4YSRA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 16.6 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 96
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysrA00
1R1CA 2GC7C 5D4JA 3X1FA 1URIA 4Q8BA 1E67A 2XU9A 1BXUA 4YSUA 2H47C 1V54B 1PLBA 1BAWA 1SDDB 2UXGA 2BP8B 2H3XC 1JERA 1W6LA 4AKQA 3ZBMA 3SBRA 4GP8B 2QDVA 1OCCB 1J9QA 4GP5B 3IN0A 3ERXA 1ASOA 3QPKA 1DZ0A 3AW5A 2AZAA 3CDZA 3CG8A 4DP5X 3QJRB 3OMAB 1IKOP 2XV0A 1JXDA 5B1JA 5B1AB 2FT8A 2AVFA 2XYBA 3EH5B 4KOCA 3ZDWA 2YXWA 2WO2B 1OE2A 5IY5B 3IEAA 5B7MA 2PCYA 1RKRA 2BW4A 4YSDA 1IUZA 3AG4B 3FYIB 2YAFA 3T6XA 2CBPA 3T71A 4BDVB 3FQYA 4N4YB 1JVOA 1GSKA 5AZUA 1L9PA 1NPNA 3NSYA 1KYAA 4A68A 3PAUA 4KO5A 1A4CA 1OV8A 1PAZA 2Q9OA 2BZCA 2YAQA 2VSKB 3WI9A 3FU8A 4NB7A 1MG2C 3FSAA 2J5WA 3L45A 1FWXA 2XX1A 1KBWA 1ILUA 3JT2A 1AS7A 1GY2A 2Y1AA 2PPAA 1ILSA 3KW8A 5B1BB 1B3IA 1AOZA 2ZWNA 1KDIA 1ET8A 1PLCA 5F7BA 3S8GB 2DY2A 4EF3A 1UATA 1GW0A 2UXFA 2VMJA 2CUAA 3NJHA 5B7EA 3DTUB 4F7KA 2I85A 4A2GA 2J57A 2E86A 3QJTB 3SQRA 3QJQB 4G7QB 4DP7X 2ZONA 2XXGA 3FYEB 4YVNA 3NJIA 3AY2A 3QQXA 1OCZB 1J9RA 1L9OA 1MZZA 1OCRB 3NSFA 1EHKB 2YXVA 4ZK8A 1IBZA 2DWSA 1HFUA 3T9WA 3PPSA 1SF3A 4DPAX 1L9QA 1CYXA 4YSTA 1E5ZA 2FJSA 3KW7A 4KNTA 3MBWB 4HALA 3WKPA 2HX9A 2GSMB 4DP0X 2WO3B 3OQRA 2VM3A 2LLNA 2I7SA 2IDTA 3FQ1A 4HHWA 2IWKA 4YSRA 3WNIA 5I5JA 1OE1A 3ABKB 4E9SA 2VW7A 3MX0B 1KDJA 3X1NA 3GXUB 4DPBX 1NWPA 3FS9A 2PLTA 5LDUA 3TBBA 4E9QA 1XB6A 2DWTA 2X88A 3H56A 2PPDA 3NYKA 1SDDA 1WA0X 1BXAA 1E30A 1JZGA 2BP8A 2YAMA 2IH8A 1KCBA 3H4FA 3WIAA 2FT6A 1SJMA 1L9RA 4HHGA 3ABLB 3BVDB 3GDCA 4UAHA 2YQBA 2PP7A 3FQ2A 4QKTA 1ZV2A 3PLYA 4M3HA 1T5KA 2QPEB 1CYWA 4CSPA 1GY1A 4KO6A 1AIZA 2PP9A 1A8ZA 4AX3A 1SHWA 5AFAA 2CAKA 3S3BB 1TKWA 4FAAB 1CC3A 2EIMB 3S3CB 1JVLA 3FU7A 2BW5A 3PCYA 1M56B 3G5WA 4PAZA 4E9RA 3FSWA 3D12B 1CUOA 2MTAA 4BWWA 4F2FA 3FT0A 4BDVA 2VSMB 1JZIA 1ET5A 1QLEB 2GI0A 2FQGA 1AS8A 2BO0A 1ZDQA 4KO7A 1WA1X 3CZUB 4CSZA 5I28A 2PPEA 1M57B 4P5SA 1XMEB 5A7EA 2AZUA 1V55B 2FQDA 2IWEA 4RH4A 2DYSB 3ZIYA 1ZPUA 1GS6X 1I53A 2IDFA 1BQKA 5D4HA 2X87A 4GY4A 4BXVA 1MZYA 4A67A 2CCWA 1A3ZA 1GS8A 3ABMB 2EIKB 2GBAA 2HLEB 1ASQA 5FC9A 4YL4A 2IWFA 2YAPA 1QHQA 2P80A 2FNWA 4E9VA 1NDTA 2JFCA 4DP8X 2I7OA 4Q89A 1BEXA 3NT0A 5I6OA 5B7FA 2FQFA 2HRGA 3CVBA 5I26A 3UAAA 4F2EA 1XB8A 1JXFA 2YARA 3FPXA 2P80D 4YSCA 4DP2X 1QNIA 1NIDA 2IAAC 2H5UA 2R7EB 5PAZA 2NRDA 1KGYE 2VW6A 4A2DA 2BWDA 2UXTA 4A2EA 3NP3A 3BQVA 2GC4C 3RYMA 4BWTA 2W8CA 4GP4B 5B1JC 1XB3A 4JHUA 3UACA 4YSQA 2B3IA 5AKRA 4HZ1A 3WG7B 1NZRA 3OMNB 3H4HA 3X1EA 1WAEA 4N8UA 1NINA 3FU9A 4K9JA 1AACA 1OOWA 3PAZA 1KBVA 2YAEA 2HXAA 2GHZA 4WTQA 4DP4X 1SF5A 4E9YA 4DP6X 1NICA 2XWZA 4G72B 4ENZA 1VLXA 2QDWA 3UADA 3EF4A 1ZIBA 3AG2B 1AAJA 4YSAA 1J5DA 3HB3B 4FA7B 2BWIA 5D4IA 3AG1B 1BQRA 3S3DB 3JTBA 1NIEA 2XXFA 1AZUA 3ASOB 1OE3A 3OD3A 3PXLA 1BYOA 1AANA 2UX7A 3GYRA 2XX0A 4UANA 2XLLA 2QPDB 4GXFA 2DV6A 3C75A 3CVCA 1A4BA 1SFHA 5EHFA 3IN2A 1RCYA 2PCFA 5I5IA 5I6MA 1E5YA 1GYCA 1HAWA 2QT6A 4NERA 4E9TA 3N55A 4BXSV 4YSSA 3PAVA 3EH3B 1FA4A 1MG3C 2TSAA 7PAZA 1E65A 1F56A 1ID2A 1PMYA 3NSCA 3FPYA 4P5RA 3QJSB 1J9TA 1JZEA 2J55A 4G70B 3X2QB 1PNCA 1AZBA 9PCYA 2A3TA 4KOBA 1AG0A 4AKOA 1IC0A 3V9CA 1AZRA 1X9RA 1N68A 4JKNA 2GB2A 1J9SA 1PNDA 2Y69B 1NIAA 3X1BA 3ABGA 1ZIAA 1N70A 3X1GA 1V10A 2BP0B 3IE9A 2WSDA 3NJMA 8PAZA 2FWLB 2JXMA 6PAZA 2AANA 2YAHA 2IDUA 1ZDSA 3NJLA 1J5CA 1SNRA 1AZNA 3AG3B 4A66A 4NAJA 4JHVA 5I6PA 3NP4A 3OMIB 2VW4A 2MRYA 3NJFA 2YAOA 4YSEA 2PPCA 1SFDA 3QJUB 4M4RB 1TEFA 4UF7C 7PCYA 1JZHA 3EHBB 2XV3A 3S8FB 1NTDA 2PPFA 1GR7A 1AS6A 3IBOA 4W1TA 2VN3A 1BXVA 2B08A 3UABA 1KV7A 4E9WA 2HRHA 4KO9A 3ZX1A 1DYZA 3OM3B 2IDQA 2R7EA 3FU7B 2UX6A 2ZOOA 3CDZB 4BK5C 1ETJA 4YSOA 3V9EA 4L0PB 1IBYA 2GIMA 4E9XA 5I5MA 3ASNB 2J56A 5TK2A 2N0MA 5I6KA 5E9NA 1PZCA 3T6WA 1W8EA 4X4KA 1TU2A 4A2HA 2OCCB 1M9WA 5TK4A 3NJJA 4KNUA 1OF0A 1A4AA 2EIJB 3UGEA 1ET7A 4MFHA 4PCYA 3UAEA 1JZJA 2OJ1A 5ANHA 5PCYA 1NIBA 4HCFA 3FSVA 4G71B 1L9TA 2AFNA 3AZUA 4HCIA 2EINB 1PZBA 1L9SA 2HZHA 3FSZA 3SBQA 1PCSA 1RZPA 1AZCA 1WS7A 1PY0A 2PP8A 3NJGA 4AZUA 1A65A 1JZFA 2OV0A 2FQEA 2XUWA 3DIVA 4A2FA 4DP9X 2EILB 2RACA 2VM4A 5B1KA 1X9UA 3N2JA 4YSPA 1ASPA 1NIFA 5B3SB 2FTAA 2CJ3A 3QJVB 3TA4D 3TASA 3CVDA 2HX7A 4G7SB 4HIPA 2CALA 3WKQA 4G7RB 3T6ZA 1PLAA 1NWOA 1FFTB 2UXVA 5F7AA 4KNSA 2BZ7A 1AQ8A 3DKHA 2FT7A 1WA2X 1JXGA 6PCYA 3T6VA 1BYPA 5I6NA 1TEGA 2DYRB 2TSBA 3WNJA 1PF3A 1YLBB 1MDAA 2HX8A 4GYBA 4WKXA 1AR1B 1SHXA 4DP1X 1BQ5A 1ADWA 1CURA 4AKPA 5I6LA 1KCWA 2BHFA 3NJKA 4AI7A 4QLWA 4HCGA 4W9ZA 3NSDA 1HAUA 3EH4B 4DPCX 2JKWA 2ZXWB 3U25A 1RZQA 4TXVB 2BP0A 2W88A 4HAKA 2XV2A 1EZLA 1NPJA 3NJNA 1OCOB 3SBPA 2Q5BA 1AG6A 3HEIB 2XVBA 1WS8A 3TU6A 1PZAA 2IH9A 1JOIA 4YVUA 1GS7A 3TBCA 2IDSA 1W6WA 4BWUA
chains in the Genus database with same CATH superfamily
4TSAL 3G5XA 4LVNC 2VXSL 1MCOH 1U3HC 3FFOA 1SBBA 2C9PA 2PXYC 1J48A 3REWA 3DWTA 1QABA 5DC0A 3QEGH 1E5BA 3T8XB 3P0YL 2OX5A 4PWFA 4OFQA 1B9ZA 3N41F 1JRHL 2JCCA 4D0CA 1UHVA 2OTWB 2GSIA 3V4VB 3KS0H 3RUGA 4GP5B 4TRPH 2C9SA 1Q9LA 4ZOAA 3QR2A 2G3ZA 5HHPA 4XX1G 2DJ4A 2HKAA 3AT0A 2G2RA 4K0OA 4G11A 2ITFA 3UTSA 1M6OB 2V33A 5L8LB 4TQIA 2D0HA 1WRFA 4ICWA 4N9GB 3KPNA 1V27A 4K2UL 3MNZA 1MSPA 4KRLB 2F54E 3ZE2F 1IGMH 3B8SA 4LMQI 4YFDB 3IEAA 3N0PB 5HJBA 5KBLA 4FFVC 3R8BB 5JIMA 1I1AB 2J44A 4PJXE 1K2DA 1YY8A 5EPMA 5G5DA 3SZ6A 3TZVC 3BKJL 1UENA 1YJDH 3OVUB 4RAHA 4IK7A 4YN3A 3VACA 4WTXA 2APTA 4DZBB 1SLWA 2W9DH 4XBGA 8FABB 3GI9H 3LKSA 4P5KB 5DUPL 2Y2WA 4L4JA 2Q9OA 5FO7A 3BGMA 5GRJL 2NY4D 4E42B 1SXCA 3TA3D 4JPSA 3BP6A 5FECB 5KYXB 5DQJA 2Y24A 4XB8A 1QSED 1DSYA 1WBZA 3L7FA 5EN2A 5E4AA 1MWAL 4FFWD 5AW9B 3G5VB 1GY2A 4DOHB 1CF8L 2VLRE 4YGVB 3U6XS 4M56A 1PZ3A 3I74A 3O8XD 3B2UC 2ICWI 4RMWA 4AV4A 5CAYB 4JFEB 5E24E 1FZKB 1ZTXE 3GLDA 1UATA 1GW0A 4QHUA 1S6NA 3D87B 5IMOB 1ONQA 3BWSA 2Q86A 2E0PA 4I77H 1KCVL 2HVJA 3V0WH 2PR9A 3BI9X 3FTUA 3S34L 5BRQA 2WOBA 1NCHA 2ADJA 2EUWA 3IDIA 2BINA 3ZE0B 1RMFL 5HYQB 4IIZA 4YVNA 2IMNA 4UILL 2VNCA 3ZQ9A 3AY2A 5KBKA 2XPGB 1KT2B 3OAWA 4MCMA 5EA0H 3TIDA 4OD2B 1R0AH 4ZX5A 3FB5B 2W1NA 2YXVA 3E8UH 3UG4A 3SYAA 3UTZB 1F11A 3FTZA 1HHKB 2H26B 1DTUA 1SF3A 2R1YB 5INCA 3HAEA 2PR4L 4JM2A 3N44F 2Y2YA 4K3EL 5GRYA 3D0LA 4MJ5B 3CDGA 4IU3B 1ZS2A 4DP0X 3ZE2E 3VXSD 1OQOA 1AIFB 1LWHA 2CO6A 4GXVL 3W0WD 3WIFB 4IBLT 5I30H 4MASA 2DW5A 4FNLH 3SD5A 2F7QA 4HGKC 5D9SB 1HNGA 2OTPA 5D1XB 4Z3FA 4X4XB 3TVMA 4RQQA 3EJTA 1IKFH 3VFGL 3MGOB 1JZGA 2WTOA 4R7DA 3UTTB 4I85A 2F53E 4MRBA 4CVWA 4X5LA 2D73A 3T0DA 2J8OA 2Y7MA 2R0ZL 2XTSA 4JO2H 4OQ1A 4YNYB 3S9DB 4Z7WB 4IM8A 4OLZL 1OB1B 2KZKA 4D0DB 2VDKB 5AFAA 2PTUA 4O9HH 3KWXA 1ZT4A 4XNYH 3AS2A 3PP4H 3Q3GA 4UQ2B 4FAAB 3SKMA 1NOLA 3H85A 1PSKL 1SJHA 3EHBD 4ZUTB 3DXAE 5AVTB 4EXPX 2D0FA 3H2PA 4JRYA 2K7PA 2K6ZA 2XOTA 2Y6TE 4PGDB 4K5LA 1TFHA 3U0TB 1KWKA 4ZNEA 3KH3A 3CN3A 3FT0A 5IBLC 1W72A 3FOLA 3VSVA 1JWMA 4UDTA 1XIWC 3EGXA 3VM7A 4G6FB 2XRAH 1S8DA 1DHKA 2Q1EA 3EYVA 4ZTOH 3TEYA 5E5MB 4UDUB 1OTTD 1CU4H 2VR5A 3GXDA 4DCQA 5I19L 4K8RC 5CJQL 1J88A 1YCSA 4BZ1H 4PJXB 1MCFA 4D8OA 4LP5A 2OI9C 3WTWA 4DGWC 5E8NB 1KGIA 2VDRL 3SKOA 2J20A 1XR9A 5E6SB 1ORSA 3VD3A 2IAMC 3CXFA 3KLQA 3DSNA 4KQ4L 3HTLX 4ZFFA 3AM8A 4NQDD 2BSEA 3FW6A 1DQLH 2XWBA 3NA9H 4NOFA 1U91B 2VDOB 3A21A 4HIHB 2ZIDA 5IJVA 4HDIB 4GQ9H 1S78D 3QO0B 2VLRB 5L8JB 4D0BA 1UD8A 3VXTA 2XTJD 4RMRA 1I8MB 2BNRA 1UGNA 2AERT 3EFDH 1NDTA 5HXMA 4WW2A 3OKYA 5IF0B 4G83A 2C4FU 1FYTB 2J5LB 2P3YA 3CSYA 5I8EB 3RWJA 1PX3A 5DJZA 1MRFH 3CDFA 5F9WC 4P3CL 3ZDXF 4YSCA 2X3CA 4FQCH 3BGFB 4F7PB 4K94H 1GPOH 5I1IL 3PHQA 1DJXA 3I6LD 4NZRL 1TZHA 3LEVH 1XCTA 5HJDA 5KWYC 1AC6A 3RAJH 2OMUA 3TEWA 5FYKU 3QB7C 3QHTC 2N7BA 4LAQH 2YFOA 4GP4B 1URZA 1MCWM 3FFDB 3MLWL 2ZJSH 3V5HA 3X1EA 2DLGA 3NDZE 3P77A 1HEZB 4S1RH 3HNVL 1JMXA 1DLHA 3CFQA 1S7WA 2WZ6A 3GHBH 3JWDH 2N01B 2P42B 3KPPB 5CF3A 3C08H 3I6KA 5D1QA 1DJGA 1YNLH 2JI1A 4QRQB 1XF2A 1BPVA 2VOTA 4DP4X 2GQHA 2J7LA 4DP6X 3ALPA 3ZE2B 4ENZA 1VLXA 4TVPH 2OZNA 4XPAL 4OV5B 4HD5A 1G7PB 5JLZA 3FO2A 4QUOA 3V4VH 4PJCA 2JMRA 1JK8B 1A64A 1I7TA 1P7BA 4XCEA 3HN5A 2I07B 1I7ZB 4JPWH 3KWWB 3SGJC 3BH9B 2HLFD 2R9HC 3ASOB 5TQ0H 1OE3A 2VLJE 1OTSC 1MF2L 4ORZC 4W81A 1NMAH 1MQKH 3K46A 4XCNB 5LLIC 2KS0A 3CZEA 4UOW1 5CP7A 1CLOH 1SBSL 2VUYA 3CVCA 3EG9A 3PRZA 3RDTD 3ML9A 3TM6A 1RHFA 5LG1A 3RJOA 4XCFH 1WP6A 2YPVL 1GYCA 5F9OL 4HKBA 4BYHA 4GRLD 5TDPB 1J9CT 5HGDA 2IO5A 4OZGF 4OCXH 1JS4A 4YSSA 3VXSE 1SXZA 1E4XH 2MHAA 4F8PA 4J8QA 4JB9H 1ID2A 4MXWL 5SWQA 5I1JL 2DWYA 1BZEA 1VESA 4GW1B 2VE6A 4MMZA 3TJEH 3LQAC 3DXAB 3ES6B 4JKPH 1T83C 1ZHKA 1HL5A 3ZDXE 1A6VH 1T80A 2EUZA 1SUJA 3IB4A 5E1QA 4BM7A 5IWLC 3N1MC 4MQXC 4AKOA 4CU6A 5I18L 1N0LB 4LNVA 2IIJA 2CR6A 3QS3A 1JAEA 4RISL 4YZFF 4JFYA 1YC8A 3PL6C 4RFNC 4XO4A 6PAZA 1Q9KA 4M7LT 3RFZC 3O0RL 5CEZE 2Y5TA 1BZDA 1UH2A 1CLVA 3GSUB 1EJFA 5DZNA 3RNQA 1YEDB 1LD9B 1J1PH 1MHEA 1UA6H 3VGDA 4JHAH 5J1AB 1OGPA 2IOIA 3BWAA 3QJUB 3N44B 2AK4E 5EIIA 3KZ8A 3VB8A 1F90L 2YIHA 4U31A 5J11C 3NH7H 1PL3A 4AITA 4M61A 4ZOBA 1CIDA 2EDJA 2YR3A 4ICXA 1AS6A 3IBOA 4HCRA 2VLKE 5KG9B 4KK9C 1X6LA 2IAND 1GJIA 5F7EL 5D96C 2VT0A 5KSVA 3BAJA 2GUOA 5A2IH 1UM5H 2V7HB 2VXVH 5C71A 5I8OL 2HB0A 3CSBA 3F12B 1KG0A 1KIPA 2CO4A 3ZMNA 1H3VA 5IQ7H 1L5GA 2Z31C 3RZWA 3FL7A 1RFDH 3ZKQD 2OMBA 1CI3M 5JW3H 3MA7A 2NLJA 1RZ7L 5EU6D 4AQAA 3P9WB 4KXBA 4Y8AA 4YFEA 5TE6L 1U8OA 1QZ1A 2CLRB 1VGKB 4GMTL 4G5ZH 4DO6A 4OIAA 4Z3TA 1JHLH 4R90H 2NY4B 4OZGE 5DUBB 2I5YH 3ARXA 4ZOEA 4AUYA 1AJ7H 4F93B 1QSEB 3QEQA 2LQRA 3BWZA 3PS6A 4H4NA 2WVUA 2EINB 3KD4A 2HRPL 3P9MA 4FKEA 3SBQA 1D7CA 3C9NB 4KKBC 5E1GA 4NUMA 1KELH 4LDLB 4PWGA 4PCTA 3O8XB 3NJGA 3VFRA 1Y7VA 5C0RH 4KXDA 4R0LB 4YZFE 3BPLB 2VDKH 3MREA 5AVWB 2JE8A 3TIEB 3QWRD 2CJ3A 4KNQA 3LXAA 3MV9A 4HV8A 4O5LL 4B9CA 2K3HA 1NDMB 1L7TL 2B2XL 3I6LE 3QIUC 1BVKA 4P5TA 1CDGA 5HVWA 2YJLA 5T5FH 2VLJB 5DU7A 3UZEC 5J7CC 4HK3N 3R0NA 4NUQA 5FYJH 1OP3K 3V0FA 2WNXA 3JV6A 3T2NL 3FN0L 3GSNB 2NT0A 3CLEL 4W4NA 1TVBB 1MAMH 1Q0YH 2Z7ZA 1G4MA 1JNNH 3PWPD 2H32B 4ZUUB 2OTUB 2WWMD 4ZPTA 5DDHB 1KN4L 1Z0MA 4WY7L 1GJUA 4JFQB 3OX8B 1HAUA 2NY1C 4YHKH 3VXSB 4GMSH 4CN1A 1ZV5A 3B9KB 2W88A 4FHBD 3W0WB 4JFOA 3ZDXB 1GH7A 1U8KA 5ESVA 3GQFA 5DK0B 1E9QB 2BHUA 3AROA 1ES0A 2R0WL 3HE6C 2K70A 2NNRA 5C7ZA 2VDOH 3O2VL 1T04B 2CK0L 2PO6C 4UMSA 2X53A 5F7WC 4MD4B 1O7VA 5CZXC 2P5PA 4YSUA 4LQ1A 5FGBC 4FNPA 2WYHA 1ZTXH 1IAMA 1P84K 4MZRA 3OZ9H 3RRQA 3F5WA 4J1UB 5ICXA 4JPQA 5C08A 2P9RA 4AJ0A 5EO9A 4DP5X 2ZUVA 5MI0B 4KGJA 3H7BA 4OCRH 5JDJA 2JIXB 4JUTA 3CXHJ 2F2HA 2XYBA 4RX4A 4DH2A 1IGFH 5ECJE 4ZPVB 5GJTL 2QGEA 4O02B 2P5WD 3FQWB 4X5WB 5DMJB 5K9KB 4YSDA 1J1XL 4XNAA 15C8L 3O2WL 3QCVL 1ETB1 4PV8B 4TNGA 1WBYA 4P2OB 1JVOA 4TPRL 3T4YB 4LHUD 4YHYB 3D6GA 4S1SH 5C07D 1CS6A 1M3JA 2BZCA 2LVEA 3SDYH 1M1XB 4XWOC 1VFAA 1W80A 3FSAA 3F3HA 3HC2A 1QFWI 3QORD 3Q6FB 3QHZH 4X7SL 3EO0A 1RZGB 4QRAA 1S3RA 1FWXA 5FV2A 3V7MA 4BELD 2DQTL 1RPKA 5F9JB 4MVBC 1BZ8A 5MEND 1YECH 1IIIA 1S3KL 1VCAA 4IBZA 5GS3A 3MRMB 4Q52A 4QWWC 3P4OB 2P5EA 3HRZB 4YBLB 4LLWA 2ORBL 3LZQA 4Q0XH 3SPVB 2Q8BL 1OP9A 2XTJB 4QT5A 1U4EA 4FYQA 3TFKD 2FUQA 2XWTB 2MCG1 5LBSA 4AXWB 4MB5A 2E86A 2OMWA 3CIQA 5G4OA 4WWKA 1MLCA 1HSAA 1OAZL 3EFOB 1EQWA 3VD0A 4C83A 3DHUA 2FYYA 4PJHA 2CXKA 4ELKB 4NQSA 4Z23A 2P1YA 1YQVH 5DJ2B 2R27A 1DFBH 3GIVB 2WYTA 1T1WA 1GIGH 4N2IA 2EXWC 5DJXB 2O6EA 3CFCH 1F1AA 5HI3C 3SDDD 4EBQH 4ODXB 1XD0A 2CJUH 3KXFD 2P7TB 2HVKA 1A7QH 5AKTA 1CCZA 3IJ9A 4M9PA 3MRDA 3KPTA 5AAWA 3NFSH 4ODHH 1QEWB 4HWZA 1XL4A 3BAXA 5AWNL 1J86A 1FNAA 3D3VD 2VM3A 5IVXA 2IDTA 4YSRA 2WN3A 1MFBL 4JQVA 3HI5L 1G9MH 3J8F7 4OJAA 4QRSA 5IV2B 1TTRA 5L4JA 1BBJA 2A4EA 1U33A 1DUZA 3BPCA 4FF9A 2V9QA 2A74C 1T5WA 4FQIL 3O11A 3X1NA 3E2HB 5HYJD 2YZ1A 1IFHH 2ZCKL 3MRFA 1HXYA 4H8WH 4AYFB 4YXHH 4JR9L 5JPMC 1E3XA 2L7QA 3H56A 4OI7A 12E8H 3DARA 5K9JH 5D2LB 1FRGH 3CCHB 3PWUA 1KCBA 4M3KB 4WGWB 2OM5A 4JCWA 4QRTB 2YPKB 3QFJA 1VJSA 1ZWIA 4PREB 5LUMA 2J8UF 3M45A 4TMPA 1JPSH 4U6YB 5IHHA 2J21A 2HA1A 3G5ZA 1U2HA 3KM2A 5A3IC 1AH1A 1IGYA 4YR6B 2WUBL 2VABA 1L6PA 2WBJD 5DHYA 4QJ5B 4GQZA 4ZMYA 5BMFH 2ENYA 5DZAA 3MLSL 3FB7B 3I84A 2Z93A 4K3JH 1Q0XL 3CHQA 4YHOL 4LCWD 2JKIS 1ADQA 5ITBL 3UOAB 3MJ8B 3ULSA 2YLKA 1FUNA 5AW3B 1YRKA 5LVEA 4XCCL 2DKSA 1QLEL 3MRGB 4AT6B 3T0EA 2ESVE 3MBEC 4U6VH 2VKWA 4L4VD 4R9HA 3IFOA 3C5XA 3TN0A 4CSZA 2VDQL 5I28A 1CT8B 3MZTA 4JKLA 1FNEB 2VO8A 1EZVY 2H0JA 4QRBA 2FNBA 3P9LA 1N8ZB 5KVEL 3MV01 4Y19A 3VRIB 4JGUA 4XMZA 1INQA 5C09A 1XX9C 5GHWL 1ZPUA 4N8VA 3RNKB 3MRIB 3CPLB 3I85A 4TNEA 3IGAA 5FYLD 2W60B 2AAAA 4TTGA 3RVXD 5C0IA 5C9KA 1E42A 2G5RA 3L3OB 4NS0A 3ABMB 1KB5B 5FO8A 4WSKA 4JHWL 5HHOD 4HIEA 5DD1H 1KUMA 1S5IH 4OCWH 5FC9A 5JO5A 3CPUA 2WQWA 4P3DB 2GJZA 1BFOA 2SODB 3VXME 1G9EA 1ZEAH 2IANB 2BIMA 3QNXB 2ODIA 5HDQL 1AQKL 3MRRA 1UG9A 3GSNH 5H2BB 2P5WE 2NW3A 1AKJD 2XWJB 4A39A 1Z9LA 5I73C 3NG5A 1VIWA 2Z8WC 5KBPA 2FYVA 2H32H 2VL5A 4BQ8A 4X9FA 3INOA 5AD0A 2YEQA 3JZYA 1HHJA 5EU6B 3UAJA 5C07E 1U8MA 2E4FA 2ICEB 1EMTL 3NP3A 5KSBA 1BZ7A 4LSVL 3O45A 3BUYB 1OCWH 2VZSA 3CFEA 4HWEL 3UJIL 4XC1L 3IFLL 5HGHA 2EEAA 5ALCH 1K5WA 4YSQA 2B3IA 1I75A 1NBVL 1M71B 4ZD3H 3D0VA 1IM3A 3AB0B 3QNYB 1A3LH 4XT1C 1U8QA 2H1LM 3JWOC 4P46A 5F7HA 4N5EC 3K4ZA 1RH8A 3HPJB 4JBSA 1XMWA 3LRSA 2GHZA 2KZ1B 1AO7D 1T21B 2JELH 4LHUG 5CNHA 5EMYA 2FEJA 4ZAKC 4ANWA 1YPZF 2XQYK 3L9BA 5CEZH 2CKBA 3L4UA 3Q6GL 4DO4A 5IFAH 1E4KA 1HCYA 1F6AB 1S7RA 1MJJA 4HEMA 4PW4A 2XIIA 3B7UX 4B95C 4LP4A 3S5LG 4AQ1C 2GJRA 5CU5A 4IBQA 1SN2A 5C0CA 5D4IA 3AG1B 2H8PA 3S3DB 4X8GA 3HFMH 1HCFX 3VD5A 2XXFA 3MHZA 5IUCA 3S4SG 3KPLB 4XMLH 3VYOA 1B90A 5DEGB 4LPTA 1NUGA 1KLFA 3GTNA 4P5MA 5HGAB 1HJCA 2DQJL 1KIRA 1YEIH 5L4MA 1V7NL 2JQMA 4EQ2A 2CO7B 4GBXC 1T0PB 3QSKB 3M1BA 1O5DT 4OFVA 4U3SA 2XLLA 4F7MB 4GXFA 1C5DA 2WHVA 3NGBB 1QKZH 4O02H 2NSXA 1A4BA 1SFHA 5KOMC 3H3BC 3OHXA 1DANU 1J8HA 4PJIA 5C0JA 4I87A 2CMRH 1GPOL 3CBKB 4JG5A 4K94L 3L6FA 3S35X 2V6HA 3WNOA 1KPUB 2AC0A 2YWZA 4CMMA 3O3UN 4FERA 4E9TA 5MHSE 4A7SA 3GGWA 4G6JL 2NXYB 1EIBA 4BFRA 2P8PB 3DHJA 3CC1A 3G9VA 2PYFB 3E6FA 3BXNB 1E65A 1F56A 2OA9A 1AQMA 5HHQA 3W37A 4AYBA 1UXWB 4P07A 5HYJE 1S9XB 1KJVB 4NLHA 5DYOB 2XHNA 7CGTA 5JW4M 2QSCH 4ZUVB 4I0PB 2NMSA 1N68A 4PVNA 3WJMB 1UYWH 4FTDA 4N6QA 1MW1A 4ALAH 2FD6H 4Y4HD 1QP1A 4UUJA 5JIDA 5L4FA 5DRXA 4YS4A 4XHQA 3LS5L 2B16A 1BVLB 1CDIA 3H9SD 4Y5VC 3GRWL 4WI0B 4B9GA 2JXMA 5LGJA 2YAHA 1MJ7L 5EU5B 4NUGL 2K9FB 4Q4EA 5LNEA 3FO9B 5EU4A 5JHAA 3FU6A 4NCC2 5E8OB 4GG6F 3TYGL 1P5UA 4NAQA 1MFAL 3GUFA 3L3HA 3LIUA 1T2QH 3WGVB 4EI5C 4LK4A 1YPZE 4PGEB 4FS0A 4PLOB 1QWUA 2APWA 3U9PH 3GJEA 4BFGA 4LRNH 3VXPA 4W9KC 2C26A 2NR6A 4IJ3B 4QNPF 3UABA 2DWEB 5BXFB 1N7MH 4R5XA 3VXRD 1FFPB 1OZUA 4JGJA 1IC5H 2BHYA 2UV3A 1NMCC 2VZ1A 2YUWA 4KUCD 1JGEA 4OF6A 4Y9BA 3O9WA 4GINA 4L4VE 2P5WB 4DZ8A 2AJVL 3PQYE 4HHAA 1IAOA 5CMAA 5CR1A 3BAWA 1SY6A 4YLBA 2J8UB 3LPGA 2HH0H 4I0CC 5BOZG 2V8MA 3F83A 1A6VL 3IFPB 4P04A 3X3FH 3WE1A 4LHUB 1PD0A 3LNGA 2PTTB 5C07B 4XP1H 4MD5B 1MDTA 1VPOH 2DMHA 3H3PH 4GEIA 1CLZH 1C8PA 2O5NA 3EDJA 1JZJA 2GBTA 2OJ1A 3Q8AA 4HJTA 3QORB 3S5LB 1SEBB 2XQYG 3QZBA 5D7KD 5SX4I 4D9QD 2DF3A 1TQBC 1RZKC 3ALXA 2DDQH 4IBSA 1IARB 3GZOA 4JFDA 1HC1A 4HCIA 4OKVB 3S4SB 2D9QB 5D6DA 3IAGC 2BS71 3IWVA 4JHAL 1Q94B 1WS7A 2WLZA 1T03L 3KS0J 4ODUA 1A65A 1V8HA 2HJFA 4EI6A 1EV2E 5M94B 2RACA 2ALWA 5F71A 1JRHI 2V7NA 1HOCA 1XGYL 5DTFB 3U0WL 1MLBB 1ZVSA 3V0HA 2PWDA 3EO1A 4KHTL 3TT1L 2H2PD 1HJBC 3TLRA 5FKAA 1RK0A 4NKOA 3RGVD 5BVPH 4JDZB 4GG6E 4C56A 1OD9A 1U30A 3GKWH 1MHCB 2VXVL 1GL4B 3V0GA 1NEPA 3QZOA 3LNFA 4X6DF 5F7AA 1Z9SB 2D2OA 3AY4A 2QLYA 4BSWA 1JXGA 3RB5A 5A16B 2CO2A 2ZKHL 3CH8A 3OKNA 4H8PA 1DUYB 4LPXA 2FJFB 2OQJA 3MV8A 3RE0A 3RJQB 3SDDB 3TO2A 3U4EA 5E51A 3VRLE 4QNPE 1U6AL 4ETQA 3ESPA 3I2CL 2ZOLB 5T1DH 1SLUA 4JPVL 1LE9A 4PG9A 2GSGB 2HTKD 1JPTL 1KCWA 2YD5A 4IRSB 1KC5L 4RWYH 5CGBA 5JW4Q 2G5UA 4QLWA 5FGSA 3D3VB 3EH4B 1X5JA 4MB1A 4MNGB 4Y2DA 1X4YA 1TTBA 3U25A 4UZUA 4HP5A 4KJYA 4UQDA 2WJ7A 5ENWA 3WN5B 3WTTA 1TJIH 5DS8A 4Y9FA 4L18A 1VFUA 2Y36H 1EDYA 5HYJB 4L1BA 1XCQB 3E3QE 3BWUF 3DOSB 4NRYB 4D2NA 3IF1A 5KOVC 2Y1VA 4IKIA 5F7KC 1KB5H 1OP3H 3TU6A 1ZVHA 2PWGA 4KUCF 1HINL 5FFOA 3GSRA 5DZOA 2X38A 1YEEL 3RGHA 3L95B 3X1FA 2A83B 1JWUA 5FYKD 5I15L 4CILA 3IDYC 4NUJB 3UTQA 1A7NH 5FHBH 4FQ1L 3BE1H 3ARGB 3DURB 4HUVA 2H3XC 4JM2C 5GRVL 1AD0A 2BRRH 2XPZA 5KANG 1D5MB 1XR8B 5EUOB 4GFXA 2C4XA 3KCWA 3GZPA 5FFGA 4KK6C 2AZAA 3WTUA 3X13A 3HBPA 1YPZB 2JJTA 3VFVA 4YHLL 2D3JA 3GJFA 1DVUA 5FYJL 2NTFA 4UM9D 1UWFA 2VLMD 5H37G 2D0GA 1BFTA 2MPAL 3JYBA 2XVGA 4FXLA 4M7JH 4ANXA 4C4UA 1QUNB 3A47A 1OF2B 1R3HA 5KN5A 1DVFB 2P52A 5CIPB 1OALA 4O58L 4X6DE 4ZUWA 3H9SE 4KAQL 3DDFA 4L4VB 5B21A 1NGYB 2NY5H 2AV7B 3BZ4A 2CLVA 1M4KA 4LCYA 4DFIA 4F37K 2R56L 2QFPA 3NSYA 4A68A 3TS8A 3GS4A 3MLTB 1A4CA 1CL7H 5D5MA 5INDA 1XBRA 2DKMA 2X4NA 4PHXA 4NB7A 2R1WB 2X4QB 2NX5A 1VCBC 4OJFH 1JDAA 4XNXH 3W9DB 2XBZA 4F37F 3RVWC 3K1DA 4OFYA 1T3FA 4I2XA 1IILE 1FPTL 5DMIL 4JCLA 1XGQA 5HDOA 5HHOB 1W0YT 1ZVNA 1HI6A 3WEXB 1ZKAA 4ORGB 3KYKH 5LXGL 3BKYH 4KTEH 2R4RH 4TQHA 2GIXA 4PLJD 1CDCA 2CWRA 1DN0B 4XAKD 1BYNA 3FQ4A 5BQ7A 1VFBB 4HKXA 2I85A 4YBQD 3ECVA 3HG5A 2CU9A 5DA4A 4JNXA 5I1EH 5JR1L 3PABA 4PVLA 4U1IB 1J8KA 4LDEB 1RZIA 3L48A 5JIQA 2XXGA 2J6EL 4POZC 4JFTA 5CLYA 1KBBA 3MJWA 1KLUA 2DLFH 5C8JB 2GAZA 3OKOB 4GG6B 1LL1A 3V55A 5CLXA 4I18A 2WM0A 4HWNA 4QTIL 1PZ5A 3NSFA 1H8SA 4NM8H 2FZ3B 2K7QA 2H1PH 3BQUD 3LSOB 2G9HA 2ZD0A 1MNUL 3MODL 3PPSA 3ZUNC 5IQ9B 4GUQA 5D93C 3GMOB 3BESR 3KW7A 4L1TA 4PJEF 5E95B 1YNTA 4I5BB 3D85D 4S1SL 4IK6A 2BP3A 2BXZA 1Y07A 4IDLA 3DX9B 1FZOB 1PG7L 1AO7B 3SD2A 3CSGA 4WI3A 1I8KA 1JPST 5DZLA 4PLKC 2DTML 2GJ6E 2QQNH 1MJ8L 2F5AL 3FUJA 1CE1L 3FS9A 4XMXA 5LDUA 2AXJA 3QJOA 5B39B 2WMPB 4YZWA 2EVJA 3SY0B 3AVEA 4KUZL 2BDNH 2BZDA 4KKNA 1JZDC 2IH8A 3F7KA 2P8LB 5CKAA 4YLQT 2HFEA 1L9RA 3PP3K 1ED3B 1T6WA 1WQVT 4MD0A 5E1HB 4Z7UF 1D6EA 3DHMA 1UWYA 4RDBA 1QBMH 1CDJA 2BMKB 4H5SB 4N26A 1LK2B 1YN7B 5T33L 1ZV2A 4ZFGL 4FHKA 3B2XA 3IU4L 4YPGA 2C7FA 3FF7A 1QW8A 3QDJE 1MFVA 4K7PL 4LVEA 4XPBL 5AOLA 2PW2B 2P8MA 4NO5B 4Q58C 5G4MA 1DQTA 4X99A 5IROC 3RX9A 4I9XA 4TUOB 5DLMH 1BAFH 5T3XL 3RWFB 5I2IA 3EJUA 4M8QA 3LRLA 1GGCH 4HUWB 2IH3B 4M1CD 1EJ6A 4NC1E 1JV5A 5MEOA 2FJHA 3GSOA 1E27B 4R8WH 1PQZA 2E76C 3DUUA 3QDMD 4H8VA 4XMTA 1PW3A 4G59C 1UJ3B 2X1XR 3VU2A 5J6GB 4MS8D 3L9YA 4GKSB 4X9HA 3O41A 1IJNA 2FWOA 4X6DB 3U7WL 3C5JB 2YQ3A 3G6DH 3H9SB 2KQMA 5E2JA 4PJAA 5FYKE 4XBMA 3LZRA 1BD2A 1QTSA 2G3MA 3LVEA 3OPZH 5IEKA 4QOKA 3T2LA 2AJZA 3VFSB 2CXGA 4PJEE 4ZS7L 1OPOA 4RRPM 1N2RB 2UZIL 4HF5H 3UBXG 3IFNH 5CCJA 5F9DC 4WI7A 1A25A 1DZBA 4XPGL 4P06A 2MCPL 1FNSL 1BEYL 1DBAH 1EAOA 2X12A 5ANME 4MMZC 2NY7H 3JZ7A 5ERWB 1DQVA 4OZ4A 4LOUD 4UB0H 1PLGH 4XZUA 1F5WA 1JPSL 5CGYD 4XVTL 1J0ZA 3NCJL 1FG2A 1C12A 2GUYA 2R23A 1H15B 4X0KB 1JYXA 1LVEA 3AT9A 3QDAA 1QVOA 4DP8X 4JJ5B 4FTVE 1II4E 4Q89A 5T1MB 4YAQA 4FGMA 4Z95L 3UIYA 3K2UH 3WXVH 4BFKA 1INDL 4NT6B 4Z7UE 3N1PC 3OKDB 2VM9A 1OB0A 3JTSB 4PSPA 3BKCH 4DJMA 4QXWA 2NRDA 2QQKL 2VW6A 4JDTL 4WNQA 2BWDA 4BH8B 2CIIB 4QCIA 1A6PA 4LEEA 4NAMA 4OM0L 4XPTH 1WD9A 1BG1A 3NZHH 2NSMA 5CCKH 5GRUH 2AMUA 5K9OB 4NKMA 4XMKH 1MCQA 4HT1L 5ADPL 1TU2B 2QZ5A 1ULVA 3DX6A 3QUZC 4QGTA 4TSBH 3O6FD 1IGCL 1NZRA 1U8HB 2BVQB 1NGXB 4G80B 1X7TA 3JWNE 3LQZA 5ESAB 3B9DA 3EAKA 3NZUA 5F1IA 2LU3A 1A9VA 3KYNB 4KRPC 3ZLQC 2X4UA 1X5MA 3LKQB 2V5SA 5E6ID 5F8RC 1TNNA 3U2JA 1M2VA 1LQBC 4ZX3A 4X6CA 3EF4A 1YAZA 1C9SA 3UJJH 4PJ8D 4CC4C 4OUUA 5D7LE 5DJYA 2GJ6B 4XN8A 1XSJA 5HGBB 2ZP9A 1RP8A 3HC0A 4IYKA 1EZVX 3RGVB 4CN6A 1LO4H 1NC4A 3K8MA 1AD9A 2GW5A 4IIQA 2ADFH 3JWNG 5TE4H 3OR6B 2O26U 5JUEH 4OFKA 3VGAB 5L8KB 2B15A 2OJEB 4A38A 1EXHA 4X98B 5HVGB 1A6WL 4RA0C 3MRLA 3UX9B 3B3IA 4S0SD 4PJ5A 5CIPH 4L3AA 2G75A 3V4PB 2WLIB 2HMID 4WW1B 3QDJB 1FN4B 4IRZL 1B9KA 1D5ZB 4QF1B 4MKTA 2YMTA 3OKEB 4Y9CA 5JNYB 1HNFA 1Y1UA 4F58L 1FA4A 5T1KD 4YHPA 2BCKA 3EUDA 2O61B 3NSCA 4NKDA 4F7CA 2JKSA 4FJYA 4N24A 5DR5L 1WH0A 3E6HA 4FN0A 1AZBA 3DTXA 4IRJC 4LLDB 5DJDB 2W9EL 5J3HD 2ZXDA 2IALB 4JG0H 2UY7B 1UVQB 5FYLH 3AU0A 3DA0A 3UBXB 2GB2A 1NFDF 4P5TC 1F45A 3T1WA 4OCMC 2Q7YA 3QCTH 2JELL 2F7IA 5F6IC 4J2QA 1DL7H 4PRIA 4BUHA 2NY6C 1QBAA 3QRGL 3FO0L 4LU5H 4P9HC 1ZDSA 2LTQB 1AGCA 1CGUA 3IAPA 3IGLA 3NP4A 3C2AH 1X5IA 5BCAA 2EECA 5DC9B 2YAOA 2ZX7A 2K0RA 2NYZA 2R8SL 1NCCL 4PJEB 1G0DA 3CD4A 4NRXB 5C0AE 1YEWA 2N1KA 5J5EA 4O00A 1O7DC 4MNQE 1NSNL 1Z5LB 1OWWA 5ANMB 1D9KD 1G84A 4BZ2L 1VZIA 2X4PB 4HJJH 1QKZL 3DX8B 4YDJA 2IDQA 4UM9B 3P2TA 1XL6A 1RULL 3D18B 4XMWA 1HE7A 2ZOOA 1MFDH 2L7JA 3PWNB 4LP8A 1P1ZA 3DETC 4HA1A 1YY9C 5AVZB 5HYEA 4XN4A 1FZJA 2GTZA 4KKLD 4ZXBA 3RL2B 4Z7IA 3FO1B 1ODUA 4UV4L 3NABH 1CTNA 3GF8A 4F1ZA 4OZIF 4H0LC 4M7ZB 4Z7UB 3TV3H 4F2MA 5GZOD 3FRUA 1V3LA 4NQVA 1C5CL 5JPNC 3PWVB 3TT3L 4KVPA 4O2FA 1S9KC 4BK8A 5BRZA 1UYWL 1KLGA 4ALAL 4MFHA 4G8EA 1XEDA 2XBTA 4WHCA 5E2UH 5GZND 4NI3A 4C54A 1FJ1B 1KMGA 1UKSA 4I3RH 3NACL 3BZ5A 4HS3A 4GO8A 1B0IA 2NNCA 3FCTB 4LDCA 3L2MA 3IMWA 4R84A 4G6AC 1R24B 3IRZA 1TJHH 4Q97A 3GD1C 2OXGA 1S9WA 5H37H 3X3GL 5IJCC 4K9EC 1K3IA 1HQ4B 4AGPA 3BVNB 1NGWB 2HFGH 4P4RB 2R2BB 4JFZL 1E9PB 1LO2H 4XOCA 4A2FA 5IHBA 2OS7A 4K71C 2VM4A 3QUXA 5B1KA 3HG1D 5E99L 1F4AA 3N2JA 3U9PL 4AIXA 2WWNA 5CKGA 1UURA 5DZPA 4JHZA 2EXYD 1P6WA 4HWUA 4HOZA 4N0FB 4MYPA 5BZWB 4O2EB 4FXGC 4G7SB 4U1JA 1N7ML 3IPEA 4RVBA 1U8PB 2VAAB 3UAFA 4ZQTA 3K8KA 1TMQA 3VQMA 4AL8C 4X8XA 4PB0L 1ZLSH 4XWGH 4QRUB 5DEJA 3WO4B 4J6RL 2QGCA 4LMQE 1EA9C 1DBBL 1FP5A 2G60H 4W9IC 3F84A 1PF3A 3BQUB 4W68A 2RAMA 2FRGP 2M1KA 2EEXA 3VB9A 2L4OA 3SGDI 1B6DA 1AHKA 1BQ5A 3D85B 3SDCC 2DWXA 1WYJA 1I7UA 2KUTA 1A6ZB 1ZV9A 2PYED 1PDKA 2KMWA 4XXCC 4WAFA 1U92A 3DO4A 3IDNB 1YUHA 5EOTA 2ZXWB 1WWWX 2YA2A 4RAUA 3DMMD 4WWKC 1WO2A 1NPJA 3NJNA 3V4UH 1ZA3A 1HDMB 3GO1H 3CVHB 1RZFL 2AXFA 2DEWX 1TITA 5IKCA 3VXNA 4EN3B 1BGXH 4KKAD 3TPUA 1GS7A 3OF6D 4BK5A 1MCKA 3G7TA 2UY6B 3NIFF 4FEMA 4Y16B 4ZFZB 1HH6B 1N5AB 3ULVF 2DL9A 2FO4B 4KVNH 2H47C 1V54B 4HUUB 1FL3A 4LSSH 5FR3A 4I8DA 3D06A 2A9NL 3KYMB 1UD3A 3JVFC 2CJSA 4PW9A 1I1CA 2FLMA 1OP4A 1OPGH 2GTWA 3P4NA 3IRPX 1KTLB 1RLWA 1A4JA 3SKUD 3IN0A 3ERXA 2YK1L 4AQ8A 2YRLA 1HH9A 4L1HA 1COBA 5IW1A 3LKNB 4MNQB 4MBRA 4N0CC 2XWDA 5DJ0B 4EOWH 3HZYA 3FZUD 5GGSB 4X7FC 5JZ7C 1H5BC 4KOCA 2B8OT 2FHBA 3OGCB 3K71B 2ZTBA 2VQ1B 4O51B 3ZGIA 4KPHH 4ZFQA 4NKQB 4WFGE 4QR7A 1RKRA 3GHEH 2O5ZH 3DGDA 5GGUA 1FSKC 4LBEA 1LE5B 3LPPA 5IB5A 5JXAH 2F74A 3DX7B 4OLXL 1IEAB 5L2KA 5CS7A 1N64H 3Q1SH 4HETA 1H9DA 2ZX9A 1GJWA 3OQ3B 4GW4B 3C09C 5CN1A 4LL1A 5B8CB 1MG2C 2WQSA 3TBTB 1QAWA 4BZ1A 1JYVA 4M1DH 3ZUCA 1FGVL 4XBPA 5GIRB 2IC2A 3T3PE 1GGIL 2E5EA 2XZCL 4ABVA 4JUSA 4ETYA 4PRBA 1MI5D 3JV4A 3KPRD 3BP5B 4FE9A 4WO4A 2XQBH 2EE3A 4J2XA 1WAAF 2GCYB 2ZSVA 3UTSE 3ATEA 3WE6A 2Q3AA 2WLHA 1ET8A 3T0EC 2AQ3A 4XBEL 3WLBB 3F7RA 2I9LB 3QUYA 4CKVX 2NTSP 4KKCC 5H94B 3BUQA 3V4PH 1FL5A 1NFDB 1HHIB 3TN0C 3PJLA 2L04A 3NIFE 5KBMA 4R4BB 4B27A 3ULVE 3QJQB 5HJ3A 4F57L 2ZONA 1Z32X 3LZPA 5FW6A 3K72B 5IESL 2R2HB 5EZOH 4TQPA 2W0KA 2QBWA 3TJPA 3WMSA 3MCLL 3R19A 2DWDA 3QQDB 1BBDH 1F58H 2B20A 2YBRA 1QR1B 5IB1A 1T7YA 1AXTH 3MPCA 1HNYA 5E2WL 3QFDA 1EHKB 4P23D 5CD5C 2YZ8A 4NI6A 2QVMA 3WAJA 5DK3A 3V7AE 4WU7B 2NY5L 3NN8A 1S7UA 4MKMA 5K93A 2APBA 1TSHA 2Z0UA 3O6FB 4HH9B 5I74C 4KWUA 4X9YA 3OLEA 1CGTA 3FOMA 1CL7L 3DROA 2XKNB 1U2YA 2FIKB 5FYKH 3W11C 4KKZA 4WFEE 5DJ8A 5LN4A 3WY4A 3CK0H 2E56A 5KVDE 4JFXB 4KZEL 5FEBA 4TOYH 2BIOA 3GXMA 4DK3A 2OMXB 2CLZA 2ZF8A 1UD2A 3MX0B 3HG1E 2B77A 4KBPA 3GXUB 3PAYA 3QUMB 4JS7A 5I8CB 5EOQL 2NUTB 4PJ8B 3APCA 4RFOL 4M5YH 4OZIB 2A99A 1R47A 3V7AG 1KYFA 3T8XA 4A6YB 1M7IB 2WZPA 2WXLA 3VYNA 2FATH 3H4FA 4XN1A 3NCMA 2GPZA 1F2XK 4IOFC 4HHGA 5LHDA 5EEXA 1T7VA 3O2DH 2CBOA 2A9MH 2ICWB 1H6TA 5EU7E 1XZWA 1T5KA 3JUZA 2DQIH 3IJEB 4DW2L 1MELA 1M6OA 2HAZA 4P46C 1FFQA 1WAAE 1BOGB 4N9GA 4RFEB 3ECWA 5FDWB 4WK2B 5IMMA 2EVGA 1OM9A 4AYGA 1MVUB 2A9AA 1E4KC 1HHHB 5DWUH 3FFCA 4AYMC 3JSSA 2VDPL 3QZWG 5T1KB 1I1AA 3SYQA 1P2CB 4JGNA 4W9JC 3MUY1 2MTAA 1GOGA 3PP3H 3ZL2A 4Y1AD 1ET5A 3HR5B 3EBGA 5GS0C 4DZBA 3A6CH 4Z77A 8FABA 3RZCC 4P5KA 3ULUL 5ACMA 2CR3A 5E5RB 4E0RB 4E42A 3HAEG 4JQXA 4U3HA 3JWNH 5CJOL 1JNLH 5FECA 5KYXA 3B5GA 2AZUA 1G1CA 2Q20A 3OHXC 1BX2A 3QWOB 4MJ6B 3G5VA 2ATKA 4XN9A 3V6OC 2EH7L 3AQDA 3R06B 1YYLL 3OXRB 2NY3D 2BDNL 4YGVA 3UXFA 2Z3FA 5BW7A 1Q0EA 4OGQC 1NKOA 4JFEA 5DJ6B 1FZKA 2CSPA 3HPLB 1IQWH 5IMOA 4BFJA 4XMPL 1IE4A 1D9KB 2AJ3B 2Q8AL 1CGYA 2ZAGA 3RTLA 1QHQA 4YJZL 4FNQA 4Y5YC 4ZNEE 2ZOTA 5HYQA 2Z1KA 1L7IL 3UEZA 2XPGA 3I9GH 3PV7A 1KT2A 4F24A 1TF4A 5D71H 2VR8A 3EXLA 2Y0SA 4M6OH 2VDLB 2YARA 4U4BA 5FWRA 1GC1H 4G2AA 4OD2A 2PTVA 5F96H 5FA3A 3FB5A 4Y4FC 5PAZA 4OTXH 1E0OB 3UTZA 1MFEH 4GOSA 5EIVA 5KYWB 4PJCF 1P5UC 1HHKA 3D5OF 1YY8B 2A9CA 2R1YA 3DPDA 1CG9B 4R96B 4KQ3L 4KRMB 2JVUA 2ADYA 3L5HA 3RGBA 1WC7B 4MJ5A 1CICA 5GS2D 3FQXB 3CVHH 1O9WA 4IU3A 3ILDA 3HBQA 2WB1A 3QARA 3OB0K 1IFRA 5CO1A 1AIFA 1CK0H 4ISVB 5CGMA 3ARRA 2XZZA 4KJQC 2R29H 5FLVA 4M1GH 4NENA 3WIFA 5LNDA 3IMSA 1NINA 4IS6B 1AFVH 5E8DL 1FH2A 1LWJA 3MI6A 5D9SA 4PS4H 1HIMH 2HXAA 4HOMA 2XC8A 4XVOA 5D1XA 5AVSB 5MEQB 1OARH 1M53A 1U3HD 2PXYD 3DGGB 2XWZA 3MGOA 3E0GA 3RWDB 3EOTH 3AG2B 3SDXF 3UTTA 2WAQA 4J3BA 3ZHKA 1MEXL 4FA7B 3MLRL 3NTCH 3HG1B 2BWIA 5CFHA 5HVHB 4IDJL 1ONQB 3S36L 1FAIL 4YNYA 4TQEH 3Q5OA 4R3SB 1EXUB 3F7VB 4KKQA 1AZUA 4Z7WA 2YD6A 4DGUA 1EUTA 3ARED 1AGBA 3QHFH 3LEYH 4L1LA 4I3SH 3MV7D 4D0DA 1ZXQA 3ZRCC 1RU9L 5AOKA 3RWGB 1UXMA 3QZWB 4IKNA 4L5FH 4JANA 4FXKB 4UQ2A 4EUPG 4FZ8H 5IEHA 2CGRH 4DGYH 5JHBA 2PCXA 4NNXB 3TIDB 3BKCL 1RCYA 3KVDD 4QY8B 4MNHB 1AGDA 2X1QA 5T5FA 1E4XI 4X9IA 3WNKA 4ZZFA 4XPTL 3ARFC 4CC0A 2WBXA 1Q4NX 2FX7L 3TZVD 1WISA 1EFXA 4G7YL 5D1QE 3S48A 5E5MA 2PYEB 4UDUA 4I9WE 4DQOH 2FB4L 2DM2A 4LSRL 2B14A 9PCYA 1CWVA 2IPTH 4LSPH 4W6YB 3TYFA 3NUKA 5E4IA 1GHFH 4PJCE 5FHAH 1CVSC 4OLYH 4IKLA 3VFMB 4TUKL 3AY4C 2FWLB 4PUBL 3O4LE 4MJID 4N1CA 1LO0L 1ZJAA 4RQQB 3NFPB 4B9PA 3CN4A 5B22A 1X5HA 4M4PA 4FNRA 3UCQA 4NN5C 4TKWA 3K3QA 3B2UD 4A7VA 4YOKA 4KDVA 4ZFOB 4PGJA 4HIHA 5GGVL 2VR6A 5DMGC 5E4EB 4OGYL 4HDIA 4W70A 2W07B 1LO4L 3QO0A 2VLRA 4PRHE 5L7XL 1IEHA 1FORL 4DEPC 4HBQA 4Z6AT 1I8MA 4Y2DC 2D03H 4KZ0A 5IF0A 1X7QB 1FYTA 1GR7A 4N2DA 1XD1A 4HWBH 4W1TA 4Z3IA 5J1TC 3SDXE 2GI7A 3N40P 1RLBA 4E9WA 1VB9A 3DK2A 3L3JB 4Y1AE 4F7PA 2XDHA 4PV9B 5E6UB 1T0NB 2GIMA 4E9XA 4MA7L 4WWOA 4UDTB 1S8DB 3BUDA 3WXWH 1UUSA 2QVFB 4EZLA 3RURA 2HVBA 2X2IA 4ONGH 3FFDA 2EYRB 1A0QH 1KTJA 5FLUA 1SLXA 1HEZA 5FYLL 4YIQB 3ESOA 3QUMH 2DLTA 1EO8L 3KPPA 3QCTL 4QRQA 5KYNA 4W9EC 1NIBA 4UQAA 2JJTC 4DGIL 4LU5L 4A6YH 4IOSD 3PF2A 4OV5A 4V1DD 1MI5B 3KPRB 3LKPB 3WIHL 4BK4A 1JK8A 5JIPA 3QZLA 4X50A 4BQ9A 5AB9A 3OKLA 4MJ4A 4P59L 2I07A 1I7ZA 2O5YL 1KGCD 3BH9A 2B1HH 4KX7A 4EUPB 3X11B 3DIVA 2EILB 1U9KA 3Q7JA 3GT6A 1IFGA 3MLVH 2FWUA 5M95B 3CSYB 3RWJB 4EAEA 2OAAA 4NGHL 3OC8A 4X2UA 1JK9A 3R18A 4WO0A 2HP4A 3BSGA 2Y25A 3MKKA 4X5RA 1NWOA 3EJYC 2G4EA 5EZIH 1UWEH 4RMQA 4K7FA 2EJ1A 2LU7A 2UZXB 2VQTA 1RZJC 2AJSL 4K55A 3BAEH 1P84J 4PJ6A 5TDPA 2YD1A 4RDQF 1MPAH 2VMEA 2Z4QB 1BV8A 1BYPA 1C1EL 4Z3EA 5IBLD 1R19A 2WVSA 1E4JA 4GW1A 4M8RA 2OL3L 1NAKH 3DXAA 3ES6A 4GYBA 4CAGA 1YC7A 3QEQE 2QSVA 4DP1X 3C6LD 3BISA 5I1KH 3GBEA 1SMOA 4WEBL 3NJKA 5FB8A 4NQEA 4NO0A 4LSUH 4PG2C 5D1QB 3AITA 3NIGF 2Z9TA 5GJSH 4XVJH 3HZKB 4L9LA 4FG6C 4KY1H 3FTGA 4PJBF 4F15C 4Z5RB 3LHPL 1TTCA 2IAMD 2HJLB 2XVBA 3T0XA 4RAVB 2QPUA 2VRAA 3BFQG 3GSUA 1DSFL 5DUMH 1YEDA 2HKFH 4XNZC 4ZO7A 5J1AA 2YSSB 1WAPA 2OR9H 3MOBH 4LVOB 3ZR5A 4Q8BA 5LXVA 2V17H 1Z0NA 1E67A 3O4LB 3PXJA 3ZO9A 2AGJH 2DOCA 5KG9A 3SBRA 4UCFA 2VDLH 5GGRB 3CU7A 3ETBJ 3WJLC 4MXQD 5DFVC 5GGTL 1UB6B 2VDML 4WSGA 1XF1A 1DZ0A 2V7HA 4GW5B 4PRHB 4ADJA 4BD4A 3F12A 1HCVA 1XV8A 2DIJA 5JHMA 1GTNA 1IKOP 2AKRB 5JIKA 1OLLA 3SDXB 4OGAC 2Y06H 2YD4A 1SJVA 1UQSB 1WFIA 2CNYA 4LOVA 1JCKA 3AS1A 4Y1AB 4G8AC 1PJWA 4IHOA 5IVZB 2CLRA 5I0WA 3TTSA 1VGKA 4EIGB 1AC0A 4DQAA 3INUH 4ZODA 3H9HB 25C8L 4RNRB 1PVHA 1PG7X 5AZEH 3HMXH 1OAQH 3ATDA 3TA3A 2JB6B 2Y07H 3IDMB 5EO1B 1QSEA 4NO3B 1F13A 4BRVA 4PJHF 1GZHA 3QXTA 2ZXCA 4WWPA 3C9NA 2NY3B 3A6BL 4D9LH 2Z91B 3O8XA 3D69B 3VGBA 1MREH 3JT2A 1GGBL 3NOIA 1AS7A 4R0LA 1QSZA 4JJHA 4WJ5B 3NIGE 2K6WA 1EO7A 4KVNL 1AXSB 5CM1A 4RMBA 1TZOA 5E7FA 2R9HD 35C8L 4M61B 3TIEA 4R2GC 4UU9A 1OTSD 4RDQG 5DQDL 4UQBA 2C4FT 4PJBE 3V52L 4JDEB 3ZYZA 1YEGL 4K7PX 1NDMA 1DFXA 5KSVB 2VZOA 3DTUB 1FLTX 3GB7B 1QI3A 1SHSA 1BJ8A 4KXCA 3KR3L 3Q44A 4NHUB 2YN3A 4YGAB 4N2FA 3SGKC 4JZJC 1U3YA 1CFVL 1HE8A 2YKKA 1SZNA 3GSNA 5TF0A 4JVWA 3TBWB 4NPYB 2B5IC 3OPUA 4FG0A 1TVBA 3FF8A 5E03A 2IV8A 4LQFL 2N59A 4MCZB 2H32A 4ZUUA 2OTUA 5DDHA 2WQ8A 4HYTB 4PI2A 4EPSA 2L3BA 4JFQA 2PCPB 1NMBH 3VXSA 5JXAL 4N20A 1JF5A 1JGVL 1JGUH 4V1DE 3W0WA 2OMZB 4FZEH 4OW6A 3SY6A 3WKPA 4MYWB 3LY6A 3GNML 2F0CA 3PL6D 3C6EA 2WXRA 5DK0A 1SEQH 1T1XB 2P5EE 3R7RA 1E9QA 1U3HB 5BO1H 4L8BB 4RETB 4E9SA 2PXYB 1T04A 1OAUH 1MRDL 5AEAA 4MD4A 3ZKMC 4X6EB 3C2SA 1OWRM 1UEYA 5ACZB 3MBXH 1N6QL 2QADC 5KBNC 5ITFB 4FQJL 2DQHL 1C7SA 4PJHE 2KKQA 4LIQH 2I27N 2WGNB 2WXKA 3AREB 4BCXA 5HD8C 5HYIA 2HG0A 1PD1A 2B4CC 3NEOA 4J1UA 4LLYA 4NC0B 4HK3J 4LLAA 2YQBA 4KK9D 3AXHA 4OGXH 2JB5L 3FK3A 3IVKB 5AYUH 3GBNL 3ZYJA 2XZAL 1F6LL 1SRDA 1Y6NR 2EAEA 4FKHA 1XGZA 4CSPA 1BM3H 3F8UB 1AIZA 2AF2A 2GT9A 2BVUA 3E80A 3PV6B 4RLDA 1IKNA 3ZL4L 2DD8H 4JFSA 4LEXH 4ZPVA 1F58L 3ZSTA 4O02A 3FQWA 1GAFH 4HGWA 4X5WA 5K9KA 4FJZA 2NXZB 1I8UA 3G5WA 4PAZA 2V3DA 4R7LA 4PV8A 1G5AA 4P2OA 5IGXH 5GGVY 3T4YA 4BHUA 2Q10A 1KN2L 4HBCH 2DQUH 4S1DC 2OBGA 4IIQC 4JFOB 5TJWK 1CZ8L 2FBOJ 1AS8A 4OFIA 4KK5C 2A1WH 1ZDQA 2R4SL 3D34A 4R83A 4Z0XB 4YDLB 1M1XA 3SOTA 1WA1X 5BV7C 4KDTA 3Q6FA 2A73A 2HT3D 1RZGA 1U3NA 1R3JB 3QFJE 4QJ4B 2V5RA 1IEBB 1V55B 5F9JA 3EBIA 4EUPH 4OFPA 4BV1A 2N7AA 3R4DA 1REIA 3CDYA 3P4OA 4N2HA 4P2QD 3HRZA 4NWUL 2IQ9L 5CINL 2FATL 2XWXA 4G6KH 3SPVA 2LVCA 1WZ1H 5AVRB 3EJJX 4HAFA 4FI7A 1JHTB 3B1UA 2XWTA 3M86A 5DZ9A 4AXWA 1AZVA 5ICXB 3NIGB 3QIUD 3GSWB 4WEUD 3EFOA 4M5ZH 1YNKL 4GI6A 4ELKA 4PJBB 1CQYA 5DJ2A 4G8IA 3GIVA 2NW2B 3VQLA 3CVBA 3H54A 4LEOA 5DJXA 2EVFA 2GHWB 2OULB 3M07A 4OF0A 1XBDA 1T1YB 1MHPH 4DP2X 3UDWC 3OAUH 3T2OA 4GUCA 2YJQA 4KQ0A 4ODXA 3SKJH 3SOBL 2P7TA 4AK1A 2QVIA 3DGCR 3J07A 4XPFH 1Q1JL 3N3EA 1QEWA 1SJXA 4Y19E 5BOJA 5I71C 5C09E 2XICA 3N5AA 5HHXL 1OQXA 3SPIA 3G08A 3B4NA 1DCLA 5IV2A 1KJ2L 3H4HA 4L0ZA 4DN3H 3U30C 5IFHL 3HE6D 4V1DB 4ONFH 4X80L 4PJIF 2G5BB 4WTQA 4AYFA 1ZT1B 4PV1C 1UT2A 3H9YA 1SXNA 4NP9A 4ZXBC 5D2LA 2BCMA 3CCHA 5DVLA 3K1KC 2JI3A 4AQEB 1PZDA 1KTRL 2ENSA 4LFHD 4QRTA 2YPKA 3MR9B 3SN6N 5E08H 1ZLEA 4PREA 4N8VG 4AEIH 4U6YA 5L9DH 5BVJB 1ECZA 2DKUA 5KSAB 1RJZB 2LHAA 4JDVA 4C83B 3RDTA 3N91A 4HKJB 1YJDC 3BYTA 3FB7A 2QPDB 4IOIB 4PR5B 4GRLA 3ISRA 2CUIA 4XP6L 1Z9OA 2JKRM 1QASA 3BHBB 3WHE0 4BHUI 3FCBA 3D30A 1BHGA 1D5BB 1M42A 1MFEL 3MJ8A 1KEGL 2DI9A 3MRGA 4XO5A 3C6LB 2NY0C 2DZEA 4AT6A 2GEEA 3MTRA 1MJUH 2TSAA 3B2VH 3SPCA 4NQCD 5CD3B 4Y0GA 3POCA 3KBFA 3QUXC 4KI5C 4PU2A 2Z7WA 5EBGA 4LL9A 4G70B 2EUVA 3X2QB 1CT8A 3HNTH 1NC2D 4HEME 2WLNA 2BLFA 5CU9A 3VWJC 1SOQA 3BPCB 2Z0BA 1J9SA 3O11B 4XI5C 4U1LB 2E7BA 1OGAD 4ZS6C 2ZUQC 2JKNA 5C0CE 4FFYL 4PPTA 2H1XA 3MRIA 3CPLA 3GSQB 2OSXA 2VCOA 2P45B 2W60A 1AYRA 1U3JA 3PWJB 2NY2C 5DVMA 3EYQD 3L3OA 1DBKH 2VW4A 1KB5A 4FP8H 4HUMB 4LHQB 1F00I 4W4OA 3CMOH 3O3BB 1J8HE 4J3XA 4P3DA 4PJIE 2IANA 4UF7C 7PCYA 3QNXA 4I3SL 2BVOB 2XV3A 4P9MH 4JO8A 2QV2A 5DHYB 2LAAA 5H2BA 5HHVH 5LCVH 2Z8RA 1BQLH 4PYHA 3MUZ1 4YHIB 2XWJA 3EYSH 2E8ZA 3GBLA 2R15A 3FTVA 2HRHA 1HVXA 1UZGA 2VXTL 5GS2H 1BCIA 1U8IB 4XPHH 4ZMOA 5FO9B 5EU6A 1D5IL 4PTUA 5I66B 1YZZA 5HI3D 1TJGH 4BK5C 4FA8A 2H41A 2ICEA 4HW6A 2JKXA 5I75B 1QUPA 1MFUA 4L4TD 2CK2A 4AC2A 2F8OA 4WI2A 1X5GA 1SYVB 2DIEA 4Q7DA 3RKDC 3BUYA 4R26L 4F91B 4M9OA 2E7HA 5AUMA 3LD8B 1M71A 1A1NB 1HWHB 2KZBA 3QNYA 4U2YA 1OF0A 3I6GB 5J57B 3UGEA 4P2QE 4Z7AA 3HPJA 4XR8C 4KTDH 4CGTA 1T21A 2BSBA 2J25A 4AY0A 1PY9A 3DVGB 5C09B 3LQMA 4N8VB 2H6UA 3B8YA 4R97C 3V6BR 2B59B 4NP4H 3ZTJG 5C0GB 1F6AA 3TF7C 1WUZA 3JVGC 3NCFB 5EF0A 4AVHA 2IG2H 3GI8L 2Q3ZA 1YN6B 5IQLA 1PCSA 3QWRA 1AZCA 3PPEA 4FULA 2PP8A 3TF4A 5JW4N 4KU1A 1JZFA 3KPLA 3O6KH 5HGAA 2FQEA 4GG8B 5DEGA 1RXLA 1AE6H 3MRRB 5FYJU 4GIPD 2MIZA 5JQHC 5A3ID 2CO7A 3L5XH 4HWBL 4U33A 4XO8A 1L6XA 4NDMA 3OL2A 4F7MA 2X4RB 1S4IA 2JLPA 4OT1H 4F7TB 5CUSH 5AW7B 2C9UA 2VL5B 1PLAA 1FFTB 5DCCA 5AD0B 3MLXL 5E6RB 5ELIA 3DKHA 1KPUA 2FT7A 3VSTA 4ZMZA 2HRLA 4E41D 1NL0H 4XP9L 3T6VA 2P8PA 2ZG1A 1R34A 2PYFA 3BXNA 4WO4C 4XXWA 4CKQA 1MCEA 3MBED 3VMPA 1UXWA 1S9XA 5DYOA 4HC1L 2H6PB 3GJFK 1ADWA 3K5SA 4I0PA 4JFDE 3QUYC 1RZ8B 4WV1B 3WJMA 4JG1L 3PL6B 2AEQL 2RFXB 2DQEH 5I1HH 3UO8B 4HG4J 5L6YL 4XOBA 5HYFA 3RFZB 3FKUS 1BVLA 1JF6A 3AMLA 4WI0A 4V2BA 1LK3L 2CKBB 4ZMVA 3F7YB 2R0LH 4MAZA 3PREA 1IU1A 1F42A 1IJ9A 2WIIA 5EU5A 1R5VB 4Y4KD 3FO9A 3CFNA 3CSPA 2QVKA 3GMNB 5E8OA 3SE8L 3RY6A 1G7JA 2WXIA 1V3MA 3Q43A 3S6CA 5D1ZC 1IT9H 1EJOL 1KLFB 1P4IL 1Z6JT 4PGEA 4G8GD 1KIRB 1MCNA 3QE5A 4ZX4A 3FC8A 1F3RB 4MAUL 4XAWL 3MV8E 1RUML 5BXFA 4B6ZA 2E9IA 1FFPA 2MNWA 3QUGA 2Z65C 1J8HB 3AW5A 4PJIB 2XCMC 1UWEL 2LABA 3UGXA 3L7EA 2P5WA 4ZO6A 1E4HA 3JWDC 3QG7H 1NCJA 5B1JA 5GGQL 1KCSL 4IW4C 5HHQB 2J8UA 3IFPA 1BIIB 1WFOA 4LHUA 3MCYA 4K23H 5KTEL 3OG6B 5C07A 3H2QA 5I1GL 3CUPA 3K6SB 4G3YH 4MD5A 1CBVH 2CBPA 4AJWA 4P49A 3IJ8A 3T71A 1MQ8A 1G9NL 1I3RA 3MRPB 4UUJB 1CL7I 3QORA 3S5LA 1SEBA 3T4AB 1KYAA 5IJBC 2V3EA 1O75A 3WFCL 3T3MF 1HHGB 3U9WA 1EO5A 2GBUA 5KEZA 2YAQA 5D7SH 3BD4A 1SPDA 4Z9KB 5MENA 4OKVA 3ZYOA 3D0AA 3T04D 1VAHA 1AZZC 5EU4B 1EHLL 4MRCA 3GXIA 2A5UA 3HE7D 4P2QB 5EBWB 1Q94A 3MOBL 1I85C 1OSPL 3ZDYB 1I1AC 1RUAL 1ZY9A 1MWAB 3THMH 2QELA 4FL4B 3NZ8B 3MOAL 1LO3H 1R3KB 5DTFA 1ZGLM 1MLBA 1CI5A 2A0LD 5KJ4A 3QIUB 5FW8A 3AU1B 4TQ8A 4GBXD 2I25N 4JDZA 3SBWA 5CZRA 3IMVA 1U58B 1MHCA 3RX7A 4JQXC 4KKRA 4XN5A 2D31A 5DQ9A 4N8PA 1Z9SA 4KMLB 1XF5B 4G7QB 3IDXL 1JGEB 4IKKA 3MUGB 4KITB 1RQ5A 2WY3B 5HI5D 4DZ8B 4FKKA 1DUYA 2FJFA 1L0PA 2VMDA 3SDDA 4HHAB 1JFQL 3KXFA 1DQDH 2ZOLA 1L9OA 3P0VH 5BW7C 1YDPA 4QXUL 1HXKA 2NUPB 5D5ME 3RTQD 3NEXA 4UT6H 3CZFB 1T4KB 4JQIL 1F8TH 3D3VA 4MNGA 4EN2A 3HMXL 4YSTA 3O81A 3WN5A 2FJSA 4S2SA 5HI4D 1QI5A 3CFJB 1I8LC 1MCIA 1ORQB 1XTLA 3UBHA 1MCHA 5HYJA 1NCGA 4G9DB 4NRYA 3L1EA 3S5YA 3O6LH 1B4JH 3KYAA 4DPRA 1CO1A 2WSKA 2X2JA 4XRCB 3LIZL 1PY4A 3L95A 3SPHA 1BLNB 2A83A 2PLTA 3BDYH 4YHNB 1WZAA 4NUJA 1P7QB 5FM4A 1LP9A 3ARGA 3DURA 1IAIL 1WA0X 2YAMA 2ZOUA 2ITEA 2A2QT 2B1AH 3HMWL 2H0PA 3ZTNH 2X9YA 3MLYH 1SDYA 1D5MA 5EUOA 5IW3A 2XT1B 3CFDB 4J4PC 3DX4A 4E41E 1DANT 1AKPA 2H3NB 4XNDA 1YPZA 1Z3GL 4WCYH 2M8XA 5FUCC 4M6NH 4HS8H 4JN1L 1T1ZB 4Q9RL 1Z1WA 3CC5B 5D1XC 2OQJB 3MV8B 1QUNA 3BAYA 3U4EB 3PY9A 1OF2A 3S35H 3WOVA 1J5IA 2YN5A 1WITA 2OZ4L 1DVFA 1K85A 3K2KA 2BW5A 3WSQH 4NQCB 2Y3AA 3Q8FA 3GFUA 4L4VA 2QV4A 1NMBL 3FQNB 1NGYA 4JZNA 2AV7A 3FXIC 3L2LA 1SM3H 3HLAA 1E7UA 1T6BX 3VW3L 3RL1B 2ZWSA 2AMGA 3HA0A 2XA8H 3MYJA 3MLTA 3CN2A 3SO5A 1Q72L 5CN3A 5C0DB 3MLZH 5IHUL 1CQKA 1BVZA 3WKYA 4ODTL 1SEQL 3RBGA 3D48R 2R1WA 1KIQB 4HXBL 3DUHA 2X4QA 2D3LA 4HSAC 3RILA 4ESKA 3A5VA 4TTDD 3EJCA 1XMEB 3GSRB 3W9DA 3ZRFC 2J3SA 2LT9A 2J12B 1A7OH 1FIGH 2DYSB 1JWUB 3MXVH 2VDRB 2CDGB 5DSCA 1IX2A 1U8LB 5HHOA 3WUWA 3S36X 5I0ZA 3WEXA 4WNSA 3TL5A 4ORGA 5D4HA 2V2XB 2X2UA 4V2CB 2ZYSA 1G7QB 1U4FA 5C97A 3WIHA 2YUXA 4E68A 1E3ZA 1VFBA 3LZNA 1UA7A 1LO5B 1RIUH 2Z92B 1AKJA 4U1IA 2R0KL 3KVPA 2YAPA 3LQAH 1OLZA 3GJFB 3HFFA 3ROOA 5C8JA 3ZVVA 1T20B 2HTLC 2XJLA 3OKOA 3OXSA 4GG6A 2KC0A 3R8QA 3QYNA 4NWTL 1GGYA 3MRCB 3I50H 2VDNL 4G43B 3L3DB 4N8CH 4UM8B 1DJHA 2FZ3A 4A2DA 4ZUWB 3LSOA 4F8LA 3UMTA 4PJAE 5IQ9A 3OBAA 3GMOA 4A2EA 1QHOA 3QWQB 4OR1A 2W9LA 1N6VA 2CKBH 4I5BA 5AG9A 2YMXL 4JRXD 1WEJL 3DX9A 2J5LC 5D7JB 5SX4H 1FZOA 4JHUA 1AO7A 2A74B 3BP7B 2BOCA 3PUCA 1YMMD 2V2TB 4KMTH 4K9JA 5F97E 3OB8A 3HVNA 2AABH 3BGFC 2FEEI 4TSAH 3VGFA 3VD4A 2VXSH 5AW5B 2WMPA 5B39A 4NQUA 1G7HB 5E5LA 5F3BB 4NKIL 5H8DA 3F6IA 2N7SA 1UACL 3PJNA 3P0YH 4ZZKA 5HVFB 4G6KL 4FYRA 1JRHH 5JHLL 3Q9PA 4H5SA 2BMKA 3EJZC 5GRWA 5GQBA 5H37A 1LK2A 5H4ZA 1EAJA 4A63A 1WWBX 4L8CB 2ATPB 3PABB 3A4DA 3T3MB 2DPKA 4KK6D 1WCQA 3PXLA 2PW2A 4NO5A 3S37L 1J87A 3VD2A 1L9MA 3GYRA 2BS9A 5FO2A 1EWHA 1KLUB 2YUVA 4R7XA 2YGVA 2ZXQA 4K2UH 4TUOA 1V05A 1VF5C 3SEPA 3MGTB 1ZJBA 3RWFA 4E41B 5DMKB 3DSFL 4XC3L 4ELMF 1MHPL 1SXAA 4M3JA 4WDIB 3ZTJH 4HUWA 2IH3A 5ESQB 3MLUL 3QG6B 4EIBA 1ETZB 4NZTL 1E27A 3MBEB 1FC1A 2VSDA 1WBXA 3BKJH 4JREB 2YOCA 3HI1A 1NAML 2H3KA 2FGWL 7PAZA 1FFOB 4ZW5A 4W9FC 5DUPH 5C0EB 5J6GA 4GKSA 4O2CB 4Y4HA 4M6ML 2O93L 4X6DA 3C5JA 3H9SA 2IFFL 2ZOWA 1INEL 3FQUB 3T1FB 5BNXD 3DTDA 1OAXL 5TTRA 3UZVB 3II2A 1H3WM 1MHHA 2Y69B 3F64A 4Y4KB 3VFSA 2ICWJ 1MWAH 2XV6B 2Q6WB 2XPYA 1RHHB 5E0QA 1N5YL 1N2RA 1GGTA 4JRYD 4Q6IA 1CF8H 1BZOA 3EYFB 4WVRA 3UYOD 1TIUA 2CKNA 5GXBB 3QEHA 3VM5A 2HFEB 5ERWA 3BX7C 2C9QA 2E6QA 4MD0B 1D6EB 4WFFE 1JNHB 1KCVH 3QO1A 4KMQA 4PJ5E 3FCGA 3S34H 1ZRUA 1H15A 4X0KA 2WKOF 1SQ2N 3KE0A 3VXRA 1NTDA 3SGEH 2COVD 2P8MB 2LV4A 1RMFH 2RD0A 3IMTA 5T1MA 4TLKA 4UILH 2B1OA 2XFXB 4M62L 1EH9A 2BIQA 4NT6A 1DJIA 3BVUA 5AZ2H 1A3RL 3OKDA 3JTSA 4YC2B 4M8QB 3MU3A 4NJ9L 1QFHA 2ZICA 4YE4L 1H3TA 4TUUA 4Q2ZB 1UD6A 4N6RB 4HKZB 3FUHA 2CIIA 2FJHB 4Y2LA 1BIHA 4BH8A 2PABA 4XX5A 3HRPA 5E1AA 5CBAB 2PR4H 1UH4A 1RD6A 2BSED 3E1F1 5K9OA 1SVCP 1MJUL 5C7XL 4K3EH 4H8WC 1MUJB 3AXLB 5KVMC 1ICTA 3EZ8A 1W8EA 1TU2A 4GRWB 5KVFL 4ELME 3V0AC 2FWOB 3IDJB 1X9QA 1U8HA 2BVQA 4GXVH 1NGXA 4G80A 1A4AA 5KANI 5ESAA 1TZGL 1ET7A 1FNLA 3TBYA 4UOJA 2AJZB 3KYNA 3WMPA 5BUAA 3LKQA 5ID1B 5I1AB 3HE7B 3FSVA 3VFGH 4X4MA 1H3XA 4HX1B 5ID0B 5CWSB 2AJUL 3MA9H 4OBSA 2CPUA 1X5ZA 2GJ6A 4ZDHB 2DBJA 3CZGA 2R0ZH 3HZ3A 5HGBA 1TT6A 3RGVA 1ZANH 2OV0A 3LNDA 4OLZH 4BCZA 4L3ED 4AEEA 2YEZB 5JW4R 1X9UA 1IBHA 3BUBA 3QJVB 2OJEA 5LCVL 4X98A 2JJVA 1TYRA 1PSKH 3HG0A 1GZHC 4F2ME 4FFWC 3V4PA 5IROD 2WLIA 2CHZA 1LEKB 3E7JA 1MCBA 3QDJA 5DD0H 1FN4A 4WK4B 2ZQKA 2J1ZA 1D5ZA 3WAKA 3W5NA 5IK3B 4QF1A 4X6BB 4KK8D 3OKEA 3DJRA 3NPSB 5JNYA 2FBRA 5BRZE 3RTQB 3ARTA 4GI8A 4LPUA 5JOFB 5I16B 1K8DB 1YMME 3BPLC 3M17B 2O61A 4HJUA 1QQDB 2E75C 4DEUA 1RIHL 5I19H 1SHXA 2PWEA 5HY9B 3L1OL 5CJQH 4LLDA 5DJDA 5F21B 1L9NA 5I6LA 2H0EA 1CXHA 2IALA 2WQAA 2UY7A 3UBXA 4F3FA 1BFVH 3FH8A 1AR2A 3L3KB 4Y5VB 4AI7A 2BFGA 2XN9D 4HCGA 2VDRH 3C5ZD 1XSOA 2ZWKA 1N9PA 1OM3L 4PS8A 4DUVA 4HUXB 5AAMA 4NZFA 3S0PA 5IOPA 1UZ6E 1WD8A 1R4XA 4G8FB 3VFTB 1AQHA 4YMPA 4OIIL 4WSJA 4UT9L 3B34A 3MOQA 1YEHL 4PJEA 5A7BA 3L4VA 1R1CA 4CADB 4HJEA 1BQUA 4NRXA 3WY1A 1NC4B 3GJFH 3V4LA 1JWSB 2WPGA 1Z5LA 3L81A 5IHLB 3VX1A 3B9KC 3VUAA 2AQTA 3LRGA 5LG6A 2G30A 1P9MA 1KF9B 1P4UA 4JN2A 3MRLB 1DDTA 1OCCB 4NCC1 4P3CH 3B3IB 4UM9A 1R17A 2R39A 3OHMB 4XH2A 3D18A 2E27L 1CFNB 3QEUB 3O2DA 3PWNA 2ZKYA 1L0XA 5I1IH 3BPOB 2OMNA 5J0BA 4G1EB 2OYKA 1YVLA 4L05A 3I02B 2BOLA 4MAYB 2PN5A 4NNYB 4NZRH 4TULL 3QISA 4JKWA 1KYOK 3RL2A 3FO1A 1ZLVK 4U1KA 1NGPL 2FT8A 3ENEA 5E6YA 1FO0L 4EZJA 3N85L 4Z7UA 1TFPA 4YK4C 4NKDB 3B7RL 4YQXL 1R6VA 3SE4A 2IPUK 3VXUD 3E6HB 3Q2VA 1I82A 4LCCA 1KXTB 3PWVA 1IAIM 4J23A 3QUZD 2WINB 5E1IA 4DGVH 3HNVH 2JK5B 1BMGA 3ZHDA 5L88L 1G7LB 4OQTL 3MSPA 3QA3A 1FJ1A 1J8RA 2EDRA 3NSXA 2Q2EB 3OJDB 5CZKA 2XKSA 1FVCB 3FCTA 4WWID 4KRPD 4ELMB 4N5UA 4XPAH 3MUHL 3DO3A 1R24A 4M43L 3VCLB 3A22A 3QR1A 3WDIA 4N2EA 1I9IL 1HQ4A 4IBWA 4MQ7B 3BVNA 5EULV 1NGWA 1HK6A 1JPFB 2R2BA 1E9PA 1EHAA 4KROD 2XIBA 3AABA 4UMGA 4P2OC 1IQDA 2ZUUA 4HUCA 4YHYC 5IMKB 2ZCZA 4N0FA 5CP3H 5BZWA 2DY2A 4B97A 3S8GB 3U2SB 1UGKA 1UWXK 2QPSA 3DHPA 3EZJB 1SBSH 2KBGA 4HIJA 2EIZB 1NOAA 4X7TB 2BX5A 1U8PA 1W2KT 2ZKMX 3MJ7A 3QQ9D 2GEQA 3KBHE 2K8MA 2YC1B 5F9OH 1Q9OB 2VGLM 2YPVH 4QRUA 5EOCL 3UC2A 5L2KE 3BQUA 1UA3A 3LN5B 4MXWH 5I1JH 3UBXI 1L3NA 1SOKA 2X0UA 3HRZC 3KDMA 2LR4A 5C9JB 3VFPB 1S78C 3D85A 3D51A 2X4TA 2XTJC 2D7NA 3ARBD 2KDYA 4TSCL 4O2FB 4QRPD 4IRJD 5I18H 5BZXA 5D70L 1DQIA 4H0HB 3IDNA 4F8OA 1M7UA 3MMEA 3BDBA 4G8EB 4N22A 1H8NA 4OF3A 4AUUA 4CNIB 3NPZB 5KSUB 1KIUB 1YMMB 4RISH 4OGZA 1S9YB 1HDMA 4KJPC 3GBML 3CVHA 3S3JA 3O0RH 3PHOB 3OQRA 3B9EA 4CVXA 2NY6D 3DRQB 4EN3A 2OXGB 2R29A 5GRZA 4L3EE 4HIXL 2UY6A 4ZFZA 3KLKA 1HH6A 1N5AA 3FH7A 4N2OA 3UGUA 4UQCA 5F2FA 2FO4A 5EC2B 4HUUA 1F90H 2DWTA 3KYMA 3FMGL 4WI9A 4PRAB 5E2TL 4OCSL 1MXDA 1KTLA 5F7EH 3TCTA 5HP5A 4UT7L 2X70B 3M88A 3N0AA 3C87A 2CZNA 5CFAA 2BSSB 3HB3C 4MMYB 4QKXB 2OSYA 1D7FA 4YWGL 5I8OH 2VR3A 3LKNA 2GYSA 3E2HC 3UO1H 1HL4A 1NUFA 3A0OA 3OR7B 1AMXA 4K8RL 5DJ0A 1J12A 4PWKA 1YY9D 5GGSA 3KNBB 3OGCA 1RZ7H 4GRWH 3K71A 1DQDL 2VQ1A 4O51A 1CC3A 5I0DA 1E9OB 2XN9E 1U36A 3QDMA 1JVLA 2ENJA 2PCFB 4GMTH 3MUJA 1I7UB 2DS4A 1KJ3L 1UB5B 3DOIA 1LE5A 1F8TL 3DX7A 4ZQKB 1IEAA 1YUHB 5F72S 1PKQB 3GINA 4KX8A 1QLEB 4GW4A 2RIKA 4WGKA 2JJWA 4RRPG 3VFUA 2E47A 4G7VH 3ZE0F 4JL2A 5B8CA 3D2UB 3TBTA 1GMEA 2HRPH 1QSVA 2VDQB 4RGND