PCYA 3TASA 2YXWA 4BDVB 1AS6A 2DY2A 3ZBMA 5I5JA 2PP9A 2DYRB 3NP3A 1B3IA 1QNIA 5I28A 1BQRA 1XB6A 1QHQA 5B7FA 4DP5X 3MBWB 3NJHA 2MRYA 2Q9OA 3OD3A 3QJSB 4YSTA 2IDTA 3NT0A 2GI0A 1CC3A 3NJGA 3FYIB 5B1JC 2HX8A 2QPDB 2BP8B 5PAZA 2VSMB 2HXAA 1L9TA 2GBAA 1CURA 3TBBA 3C75A 1OE3A 1XMEB 1L9OA 4YSRA 3NSDA 3X1EA 1BXVA 3QJTB 2CJ3A 1SFHA 4HHGA 4WTQA 1NICA 4KOCA 1T5KA 1X9RA 2DV6A 1KV7A 1JZEA 2EINB 4HALA 3T6XA 4DP9X 3TA4D 1A4CA 1V54B 3S8FB 2EIJB 3ERXA 3WIAA 1GS7A 5I6NA 3WG7B 5D4HA 1ILUA 5B1JA 5B1BB 1HFUA 4E9SA 2FQEA 4DP7X 1ASPA 1W8EA 3CVBA 5D4JA 3UADA 2XX0A 2H3XC 3V9EA 2OCCB 1AS7A 3T9WA 4A67A 4AKQA 2VSKB 1L9PA 2IWEA 4GY4A 1OE1A 8PAZA 4KO5A 1HAWA 3ASOB 4RH4A 4G71B 1BYPA 2IWFA 1ASQA 4E9RA 5I5IA 4DPBX 6PAZA 1OCRB 1NPJA 3EH4B 4W1TA 4HCIA 1AAJA 4HIPA 3UGEA 4BWTA 2OJ1A 2E86A 3PCYA 2AFNA 3QQXA 1WS8A 1IBYA 3KW7A 4NB7A 1NWOA 3IN2A 2AZUA 2JXMA 3AG2B 5PCYA 3JT2A 3L45A 4M4RB 5I6KA 2PP8A 1AG6A 1ID2A 2IWKA 3H4HA 2BP8A 2PCFA 4X4KA 2P80A 1BYOA 1CYWA 2HX7A 4G7QB 2AANA 1TKWA 4FA7B 4K9JA 5I6MA 1JZIA 2CAKA 1DZ0A 1E67A 2JKWA 3EH5B 2MTAA 1A4BA 2VW7A 2XU9A 2NRDA 3AG4B 4JKNA 4N4YB 2UXFA 4UANA 1E30A 3ZDWA 4YSUA 3TU6A 2XX1A 1GYCA 1IBZA 2BW4A 5FC9A 1RKRA 1AZCA 3WNIA 1ILSA 1ADWA 2CALA 1AG0A 4EF3A 1NZRA 2XVBA 1JOIA 1JVOA 4GYBA 1PNCA 3DTUB 9PCYA 5LDUA 2WO2B 2R7EB 4NAJA 4YL4A 4YSPA 1EZLA 3T6ZA 3FSAA 1SJMA 2PPEA 5I6OA 1J5CA 1GY1A 2BWIA 3U25A 3AZUA 3S3DB 2VW4A 2A3TA 2FQGA 2FT6A 1FA4A 1L9SA 3NJFA 4P5RA 2ZWNA 2X88A 5AKRA 1AR1B 2Q5BA 4BXVA 2QDVA 2XV3A 4NERA 3FSWA 4AI7A 2VW6A 4E9XA 6PCYA 3N2JA 2XUWA 1J9SA 4W9ZA 4DP2X 3G5WA 5I6PA 4DP8X 1MG3C 3HEIB 3RYMA 4KNSA 4YSAA 1ASOA 4CSPA 1NIAA 2J56A 3QJVB 2OV0A 3EHBB 2WO3B 4YSDA 2UX6A 4KNUA 2VN3A 3CDZB 2YAMA 1AZBA 3EH3B 1PLAA 2YAFA 4E9VA 1RCYA 3GXUB 3KW8A 5D4IA 2CUAA 3FSVA 2BP0A 1ZPUA 5F7AA 4JHUA 2IH9A 1KBVA 1BXAA 1ZDQA 2PCYA 1PZAA 2YAQA 1FFTB 3OMNB 4DP1X 5B1AB 4GP8B 2XLLA 4A2DA 1PAZA 1SF3A 1NTDA 4YSCA 4E9QA 1KCWA 2H47C 2BO0A 1BQKA 1MZYA 5B7MA 2QPEB 2IDQA 2ZOOA 1A3ZA 2R7EA 3NJJA 2YAPA 1F56A 4N8UA 3PAVA 2FT7A 4HAKA 4F2EA 4ENZA 3FU8A 4UAHA 2GC7C 4HCFA 2PPAA 1V10A 4A68A 4DPCX 3X1BA 3WNJA 4DP6X 5ANHA 4KO9A 1UATA 3NJNA 2EILB 1PLBA 1SDDB 2VMJA 1JXFA 2QT6A 3UAAA 4BDVA 4QKTA 1J9TA 1JXDA 4E9TA 1L9RA 2FJSA 3BQVA 1RZPA 1W6WA 2YAEA 2XYBA 3FYEB 2HLEB 2PPDA 3TBCA 4DPAX 2FWLB 3NYKA 2UXVA 3S3CB 2GSMB 4G70B 3MX0B 2PPCA 3ABGA 2ZXWB 1KYAA 3PPSA 1KBWA 2BWDA 1TEFA 3CDZA 1IC0A 1XB3A 3NJLA 2HRHA 3X1GA 3N55A 5B7EA 2P80D 1OCOB 4E9WA 2IDSA 1J9QA 1CYXA 1ET5A 3H56A 4WKXA 4Q8BA 3NSYA 4AX3A 4KO7A 4TXVB 1NDTA 1PLCA 2XV0A 2GIMA 2GC4C 4YVUA 2XXFA 3PXLA 5B3SB 2FT8A 2FQDA 3WKPA 4ZK8A 3ABKB 2DWTA 1SHXA 1KCBA 4FAAB 3GDCA 4HZ1A 4MFHA 1L9QA 4DP4X 4YVNA 5I26A 4F7KA 3WI9A 1ZDSA 4AKOA 1WA0X 2IDUA 1N70A 1OOWA 2YARA 3IEAA 3FS9A 4YSOA 3PLYA 5TK2A 3OQRA 1IUZA 4P5SA 2LLNA 1JZJA 1BXUA 2PP7A 1GY2A 2BZ7A 3WKQA 3AW5A 3NP4A 1J5DA 2FTAA 3X2QB 2RACA 2UX7A 1QLEB 2UXGA 2J5WA 1AIZA 1WS7A 1OCCB 2W88A 1KDIA 1R1CA 3UACA 2IDFA 3D12B 3QJRB 4A2EA 1AZUA 3AG1B 4PAZA 3ABLB 1GS8A 2B3IA 2N0MA 3FQ1A 2B08A 3OMIB 2TSAA 1AZRA 3SBQA 2VM3A 5I6LA 3T6VA 2ZONA 1A65A 1VLXA 2EIMB 3FQ2A 1AANA 2FQFA 3IBOA 3H4FA 1OV8A 2J57A 3CG8A 4KNTA 4F2FA 1NPNA 1RZQA 5EHFA 3X1FA 3NJMA 3NSCA 1NIEA 4KO6A 3CVCA 5F7BA 1YLBB 2EIKB 1JZHA 1W6LA 2PLTA 2YAHA 3S8GB 2AVFA 4Q89A 2VM4A 4HCGA 5AZUA 3PAUA 1E65A 1ZIAA 2UXTA 1TEGA 4GXFA 4BWWA 5TK4A 2IH8A 4JHVA 3IN0A 3HB3B 2YAOA 4GP5B 1BEXA 4HHWA 1PCSA 2DYSB 2CCWA 1PMYA 5A7EA 5IY5B 2YQBA 4CSZA 4KOBA 1NIDA 1PY0A 2IAAC 1MZZA 1ZV2A 3FU9A 3T71A 3QPKA 5B1KA 2XWZA 2BW5A 2AZAA 4BK5C 3NSFA 1X9UA 4G7RB 4A2FA 2I85A 2Y1AA 2W8CA 1A4AA 1SHWA 1E5ZA 3T6WA 4G7SB 2BZCA 4BWUA 1PNDA 3CZUB 1JXGA 1HAUA 2HZHA 3DIVA 3FU7B 2HX9A 1WA2X 1SF5A 3CVDA 3ABMB 2I7SA 2WSDA 1PZCA 4QLWA 1N68A 1BAWA 1ET7A 3QJUB 4UF7C 1TU2A 4L0PB 3FSZA 3JTBA 1M57B 7PAZA 4A2HA 3V9CA 5E9NA 1AACA 3GYRA 1IKOP 2H5UA 2XV2A 1AS8A 3NJKA 2XXGA 2FNWA 3DKHA 1AZNA 1EHKB 1PF3A 1NWPA 1NINA 2PPFA 4E9YA 1GR7A 3FPYA 4GP4B 3FPXA 2J55A 1AQ8A 3SBRA 4BXSV 2QDWA 3OMAB 3ASNB 4M3HA 2JFCA 4YSEA 1ZIBA 4AZUA 2HRGA 3UABA 1V55B 3AY2A 4G72B 3IE9A 1JVLA 1CUOA 1WA1X
chains in the Genus database with same CATH superfamily
3E1ZA 1VADB 5L8LB 3B9EA 1X5ZA 1JNHA 3G5YB 5IVOA 5C0BD 3MLXH 5ETUB 2DQFB 1N5AA 2C26A 4RWHA 1VESA 3ET9F 4HEPA 4WEBH 2EH8H 5DT1H 4AK2A 4XXCA 2MOQA 5IBLC 3FRUB 1ECZA 1CZ8L 1N64L 1O5PA 3W39A 4DW2L 3NCXA 3P69A 3QDJD 2V8MA 5KJRL 5KSVB 4NN7B 1F4YH 3N9GL 3GSRB 3I74A 32C2B 2PETA 3AM8A 2DWEA 1DSYA 4URTB 4C57C 3SYCA 3U4KA 4ZMLA 2QSQA 3C9NA 4U4IA 3NRFA 4PCYA 3FU7A 1XB8A 3SQOH 3P9MB 5J13B 2GHZA 5C0NC 3AVEA 2GTZB 1JYVA 3K1DA 3OKDB 2FHFA 1GS6X 4JY6A 4M62H 4OF8A 2BC4B 2H2PD 3T1FB 5EBMB 1RJZA 2WQSA 3JWNG 2MCPH 2YMTA 4WGVB 3G6JA 1L0YA 2A1WH 3L3IA 3HC2A 1QX1A 4UV7L 5BV7H 1A1OB 2AEPL 3FQ4A 3C8DA 3MV8E 4PRIA 3MV11 4NO0B 3U7YH 1CJYA 1F6AA 4N2NA 4L5FE 3ZE1F 1TCMA 3BAJA 1B3IA 1NCWH 4H20L 4ZQKB 1A6ZA 3I3BA 3KS0J 3MYZA 1BREA 3H9ZA 1G7QA 2ZX7A 2GI0A 1MRFH 4KY1L 5AVSB 4Z5RA 3V5KA 5CINH 1HDMB 4N2MA 5JXAL 3Q05A 2HXAA 1L9MA 4PMEA 3GJFH 2CDFB 5HHMD 2HPOA 4OM1L 2F53B 4GSDH 4JFHE 5AOZA 5A6IA 1UD6A 4JGNA 4OVUA 1J05A 1O9ZA 3F84A 4NNXB 1NBZB 1KXTB 4XHQA 4OF7A 2XN9E 3QJTB 4QAMB 1A9BA 1NCIA 3IDMB 4HUCA 4CADA 2N7BA 1CGSL 3KYMB 1Q9KA 2XA8H 2YSSA 3ZKMD 2BVPA 2DTML 3MRJA 4JPVL 3W11D 4YHZL 1LK2B 5CP7B 4C54A 2HFFA 1BFOB 2TAAA 4HUUA 3TBWA 2CH8A 1S5IH 4Z7VE 2XYCA 3ARGB 1FFNA 3DUSA 3TNMB 2K45A 5CCKH 2QELA 4DP7X 1BVNP 1WBZB 2W1NA 3CE1A 3GO1L 4KWUA 1GAFH 2DH2A 3TM6A 2NY7H 3TZVB 4LP5A 4NEHB 1A7QL 1F6LL 4I4WA 4WWPA 5C7XH 4B9CA 4KO5A 3WIFA 3EG9B 4KU1A 4YIQA 5JQ6H 2D4DA 3ULVD 4XMXA 3DRQA 1EXUA 1U92B 2WUBL 4E9RA 1ZHKA 1M7IA 4BUGA 4IBUA 2KT6A 1N7MH 4RVBA 1LE9B 5C3TA 2MQ0A 1UFUA 3D06A 5KTEH 3DX8A 4AG4L 4HIPA 3KGRA 3RVVD 4LGRB 3HZ3A 2C4FT 4NQEA 2AJXL 1MFBH 1P7HL 5E94A 2HTKD 4IDJL 4KI5F 5AVXB 5D4QA 3QZMA 1SBSH 3VWKB 2OK0H 2BSEA 3IGLA 3K6NA 5HYQB 1FORL 1TKWA 4P2OB 1J1XH 2GY7B 2E7LC 1UWEH 3FOLB 2YRPA 2XU9A 2IQ9H 5IF0B 3SBWA 4N4YB 3OJMB 1MCWW 4JFOA 1CICB 1A47A 3TO4B 4I48A 1N67A 4HCRL 3NN8A 4O00A 5CEXB 3HI5H 3O41B 3QORB 4Y19A 2KHAA 5HHPB 1DVSA 1RMFH 5AAPA 3EFDH 4OAWB 1HZHH 4XE5B 5BS0B 1ML0A 3EH2A 1DVFD 4NAJA 3S4SA 2YBRB 5AZ2H 5HYFA 3FO0H 2WBJD 3EYFA 5D7KD 3O9WA 3TCXA 2ZUWA 4B9FA 3UMTA 1XCXA 4A2LA 1FA4A 3S5LA 3U36B 3PNWA 1V8HA 2VUOA 2WJ7A 4EQ3A 3QI9A 3HTLX 4R3SA 1TQWA 2CJSA 3K2IA 1CZ8H 1XV8A 3HNSL 3O4LA 2NX5D 5KJRH 4XCFH 3GBMH 5KYXA 3M17A 3EO9L 4PTUB 4KKLD 4P2CG 3HC0A 5BO1L 3TO2A 4AMXA 12E8L 4NZRL 2ZNXA 3TJHD 25C8H 4X6DB 3T8XA 3QUXB 4DP8X 4LLDB 2BSRB 4WTZA 2VR5A 4XCYA 4N24A 1W0WA 1E6OH 2HVKB 2H41A 2F0CA 2VDLB 1BMZA 1T04B 4TOYH 2OV0A 3OXRB 1T5XB 2IALB 4KK5C 4L5FH 3SE8L 1IBDA 2WO3B 1FC1A 3GKZA 2AK1H 4GAGH 2JELH 5HHVL 3SDDC 4IJTA 1SYSA 2AJYH 3U4BH 2A83B 4FLSA 5IZ7A 2XIIA 1WBXB 1TVHA 2VDKH 3GXUB 3GJFA 4UV7H 4KAQL 4A04A 4F3FA 5K9JL 1MEXL 1TETL 3C60C 3LKNA 4DTGH 1G7LA 2DAVA 2Y24A 2WLMA 3VG9B 4BHUA 4XAKE 3GZPA 1PZ5A 3FTXA 2QL1A 2GK2A 2NY6D 3E8VA 1CGUA 3BT2H 2IH9A 2R2HB 2R1WA 4WFFD 1KIPA 5B1AB 3LMJL 2N56A 1HZKA 3HZKB 4WI2A 3APCA 4IGBD 4P48A 1MZYA 1QA9A 3POHA 3VG0H 2ZOOA 5C0RL 3TH2T 4IU2B 4X6FB 1KGXA 2XZQL 1J5IA 3VTTA 3UCQA 3L3DA 3HMXL 3H9SD 2Z34A 2F7IA 4ZFOA 4BQCA 5BUGA 4UAOC 1U8QA 3ETTA 4N0YH 1U8LA 3L95B 1Z9OA 3VTAA 3P0VL 2UY7B 5C2BL 3MJ6A 4L3CA 4ZMOA 3A6OA 3VXUA 3PFUA 2N0KA 4YHZH 2P47B 3NA4A 1AGCA 2FECL 1FG9C 2EDFA 2CGYA 1VFBA 3ZDZB 3EJZC 3NIGF 2QGBA 5IT2H 1Z5LB 3D9AL 5GGVL 4XHJC 4L3EB 4J2XA 3DPBB 2OW6A 2FWLB 5H35B 2ZF9A 2ZOKB 2AV7B 2AK4E 2AABH 2UXVA 1HL8A 4J3OF 4G70B 4Z23A 1XGPB 3GSVB 1G6RL 3T5WA 2GSIB 4LPYA 4TNEA 2BWDA 1KBGL 1TEFA 1KBKA 2XI9A 1RUQH 5DHXB 3QEQB 3ZZLA 4YZFE 5EOCJ 2WUBH 4JCWA 3BVVA 4TTDC 1ACCA 5DRWB 5DFVC 2CGZA 5IVXE 2WZ5A 3MBXH 3BP5A 4AG4H 2FGWH 2VLRE 1BBJB 1PZSA 2ESVD 3MYJA 2F54E 3IAPA 4G6MH 4XI5C 1QTSA 4WTWA 2OSLB 4FNPA 4IEFB 1JPEA 3C8HA 4HZ1A 4FG6C 4MFHA 1J10A 1VAHA 2EE3A 5FUOH 2C3WA 1ZDSA 4KZDH 1FO0L 1W16A 4J6RH 4Y1AB 4PSPA 3EOAA 4MA8H 4U4BA 4G5AA 3TBYA 1S7TA 3T0ED 3OXSB 1B0GB 2DL2A 2X53A 4W81A 1DL7L 1PJ9A 3C6SB 1BGXH 2H4EA 3NP4A 4NJAL 3VFSA 5EZJB 4X4XA 4GOSA 4S0TD 5E7FA 2DIAA 3GSNB 3BWAA 5JNYB 1RHHA 2W88A 1A7RL 2GBVA 4R0LC 3IFPA 2PO6A 4PRPB 3GXIA 3MOBL 4P46B 2BVOB 2N1KA 3OLEA 5ICYA 1J1PL 4XOCA 1WK0A 2DQ6A 2XY2A 1OT1A 2FR4A 3NDYE 4AJYV 2MNJB 3ARSA 3NFPA 4LESA 5DDHA 2ZUQB 3MV8A 4FZEL 2J71A 5D1XB 2PTTA 4PP1C 2EUWA 2X41A 4H8HA 2HJLB 3AT8A 2C3XA 4MWFB 4PBDA 3DXAB 3FQ2A 4ZAKA 1NPNA 4QGTA 1PEZA 4BIKA 2ZSWA 4LDLB 2KI6A 3O0RH 4NZRH 4TUOB 2HT2C 4F80A 3BKYL 3SPVA 3OF6D 3MLUL 1ZEAL 2ZP0T 3GMLA 1JZHA 4KGJA 2GCYA 5HDQL 4CDGC 3H7LA 2BVYA 4EDXA 5CLYA 5L2KD 5BCAA 1TQCB 3ZE1B 7FABL 2XN9A 4Z3TA 4UNUA 4BFJA 2P5EE 1KLGA 1VEOA 3OHMB 4AEFA 5ID1B 4H26B 4GP5B 1DFBH 1I8IB 1S9VA 4GO9A 4P59H 2HJKA 3MCLL 4CSZA 2F5BH 3E38A 3WE6B 4ZFQA 3T71A 1IGFH 3A67H 5IG7A 1CDBA 4Z7VA 5JUEH 3QCVL 4A6YB 5DEFB 2LFGA 1TT6A 5DU7A 1GVIA 2XWDA 5LB1A 1E5ZA 1DQML 3WNOA 4HFWB 3HFFA 2EDMA 1FFRA 1MRCH 1G5AA 4KVNL 1GTFA 4WAFA 3REVB 3HA0A 4PRHE 4KXBA 5IBUB 2C9UA 2HZHA 4UQBA 3RVWC 3CVDA 4HKXB 4QT5A 4HXBH 3QDME 1OO2A 4FMFA 1AI1H 5HJBA 3HFMH 5I9QC 3GSQB 1WFMA 4TNVF 3VD4A 3P0VH 2RCSH 4UT7L 1X5HA 3ILPA 4HWBL 5CO1A 5JLZB 5GZOA 1QSEE 5D7IE 1NKOA 3L8QA 3ZR6A 4RISH 1GYUA 1J1OH 3QIUA 1CF8H 4RETB 5HGDA 5C1MB 1LLAA 5AB9A 4HJJL 3D5OF 4O4YL 5A16B 3Q06A 1GOFA 2FEEL 3TF4A 1O7DC 3NIFE 2FLMA 4N8VA 3CQPA 4RIRA 2QGDA 4UQ9A 2CKBB 1X5YA 1KY7A 1IL1B 3MREA 3FN0H 4X9FA 4Z7QE 4P5KA 1DQDL 1UYWH 3DUHA 2QDWA 1S7WA 5ACZA 5JA8B 3S36H 3VXRB 4I1NB 1JV5A 1KPUB 4DZBA 4NXSA 4GUPA 1SYVA 2WXKA 3WTUA 3AQXA 2P8LB 2J6EH 3UABA 1HTYA 2AMGA 1Q94A 3K2KA 5T5FL 5JPMC 1ZANL 3FQNB 2PYFA 1X4ZA 1UA6L 2EVHA 1XR9B 4E42A 4B9KC 1NDMB 2Y7SA 2JKTM 1QEXA 3I85A 5C0BE 4GQZA 2ZXGA 1CFSB 3BVUA 4P49A 3ARGD 4AT6B 2PW1A 1B0RB 4JKMA 2ZAGA 2QEJA 4MS6A 3NIDF 3FCTA 2XHNA 5CSZB 4QMEA 4O9HL 3F8UB 3FT9A 4XPAL 1EO8L 4ZO8A 3H9HB 2OMUB 2A0LC 4JBSA 4MMYA 4C4KT 2LTQC 4JN2B 5GRJL 3T4YB 3BP4A 4M6OH 1BZ7B 3SPGA 4EN3C 4Z3GA 3RAJL 1FWXA 4IOFD 3F58H 1NPUA 1MH5B 3EO1A 3H6JA 4OCMC 1KTKE 2VL4A 2X87A 5L9DL 3FT0A 2MPAH 1AO7B 4YK4C 5B39G 1I7UB 1KTLA 3ZX1A 2VZSA 2KC0A 1H3VA 4NBYB 4QOKD 1OF0A 1GSKA 4I85A 4YBQD 1D9KD 4G11A 1UACH 1U95B 3TN0C 2O93L 4JRYB 3N40F 4PJDB 5E00A 5INCB 1NFDE 4X6EB 4WCYH 4ACTA 1IBBA 1AYOA 2ARJB 2A9NL 1URZA 3KDMB 2PP9A 1XF3B 3OR6A 3BPOC 3RB7A 4DQOL 4GRMA 3VRLF 4WUUE 4FF9A 4YO0A 5DVPA 1KEGL 1UCBH 2EEXA 3SGEH 3VWKD 2YA0A 3MOBH 4KXCA 1CR9L 1J1PH 3MBWB 4AIZA 1SEQL 5LGYA 2EUXA 4UB0L 1U91A 5TPWL 3NT0A 5JW4Q 3VYNA 2N3JA 5T3ZD 1P7QB 3ZN6A 5LGJB 2RTTA 4FXGC 1JFQH 1HZLA 5LO7A 2X4RB 1TTUA 3BZ4B 2WB7A 4OJFL 4QRPD 1QZ1A 3ECBA 4RFEA 1ZKAA 1OGAB 2Z8SA 1DZBA 4YC2B 3P0YH 4JY5H 5HHME 1HNFA 4QPEA 1FL5B 1NM4A 4N2EA 4NRZB 5M94B 3BEVA 4WSJA 2ZKWA 1ZS2A 2L8AA 2W9EL 3H42L 1CL7I 4HSQA 4N9GA 1SJHA 5E6IC 1QR4A 2DQTH 4HWEH 3FFDA 15C8H 2A6KB 2NYYC 4WU7A 5FA4B 5JORB 5DS8A 1YUHA 4R5XA 3OG6B 4YL9A 4LCYA 1UOKA 1OB1B 3GZKA 1F4WH 4JDZA 4LDCA 2K6YA 5B1JA 4I77H 4M7JL 4UTAL 3TNNB 2EXYC 2VO8A 4ZOAA 1KCRH 5MEOB 3VACA 2H3XC 1AS7A 3T9WA 3KPPA 2VSKB 4BQBA 2QTVA 4WK0B 3U6RB 4UBDD 4RZCB 2BH0A 4CILA 2ICEB 1MHHA 3QNXA 4LCUA 3IM1A 5GJTH 3RWJB 1KJVA 2ADJA 4Y9FA 4OIIL 1NFKA 4I3SH 5FX3A 1ACXA 3KPOB 2XACC 4FXKB 3DVGA 5M95B 2PR9A 2BNUA 3EJRA 1CT8B 4G9FB 4RRPA 3M07A 1U9KA 2J20A 4UOJA 4OLVH 3PHOB 3PWJB 5E8DH 4BBWA 1H3PH 1M6OB 1IT9H 1BVZA 2JB5L 4HV8A 4JFEB 4KVPA 3MLSH 3D39B 5ADPH 4HH9B 3H4HA 2E4FA 2P80A 1BYOA 3EBIA 3N44F 3JT0A 2UUDK 5DJ2A 5EWIL 5CFAA 3NIGB 3GUTB 2B4CL 2J6EA 4KHTH 2VLRA 4NPKA 3TEUA 3B2MA 4OI7A 1GC1L 2F54A 5KUKA 4HF5L 3FF8A 4LEOB 4BRJA 3PGDB 1JZIA 1E43A 4TRPL 3S35X 3ZZQA 3CSYB 4QRTA 4Q9QH 3TEWA 1JRHI 3BKML 5JZ7C 4OUUA 5IQLA 1RZGA 1AHWA 3VUAA 4XMLL 5BOJA 4PP2A 3V9FA 4P23C 3K6SB 3UAFA 1JOIA 4ZD3L 1CTMA 1OANA 3X12A 4Z3JA 1PCXA 4EI5D 5HY9B 5CZRA 1WG3A 4KJPD 1OP4A 2R7EB 4B7IA 4PJXF 4XNYH 1NSNL 5AAMA 5T5FH 3VFVA 4N2CA 1JXJA 4LFHG 5F2FA 4HIHB 5D7KE 4AH2A 3NJFA 1G43A 5FK9B 1CE6A 2ZWNA 3NCBB 4N2GA 4QRRD 2D9CA 3CFBB 2VM9A 2XQBL 3G7TA 4LK4A 4XP5L 3RL1B 2EC8A 1BOGB 4TL5A 5AYUL 1OAZL 3W2DH 4OQTL 3OV6A 4KFMA 4PWEA 3K8LA 3VFOB 5HHQA 1M9SA 3ARDD 1EO8H 2NX5E 1UB5B 1BMGA 4QO1A 3B8SA 1XF5B 2AKRB 3WY3A 1R3JA 2CA3A 3O3BA 1FGNH 4DP2X 3SE4A 1NA8A 5CN3A 4MDIB 4BSVA 2ISDA 3F5WB 1CDGA 5KSBF 3ARFD 1YNLL 4N2BA 4HUKB 4PS8A 5TF0A 5C07A 5I24A 1AE6L 1XTLA 3QJVB 3A6BH 2A99A 2FVNA 4G42B 3WN5C 1MREH 1D5XA 3Q0HA 2Q87A 4YXKH 4GH7B 4ALAH 2YAMA 3FUKA 3Q2VA 1HH6B 1MFAH 4EAEA 5D4IA 1XF4A 5LBGA 4B41A 1WZ1L 3VO0A 5AAWC 2OMBA 1IIIA 3C87A 4F9LC 5T1MA 1XGRA 4IMLB 4AGNA 1MCLA 1BQLL 2P5EA 5CS7A 3V4UH 3O8XC 3WJJC 5IHUL 1UB6A 1LGVA 4L2LA 1SEQH 3DETD 5IJVA 1PSKH 1SJEB 2VMEA 5DEGA 5T1LA 1C8QA 3T8VA 5BOPA 3NDZE 4JPWH 1X9QA 1BVKA 5HGBB 2BO0A 1B4JH 3TPKA 1BQKA 4HUVA 4WWKD 5IB3B 4JUTA 4U1IB 4WKZB 2HN7B 3FAXA 1OB0A 3QHFL 2Z0UA 4G8EA 2E6PA 4XN7A 4X6BA 2VLKD 2DJMA 5IWLC 3WHXA 1V10A 1P5UB 1RIUL 1BDYA 3IDYB 4PRHA 2XBTA 1T4KA 4JM2F 3L3GB 1MUJA 2KERA 1PLBA 1K8IB 1M7XA 2QT6A 3QDMA 2VERA 3ARQA 1UKSA 5AYTA 3WNNA 1FPTH 4A39A 4K9EC 4GG6E 4QXGL 3TYFA 1HIMH 1A7BA 3GRWH 4M43H 3R8QA 5IEHB 1N10A 1QSEA 5D7IA 3W0WB 4PLJC 1ZLWK 2D7TH 4GMSH 1Y0LB 3DIDA 3V6BR 3KLDA 1SRDA 1RUPL 2EYTA 3PQYA 1MQKL 1MVUB 5IROC 2VDOB 3BYTA 3D07A 2Y1ZA 5HYEA 2EDWA 1TMCB 4F33B 2VRAA 3RVUD 4YX2L 4YFDB 4NUQA 3ES6B 4YHPA 2YD8A 5ITBL 1KIRA 2NT1A 5DRXA 1WEJL 5HGAA 5KEZA 2OMYA 3LRGA 3M46A 1TF4A 1TJIL 3NSYA 3PYCA 5IBTL 1R5WA 5L4FA 1I7ZA 1QVOA 4CC0A 3LKPB 4YVUA 2XXFA 2C5DC 1IM3A 3WFBL 4B5ZA 3SPIA 3TA3A 3RFZA 3MRNA 3VFTA 3UYRH 5C0BA 1GHFL 1QBMH 2Z31C 3R18A 3BWUC 3C5JB 5IM7A 1ADQH 1AXTH 1KPVB 4HIEA 3CLFH 3MODL 1CD0A 4XXWC 1PW3A 4OJYA 2FATH 2YPVH 4JDTL 4ZMNA 4G7YL 5T5FA 1XGTB 3BAYA 4HQQL 4QHNA 3GIZL 3PLYA 1S7UB 3CK0H 2WYTA 1UQSA 1Z6JT 3X3GL 3QNYA 2OR7A 2YPLB 5IQ7L 4Y2OB 4ABUA 1AKPA 1IQDB 4IYKA 4KMTH 1JE6A 4NAMA 2YMXL 4PR5B 1FRGL 4MVBC 1JV2B 2R2EB 1IAKB 2YOAA 2VR4A 1KB5L 3TVMC 1CQKA 2G3MA 3COOA 5EN2B 2YXFA 3ZGIA 1NCDL 3NIDB 3HE6B 4Q4IA 1NFDA 3CH1B 2XZCL 3NJVA 2RFXA 4FLQA 2A73A 2Q8AL 4NS0A 5KVDL 4OZIE 3ARBC 3FOMB 4Z18A 2XQBH 3VI4F 4HC1L 4WGWB 3NA9L 4S10A 2LE9A 4WUUA 5IB5A 1DLHB 4OQTH 5I6LA 2NQCA 1G7MA 1A65A 3CUPA 5DSCA 3WD5L 4X5PA 1CFQB 1RPQA 2NW2B 3P73B 4KNTA 4GRLC 5T1JA 3TT1L 4YE0A 3AY4A 4HK0B 2HJFA 5JYLA 2G4EA 1JTTA 1XZ0B 2IPUG 1QQDA 3ZZ1A 1C1EL 1PD6A 1R75A 4P0DA 4LPTA 2R0WL 4KTDL 4AK1A 4TUJA 4U6VL 3NCYS 3EFFA 5A7BA 1W6LA 5I18L 2GJ6D 1AY1H 1DP0A 2CMRL 2V6HA 2VZTA 1F8TL 1P4IL 2VM4A 3CHQA 4ONHB 5IB1A 5DK3A 1Z3GL 3K6OA 4UT6L 3DJZA 3P4OB 1QYGH 3D3VD 3S96A 1IBHA 4HEME 5DI8B 1C16A 4M93C 2IH8A 3QUYD 4ODWA 1RZIA 3HB3B 3Q2CA 3L4XA 4ZX5A 4J3XA 3VQMA 4NHUA 2GEEA 3EOYG 4KRPC 4IRSC 3LV3A 3QZOA 1JTOA 4RAVA 5IHUH 3BH8A 2WCSA 4XNXL 4IIQC 2UYLA 3TWCL 5B22A 3CGTA 1S8DB 5F0MB 5JPNA 1NFIA 1CG9B 1E2ZA 2MFNA 5J0BA 3Q2WA 4PB0L 4JFDB 1SVCP 3IJ7A 3S2AA 3INOA 3NSXA 2UZYB 1R9FA 5TH2B 4DVBB 2ZX5A 2Q6WB 2HX9A 1O6VA 4IJ3C 2CO1A 3QXWA 4UTAA 1FAIH 1OTTC 5J1AA 5TTRA 4QLWA 3CFJB 3MUGA 5E4EB 2YD5A 2EKJA 3WLWD 5F88B 2ZTBA 4BINA 4TS6A 3L7EA 4Q6IA 4NRXA 5KANG 2C1OB 3V9CA 1C5BH 2XV2A 4Q14A 2M8XA 3K2UH 3NSJA 4G6AD 4PB9H 5HPMB 2WLHA 5J3HC 4YHYC 1OSPH 3RUGE 5C9JA 3U9PH 4YDIL 1KN2L 1FNEB 1SN0A 3MLVL 1QI4A 4X99A 5BRQA 3V6FA 1BW8A 3RY6C 5HI3C 4U6YB 1XH3B 2GFBA 2IPTH 2Q3AA 4JLRA 5E08H 5FO8B 2F53E 3UAJC 1P84K 3C5ZB 4P06A 1CFTB 3DV4B 5JTWA 1EAOA 4MDJB 5IFAL 1MQKH 4ZUWA 3BD5A 2CJUL 3ASNB 5EU3B 1DBJL 5AEAA 1H3GA 2HLAA 2XA3A 5E6ZA 3S34L 4G72B 3P9LB 2QQLL 4QTFA 4DGYL 4LXFA 4FQ1L 1ADQA 4HK3J 3BIAX 3GHPA 2YPVA 3C5XA 1P0SE 4X9GA 3Q1SH 1HXYB 5GZND 1LDPH 3HKFA 3N44B 4GSQA 1H9VA 2ALWA 1IJ9A 4B3EA 4FQPA 4AW7A 1K5NB 4WGKA 1DVFA 1MRDL 1MNUH 1VKXA 1MFUA 1ETJA 3FUIA 4OF5A 4QXUH 2WBJA 2X6VA 1CF1A 5FO9B 2OMZB 1VFOA 3X1NA 1NIBA 4OD2A 4NN5C 5DZVA 1QLFA 1URIA 3KL0A 5IJBC 4JHZA 4DCQB 5FKAB 2LQRA 5EC2A 3UMNA 3CVHL 3UJTL 1FLTX 2NX5A 4M5YH 2UZPA 4HOXA 3TPUB 3LEVH 1LO4H 1M05B 3LXUX 1LD9B 3SDCB 1JZFA 1ETZB 3A3YB 4FFYL 3HI6H 5C0IB 4DAGH 4ETYA 4PJXB 4OQTA 3UTQB 4X2UA 4LGSB 1PVHA 3AXLB 3MRCA 1N59A 4UIMA 2Y0SA 4K2UL 4ELMB 4M9PA 1NCOA 1FVEA 1PG7L 2OAAA 4GIOA 1BQRA 5JR1H 5JW4M 3LQAC 4HSAC 5HI4C 1N5YL 3JTSA 3QJHB 3DMMD 3H3PH 2FO4A 4HGWA 2WVVA 2X0UA 4OV6F 4J3OD 4TSBL 2FX8L 3DGGB 2HX8A 1BIIB 4MNHB 5T3ZE 5C0FB 3KWTA 5KANI 1XXFC 4UDTA 4LSDA 5D1ZD 5KSBB 5HYSA 4H5SA 5BVPL 1OE3A 2KYIA 1M4KA 3RU8H 2APVA 2DS4A 5C09B 3CMGA 1EXHA 5I75C 4ATTA 3K72A 3FUJA 4ZMWA 1AGFB 5I6XB 1N8ZA 5BS0E 3MRRA 4IGBA 1BVNT 3BQUA 3GHBH 5GGSB 5I18H 3GFUA 1P4IH 5GQBA 2YD9A 5E1GA 1S5HB 2CLZB 4M7LH 4QTHA 4UT6H 1VPOL 5MHSD 3SSGA 4PVNA 5C7ZA 3ZSSA 1UFGA 3BPNC 1H15A 1QATA 3IDXH 4TLSA 2IOOA 3OAUL 5E8PB 5I16B 4AQEB 3OJVC 3ZU8A 2DWDA 1I8AA 3LNIA 3BJ91 1OK0A 1Z0NA 1NCBL 3E6HB 4QRAA 1VRSA 5E6YA 2VDLL 4S1RH 8FABB 4X7SL 1DBAL 4YR6B 8PAZA 1NC2B 1UD4A 3F6JA 4GG6A 4UQIM 2IG2L 3ARED 3BUDA 4HS3A 4X6DE 3SD5A 3MMEB 3O6MH 4KUCF 4EDWL 1E5AA 4AEIL 2DQCH 5D6DA 1FZJA 4HPYH 2CO7B 4HFUL 3OGOE 2O6CA 1OAKH 2R0ZH 3DHPA 3VQLA 5HP5A 4DPBX 6PAZA 1BX2B 5FO2A 2ED6A 3EUDA 1H3XA 1U8CB 4JM2B 1LEIB 4YWGL 1AAJA 1S9XB 5EUKA 4AM0A 1WYJA 4KJYA 3M8OL 4Z3IA 1JF5A 4NKOA 2DQGL 4G43A 3AM8C 3QRLA 4KV5F 2OR9L 1ID2A 2IWKA 4S2SA 3H6AA 2HX7A 2VDPB 3RFRA 2B20A 2DI7A 1BV8A 1HN1A 1YMHA 2NY0D 4JG0L 2AANA 3EJCA 2WXLA 4GS7B 1MCDA 2VR7A 2ZX6A 3IVKA 4XBGA 2VE6A 2OI9C 2XWRA 2NRDA 4W4OC 4RGNB 1E30A 4POUB 5DZJA 4Z7UF 4U1NB 1L6PA 3ZQWA 3DVNA 4GXUN 4GI9A 1UD2A 1IBZA 1Y6MR 3DGDA 3W56A 1N6UA 5ESVB 3MV9D 1DQIA 1EDQA 3I6GB 4RMUA 2GIYA 2MMXA 3LXAA 4JZOA 4RGMB 3VX0A 4KQ4L 4KK9D 3CVIL 5C3LD 5BZZA 3KLHC 2FIKB 4XVTH 4LVNB 2YRLA 4P5MA 4PI0A 4Y5XB 4ANKA 1JCKA 2Y7OA 5ID0B 2ZKHL 3VSVA 1GGUA 1U2YA 1R6VA 5ALBH 1PKQB 1A1MB 5AWNH 2DLIA 3I9GL 1F42A 5KSAA 1EJFA 3L9RB 1HS6A 4L3EE 4Y5YB 2AQNA 4R9HA 4MCZB 3W82A 1M2VB 5G2NA 4FULA 1JFHA 1UJ3B 1R3HB 5CCHE 5KOMC 1MF2L 4ORGB 4GG8B 1MWAH 2PYEB 1JUFB 2FO8A 3I9IA 3QEQE 1SLXA 4CSPA 5EOQL 3V4PB 4LQFL 2H9GA 4XCNA 4LSRH 4L8BA 1G94A 4OT1L 3DTXA 4QJ5B 2H3KA 3BCDA 1DQJB 4FFYH 3CDZB 1NCCL 1F45A 2YAFA 2KLSA 2Z8RA 3MA7B 1T5WB 4F2MB 1UXSA 1FUNA 1RCYA 3OF6A 1LXMA 5JW3L 3C2AL 5EMYA 5T3ZH 3VI4B 4PTTA 3G5YA 3DX3A 2DQFA 4F91B 5L2KA 3QIBB 4PJAF 1PY9A 2E7HA 4GKNB 4WI3A 3FMGL 3PP3H 4HEMA 4UV4L 2CIKA 5CN1A 4LSQL 5DEZA 3LIUA 3S6CA 4A2DA 4Y1AE 4Q2ZA 3W81A 4C56B 5KSVA 4JANB 5CR8A 1AKJD 4UT6A 1UWFA 1NCAH 1WISA 3GSNL 2IAMB 3GSRA 5DHEA 4Z7OF 32C2A 3NQKA 1A3ZA 3SKUD 4DN3H 1A3RL 4MB3A 1NKGA 3KJ6L 3BUBA 1DBKL 5C8JA 4ZXBB 4UAHA 2GTZA 4QYOB 2GC7C 2PTUA 3IMVA 3OKDA 4Y2NA 1RZ8B 2FSEA 3T1FA 1T21B 1UWGL 5EBMA 4GQ9H 3FONB 4XPBH 4XC1H 3CDGA 1AGDA 5GS0D 4DKTA 3G6DL 4MXQC 1A1OA 1RZKL 1T20B 2XT1B 4NI6A 1I1CA 3E2HB 4NO0A 1INDL 5D1XE 4XNAA 3Q2LA 4A7GF 1S7XB 1QHPA 2OYKA 3CHSA 2WBKA 2XWTA 4F8OA 3DXAE 1NCBH 4UZUA 4ZQKA 3VW3L 2VDLH 3FO2B 4LSSH 5AUMA 1DBAH 3UBHA 4F7EB 2HT3D 3TS8A 4FNQA 3RUGA 3MBED 1XD0A 2AMUA 2IQAB 4B0MB 4FL4B 1BLNB 1KXQE 4PMFA 1LWRA 3QI9C 2EVFA 4NNXA 1J9QA 1CYXA 3QQ9D 3ZE1E 1GJUA 3ESUF 1HEJC 4J3UA 2EQDA 1E4XH 3IDMA 3ILEA 1PLCA 4XX1E 2XV0A 1CLCA 4A6YL 1JHTA 1Y18B 3QEUA 5IUCA 2J2ZA 3WUZA 1LK2A 5D96C 3TFBA 1BFOA 1KCBA 3LTVA 5TDOB 1OLZA 1JJUA 2XC8A 1QZNA 2EYRB 4ES8A 5K69A 2HWZL 3ARGA 3PHQB 4BZ2L 3EJYC 3TNMA 2AGJL 3IEAA 2FHCA 3QDAA 4JFDD 1WF5A 1RU9H 4KKZA 4GUOA 1MIML 5I76A 2PP7A 3LB6C 5DMKB 1IAOB 1GY2A 3ZLQC 2LU5A 2VCOA 3WNMA 1X5JA 4IKKA 4X5XA 2V2WB 2F19H 3EG9A 3MLTB 3OAWA 5M7QA 5DMGC 1J5DA 3R8BB 2WOYA 4QXVA 3WEOA 1G0DA 1YSOA 1I7RB 4BFRA 1CTOA 4LSTL 4NZUL 2EC9T 1OLLA 4KKRA 4LDEB 2Y36L 5CD5D 3MR9B 2ZG1A 2XPYA 1LE9A 2IDFA 2ZOWA 1FL6B 5T33H 1S4IA 3CX5J 1D9KA 2H6OA 4L37B 1FIGH 1O7SA 2Z92A 4EUPG 1EFXD 3PGFL 5D7SH 5IOKA 3OMIB 4KKCD 4UMGA 1A66A 4NUJB 3ZKXC 1AXSB 3SE9H 5CHNB 4FFYA 2DZEA 2YBGA 2FQFA 3H4FA 3VWKA 3HS0A 3E8UL 4FEIA 2ED9A 3VFPB 2X09A 2C1PB 3RWEB 5HYQA 2ZUSA 2WB1A 2D8KA 5CZVL 1KEML 4BRVA 4IK7A 4P2OA 2XKSA 3VXRE 1TUPA 4U33A 3QQ3A 1BPVA 5F93C 3GRBA 3RGBA 4XNZB 3SJVB 2X3CA 1YLBB 2VQ4A 1CICA 5LNEA 4JPKL 3TO4A 5DO8A 1THAA 2WGNB 4LPWA 1KJ2H 3UJJL 3B9KC 4OI9A 5CEXA 1A6WH 2NNXA 4MMXB 1AD9B 4G3YL 2APSA 2R29L 5AOKA 1SXCA 3D3VE 5BS0A 4NLHA 1SXZA 4LLYB 3N42F 2YBRA 1PGRB 1Z7JA 2F8IA 3EYVB 2MH4A 3CHOA 5IR1A 3C2AH 3GPEA 2O5ZL 5F7EH 5IW1B 5DD3L 3U36A 1YY8B 4KXDA 4L05A 2W9DH 4B27A 2VNCA 3MO1B 5EC1B 5GRUL 3VXNB 1UM6L 2I85A 1DE4B 4AIEA 2XXMB 4X83A 3TYGH 4CMHB 3LPOA 1NBYB 3T6WA 1F90H 1E28B 1AO7E 2AQRA 2DBJA 4NZTH 5EH1A 3GSNH 2R59A 2LU7A 5GISH 2JNZA 3VWJB 4BWUA 3FQUA 4UILH 3QB7C 3VGAB 3KHOA 3QUXA 3Q8CA 1HWGB 4I5BB 2BSRA 3QT2A 2WSDA 1U3HB 3VD3A 3IGFA 4AQ8C 4YGVB 4B0MM 4HT1H 2NTSP 2HVKA 3FU0A 2GK0B 1L5GB 3L3OB 1RI8A 2WNXA 1T5XA 3OXRA 1TU2A 3TWYA 5F6IC 5IQOA 3S88L 4MZIA 5BVJB 4XP4L 5L6YH 5E9NA 4PJ7F 2A83A 3GDBA 4E9LA 5KUMA 1P6FA 5F9OL 5HDLA 2XBDA 3AXIA 2RBLA 3U30B 4ZFZB 1S46A 3UIZA 4N68A 2V7HA 3HC4H 3L5WB 3QFGA 5DWUL 4E9YA 5KYWB 5ICUA 1EAJA 3NCWA 4XN5A 3SKJL 3QUHA 2P45B 3IMTA 4GQQA 3DURA 1OGAE 5J1TC 1FHNA 3GF8A 4P2RD 1MJ8L 1BJMA 2HG0A 4LLMB 3WXWH 5JIIA 2PO6C 3HZKA 5HI5D 2K4AA 3HLKA 1JVLA 4P3DB 1PEWA 4IU2A 5DF0A 1UA7A 1BVLA 3CQFA 3BDXA 3OM3B 3KJ4B 3B2UD 5F7DB 1RUAH 3WKMH 1U41A 2AS5M 3QUMH 4K4KA 4OZFG 2RMNA 1GW0A 1ZVSB 3AB0C 2P28B 3AC0A 3BVTA 3IWUA 1GGIL 4ZAKC 5EBWA 5FF6B 5JW5B 2FEJA 1TYJA 3O6FB 1G9ML 4DEWA 1I9EA 1NC2D 1JNNL 3FO9B 5EZOH 4EUPH 1TYEB 3FTVA 4Z7UB 3VSQA 3MRIA 1NAMH 2TRYA 3QHZL 3HRZB 1FSKB 4BZ2H 1U8IB 5TF1H 1Z5LA 2CO6B 2AGJH 3ABZA 2WIIB 4L3EA 1YECH 3QUZB 5SV3A 4DEUA 5H35A 2ZOKA 3MFFB 3K71B 5HD8D 2DLFL 3EF4A 5F0JB 4G9FE 3GSVA 4FQQB 2WTPA 2GSIA 2D73A 1F1AA 5I1CL 4R4NC 3ARFA 3KNBA 4FHJA 5AVZB 2HTLD 4JFEE 4WNSA 3D39E 2P3YA 1J9CT 1QNIA 5LBVA 5J11C 1A5FH 5IVNA 1XB6A 1M71B 2CKBH 2VC2L 4HWZB 3ZDYF 2JJVA 3EGXB 3NIGE 4BKSC 3GS0A 4XNUL 2Q9OA 1C08A 3GGWA 1YN6B 2QBWA 4JN1L 3B56A 4RGND 1KJ2A 5F6HI 1JZ8A 4Z0BL 2FX9H 1OAYH 4CU7A 3FN3A 4IEFA 3VXMD 1KYFA 5E0QA 4DJMA 3TBBA 3RVXC 2CLRA 3OPZH 5MEND 2QV4A 3CFCL 4PJFF 1Q0XH 5I19H 3JXAA 4NPJA 1TZGH 2Y7QB 4BV1A 1F4XL 5IMMA 4ETQA 3BKCL 4Y1AA 3RILA 3TC9A 1DVYA 1WIUA 2OLDA 1B4RA 3LPWA 4B9JA 4FYTA 4W9KC 4KQ3H 2WKOF 1NICA 2G30A 3ME0B 3PXJA 4NKMB 4DZ8A 3OKOB 4LCIL 3OXSA 1B0GA 3HUJF 1KV7A 1JGVH 4HALA 5I73C 5FIEA 3T6XA 3C6SA 3RY4A 2FBRA 2QPSA 5DJZB 1KT2B 2CBMA 1CXIA 2EDKA 1J0ZA 1Z9SB 3ISWA 2NTFB 4CMMB 3GNML 4WRLA 2WN2A 4P9MH 2VLKA 4PJAB 5MHSE 3GSNA 5JNYA 3L5XL 4FQ2L 3W9DA 1NCTA 4MA1B 1I1YA 2BNQB 5IMLA 3D69A 2BVOA 4HIIB 3WNLA 1HINH 1NFAA 3HG1B 2Z91B 3S5ZA 5CGYC 3O6KL 3BSZL 3SZKC 2O5ZH 1L9PA 3JVGA 4JR9L 1O9WA 4Z7OB 3SKOB 2C9VA 3RX9A 4A7SA 3ASOB 2HJLA 4MYPA 4NRYB 1T1WA 4M1CD 1ASQA 4MWFA 3DXAA 3UCRA 4ABVA 2VZUA 4TUOA 4W1TA 1Q90A 4YXHH 4BWTA 2CNZA 3AXHA 2HFTA 3QIWD 5L2JB 1KXQA 1IBYA 3T08A 5AOIA 2JXMA 4G2AA 1A6PA 2JJSA 2WQ8A 3FRPG 4M4RB 1FNSL 1VF5C 4YFLI 4LO9A 1J7VR 5AW4B 2BXYA 3I50H 2H3NA 3B2XA 3LZRA 3TGXA 1I9IH 4ZFFA 3D52A 4G7QB 3VRIB 3KLAB 2PKDA 5ID1A 1OT2A 4H26A 4FA7B 1HHIA 1YYML 4C8XA 3R7QA 4Y2DB 3FFCB 3MKKA 4Y9GA 2VN5A 1IAIM 3DIFB 3QUMA 4G80B 4PEEA 5DO2D 2Y25A 4ZTPL 4NT6A 3STZA 1HHKB 2ZCLH 3MQIA 1ZT1B 5CMAB 5A3ID 2BW4A 5FC9A 3OGCB 1H5BA 1ILSA 4UYQA 4IKLA 5TDPB 2WQRA 4XWGH 3OKEB 2VIRA 1PNCA 5D93C 1LO5B 4PJCF 4EUPA 3GMQB 1SJMA 2B8OT 2VR6A 4M7KL 2BZDA 3LKRB 5FB8B 2F9BT 2FIRT 4DGWC 2KPNA 4KDTA 4C4BA 4BZ2A 4HKXA 4X9IA 5B8CA 1G9NL 2X0WA 4JRXD 4WO4B 1VFAB 5L88L 1OAUL 4NN6B 1P4BH 4AL8H 4CBZA 4XN2A 5D7JC 2B5IC 1CLYL 1QPPA 4LASL 3W0WE 1DJGA 3BHBA 3WO4C 4I18B 1HXKA 3IFNH 1BHGA 4OFKA 5D1ZI 4QIRA 5FYKD 2E9JA 3V0VA 5A16A 1UZ6F 2AP2A 4MMZB 5H37A 3QS3A 4P9HH 5DEJA 4Y4FB 3RYMA 1TG8A 1GOGA 4YJZL 2CKBA 5CEZD 4Y4HB 4LSPL 4P4KC 4HAFA 2BS9A 1IL1A 1NBVL 2YKKA 3HNVL 4R97C 3BE1L 4YBLB 2R69H 4M1GL 3WENA 1BIHA 3VXRA 2GJPA 4KBPA 4U7SA 4QHPA 4ATWA 5E5RB 3T04D 1YNKL 2P8LA 3T4AB 1VENA 5I1CH 3MUJA 4DQAA 1Y7VA 3GZQA 3FSVA 3FQNA 2GJ6A 3QCUL 4MXWH 4L1BA 5B4MD 4J3OH 1XR9A 4BUHA 4JHUA 3MLWL 1RK0B 4HIXH 5TJWK 1CFSA 3WFEL 5TDNA 3C08H 3D3VA 1FFTB 2IIJA 4YQXH 3QUYA 4JQVA 3FHEA 1PYWB 1MKFA 1CL7L 1YG9A 2C3VA 3FK3A 4L8CB 4K3EL 4Z0BH 4TN9A 3NZUA 4XBPA 2QPEB 2IDQA 3H9HA 2R29A 2OMUA 4L4TB 5EIIB 4L2YA 3L13A 4JN2A 1WCBB 1D3CA 4GKZB 4N8UA 4PWGA 4XMTA 1KSRA 4MA7L 2YPLE 1FDLH 2DOCA 2JKXA 1JCVA 1MH5A 1PQZB 4R7VA 4NQXB 5B38G 3RVTC 1AO7A 2V7NB 1I7UA 1MXDA 4H8VA 2DLEA 4HMCA 3G08B 3CBKB 3ZTJG 2DPKA 3QH3B 5K1VA 1IFHL 4U3SA 3RX5A 3DX0A 4X6EA 2O30A 3M7FB 4A55A 3AUVA 1O6TA 2BM3A 3GNMH 1XF3A 3QXVA 4PJ9B 4FYSA 3L5XH 4OLXL 4KJQD 3HIZA 2XYBA 4FTVB 4BH7B 2ADGB 1HVXA 4QTIH 1MJUL 3AGWA 4XZUB 1Z9PA 1UWYA 1U36A 2A6JB 1VDGA 3HR5B 3MNZA 5DJXA 5AAMC 4HYTB 5LGJA 2X4RA 1IC0A 1S7VB 4NWTL 3BZ4A 4ZS7L 3K81A 1A1NA 2YXMA 1OGAA 3QG6B 4MS8D 4WENB 2KZ1B 5MERA 1FL5A 4I7ZC 4NRZA 1OF2B 3H0TB 3VRLE 3D2UD 2AEWA 1JDAA 3U0WL 5SWZD 1VJSA 1KB9K 4PJ7B 3AS0A 1KLFB 4PV8A 4PS3A 5A2LH 4H8WH 1JRHL 2FT8A 2A6KA 5FA4A 4BM7A 2WLZA 3WEMA 1N0LB 5GZNA 2GVYA 1ZTMA 2WANA 5I26A 4DP4X 4PUBL 4LCWB 2CUIA 4H0GA 3LY6A 1OOWA 3O2DH 3VXQB 3TNNA 3DYMA 5MEOA 3VFRB 1DTUA 3QZWG 1M42A 4JFDE 3U6RA 3CXHJ 3DPDA 4LSVH 3ROOB 3BXNB 5DQDL 5KYYA 3MJGX 4HBQA 1C5DB 2EKSB 4LLQB 4PLOB 2FTAA 2BRRL 1R4XA 2RACA 5CUSH 4R84A 3QO1B 3KPOA 5CILH 1AZVA 1J12A 3LH8A 2FB4H 4JDEB 2R4SL 2RALA 4MTMA 4RFNC 4GI6A 4F7TB 1X5GA 3QDGD 4G9FA 4O2CA 5I8OL 1KIQA 2R56L 3PIQA 4PGEB 3IS1X 1DDTA 4S0HA 3LEXB 5ANMA 2FBJL 4HHAB 3PHOA 5T5NF 1JPGB 3PWJA 4B9ZA 4IBYA 1YAIA 2E5EA 1M6OA 2ZE0A 3BN9C 3JV0A 4JFEA 2VDOH 2NDFA 1X7QB 3D39A 5I71B 3E6FB 4HJ1A 4HH9A 5GGQH 3ULUF 4WLCA 2CNYA 2R69A 1CDYA 3HHSB 4YNYB 1B4LA 3TIDB 1BFVH 2V5RA 2J57A 1JDCA 1MI5B 5K9KB 5IOPA 4JKLA 4LEOA 3DMMA 1NIEA 3PGDA 1E4JA 4IBZA 3ZTNH 2K8QA 3CSYA 5IKCA 1IGML 4NC1E 5K5YA 3RZCD 1FFOA 1DJSA 4JZJB 1A9EB 4FJ6A 4LSPH 5D1ZA 4RESB 1AHKA 3VU1A 5AZUA 5IFHL 1E4KA 4PG9A 2X1OA 2BXZA 2E0PA 2YN5A 2WLNA 1H0DB 2AJZB 3RWDB 3IN0A 3ZDYB 2KLTA 4CA4A 3VD2A 4K71B 4F8LA 1PMYA 3V8CA 43CAB 1HHGB 1I3GL 1ITBB 4UQ3B 5D1QB 1FVDB 5IY5B 3ULVL 1NLBH 3ZTJH 4HIHA 4JZNB 1I8LA 2X4UB 4XVOA 3ECWA 4M7ZB 1UOLA 4ONFL 5FK9A 5FYLL 1V27A 1II4E 3QPKA 2O61B 3I3EA 2BW5A 2NZ9D 3CFBA 1T66C 4Y16B 3RL1A 1NL0H 4ZO6A 4PJFB 1BOGA 1TTGA 2JKIS 3NVQA 4LF3B 2B9BA 2W8CA 1A4AA 2CDGB 3QUZD 4J4PD 1JPSL 5F7KC 3VFOA 2MNWA 1HK6A 2ICES 3BN3B 5DK0B 4BFOA 1XF5A 5FUCE 4MAYC 3UX9B 3B3IB 4DFHA 2OXGB 3HUJB 3PWVB 3IWVA 4PJXE 3QXAB 4FQXC 3AREA 2X7LA 2CGRL 3OTTA 5GS0H 4LLWB 4UF7C 1PIGA 4RMWA 2PUQT 3THML 4DT2A 5IW6B 1HSBB 4D8PA 1D6EA 5DC9B 3PUCA 2FWSA 2ZX9A 3VXTA 1K8DB 5ABZA 2FJUB 1U33A 3Q43A 3EGDA 3SEPA 3PL6D 2XZZA 5A2CA 5CWSB 1I1AC 4LAQL 4OLXH 4HU8A 2AI0H 3O3DB 4X0KA 3U4EB 2QPFA 4BZYA 5KSBE 5HYIA 3VDAA 4TL4A 3NABH 5C09E 3OX8B 4AE1A 4R90L 3EOTH 4ODSH 5HGBA 1BD2B 2YGVA 2H2PC 4WUKL 3RWGB 4TLUA 2FAUA 2WD0A 2GJZB 2WXOA 4NWTH 5I0ZA 5IB3A 3TV3H 5DLLA 1M1XB 3AT9A 4U1IA 4WKZA 5D7LD 2DMHA 2HN7A 5DTFB 3WEXB 3UROR 4GQPH 3N6YA 1XHHA 3O2DA 3DRTB 1M56B 5DJ0B 3MRHB 1SUHA 5AW0B 2YXVA 3CTTA 4L3FA 3MV9A 2VTFA 4OLUH 1GKEA 4NCC1 4HKZA 4ALAC 4L3AA 4YHLL 3ZIYA 1GSMA 1YEGL 2WZ0A 5IIEB 2ZICA 3APFA 3AY4C 4HISA 2WQVA 1BJ1H 4ANWA 1F4AA 1S9YB 4XPFL 1Y6KR 2JIXB 5IV2B 4HPOH 1QG3A 1WD9A 4PJIA 1R3KA 3ZZSA 1BFTA 2BIHA 2V9UA 3S8WA 2W65B 3CFMA 5HSFA 5IEHA 3W0WA 2R1YB 3ETBJ 4G8FA 1Y0LA 1NIFA 2AEQL 2P5PA 5IK3B 4E36A 1U4EA 1AZZC 3OB8A 1JWMB 1VIWA 4PJ5D 1MVUA 1TLKA 4PW9A 1TFPA 1RHFA 1ES0B 1NM9A 3HZMA 3AQZA 4PJCB 3SY0B 3P1VA 3ZKMC 3ZKQD 4WI0B 3ULSB 1P4LB 4M7LT 3W11C 4F33A 1PDKA 3UZVA 2DYRB 2XBZA 1ZY9A 2F74B 3ES6A 4OGAD 4R7DB 1MHCA 1DO5A 3QR0A 4O51B 3LVEA 1J8KA 2HRLA 4AYBA 1U4FA 5LAXA 4H8UA 1ZSDB 2HPTA 3Q6GH 3RKDD 3LKPA 3V0HA 1HEZB 3IPBA 4D9QD 3II1A 1KGJA 1IC5L 4RGNE 1L9TA 2Y3NA 4DKDC 3MSPA 1RJLA 3VXME 2ENJA 3ULVC 4YSRA 1KPVA 4LSUH 3NSDA 1KTRL 2O72A 4ODXA 4ORZC 4X5WA 4A63A 3JV4B 3WIHH 4JVWA 3FO1B 1HESA 3UERA 2Y5EA 4Q6IC 2EVIA 4AUUA 4CVZA 1IGMH 1S7UA 4LQ1A 4ODHH 3DTDA 5DYOB 1AKJA 3KWUA 1X9RA 3WS3B 3RVVC 1RUKL 4YHKH 3B8YA 1WFJA 2YPLA 5EZIL 3DX2A 4Y2OA 4YEFA 3N1GC 1BG1A 4OJEH 1XH2A 4ZFGH 3BFWA 4PR5A 5DVMA 3WNPA 3L1OH 1JV2A 4R7XA 3IJ9A 1MCBA 2HTKC 5FKPB 4FYQA 4QF1B 5I8EB 1PKQE 3CLWA 1ASPA 4PJEF 1T1YA 4XRCB 3CMOL 3LZLA 2OCCB 4GW1A 4AJWA 1AP2B 4A67A 1M1SA 3FUDA 2PMZA 4ICWA 2VABB 4JFYB 3NG5A 3FOMA 3M1OA 1LO3L 3ATDA 4JJHA 1DLHA 3KBPA 4Y4HD 2IWFA 3L5JA 2PYEE 3WU1A 2E6QA 4JFQB 1CFQA 2NW2A 3MUY1 3FCSB 4WI9A 1NEZG 1CS6A 5KVFL 3K0WA 4KRMB 4NNPL 3RWIB 2XICA 5JXED 4ZTEA 1IC7H 1K6QL 1DVFC 3MBEA 3WTXA 4KUZL 4AV5A 4F2ME 2WBJC 2C4XA 2BFVL 3KW7A 5I1EH 4NQTA 5DA0B 1MXGA 4IBWA 3NOIA 1GYWA 5KVFE 4XNDA 1NUGA 3VI4E 4RAUB 3SPJA 3P4OA 5FGCB 4MSWB 1U58A 4X4ME 3G3LA 5DI8A 5E23A 2G60H 4JVPA 3WO3B 4F1SA 4ODUB 5IJKA 4QXWA 1JTPA 1DZ0A 3Q3GA 4KI1A 5KYUB 3S3PA 4ZX4A 1A64A 4C56E 2ROYA 1E27B 3TJHC 5J9PB 1KELH 2E7CA 1IFRA 3UC0L 5K1JA 1IC1A 1G1YA 5EORH 1AZCA 4XCCL 5D5MF 2Z9TA 4H2AA 2AXWA 1Q38A 2B2XL 2OZ4L 4XX5A 2MSPA 4M4PA 1MFVA 4JFDA 4NOFA 2ZCZA 1EZLA 2EDLA 3FSAA 3T6ZA 2UZYA 1TTAA 2X4QB 4TNVK 4TUKL 4DVBA 2R4RH 3BYYA 5EBLA 3SGJA 4HJEA 2Q7NA 2OBGA 4PU2A 5EZLB 1WSST 2XPZA 4PJ9D 1IC4H 3CFJA 2NY6C 4L29B 4D0BB 4UU9A 2PR4L 4JRLA 4MNQB 4YHLH 4Z1PA 2ADFH 3VSTA 2WWMD 5EDSA 5I82A 3VGBA 1IV8A 3MRPB 3FSWA 4U1KA 1RK1B 1EJOH 1J9SA 4LNRB 5HPMA 1D2PA 4IGBC 4WV1A 2F58H 4D9RD 1C5CH 1EFXA 2XV6B 3P4NA 1NMCB 3WKNA 3TCTA 5FYKE 3QAZC 3KL5A 1TQSA 3C12A 5ESAA 3WFHB 4CVUA 5BRZB 3OKKA 1ASOA 4GKSB 1OSYA 1UXWB 1XH3A 4OCWH 2D9QB 1KCUL 1QRND 2DDQL 2V5MA 3IMSA 4U6YA 5E7BA 3VD1A 3VRJB 4OCXH 3DV4A 1SHSA 3HVNA 4TVPD 4CC4A 1AFVL 4NO3B 2VDPH 1AQDB 4E9VA 1NBQA 3UTTD 1KZYA 2QQKL 2F1BA 3UG5A 1WFIA 1P9MA 3B5GA 1LE5A 2ZAIA 2WM0A 3WIHA 1FBIL 4L1LA 4OCSH 5FHAH 3LN9A 1KBVA 5D6DC 1BXAA 4F8PA 4HG4J 5LDSA 3OMNB 2J7LA 4QUOA 4XCEB 1K5NA 3MV7B 4JO1H 5TE4H 5JHDD 4ELDA 4OM0H 4GT0A 2ZCKL 1EO7A 1WITA 1JGUL 3IXTB 3TT3H 1TJMA 3BCFA 2MCG1 1FYTB 1F00I 1NMAL 4M56A 1K72A 2HP4A 3TH3T 3QARA 1UURA 4F57H 1J8HD 2FT7A 5E99L 1YEEL 3QWQB 4DCQA 3F12A 4GIAA 3D85B 5FKAA 1NANH 2G2RB 1ONQB 4FFWD 4Y7OC 4YOKA 4ZW6A 2LU3A 2IANB 3HBQA 4GRWF 1E3XA 3WNJA 3CC5A 1M05A 1LD9A 5DUPL 2G9KA 2Z7YA 5DMYA 2WLYA 3GHEL 4PJXA 2ATPB 4PVBA 2EXWD 4TF4A 2A38A 1OTSC 3AXLA 5CLTA 3TEYA 1K4CB 4F27A 4LPXA 5KBLA 2ZCHL 3F83A 1R0AL 2NY4B 5BXFB 4MRCA 3ILQD 4DWHA 3VMNA 2XWCA 3AJ7A 4JQIL 1MI5D 3E9UA 4CU6A 2DQUH 3D4GA 1JGLH 3NCCB 3V4PH 3QJHA 4B9YA 2OMXB 4XMPL 3LOWA 3MX0B 3K46A 3MNVB 1LO3H 2FD6H 3DGGA 4MNHA 4JFPA 3T0EC 5L4JA 4KNQA 2YO3A 3GXPA 2VLJB 3SJVE 1YRKA 4BEIA 3V55A 2H26B 4MZRA 1TQVA 5GRZA 5BMFL 4MDRA 2O5XH 5C09A 3KLKA 2XTJD 4YDKH 1T2QL 4OGYL 1L0QA 2V9QA 5F9AC 4TXVB 2WUCL 2AEIT 1SLUA 4XPHL 3MLRH 1NOFA 5GGSA 1YY9D 3BVXA 5FYJL 5T3XL 1G4MA 4B9GA 4YXLL 3AQDA 4XO8A 3GDCA 4K7PH 3FTYA 4L4VB 3AWEA 1JZDC 4L48A 2IGFL 1CMOA 4W6YB 5DQ9A 1CDJA 4XXDB 4Q97A 1QR1B 5FM4A 5E8PA 5I16A 5I30H 2YARA 5FYJE 3BAEL 3T0DA 1FL3B 3QWNA 2XQYA 4NYLB 4OCYL 5T3XE 8FABA 4DKFL 3GD1C 4OIFA 1WJ3A 3BZ5A 1NC2A 4YR6A 3S35L 3S7GA 3ULUE 3LYRA 1A6TA 3P3SA 2FCBA 1QLRB 3MMEA 5E9DB 1JHLL 3RJQB 2UX7A 1SGKA 1P1VA 2H8PA 2N59A 4I9WE 2CO7A 3B2VL 1WS7A 1W0VB 2EDJA 4TLKA 5E8EB 1FN4B 2OP4L 1A02N 1BX2A 5KW9H 1JWUA 1WFNA 5CAYB 1LEIA 3AU0A 4ZODA 2Y6TE 1WC7A 5IQ9B 1A7OH 4G7VL 2FK9A 2BSSB 2CU9A 1R3IL 1XGUB 3IF1A 3FQ1A 3KD4A 4NN7C 1YEKH 3J7HA 2WCPA 4FQIL 3WGUB 3NTCH 4DUWA 5FYKH 2P5WB 2EADA 2APTA 1JF6A 4OCRL 5G55A 3X13A 2J3SA 4AE0A 1OV8A 3STLB 2VRKA 3CC1A 3NSCA 2HLFD 1FNGB 5F96L 4XH2B 1BD2D 5E5UB 4M8VA 3MRBB 5D8JH 4H0LC 1F13A 5I1GH 3DDGA 3ESOA 5C86A 2EIKB 1XT5A 4JM4L 4PYGA 5DFAA 3VXMA 2DRUA 4JKWA 3HBZA 4OLZL 4QRQB 4IMKA 4N9OB 3QQNA 4UIKL 5KG9B 3WJLC 35C8L 3V95A 2QADD 1QLEL 1XMWA 1NGZA 1NEUA 4O5LH 4DOHB 3EIFA 2YAOA 3U2JA 4PJ8D 2QQKH 2CLVA 4PVLA 4AMWA 3R0MA 5D9SB 4GAYB 5CLWA 3L4VA 3ZT5A 1ZTXE 1CU4H 4P2AA 4QYAA 1FBIH 1XCWA 2EUVA 1YNTF 4Y5XA 5ITFB 2NR6A 5DMIL 1Z9LA 3NSFA 4Z7UE 3ARTA 3B7TA 1A7NL 1PKQA 1A1MA 3DO7B 2UY6B 1DCEA 4P5TD 2PTVA 5DD6A 2M2DA 4NC2B 3DX6A 3L9RA 2DQDL 1JGUH 4G5ZL 3KBHE 3MRGB 4Q0XL 4KHXL 5BZXA 1EGJL 2ED7A 3GBNH 3P02A 1M2VA 3DIVA 3L3HB 4PBWD 3ZUCA 3LH9A 4JL1A 5KSUB 1TTBA 1UJ3A 1R3HA 3GEWB 4FP8L 1D5RA 4GG8A 2PYEA 3WAJA 1PZCA 4AVIA 3BH9B 2HFGL 3GMRB 1UG9A 1TVBB 1ET7A 3QJUB 3RDJA 3V4PA 2BVEA 1IILE 4UQEA 5DUBB 4F7PA 1L6XA 4I8DA 5I1LB 4P2QB 1AACA 1DQJA 4PJEB 4NZJA 2H5UA 1DQLL 3OKLB 3MA7A 2B77A 3QG7L 1T5WA 4F2MA 1AZNA 4WEUD 3G9AB 4L8SC 2MKWA 4E5XG 2OSYA 4FKHA 2PPFA 1Q9LA 4UTCA 1RZJL 5IGXL 1P53A 5F89B 3LEYL 3QIBA 1D7FA 2VJXA 1HCFX 3MACL 3SN6N 4JQIH 1T22B 4X4MA 3MXVL 3TONA 4IOFC 1ODUA 5CGMA 4FABH 4KXAA 4PJBF 3V79C 4YUEH 3FCGA 3RTQD 4C56A 2XFXB 3F2LA 4JANA 4YBQC 1D9KC 3WJMB 1OCWL 3QEGL 1ZGLP 5GIRB 3C75A 4O58H 1TSRA 4NM8H 4R4FH 5D7LE 1ZLUK 4M6MH 4ZXBA 2ICWI 3PWNB 4NO5B 4QYOA 5JQIB 4KX7A 5E2TH 4PJAE 1QBAA 4LKCA 3KR3H 1KDJA 3HS0C 3CPUA 3SKMA 4HVBA 1XGYL 4YE4L 2GBUA 3FQYA 1T2XA 3FONA 3HG1E 5A2JH 1J8RA 5AFAA 2ILLA 2YEQA 3BVDB 4ZUUA 4RMSA 3SDDB 3QDHA 2IGFH 4Z7OE 4UM8B 4BE6A 3NK3A 1IM9B 4K3JH 1NLDL 1HOEA 5D5MB 4AKPA 5DD1H 3C60B 3FQTA 3FO2A 3QWRD 4E0RB 5DJ8B 2AERT 2X12A 1A14L 4RX4D 4Z78B 5FAAA 3I2CL 3UC2A 3U48A 1BLNA 5BW7A 4K23H 4Z7AA 4ADGA 4XP1L 2LFEA 4HS8H 4PRID 4RA3A 3NJHA 4WHTB 3V6ZB 4G7VH 1MIEL 2AW2A 1HJCA 2JCCF 5AVVB 5AW1B 4M48L 4UAOB 1WWWX 3UJIL 4FQIH 4TV3A 3FFCE 4OLEA 4WWOA 3L81A 4D9QE 4OD3L 5I23A 3GZOA 3ZRCC 4WFGE 5TDOA 1T80A 1RXLA 3WS6C 4OY9A 4JDVA 3RNQB 3I75B 1GL4B 4ZUSB 3PHQA 4AXWB 3C6LD 4NZFA 4OKDA 3L9EA 5J6GB 4ZZFA 5MI0C 1BEYL 1MCIA 1XSJA 5DK2A 5HHXL 4A37A 4N20A 5DMKA 4KZCA 2BOBA 2A2QT 1I1RA 1GIGH 2NUPB 4ZQTA 1IAIH 1ZTXH 2V2WA 2O6PA 3MLTA 1V54B 3L1GA 5E2WH 5EOCL 1I7RA 1KOAA 2X1PA 1JMZA 2WQXA 2VN4A 2BOCA 1CBVL 2H1PH 4YGAB 5IFJB 2XDHA 3L4TA 3CJJA 1MFNA 1FL6A 3J27A 5E1IA 5DURB 1RUML 1YEJL 1QKZH 3U6XS 4WJKB 3BX7C 3QISA 3VD5A 4AENA 3K1KC 5GS3A 1KJMA 3NZ8B 3L2MA 4JHWH 3KPTA 4O2EB 3RNKB 4XN8A 3ROLB 2XTLA 3B9DA 2PXYD 3VFPA 4HXAL 4EI5C 4GRWB 3EH4B 3PE9A 3IGAB 4KJPC 3QK0A 2JI3A 5AD0B 2OTWA 4FP8H 4BFNA 2F5AL 4BUQA 3SJVA 3HHMA 1A6AB 4JQIA 1QFUL 1JF1B 5C0GB 5PCYA 4Q9BA 5I66A 2V2TA 1ZHLA 1DDHB 2IPUK 2WW8A 2XZAL 1UKTA 2AJ3A 4NQED 3ZYJA 1XIWD 3D2UA 5F1OB 2CRIA 1DQLH 1NCHA 2OMVB 5DJ6B 1OP5K 4XVJL 4V33A 4OB5L 4LLYA 2Y1VA 1YEHL 3ARDC 1JPFA 3EH5B 1N18A 3EYVA 1V7ML 1TJHH 3UBXB 4X9YA 4ANXA 5IGXH 1T03L 5LG6A 1F3JA 3TU6A 5IW1A 1YY8A 4R0LB 2Q7YA 3EYUL 3MXVH 3ARFC 3DOSB 1U3ZA 1VGKB 3WOVA 1V7NL 5A43C 3D85D 3VXNA 2I26N 2XVBA 3PABB 3QXDA 2DKMA 3A6CH 1NBYA 2XWBB 3DTUB 3P77B 4RDBA 1E28A 5C08D 2BHYA 4OFDA 4Y19D 3VWJA 4URKA 2PPEA 3Q5OA 1WLHA 1U8KB 3HN8A 4IRZH 4RQQB 1EMTH 1J18A 4I5BA 3RL2A 1U3HA 4UOW0 4KKAD 2JTYA 4DPRA 3O9WD 1L5GA 3ZHDA 3L3OA 4R26H 1XGYH 3IDUA 4A7QA 2ZXAA 3DETC 5LAPA 5BVJA 4D8OA 4FMKA 4ZO7A 3DROA 4PH8A 4FTVE 1JGDB 1LP9F 3PRZA 4S1QL 5DLMH 4ZFZA 4WWKC 5H2BB 1OPOA 3L5WA 2AJVL 3V0JA 1ZT7B 3HEIB 1ZS8B 1NLDH 2VLLB 3WFCL 4M61B 2GABA 2AF2A 2NY5L 4XPGL 1XGQB 2ZYIA 4XGZA 5I1KL 1ND0B 4YSDA 3MVSA 3ARWA 4LLMA 1I9JL 3NAAH 1E8YA 3D0LA 1AZBA 1IX2A 4TVPE 4X7CC 3AU1B 1OVZA 1CFVH 4PJ7E 2X4NB 2P7TB 3JVGC 3UTTE 1K3ZA 3VXSD 4OGXH 4XN9A 3EJQA 5F7DA 2OXHA 4L4VD 3HMWH 1B90A 4GNKB 4XNMB 4M6AA 3CWGA 5LWYL 5GS1C 4LCWE 1MIEH 4H8QA 1PY4A 4WI7A 1HKFA 3TEZA 1PAZA 3JUYA 3CIQA 4E9QA 5FF6A 1TZOA 5AZEH 3O6FA 3UZQB 3BD3A 3IPFA 3RDTD 1FGVH 1J0IA 5D55A 3FO9A 3KGUA 2APBA 2YEZB 4Z7UA 5E9DD 3RVUC 3HRZA 1S3RA 1T7WA 2JJSC 1ZGLB 5EEXA 1U8IA 2AQ3A 4TULL 1J8HE 1DBML 5E8NA 2YC1B 1JMXA 2WIIA 3QUZA 3N0PB 1E7UA 3HZYA 4WW2A 2HKHH 3K71A 4ZDHB 2DQEL 5FCSH 1OZUA 1QHOA 3GB7B 4FKEA 1IBGL 1YEWA 4FTDA 3NACH 2JMRA 2H6PA 3QJXA 4FG4A 1YYLH 3DGCR 1ZLVH 4JFSA 3FDWA 5I1DA 2O5YH 2JJWA 2EXSA 1O6SA 1YNTB 1CE1H 2D03H 3ARPA 4FFVD 1CBVH 1H5BC 3VAEA 4JFVA 3JQOB 5A2IH 1BJ8A 1M71A 4HWZA 4WY7H 3EGXA 5JPMB 3D4CA 3T2NL 3I6SA 2H0FA 2VAAB 3QFJB 1MI5E 5DFWH 1RUMH 3WGVB 4P04A 2GTWB 5E03A 1XR8B 1YN6A 5FCUL 2EP6A 5JA9A 4JB9H 1KBWA 4F58H 1I3RB 4H1LB 2WLLB 5B8CC 5C0AB 3FB5B 1BQHB 2AQQA 2ZWSA 4XODA 4CL7A 3L5HA 1FF5A 2Q2EB 3OB0H 5I1IH 2Y7QA 4WIQA 2Q86B 3UDWA 3MRLA 4HXAH 4HLEA 4K94L 2LTQB 4HZLA 4Q8BA 2OL3B 1QRKA 2KL6A 4NKMA 3CFDB 4EN3B 3ZDYE 2GC4C 3OKOA 4JJ5B 4IHOB 1QFUH 3JWDL 1F3DH 4AV0A 3CFKA 3ESNA 1LO2L 5D7LA 4YK4B 2DWTA 5JO5A 5DJZA 1KT2A 4KKQA 1NCUA 1G7JA 2EDRA 2NTFA 4ODVH 3RHWK 1E4WL 4PJAA 5IB4A 1JWSA 4PJFE 4F20A 1N70A 1JZ7A 4XWOD 1IGTA 4HIIA 2BPBA 1RPKA 1A25A 4IRZA 4PJBB 2Z91A 5TK2A 3BPOB 5TGBB 2WP3O 1ORQB 1OZTG 2ZYHA 5GHWL 4YHMH 2H32H 4IQHA 2ATKA 2BZ7A 4O2FB 2VXQH 3WKQA 3AW5A 3HUJE 3DOHA 4EI6B 3R06B 2MOVA 1OCCB 3QJFB 4FXGB 2UV3A 4EXPX 3QUYC 5HTSA 4JQVC 4HLZG 1GZHC 5F3FA 3AG1B 5SWQB 3NK4A 2HMID 3BDYL 3JSSA 4WO0A 3APMA 3CIAA 1JZ4A 1FZKB 4M4RA 3VMPA 3G5ZB 3REWB 3VJ6B 4A7GA 2VERN 4UINH 5E6IB 2NLJA 4F2FA 2NCEA 1ESOA 2AJUH 4OTXH 3VRIA 3KLAA 1CLOL 3ALXA 4MAUH 2DYPB 2CIIA 3ML8A 3JTTB 5ACMA 4RGOL 1GPOL 4PJHF 4NGHH 1BD2E 2HT4D 4OBRA 4TVPH 4LGPB 1YMMD 4Y2DA 3BP6A 1DUZB 1QPXA 4G80A 3DIFA 2WKGA 4C58B 5HVWA 2BJML 1HHKA 2PLTA 2FE0A 2YAHA 1GGCL 1ZT1A 4KGLA 1WFTA 5FDWB 3FJTA 3GI9L 1I9JH 2JSFA 3QCTH 3OKEA 4JFHD 3WLWC 5EO1B 5AQ0A 2R27A 1KTDB 1LO5A 1BBDL 3BWSA 3GMQA 1ZAGA 5CF3A 1N2RB 4QRFA 2IFGA 1L7TL 2Q7AA 2JCCB 4G6AC 5E8OA 2Z93B 3H55A 3QP3A 5B1KA 3P3YA 3ZXAC 1X9UA 5LWYH 1IM9D 3RP1A 4FFZL 1X5AA 4LP8A 1BM7A 1QFWI 1D5MB 4XZ4A 1FNAA 2P43B 3KH4A 5EFIB 3JWOL 5CN2A 4S1DD 4I18A 4WI6A 1KIUB 4DN4L 2EICA 4UZSA 1BZOA 3VFNA 2YHGA 2OJEB 4QEGA 4PJCE 5CJXC 2CR3A 3P2DA 1REIA 5GSVB 1K5WA 2HG5B 4Y4FA 1I31A 1FVCB 1ZE3H 4HETA 4Y4HA 5LGHH 4OGZA 5GZNC 2BVTA 1J88A 3D51A 5JXEA 4PGBB 2R39A 1MW2A 1TTRA 1BQSA 3BESR 3T4AA 4JQXA 4P23B 5K9OB 5GZOD 4YLBA 3BO8B 3QIUD 1S9KC 1LMKA 4AL8C 3GXDA 1UZ6E 5JHBA 1BM3H 1CYGA 4N87A 2LLLA 1FFQA 1UVQB 3DI3B 4APQD 1D5BB 2Y07L 4N22A 3LIZH 2MCMA 2EAEA 1DQTA 4ONGH 5ELIA 3U7WL 1PYWA 4G83A 3MRMB 4BGLA 5H4ZA 3KWWB 1MFEL 5HJ3B 1QUNB 5EIIA 4K73A 1KXHA 3AMLA 1WCBA 4YDVB 1E2WA 2Y5TB 2BP0B 4GKZA 4RBPH 1PX8A 5I5MA 3CDCA 5GGRA 1OM9A 2R51A 1PQZA 3DX9A 3FB6B 3GSXB 4NQXA 2A77L 2ORBL 2OYPA 1YJDH 2QKIC 3GMNB 2H32A 2OX5B 4Z7NF 1HQRA 3JWDH 3DMMC 2VXQA 4YN3A 3G08A 1R5IA 1G7IB 4AQ1C 2IPKA 2ZF8A 2R1XB 3LQZB 3QH3A 4J3OC 3D1MC 1G1KA 3K4AA 3WN5B 2DQHH 4PJ9A 5DD5L 1DYZA 5D1ZC 4N2IA 1DQQB 3GJEB 4FTVA 2P48B 4J23A 1NC4B 2YJQA 2NW3A 3CFNA 4AZ8A 3UPRB 3DYPA 4ABQA 1M7DB 4XZUA 1LO0H 1SY6L 1VHPA 3O8XB 1R46A 2A6JA 3HR5A 3IFLH 3IMWA 4HEPG 4IBLT 1S7VA 5TE7L 1I8LC 2H0PA 4FJYA 3AITA 1T1XA 4YDMA 3F7YA 4QCIB 4KROD 2RQEA 4FLOA 3H0TA 4KPHL 5FGCE 5J56B 3IMRA 3CCHB 3QJSB 4PJ7A 2CXKA 3ALPA 2AXGB 1LP9B 3V5HA 1XBRA 3UTTA 3NJGA 3BEWB 4TNGA 1CK0H 2NDGA 3FQWB 2YMOA 1UADC 3U2SB 2GBAA 3CZLA 2NCMA 3AREC 1UM5H 3N85L 1AD0B 4IDLA 3F04A 2DD8L 3NRPA 1I7TB 1L9OA 5D71H 1JI2A 4XAKD 3RIKA 3T0XA 4LCWA 3DHUA 1OAJA 1AC0A 3I9PA 4NJ9L 4PS4L 3WN6A 1OHZA 3VFRA 1EWHA 4Y4KD 5C0CD 2GSGB 4AGOA 1IE4A 4U3HA 1JN6A 1F58H 5A6LA 5ILTL 3JWOC 3ROOA 3BXNA 1JZEA 3FT3A 4U1JB 2ZUYA 2VL5B 4NM4H 1B2WH 1C5DA 1RD6A 2EKSA 4LLQA 1Z1WA 3ERXA 1J8HA 3D0VB 3QO1A 3BUTA 2IH3B 4QHKI 4XBEH 4MNQE 4KC3B 2OMWB 5D70H 1L7TH 4H8WC 3KPSB 2NY0C 1KB3A 4HA1A 3V9EA 4PGEA 3CLEL 3LEXA 2L4OA 3DSFL 3ELQA 4HHAA 4LEXH 4Y5VA 2XFGB 4DH2A 3RE0A 4DGVH 4IBVA 4QRBA 5AVTB 3CDYA 1YEIL 3DVIA 1X7QA 1OW0A 3E6FA 4G71B 1YQVH 4YPJA 3VD9A 4P3CH 2E9GA 2FRGP 5DUML 3QPXH 4YDNA 3ZGHA 1PD1A 1JYWA 5ISZE 3CH8A 5IUSA 4FADA 2DQIH 1MI5A 2BY2A 1OARH 3L2LA 1NPJA 1Y1DA 1WHOA 3ULUL 2Z31B 1IKFL 2AK4D 5CJBA 1DJIA 4KK9C 1A9EA 1FJ1B 4HS6B 5E2UH 4OJCA 3NFSH 5EU5A 1A6UH 3D18B 3L45A 4O02L 3LIZA 2G2NA 4K7FB 1TQTA 3B34A 1AJ7H 4EKXA 1QBLH 2QSCL 1H0DA 1UOVA 2JQMA 4TSAL 5F72S 2AJZA 3N91A 1GZPA 2IOIA 3RWDA 1TPXC 4QRUB 3U83A 3S37H 1NGPH 1PBYA 3DHMA 3ZL4L 3MV7E 2Y2YA 2KQNA 1HHGA 1QSFB 2MTAA 1N4XH 2VW7A 1FVDA 3AG4B 4UQ3A 4JZNA 2F54D 2X4UA 3TVMB 1FP5A 1FYTE 3HC3H 4Y16A 1KMGA 1BZDA 2UVEA 4XP6H 3EFOB 4KY2A 4R2GD 4PJFA 3ECUA 1RIVL 1PD0A 2GG1A 4ZX6A 4I0PD 4ZW8A 2CDGA 3ARBB 4PVMA 4OLWH 1PZ2A 2IANE 3TJPA 2O1AA 1WZMA 4G6JH 2YIHA 3S9DB 3SGDI 1GY1A 1J5CA 1V3MA 3B3IA 3AZUA 1MW3A 4DGIL 3DX7B 2WVTA 2OXGA 2OCFD 1OXYA 3HUJA 3PWVA 3QXAA 4GRLB 2FL5B 2X42A 1U8HB 3H7BB 3P30H 3KYOB 4P57B 4TM9A 5CIPB 1JNLH 3FU5A 2E7BA 2NSQA 2FX7H 5IW6A 1HSBA 2JI2A 3QO0B 2Q5BA 4NZ8A 2X2YA 2XV3A 5A6MA 4FXTA 5LXGL 5F1NB 5HPOA 1DLFL 1HQ4B 4PRBA 3PWPB 5HHOB 1NGXB 2BHUA 5I17A 4W6XB 4M8QB 4PV1C 5CWSA 4M93B 3GLAA