4YSRA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 16.6 mgy
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
295
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
molecule tags Oxidoreductase
source organism Geobacillus thermodenitrificans (strain ng80-2)
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
total genus 96
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysrA00
1L9QA 1OV8A 3FQ2A 3PPSA 1BQ5A 4W1TA 2PCYA 2GSMB 5B1JC 3UADA 1L9SA 3S3BB 2UX7A 2HRHA 2BW5A 3FT0A 4BDVA 1SNRA 2IWEA 1JZEA 2TSBA 3X2QB 1A4CA 1JOIA 4F2EA 2WO3B 4AKOA 1JZGA 2GB2A 7PAZA 1AS6A 1JXGA 1ZDSA 2VW6A 3QJQB 4HHGA 1J5DA 2PP9A 1AQ8A 3HEIB 3T6VA 3FSAA 1PLBA 4HIPA 3NYKA 4YSSA 5A7EA 3CG8A 1KBVA 8PAZA 1AAJA 1NICA 1WA1X 2I7SA 2P80D 1NIEA 3TBBA 2IWKA 4DP7X 1N70A 2FNWA 1IUZA 3T6ZA 1GY1A 1KCWA 4DP0X 2MRYA 1BXAA 1PNCA 3AZUA 4ENZA 2AZUA 3ABMB 4YSDA 3AG4B 1M56B 4ZK8A 1A3ZA 5I6PA 3PAZA 4G7SB 1JERA 1T5KA 1PLCA 4KOCA 5D4JA 3OM3B 3EH3B 1ZIBA 3RYMA 2YAFA 1JVOA 2B3IA 3WI9A 5ANHA 1XB8A 3AG1B 1AACA 1BEXA 1KCBA 1ILSA 1OE3A 1ZPUA 2JXMA 3IEAA 3JTBA 4DP1X 3FPYA 3T9WA 5TK4A 1SDDB 1AOZA 2YAEA 4DP2X 4E9WA 4TXVB 2Y1AA 1QLEB 3X1BA 2YAHA 3AG3B 2AVFA 1V54B 2PPCA 2XLLA 3HB3B 3ZBMA 2J5WA 1E5ZA 2BHFA 4W9ZA 4F2FA 1XB6A 1SFDA 4KO5A 3QJSB 1GSKA 4P5RA 3X1EA 1WS7A 4JHVA 1AS8A 4YSUA 2NRDA 1VLXA 3SBPA 1A65A 4HCFA 5B7MA 4A2GA 4YSAA 4E9TA 2PLTA 2GHZA 4DPCX 2XUWA 2TSAA 1YLBB 2IAAC 3ASNB 2XXFA 2GI0A 2I85A 4K9JA 3DTUB 2HX7A 1SDDA 1ILUA 5I6OA 2J55A 1AZRA 1FFTB 1MG3C 2DY2A 2GC4C 2BP0B 1ETJA 1OCOB 1RKRA 3NP4A 4UANA 2BW4A 3CDZB 2J57A 3ZX1A 1NPNA 3FYIB 4N4YB 1RZPA 2E86A 3N2JA 1E30A 4GYBA 1WAEA 2FT8A 3ABGA 2BP8B 2QT6A 1QHQA 3NSYA 5F7BA 1PZCA 4E9RA 1JZIA 4YSRA 2RACA 1KBWA 1I53A 3H56A 3AW5A 1W6WA 2FT6A 3OD3A 3CVCA 4UAHA 4QKTA 2FWLB 4G7QB 4GY4A 3ABKB 1BQRA 1KGYE 5I28A 3WKPA 1AZCA 2N0MA 4AX3A 4BK5C 5TK2A 2UXVA 4A2HA 1MZZA 1NWOA 1JVLA 4M4RB 3T71A 1NTDA 3GDCA 1E65A 1OE1A 1PZAA 4N8UA 1F56A 4A66A 6PAZA 1NZRA 3MBWB 1J9SA 3FU8A 2R7EB 2GBAA 1NWPA 1A4AA 2EINB 2XV3A 2ZOOA 2EIJB 1MZYA 1BAWA 3CDZA 3S3CB 1ASOA 4A68A 3SBQA 1OCRB 3T6WA 2IH9A 1KDJA 4A2EA 1ASQA 4NB7A 2PPDA 2FQGA 3NJFA 5D4IA 3X1GA 4KO6A 2YARA 2YXVA 2WO2B 1ID2A 5EHFA 1R1CA 2YQBA 4DP9X 3S8GB 2IH8A 4YVUA 1AG6A 3CZUB 2VW4A 1ZDQA 3FQ1A 3NJMA 4YSTA 4G72B 1HFUA 1NPJA 2QDWA 3AG2B 1A4BA 2AFNA 3X1NA 2XYBA 2BO0A 3IN2A 2EIKB 2LLNA 2VN3A 4KNUA 3V9EA 1ADWA 1AG0A 1AZBA 2YAQA 2JKWA 1SFHA 4RH4A 1B3IA 4E9SA 1L9RA 1HAUA 5B1KA 3GYRA 1KDIA 2IDTA 4DP5X 2PPAA 1AIZA 1CUOA 1JZJA 2XV2A 5AZUA 1NDTA 2DYSB 4GXFA 1BXUA 2FQFA 3ZDWA 3L45A 2DV6A 2XVBA 5I5IA 1CYWA 2VSKB 3PAUA 1AS7A 9PCYA 1OE2A 2BP8A 2CUAA 3UGEA 2X88A 4P5SA 2Q5BA 2B08A 4FA7B 1OOWA 3FU9A 5B1AB 2XX0A 2PPEA 4HCGA 1WA2X 3SBRA 3FU7B 3UACA 4BXSV 1W8EA 1AZNA 1PAZA 4F7KA 1PZBA 2QPEB 2FT7A 1CURA 3X1FA 1CYXA 4FAAB 2XWZA 3NJLA 2XU9A 5I6KA 3TA4D 4X4KA 5B3SB 2BZ7A 3QJTB 3KW8A 5B1JA 4DP8X 5D4HA 1V10A 3SQRA 3BVDB 4HZ1A 1AR1B 4E9QA 3OQRA 1JZHA 3AY2A 2IDSA 3WNIA 1MG2C 1J5CA 1ET7A 3FYEB 1X9UA 2QPDB 4DPAX 1XMEB 3ZIYA 2XV0A 2JFCA 3DKHA 1JZFA 1V55B 2UX6A 5I5JA 3EHBB 1XB3A 3FU7A 3GXUB 2VW7A 2DWSA 3PCYA 2OJ1A 3OMAB 3WNJA 1IC0A 4HALA 4JHUA 2PP7A 2A3TA 1JXFA 3NJNA 2XXGA 3NSDA 1DYZA 4KO7A 1ASPA 1SHXA 2HZHA 1J9RA 2XX1A 2HX8A 2ZWNA 4KO9A 6PCYA 1GW0A 2ZONA 3QPKA 2PCFA 2GIMA 3S3DB 7PCYA 5AKRA 1JXDA 2OV0A 1BYOA 3FQYA 1EZLA 1ET5A 1AZUA 5I6MA 1J9TA 1PNDA 1E5YA 2ZXWB 1OCCB 2EIMB 2AZAA 2R7EA 3NJJA 2BWDA 4Q8BA 1M9WA 3EH5B 3FSWA 4HHWA 4KOBA 2W88A 1GS8A 1SF5A 3QQXA 2W8CA 4YSQA 1EHKB 1N68A 4DPBX 1IBYA 3CVDA 1OF0A 2VM3A 4KNSA 4HAKA 2IDQA 3N55A 2P80A 2HLEB 2J56A 2H47C 1GY2A 2BP0A 3NSFA 1URIA 1TEFA 2AANA 2CALA 1J9QA 1PY0A 2EILB 1BXVA 1NINA 4YSCA 1AANA 1GS6X 4GP5B 1SHWA 1GS7A 3PLYA 5PCYA 1KV7A 1WA0X 5FC9A 3UAAA 5B1BB 4G71B 4BDVB 2OCCB 4E9YA 1ZV2A 4AKQA 2YAPA 1HAWA 4AKPA 3S8FB 2UXFA 5I26A 4UF7C 1M57B 1W6LA 3TBCA 3V9CA 2H3XC 3ABLB 2HRGA 3FSZA 4PCYA 3G5WA 4YVNA 5PAZA 4YSOA 4YSEA 3T6XA 2H5UA 5I5MA 1TU2A 2CAKA 2DWTA 2GC7C 3BQVA 2VM4A 3WG7B 4BXVA 3NJHA 4L0PB 1ET8A 5IY5B 1ZIAA 3NJIA 1X9RA 1NIAA 1L9PA 3DIVA 2QDVA 4G70B 3NSCA 1SJMA 4GP4B 3NP3A 4AZUA 4CSPA 2YAMA 3FS9A 3MX0B 3ERXA 1UATA 2PP8A 2HX9A 3NJGA 2MTAA 5I6LA 2I7OA 3WIAA 3NJKA 3C75A 5F7AA 3TASA 1SF3A 1NIBA 1L9OA 3FPXA 4A2FA 4BWUA 2BWIA 2UXGA 4MFHA 2UXTA 5I6NA 4NERA 2IDFA 4A2DA 3EF4A 1PMYA 3QJUB 4DP6X 1NIFA 1GR7A 3FSVA 3IBOA 4BWWA 3WKQA 1PCSA 5B7FA 3QJVB 5B7EA 1PLAA 3KW7A 1IBZA 4CSZA 4WKXA 2WSDA 4M3HA 4PAZA 3U25A 1DZ0A 4AI7A 3D12B 2VSMB 4BWTA 1GYCA 5AFAA 1E67A 2IWFA 3ASOB 4E9XA 4E9VA 4DP4X 2YXWA 4QLWA 4HCIA 3UABA 1A8ZA 1FWXA 3OMIB 2CJ3A 1WS8A 4KNTA 3EH4B 5LDUA 3IE9A 2CBPA 3PAVA 1FA4A 4A67A 1OCZB 4Q89A 1TEGA 3H4HA 3UAEA 1NIDA 2FQDA 3TU6A 3QJRB 1QNIA 4YSPA 3CVBA 2FQEA 4YL4A 2VMJA 2HXAA 2X87A 4G7RB 1KYAA 4NAJA 2CCWA 1RCYA 3NT0A 2FJSA 2PPFA 3JT2A 2Y69B 3IN0A 2DYRB 1RZQA 2IDUA 3H4FA 1IKOP 2BZCA 4GP8B 1TKWA 5E9NA 1BQKA 2Q9OA 1L9TA 4WTQA 4JKNA 1BYPA 1MDAA 2YAOA 1CC3A 4EF3A 1PF3A 2FTAA 3OMNB 3PXLA
chains in the Genus database with same CATH superfamily
3TA3A 4FA6A 4WKZA 3QDJA 4P9MH 2ZUUA 2DMKA 5JXAH 4LLYA 1BAFH 4PG9B 2NYYC 4QXTB 1VJSA 4XVOA 4I3SH 1ZA3A 1RH8A 4Y9BA 1MHEA 3S36X 4PJAE 4ZDHA 4BKSC 2C26A 4U1HB 4AKOA 2CHZA 4AEHH 4JPIB 3DX9B 3IU3A 4QO1B 1JAEA 5JPMB 1IGTB 1FE8L 1SN0A 1GZQA 1AQHA 3G5VA 1RURH 2V9UA 2VDKH 3VWKB 1D9KD 5E0QA 2P7TA 5BRQA 3BUYA 3VH8A 4UQCA 4QT5A 5BW7A 5KTEL 3C8KA 3CHQA 3N85L 1LO2H 2E0PA 3CH1A 4CVXA 1J48A 1NIEA 1C5CH 1RZ7H 1GHFL 3PUUA 4G9FB 4J12A 3DOSB 4PTTB 3AFLA 1CGUA 5AZEH 1HQRA 1A7QH 1ZS2A 3KAAA 3PWUA 4NN7B 4WFHE 1UD5A 3HMWH 35C8H 2IAMC 4BK4A 1T5WB 3VFUB 3EFDL 4WUUA 3K71A 1S9XA 3VFGH 3BT0A 3RYMA 2YAFA 2R2HB 3VM7A 2ZT9C 1A6TB 4PREA 4W9CC 3BAJA 1RZFL 4PR5B 2FSDA 1UWGL 3ISRA 1CJYA 1S9VA 3PNWB 1RIHH 3FHQA 2CDFB 4OJCA 3EXJA 1NFIA 1KT2B 1MELA 1MXGA 1A6PA 1SBBA 4PJBB 2WYTA 1MI5D 1KF9B 3UBHA 2Y1AA 1ID5I 2CCLA 3B2VL 1B90A 1SVBA 4XC3H 2PPCA 4EPSA 5JUEH 1XFPA 3LIUA 3K72A 3AMLA 1F1DA 3FCUB 4AQOA 2HA1A 3A4EA 2O5XL 5GRJL 2OI9C 4FNUA 1SFDA 3NVQA 1A2YB 2YD7A 4JJHA 4KO5A 3FQWA 1JZ6A 2EE2A 3GSOA 5IB2A 1DUZB 1AOHA 1EXHA 4F91B 4P3CH 3OB0H 3KGRA 1BMGA 4LOFA 1KPVA 5IBUG 4DW2L 5T3ZD 3OR7B 4WFGD 1W72L 2Y72A 3MRBA 4N2NA 2BOCB 1LO5A 1VADB 4IU2B 4K3DL 4QMEA 3VXMA 5AB9A 1EHLH 5F3BA 1YCSA 2C3VA 3LN4B 4HXAL 5DR5H 5HGHB 1E28B 1OGAB 4S1RL 5DMKA 4KJYB 4OGZA 4U7KA 2GC4C 2WBXA 2OPCA 4F92B 3CFJB 5EEUA 1QZ1A 5AG8A 3QWQB 2VJXA 3P77B 4EMZA 4IRJD 2DM7A 1KFAL 2WTRA 1JV5B 4MMXA 1NPNA 1RZPA 5LCVA 1KCRL 3P3SA 4TPRH 1CXKA 4Z7QB 1E6JL 4DEWA 2R1XA 3K80A 1UM5H 5E1AA 4HJEA 1KBWA 3RHWK 3EG9B 3X12A 3C60A 3N1FC 4NKDB 2BNRD 5LBSL 1HWHB 3RURA 5J6GB 3UJJL 3UOAB 2FR4B 3BRDA 4UAHA 1FNAA 2EDJA 3B83A 3P3UA 3LVTA 2BSBA 4UB0L 2HVKB 3WS6C 2HFEA 2N0MA 5KYNA 2ADFH 4DN3L 3MJ6A 5CCHE 5HGBA 4PJEA 4ZQKA 3C5ZB 3TV3H 3VXNB 4AQEB 1T21B 5C0RL 1I8MA 3QIUD 3EJYD 1CFQB 4H8VA 1IO4C 1KTKE 4S1DC 4Y4FA 4JM2A 3ZOAA 5L2KB 4QKXB 3CAFA 1DE4B 2BNQA 2QSTA 2W0KA 2Z4QA 4H8QA 3BN3B 4DTGL 2DPKA 1ZLVH 1SZNA 1X6NA 4N87A 2ZOOA 1Q1JH 1BAWA 4EE2A 3UTSD 4GUOA 3IXAA 4B9JA 4JJOA 1IFHH 4D0DA 1OANA 1BVKB 2OTWB 1J1PH 4H44C 1Z1WA 3U6RA 1L0QA 2YO3A 3CHPA 5F1NB 3MXWH 5CU9A 1I7UB 2J72A 3MBWA 5BPPA 5BO0D 1AR2A 4JR9L 3KVQA 3T8VA 2Z31C 4TQPA 2BJMH 5JQ6L 2E56A 1QBLL 1WTGT 4NQCD 4JG1H 2BO0A 3BGMA 4YXHL 3WV0A 2CM5A 1PX3A 2VLMD 3CFQA 4ZMAT 4R96B 4JZOB 4Q9RL 2DKSA 2CHWA 1G7LB 3ARVA 1RSFA 2GEEA 3TBWA 1CFVL 4Z7QF 3TBYA 4D9RD 5IJVB 1Q0YH 3ZKXC 1KCUH 1CTOA 4PJ8D 3CFEA 1SBSH 5I71C 3U0WH 5ENWB 3GPEA 3VSTA 4GXFA 2WXOA 4XCYA 1UWFA 5C0GA 5K9JH 1VENA 3FRPB 4RMSA 4LCIL 4JFSA 2VDPL 4BUGA 4BZ1L 3R8BB 5ENWA 1MLCA 1O9ZA 5I15L 4MXWH 1S9YA 4QGYA 3P1VA 3G04A 5KSAD 4MDIA 5EG6C 1OSPL 1I4FA 1S9WA 3BKJL 4OY9A 1ZEAL 3BWSA 4B9IA 3C2AL 5CSGA 5IVZB 4AJ0A 1BVNT 4MAYB 4JJ5A 1DJYA 2UZIH 4XI5D 4G8FA 5E0FA 4KJWC 5T1KD 2QPEB 4GG8B 4KZEH 4PJGF 1CYXA 1TQBB 4WAFA 1H5BA 1KIUA 3Q1EA 1U8LA 4TUUA 4ZUVB 5TE4H 3BWUF 5IGXL 4YXHH 1O7SA 3ZL4L 3AM8A 4MASA 5E8OB 3CZSA 2YMXH 4ODSL 3TT3L 3SPVB 3QQ4B 4G7YL 1NGPL 5AD0B 2Z64C 2A0LD 3NPZB 1WFMA 3QFDB 2WQ8A 5I1LA 3JV5A 1YEEH 2OZNA 4AE1A 3PWLA 2BOLA 1HCZA 1KLGB 1OSEA 3TYFB 5L0QC 4J2XA 4I5BA 4N25A 3ETTA 3UAFA 4DUWA 4K23L 4QOKE 5TDPA 4TNWF 5I15H 2CLZB 3MOQA 3T09A 3CFDA 4JANA 4CMMA 3KMDA 4URTB 1CK0H 1N19A 1YDPA 4K94H 4HAFA 3CTTA 3T0EE 3GXNA 4R4FL 4IU3B 4AXWB 1NCGA 4G8GD 2P8LB 1T1WB 3LEYL 4LASH 2HRPH 2H26A 2VR7A 1OTSD 3M8OH 4KZEL 2OJEB 3O2DL 1BYOA 3EOTH 4J8RA 4IU3A 2FJGA 3EJRA 3JZ7A 4NKIH 2C4FU 3WGVB 3CDGB 1E8ZA 3ECUA 3T8XA 3KPOB 3QFJE 3PFQA 5D7IA 5C08A 2C9QA 3TCLB 2VN4A 4LGSB 1BJ1J 4IK7A 3GZPA 1I8KA 2A5UA 3K6SB 4QHKJ 1WZ1L 3V95A 3DX1A 4ZTOH 1P7KA 1F4WL 5L6YH 3GSXA 5IEHA 4LKCA 1RP8A 4QAMB 2YC1B 3LS5H 2BERA 2DQTL 4EDWL 3UJTH 1UJTA 2WO4A 3HRPA 2ESVA 2AS5M 2F7RA 5DURD 4JDZB 2NQDA 4IDJH 1B9ZA 1URIA 1KGCD 4KHTL 3OWEA 3KLLA 2DBLH 2OYPA 3GLEA 2VM9A 4D0DB 4ETYA 5L4JA 1GYVA 4KVNH 4LRNH 2RMNA 5JMOC 1OW0A 1AP2A 3CK0H 1E0OB 1C7TA 3HAEA 4MS8C 3WUZA 4GMTL 3P40A 2NZIA 1BXXA 1IKNA 3DUUB 1EZSA 2N7SA 5JNYB 4AJYV 3C6SA 2ZWLT 3K1KC 3EOTL 5HDBF 4I1RA 2VISA 3A4AA 5MEPA 2FJFA 4MDIB 2VQUA 1T21A 2JV6A 1J9CT 1RZKL 3LH8A 3ABLB 4HV8A 1VFAB 4KXDA 3SY0A 4DPRA 2HRGA 3U2SB 5IHWA 1A6AB 1DBKH 2DQUL 3ETBJ 1F4HA 2BIHA 3H1ZA 3V79C 1F4WH 1MJ7L 4FFYH 3SJVE 4N2LA 2DWTA 1RUML 2NNXA 3KWWA 2BPBA 4LCUB 3AABA 1XCQB 1S7RA 2AQRA 3C09B 3GJFB 3ILEA 4G42B 2AC0A 3Q9PA 2Z8VC 3TVMA 3VQ2C 3FFCB 2F5BH 4WWKB 2DAVA 1G7HB 4LSUL 2ITCB 3IGAA 3D3VE 5JO5B 3EBGA 1H3UA 5EFIA 2VDMB 2X4OB 1IAIM 4HS8L 4QHLB 5EZIH 1A7BA 2O61B 4EVNA 2EDWA 2I7OA 3QFDA 4DJMA 1U3JA 3HZMB 5EBMB 4H5SA 1BOGB 4K07A 3BFOA 4F7MA 1IBGH 1DVFA 2HPOA 4MCYB 3A5VA 4Y5XB 2EUXA 1XCXA 4L8SA 5FGRA 1CDHA 4JQVC 5HI3C 3M7FB 4KJYA 2OMUA 4G9FD 5TE7L 4F3FA 1MF2L 4HIHA 1WBXB 1EHXA 4F7MB 5JQHC 4NRYA 4TTDC 1A4JB 3KPSB 1GR7A 1BVKA 2OTUA 3QG6B 4AQZA 1KG0B 2BSCA 3V0IA 1FH5H 2D7TH 1K3ZA 4BM7A 3L5JA 1M7DB 2OJZH 2WSDA 3NIFF 4AUUA 3U25A 2KLSA 2X0UA 3DX9A 1QBAA 1F3DJ 5AFAA 2APFA 1QSVA 1DBMH 2V6HA 3IDXH 2Q1EA 4DP4X 4QLWA 4W9FC 4HGMA 4QXTA 1WHOA 3QUGA 4FTDA 4HWBH 3GINA 1VIWA 4A6YA 5DRWB 5MP6H 4FFVC 3Q01A 3UZEA 3ZE2B 3R1GL 1MI5E 3S35X 5E08L 3H4HA 3ALWA 4N22A 5H94B 1CMOA 2PYED 3CZFB 4OQ1A 5MHSD 4MXQC 4UT6H 2JIXB 1JPGB 4XNMA 1SUJA 3F12A 3SDCA 5JOPE 3JTTA 4XN1A 5AL0A 5FGBC 1KZQA 3IVKB 4FHKA 4OVVA 1SXAA 1LWHA 2RB8A 1EGJA 4PD4K 5ISZA 2Y69B 1TU2B 1ZTXH 3MRFB 4QRPA 3LQZB 1KXVC 1Z7JA 5KYUB 4X6EA 3LRKA 1JWUB 1AQDA 1BHGA 3EOBB 5LBVA 5T3ZE 2V37A 3UEQA 3UMTA 1ZLUK 1JF6A 3A6BH 4LEXL 3N06B 2NUTA 4RX4D 4WGWB 2NY0C 5HYSG 1CC3A 1PF3A 1QWNA 2C3WA 3B7TA 3CQQA 3VFMA 1OM9A 5C09B 3IJSA 2CG9X 4LNRA 4W1TA 2Y6TE 4Y5XC 1DVUA 4JRYD 5E7FA 3SDCC 4JZNA 2QKSA 2XTSA 3QULB 3FTVA 5IESL 2VDQB 4ABUA 5F6HJ 5MP6L 1FZKB 2FCBA 3FRUA 3ZZLA 4YIQA 3U1SH 1M3JA 5EIVA 5BO1L 3BDXA 2X1WL 5LVEA 3IFPB 2AGJL 1ZHKB 2YQ3A 4J8RB 3RIKA 4IOFD 1EMTH 2VLLB 3QUXC 4FN0A 5DVOA 3RU8H 4LGPB 4JM0A 5GHWL 5G4MA 5KSUB 4YUEH 4QXGH 1LK3L 3GRWL 3NIFE 3ET9F 4JN2A 4ELKA 2F53B 1X5AA 5BMFL 2IMMA 3S34L 1CIUA 5D7SL 1OAJA 3SYQA 2MQ0A 3N3EA 4KXBA 1N70A 3LH2L 3WFCL 2ZYSA 3WY1A 1UYWH 2O5ZL 5IOPB 3QYCA 4ENZA 4C83B 4NQEA 3ABMB 5IQNA 3TBSB 1IC4H 5ESVB 3TCXA 5CLXA 1MCWM 2YKLL 4XMUA 3TN0C 4P2RB 2YEVB 1U91A 2VLRD 3QUYD 5FWQA 4WFEE 2YD8A 3GNML 1XB8A 4J3SA 1AACA 5ANMA 2V2WA 2CIKA 5CSBA 1JDDA 3Q2WA 4CVUA 2OMUB 1CLZH 1HCVA 2IADB 2Q0ZX 4S1SH 5DFTA 4MXVE 4C47A 4XAKE 3IU4L 4WEBL 3U1SL 4N5ED 5EA0L 4A39A 4F15C 2EDXA 2B1OA 4XB7A 3CHSA 4UQ3A 3M1CA 2A9CA 2MFNA 3VI4B 5HHOD 4YUEL 1QRND 2YQGA 4N0FA 3LB6D 1QLEH 1TFHA 1YY9D 3L13A 3FN3A 3ZUCA 2ZUWA 3FFCA 5DHDA 3VNYA 5H4ZA 3OKLA 4S11A 2CDGB 4NOBA 1CICA 2IGFH 4GRWH 1JJUA 2HJLB 1A2YA 1MFAL 2FLRT 1UYWL 1MFEH 2X9XA 4YK4C 5EU3B 5FB8B 1CZ8H 2NYKA 2TSAA 3BDYH 4ADJA 1NGXB 3CU1A 5DMIH 1FRGL 2HX7A 1JHKL 1WISA 2G75B 1ILUA 2WXPA 1NAMA 3M07A 4KDTA 3OAUL 5E23A 5KANG 2YZ1A 1E5CA 3NZUA 4MZRA 3AY4C 4HV8B 3HI6L 2VTFA 1KENL 5FUZH 4LPTA 2G60L 1SGKA 2KPWA 3LDBB 2XNAB 3LRLA 5EIIA 1HTYA 3BAIA 1BZ8A 4KROD 4ZMPA 2NX5E 3MYJA 3X13A 4N4YB 1YZZA 4CKVX 4OGAD 4ATWA 4K5PA 3STBA 1O6VA 1GZPA 4F7PA 1UWYA 1BJ8A 2CRYA 1HZKA 5GS2H 2FH6A 4PJFF 4RGOL 2XXMB 1I7UA 4N1CA 3DSFL 3AU1A 3UYOD 1NDGB 1TMQA 2YQ2A 1XD1A 5FECB 1X5LA 1BM3L 5C0JB 3IFLH 3AT0A 4HULB 1NCAH 3ABKB 4Y8DC 4YWGL 2D7NA 3PGFH 4LCWB 3TPKA 1U8JB 1X5JA 4MGXA 3WJMA 3MX0A 1J1OL 2V9QA 1MWAA 1RK1B 2H7WA 2ZNWA 3QIBB 4IBZA 4KGJA 5T3ZL 3SE9H 2DYPA 3FQXB 2ROYA 1KTJA 1XH3A 5CD5D 1KWGA 3EO0A 1BSIA 1HCFX 4LSVH 1G43A 4AVHA 1F58H 4LL9A 3DX8A 3S8WA 1QI3A 2D7OA 3HNSH 3S0PA 2YGNA 3QQ3B 3F8UB 2R4SH 3EBAA 1B6DA 3RUGA 4HGWB 3HRZA 5FCUH 3ZR6A 4AG4H 1SJEB 2V7NA 2HT3D 3FZUC 3BP7A 3PL6A 3C9NB 4P23B 2FSEA 5F44A 2ENPA 5A7BA 2E27L 2A9AA 2IBZY 3SBWC 2L0DA 1KGWA 3B2DC 1ZDQA 4YEEA 4FS0A 4JFZL 2WJ5A 1T20B 2PW2A 5AW6B 1CI3M 1SLXA 2FYYB 1QO3B 3JV6B 1Q94B 1JN6A 5I30H 1I9JL 3OMZA 4QOKA 4RGMC 5FXCH 3P4LA 3V0EA 5C0CA 1P84J 1J8HA 2X1XR 1I1YA 1TJHL 2NDGA 5LO7A 4PWHA 3BPLB 5IHUH 3SCMC 1DO5A 4APXB 2KKQA 4JRWA 3RJOA 4L18A 2KZBA 3E9TA 3PQYE 3UTTA 4AQ8C 2AMGA 3BGFC 5EO0B 4E5XB 3ZHNA 2A4EA 2NPLX 2DV6A 2OW7A 3MGOA 2NTSP 3OF6D 4G8AC 5E5LA 4HDIA 4IGBD 5AVUB 5I5IA 3OR7A 2FIKA 3ETSA 3TWCH 1CE1H 1PPIA 3EYSH 3HLAA 1QFUL 2ZF8A 3D4GA 5FCUL 4OIAA 4ZRGA 2OSXA 2YRLA 3EUUA 3Q13A 1G9HA 3P4OA 1DSWA 2V5RA 5M7QA 2EABA 3OR6B 4N0CC 3KPRD 4URKA 3CZEA 3ZE2F 4DT2A 4BXSV 5BZXA 1CYGA 3EO9H 2OJEA 1KIRA 3HJEA 1LQBC 1ZE3C 5ITFA 4MA3B 4BZ2H 1CB4A 1A9EA 4FAAB 3KBHE 2JK5B 1VGKB 2O5NA 4OR1A 4XBEH 3VTTA 2JNZA 4NCC2 3MNVB 3RX7A 3GMNA 2FX7H 1DLHB 3ISYA 2H41A 4K2UH 1DANT 1JNHB 3MRNA 1XDTT 3BVDB 4OLXL 1NMCB 4DQOL 5I19L 4NO0D 1MVUB 2ICEA 2NY7H 1CCZA 4U7MA 1UWEL 5KSBB 3CSFA 2XV0A 2QFRA 1AKPA 1Z0NA 3GSNL 4X4ME 1UJ3A 5DHEA 5J8OA 2JVUA 4KK8C 3U0TA 1VDGA 1IJNA 4OLYL 5CP7B 5A2CA 2NY1B 2ITEA 4GNKB 4XODA 4D9QD 5I66B 1F3RB 2F19L 3L3OA 4RFNC 4OB5H 4BUHA 4M5YL 1MFCH 3UBXB 2Z91A 1DVYA 1L7TL 2QVIA 4KTDH 5JZ7C 4P57A 3DPDA 1LP9E 2EDHA 1DYZA 1NQBA 3GBNH 4XVTL 2XX1A 2VMFA 3STLA 2P5WD 4ETQA 4RBPK 1H19A 1EO8L 3RGVD 2XA3A 3U48A 4Z7WB 4QT5B 3L2LA 2YN3A 4GXUN 3VFOB 5E5MA 1K4CA 1X5ZA 2J1KA 4ODVH 4Q6IC 3GRWA 2VLJA 1ZE3H 3EYQD 4G9FE 4XPFH 3UYRH 2L8AA 4RAUB 3ZLQC 5CEZL 1EZLA 4HIJA 4Z7WA 4JM2C 4FQ2H 1JWMB 5SWZE 4YHML 2OMWB 1KV3A 2WAQA 3CCHB 4HXAH 5E00A 5T1KA 4WRLA 3S3JA 3UCQA 1PNDA 4I0CC 4LSPL 2R7EA 3BRFA 3CU7A 2X10A 4H2CA 1MHPL 1T7XA 4HPHA 1D7DA 4LBEA 3HG2A 5IP4A 4FQHA 4XMWA 1A02N 3QQXA 1PVHA 1XCTB 2X89D 4AGNA 3IS0X 1SOKA 4NJ9H 4RGNE 2V7HA 1SEQH 1TPXB 1X5FA 4X6DF 5GZOA 1PKQE 1NEZA 2MQGA 1F5WA 1YEGH 2R23A 3BT2L 3CQPA 3BVTA 3E6FA 3B2MA 3HNTL 4G7VL 3ULVF 2C7UA 4K8RH 4KKAC 5FGBA 4GW1B 1PY0A 5BXFA 3VFSA 5HI5C 2JJSC 1R3KA 3UC2A 4KTDL 2VAAA 4JHWH 4AM0Q 5PCYA 1RK0A 3VFUA 1PQZB 3CSGA 4RNRA 1HH6B 4HUUA 5DMJB 3K8KA 1MCCA 2WTRB 3QYMA 2DJ4A 4BQBA 3MHZA 1L9MA 2EYRA 1XF2A 3DX4A 2Z31B 4ANUA 2UXFA 3FQNB 4I3RL 2EADA 4IRZA 2VE6B 3L9YA 3FSZA 3IWVA 4WO4B 3IXAB 4KXZI 2WGNB 3MODH 3BQVA 4GBXB 3WG7B 3P0YH 2W81C 4O9HL 4IOIA 3PGCB 1MCNA 4Z95L 3QEGL 1LDPL 4JM2B 4L2LA 3UJIH 3B56A 3B9KD 3LKOB 4CSPA 1A9VA 3CLWA 3S35L 3FH5A 4E5XG 1GGIH 5ACLA 3CGTA 1HSAB 2HX9A 1TTUA 5I1KH 5I74C 1EAOA 1RJLA 4ZOBA 5BV7B 1QBLH 1XIWC 1UCTA 4X98B 4P5TC 5KSBA 2OSYA 3IDYB 1BD2B 5F7AA 3SGEI 1HHGA 2IAMD 3RL1B 2F53D 4WO0A 5DJ6B 5LDSA 5DHVH 1NCBL 4MKTA 5E9DA 1INEH 4H7VA 1CLCA 4Y89A 4YDIH 2QSVA 2BH0A 2YMOA 4HLZG 2E74C 4NZ8A 1RZ8A 4RAVB 1ZK5A 3HS9A 3QQ9C 4DP6X 5DJ6A 1SJEA 3Q6FA 2AQQA 1P5UA 1S5IH 4LLUB 3WLBA 4KKZA 3JWNH 3WEXB 3V6ZA 5B7FA 5T3XL 1C08B 5D2NB 5DS2A 2Z3FA 4P2RD 5I82A 2Y36H 5FHBL 1DZ0A 3I75A 4NPKA 4POZC 5C0BE 2HJFA 1WBYB 1GYCA 3T2OA 2FAUA 2MPVA 4G6FB 2PO6D 5DD3L 1SOXA 4ZMWA 4WFED 3CH1B 4NO3B 4W9KC 5EU6A 4PJGB 1SQ2N 3BZ5A 5C92A 3JYCA 1JGLL 2NY2C 2UY6B 1GGIL 3D2UB 3IE9A 3PAVA 2DQJH 4L3CB 5DC0A 3DRQB 3UTPE 5BZDB 1NKOA 5HGDA 3PV6A 2P5WA 2RHEA 3DIFA 3WDIA 3EUDA 2R1YB 4N0RA 4QDGA 1NIDA 3EJUA 4Y16C 5JIIA 1YJDC 1FSKC 4KMTL 5KSBE 2FHCA 2J88L 4OLVH 5D5MA 5AOKA 3V0AC 3QFGA 2OMXB 5DEGA 3OKOA 1EK3A 2VIRA 5FYLL 5FW6A 3Q0HA 4PJ9A 3RPIA 1OD7A 4F57L 3TJEH 2IDUA 2WB1A 4PGBA 3PNRB 2R0WH 3ZT6A 2RAMA 4LVHC 3OGCA 2EDEA 3ATAA 1WUNT 3O0RL 1D5BB 3WEAA 1FZOB 1VPOH 5DLML 2GIXA 1FVDB 5F97E 2EECA 3L4UA 4XNYH 3TNNB 4OCSH 2NZ9D 2WSPA 1HZHL 3FQUA 1TYEB 2NY4B 1G7IB 1MFBH 3HI5H 2OFQA 1L9SA 3BH9A 3QJFB 4R7DB 3HKFA 3HZKA 2XWBB 4GEJA 3KEDA 3TIEB 1GC1C 4AMKH 5C6TL 1JGLH 5FCSH 3MLRH 4TYUA 2E4TA 4TVUA 1TTGA 2VW6A 2XBZA 3MV7D 2CDGA 4PPTA 4X7TA 2IPTL 4YDMA 4ZS6D 3H0TA 5INCA 1LDSA 4D8PB 1UASA 5EBGA 4GKSB 1A66A 1GGBL 4AVKA 4XAWH 1LO0H 2F08A 2IANA 3FSAA 3V7AE 4YHNB 3NYKA 3LY6A 5CMAB 3KG5A 5F7NC 4OD1H 1NCTA 4OJFL 4HQQL 1MNUL 2AJZB 3MBEC 2WBKA 4KUCF 4NLAA 3GMPA 4YDZA 5FYJL 3W9EA 3ZQWA 4ETQB 4X7TB 5ADOH 1WQVT 2X3CA 1U8IB 4NM8H 3ROOA 2A74B 1RU9L 4IMKC 1AHWC 2JJUA 3QIBD 2AKRB 2NCMA 3A6OA 1Z2KA 3ZKQD 3FOLA 3FO2A 4TF4A 4YNYB 3SKMB 2PCXA 2Z9TA 4NN6B 2HB0A 4PV9B 3FO0H 4B53A 4QOKD 3HVNA 1CXHA 4DEPB 4LRNL 4KOCA 1QI5A 4TNVF 3NCBB 3R7RA 1BG1A 3D0LA 3Q6FB 1OOAA 5DC9B 5IK3B 1ODUA 4HUVB 1YNTB 3LCYA 4L3AA 1QQDB 5C0ND 2MPAH 1P4LB 1R3JB 1A7OL 4Y16D 3IBEA 2MHAA 1JNHA 2Z1KA 5EZJB 1AHKA 3B37A 5KVGH 1KBPA 4E9WA 1DCLA 1HHGB 1UXLA 3KE0A 4GS7C 3OKDB 3QNXA 2CQVA 5AWNL 4NDMA 4UTBL 3KL3A 2Q3ZA 1D9KC 1FIGL 1QATA 1VF5C 1U8PB 2WZ0A 4PB0L 3HE6C 3IDGA 3T0WA 4F2FA 2XPGB 4OLZH 5JHLL 4P5RA 2VDKB 1DFXA 5I0DA 2IOIA 2XRAH 4IKJA 3DYPA 3F7PC 4MAUH 2E9JA 4XWGL 4HJIA 3ZDZB 2KT6A 1XXDC 3D25A 3DUSA 4YSAA 3HMXL 3SPJA 2KQMA 5L8KB 4F8NA 2PXYD 3IMWA 3ULSA 3DC0A 3ARUA 4G1EB 4IJTA 2IAAC 4OW6A 4UQAA 3FHEA 3ASNB 2XXFA 3HAEH 2YRPA 2ZG2A 4TULL 1ESOA 1JNNL 4L4TD 2IFFH 5EZIL 4AENA 1OAUL 4ENEC 2J55A 4PBXA 1AZRA 3GSRA 3U4BL 4MB4A 3RB5A 4CC1A 1C1EH 1B4JL 3LIZH 2DB8A 1U8HB 3NDZE 2B20A 1BV8A 5F93C 1I7ZB 1RKRA 1RFDH 3I2CH 2XZCH 2NQ3A 3IDNA 1LP9F 3L16A 5TF1L 5LLIC 5LQBL 2H0PA 1GAFL 3BUTA 3DJRA 5KN5A 4KHXH 1DQLL 4XMLH 4D2NA 4Z6AT 3SO3B 4NQEB 5KJRH 2WWKO 4UZGA 4HVBA 2H8PA 2F58H 2FBOJ 2ED9A 3GLDA 3VWJA 5GGVH 2WKOF 2D03L 1T0OA 1H6TA 4ZSOE 1OP3K 4XPHL 1F6AA 2CLVB 1ZVYA 1FNEA 3CDFA 1MCHA 1TZHA 4IKNA 1SMOA 1LNUA 1LILA 1X4YA 2NR6A 4U1NB 4AX3A 4BK5C 2KZ1B 1PZUB 1T5XB 3ULUD 3G5ZB 3MRQB 2ZP0T 5ID1A 3NIGE 4GUPB 4F2MA 1J0JA 2EDTA 3QO0B 4E41A 2SEBA 4GRLB 4HMDA 4LBEB 4LLMB 4LVNB 1N6VA 2P4AB 5IEKA 5CINL 5HI4D 2BVPB 2NNCA 4NIYE 3BUDA 5DJXA 1KTDA 1NZRA 2Q76B 3WN5A 1U8IA 4F1ZA 3EO1A 1BZDA 2ZYRA 2XQBH 4UT6L 3QIBA 2DIAA 2XG4A 2XWXA 3K2UL 4WUKH 4AITA 2R1YA 1T22A 3BSHA 1Q9WA 2EYTB 1B0RA 3CDZA 1CD1A 1J1OH 5CMAA 3V4UL 3RVXD 1SYSB 5HI5D 3JZYA 4HEPG 2HLAB 5FK9A 5E2TH 5E1HB 3UTZA 1N64L 4UQ9A 5BQDA 3R06A 4MCZB 4XP5L 2IAND 3DJTA 5C2UB 5I1DB 4MVBD 4XT1C 3BSGA 1G9EA 3GTNA 5I8EA 2O6PA 4N8CH 3P2DA 1AXTL 1IGJA 4LARH 3UYPA 3CZUB 4HHAA 2E59A 4L1HA 4KROC 4DO4A 1HVXA 1F97A 4KKCD 5GSRA 1N8ZA 3E6HA 3K4ZA 2VLRA 3FO9A 3OVUB 4Q4EA 3K5SA 3AREC 1SPDA 2C1OA 2DH2A 2ARJQ 4NNXA 2UWEF 1MCDA 4LLAA 4PRDB 4DETA 4IOSA 3AXLA 3LRGA 3LHPH 1COBA 4DVBB 4JFEA 3QS3A 4OV5B 2E4FA 3TA3C 3OG6B 4Z76A 1SFHA 4QF1B 2P3YA 4RH4A 2WLLB 2DL2A 5DS8B 1A6ZB 5GS1B 4OJAA 1UB5B 2PPAA 4JR9H 3EFDH 5AEAA 1YC7A 3MLZL 4RGND 3EDFA 4KKLD 5FV1L 2AVGA 1G1YA 3L45A 4JFDA 1CYWA 4P4KC 3LKSB 5MHSE 3ZDYE 2KPNA 4OBRA 5HDQH 5EZJA 4I0PB 3F3HA 1IIKA 3QUZA 4XMXA 3RTQB 1JCKA 4FHBD 4HLZH 5AW0B 4L4JA 3O9WA 4NRXA 1WAAE 3OKNA 3DI2B 2KL6A 1GGYA 2PPEA 3HB3C 3RGHA 2OR9L 1YECH 3QQNA 1JYWA 4XC3L 1PBYA 1W8EA 4MMZC 4QNPF 4R4BB 1FZKA 3UPRB 2C3XA 3NEOA 3N42F 1IC4L 1IJ9A 2XU9A 1JS4A 4OGQC 4Q0XH 3L9BA 5JIMA 3APDA 4JRXB 4YLQT 1KN4L 2A38A 3NCJH 1I8LC 4R90H 3SKNA 3WENA 3KLAA 4MCNA 2IH3A 1T4KB 4O2CA 4R3SB 2J8UB 4DFHA 2JQMA 2PWFA 1L0PA 3C2AH 3FQ4A 1U3HB 1B4RA 1HYSD 3LKPA 1ET7A 4NBYB 4QRSA 4BZ2L 4W93A 1NDMB 3RQ3A 2WZ5A 1ZLEA 3HG3A 5EFIB 1MEXH 1J0IA 1SXBA 1XB3A 2APXA 4CVWA 3HC0B 5CD3B 3CZJA 1WCQA 2WNGA 3WGUB 4Z23A 2XTJB 2VDNL 4GLRI 4M02A 4WW1B 4FLRA 4N0UE 1YEKH 2IAMB 4M00A 2A3TA 2NUPB 3NJNA 5IF0A 1QLRB 3NABH 1HOCB 1ZJBA 4ZMVA 6PCYA 1GW0A 2ZXBA 2F53E 2QKIB 5J9PA 2CMRH 4PJXF 1O6TA 1TJMA 4WWKC 1RAMA 2IQ9L 2FB4L 3FQYA 3AACA 1PAMA 4X2UA 2BHYA 2JJTC 3VXTB 3GMRA 5LBSH 1MVFA 4U6HA 4YE0A 1Z5YD 4YXLH 4PHZA 1L6XA 2EIMB 2IH1A 5F7HA 5FUZL 4PGBB 1WAAF 5C7ZA 1CU4L 4UNVA 3NTCL 3DX3A 3CCHA 3DWTA 5E00B 2D3JA 3P0VL 4M4RA 2V3EA 4LL1A 3QWRD 4MJIB 1CL7H 1MKFA 2K7PA 4XOBA 2VZ1A 1VESA 4YDVA 4YSQA 3ESUF 1IM3B 2P43B 2WLZA 3F6LA 2AI0L 4V33A 3U9UB 1OF0A 2V2XB 2YA0A 4XAKD 4Y2OB 4CKQA 4BFRA 4X6FA 3WSQL 2N4IA 2EUVA 2OTUB 5E24E 5T8IA 3AQYA 5C0JA 1USQA 4LSTL 5F0JB 4JVWA 5DJDB 1NCWH 1I1YB 1XTLA 2V2XA 3IE4A 2G2PA 5F6IB 2YXMA 3ZO0A 4BZYA 2KLRA 4AYMC 1CE6B 4MJIA 1F45A 3HZYB 3PYCA 2PO6A 1MXDA 3L1OL 4H5SB 1SN5A 1DP0A 4QI3A 4HWEH 3B2VH 3ILQD 3WIIL 4NGHL 1DVXA 3ATEA 4JDVB 5CR1A 1YEGL 3IGAB 4G7VH 5B8CC 5JO5A 2F68X 2Z65C 3SYAA 3O2VL 5GS0H 3WNOA 1XTMA 2AV1B 3P30L 1DEDA 1I8MB 5CJ8A 3POHA 3TO2B 4HOMA 2AQPA 3GEWB 4U1LA 2W9DH 5C0EB 3WLBB 3GFUA 4YVNA 3VFNB 1NKGA 1MIMH 3GJFH 4FCHA 3TJHC 2R2EB 3HNSL 2FZ3A 3Q3GA 4AXWA 3RFRA 2DL9A 1MCLA 2JCCB 5H8DA 2NX5D 2NY2B 2ZSWB 1Q0YL 4GIOA 4DKAA 2DYPB 2LR4A 3OKLB 4KKPA 1L5GA 4L37B 2VXSL 2YD4A 4FG0A 3DIVA 5GXBB 4KQ3L 1SJMA 1MWAB 3PV7A 4UCFA 2WLYA 1VFUA 2Y5TA 3C5ZC 5EORL 5GISH 4AQ1C 2WXHA 3P4MB 4MNGB 4QHUB 4M56A 3LKPB 3MV7E 4KRPC 1A0QH 1OHZA 2CJUH 3NJKA 3RNQA 1RZJC 4P46D 1QSEA 2PABA 4PSRA 3JYBA 4N86A 4OCYL 1UM5L 3TZVD 4X83A 4LCWE 1BX2B 2VDQH 5KBPA 1JPTH 1TT6A 4BBWA 4XR8C 1S7UB 3OJ2C 2OS7A 1Y07A 1RJZA 2Q7AA 1NFDE 4HUXB 2UZXA 1CFNA 2I5YH 2H6PB 1D6EA 3K6IA 2Z7YA 5TGBB 1IBZA 2ADFL 4DN3H 1SMAA 4WKXA 1HX0A 3H6AA 2EO1A 3MLVH 4P5TB 5K1VA 5KVMC 1UGKA 3OTTA 4M7JH 1BBDH 3L4TA 4BD4A 5K1JA 5TE7H 2UWEA 2YPLA 1NGPH 1DVTA 4JHBA 4RNRB 4NLHA 4P59L 4N5UA 4OFVA 4UYPA 3QIUC 1WD9A 3SE4C 1UTDA 5JXED 3RAJH 3P0GB 2C8NA 4O2EA 4A67A 2BSED 2HFEB 5D7LA 1QFWM 4OCNC 5HPOA 3FT4A 2R23B 3EZ8A 5SX5K 1WFTA 5LWYH 1E4KC 2ROXA 3TU6A 4FEMA 4JO2L 2V7HB 5HI3D 2ENJA 3U82B 1DBJL 3EO0B 3GMLB 4X6CF 4E42A 4XBPB 2E6JA 4PCKA 5EPMB 1OTTC 1L3NA 3H2PA 5H2BA 4MHHI 3HC0A 1D3CA 5DLLA 3RWHB 3S4SG 1DQQA 4RZCB 1OGPA 2Y07L 1RZQA 5JTWA 3BSZA 5BS0D 1DHKA 1GMEA 1F13A 1I3GH 3LRSA 3SSGA 5E9NA 3MR9A 1YHPA 3P77A 1BZEA 5I0VA 3GPSA 5DJDA 4AZ8B 1MDAA 5EF0A 3ARBD 2BNRA 4CSTA 3ULVE 1DLFL 1UB6B 4YHLL 3GBNL 4XVTH 4XH2B 2LAAA 2PWGA 1X9QA 3BISA 5D1QC 3UJTL 5E8PB 4N2OA 1JN6B 7FABH 1EZVY 4GRWB 3BPOB 5TE6L 5LGHL 4XHJC 3D8MA 5D5ME 5GIRA 3M46A 2EIZA 4K55A 3V5KB 2EDOA 2NZ1A 4GQRA 2D2CC 4JDTH 1BWWA 1I82A 5EN3A 1KUMA 3TBVB 5LG6A 1MFVA 5AKVA 4ZZKA 2N01B 5IVXF 2A6JB 4XMTA 2P49B 4KJQC 4ZFQA 1IEAB 3U7WH 2PWHA 1JTPA 1ZVNA 4XPBH 1V3KA 4YSSA 4U7SA 2W9EL 5E8NA 2JB6B 3MRNB 4AK1A 2EEFA 4ZUSB 4MJ5B 1LEGB 1VA9A 1WGVA 3PHQB 2L7UA 1HHKA 5GS1A 4AVIA 3N42B 3P3RA 1BXAA 2MCG1 3HNTH 5CZXD 3EFOB 5TDPB 3VX1A 2DEYX 4OV5A 1P1ZB 3EW3B 4FFYL 5HHMB 5BRZA 3E7JA 2OYMA 5B39A 3MCLL 3N04A 3QE5A 4J3VA 4OD1L 1SVZA 4PY7A 2VMCA 3ROLB 5HJ3B 4Z7QE 3QCUL 2CGYA 4FQLL 3P73B 4F3FB 3BFQG 1G6VK 5MEOB 1FZMA 3FB5B 4UWQB 4R3SA 5C97A 1AQDB 1JWUA 3EOBA 5E8OA 4JDTL 2X4RB 3HE6B 3NQIA 1G5AA 3QEUA 5EUOB 1MFNA 3W39B 4NQDD 3L4CA 5F1OB 5DO2C 4MNQE 5ICXA 1AGFB 1RI8A 4ATTA 5DRXB 3APFA 4AGQA 4ELDA 1QEXA 1TEYA 3F85A 1SM3H 1AS8A 3VI3E 5C0CD 3AS2A 4CGUB 1S78D 1KTDB 3OKKB 4Z95H 4GQ9L 3GZOA 5A6MA 2CXGA 2PLTA 2Y2WA 3CXHK 1I3RA 2OMTA 4KU1A 1KSRA 3R19A 4PB0H 2W07A 1EO5A 4U0QB 5KUKA 3HBZA 5EOTB 3DTUB 5L6YL 3ILDA 4PRAA 4LRIA 1NFKA 4JS7A 5CIPB 4PI2A 5GS3A 1OW0C 4YFEA 4MD4B 3DXAA 3L4VA 2EVHA 1G7JA 2ZPKH 2Q8BH 3WLWC 3VGDA 1EFXD 2OMYA 2ADGB 4FYSA 3DVGB 1GH7A 4J5VA 1Z3GH 1U3ZA 1QFWH 3QUYA 4R7XA 4KHTH 4ODXB 5C07E 3QUMH 4TQEL 1XX9C 2MEJB 1RPQA 2IG2L 2LFGA 3O0LA 3VACA 3P9LA 4JKKA 3UP1A 2H6OA 2YBRB 3BUPA 4IRJA 4QRUB 2FT6A 5D70L 3C6LC 3OD3A 1TZIA 5F6IC 3VQMA 4RFOH 4DSYA 2JF1A 5K9QG 1XZWA 2HT3C 3IJHB 4JO1L 4MDRA 3IMTA 4PRHE 1HHJB 2WUBL 3QH3B 3EBHA 3QUMA 3HBQA 1F2QA 4WJG3 1MW0A 4C8XA 5I28A 3ZKXB 1ZGLP 2FO8A 3SE3A 5D7LE 1RZKH 4L8SC 4GKSA 2YGPA 1S7VB 1NGQL 3IJHA 1I9IL 1J8HE 1MCEA 3T71A 4LHQB 2G9HB 4TVPD 3IGLA 1R6VA 4WWID 1AHWA 1E4XH 4CN4A 1NUGA 3MNWA 1HXYA 3FU8A 3TM6A 3JUZA 1MW1A 1GPOH 1ZA3B 3CD4A 3UC0L 2X2JA 1UXWA 5DS1A 5EOQL 3BWAB 4JRYA 4OLVL 5GQBA 4LSUH 3TJPA 4OLEA 1T1WA 1BOYA 2BVYA 3BI9X 1JP5A 1FZOA 3T3PB 2FQGA 4A1RA 1RQ5A 4KI5D 3IAGC 2WO2B 3KL5A 4L8BA 2VERA 1FG2B 2XQYG 2DQGL 4OF6A 5J6GA 5ERWA 2BP3A 3HC2A 3FL7A 3IGKA 5HYJA 1F58L 3N1MC 1VGEH 1KEMH 3H9SE 1MHHB 4WGKA 3RWIB 1ZPLA 5FO7B 12E8L 1MF2H 3SEPA 4F58H 2YGQA 2DD8H 4KH2A 3OHMB 5C0BD 2VAJA 2EIKB 1XQ4A 3RKPA 2CBMA 5E8DL 1KTCA 3MJGX 4MA1C 2Y9RT 1T5WA 3SPVA 1EAQA 2ZUYA 1PD0A 2YJQA 3MNMA 3PHAA 2YUXA 4O51A 4PJGE 1CUOA 1A8JH 4K0OA 1ZA6B 2CWRA 2OZ4A 3ALXA 3L3HB 3IDXL 4I88A 1CDCA 3ZHLA 4FFVD 4W9HC 1CLVA 3C6LB 2BIPA 4ZFFA 2VZOA 2BP8A 2B1HH 4HWUA 4P9HL 1WHPA 3MLWL 2R29A 5I8CB 1UOVA 4XP6L 2HUHA 3ARDB 3HS0A 2Y5TB 1IAKA 3T2LA 1IAIH 5D7JA 1NL0H 2X6CA 1DUZA 1GZQB 4OLUL 1K5NA 4AVJA 1HWGB 3EGSA 3UACA 2DOCA 2LT9A 1FLRL 3IPBA 4X9FA 1T03H 4JLRB 1PZBA 1CURA 2I60L 4QUOA 1I1CA 3QJOA 1VGEL 5JR1L 2ZP8A 1NEPA 2BIMA 5DZNA 4FG4A 1UACL 3QWNA 5DA4A 5IQMA 3ZRCC 5IKCA 2GTWB 1JZ4A 3KGUA 4FNQA 2IGFL 2B0SH 4FQQB 4N28A 5J89A 3OQRA 3TBYB 1DVFD 4CU8A 5L8LB 3MAWA 1CZ8L 5DD5L 3FYEB 5AUMA 4NUJB 3BD3A 4ZW3A 2EKSA 4LEXH 5C0NC 1AC0A 2NW2B 1EJOH 1TZGL 2ICWI 5FUCC 5AW4B 4DCQB 3RY4A 5GGUB 1M3IA 3ZL1A 4F9LC 3FU7A 3GXUB 2A6IB 1GJWA 2VW7A 4PJ9B 3RPIB 5HD8C 3NCJL 3I85A 1PZ2A 1NSNH 3TVMD 4LNVA 4YNYA 3FO9B 4NRYB 5KS9E 2FJUB 3Q8EA 1IAKB 3RWCB 1AFVH 2MOQA 5LKNA 2F6AA 3J07A 1QPPA 1JK8B 4CW1B 4OZFH 1TO5A 2P8MA 4ZUVA 3OB8A 2YPVH 2A4ZA 3WS3A 2VQ1A 3VFGL 3S3DB 5JW4M 4EN2A 1CICC 4GG8A 5KUMA 1G0YR 1KB3A 3CSTA 1F8TL 1CD1B 1LK3H 4GKOA 3LEXB 4OFKA 2R2BA 4U4IA 2CHNA 5CILH 4XTRD 3EOAB 1UH2A 3TEXA 1DE4A 4MMYB 1SHMA 1EANA 1KJMB 2VZUA 3NJJA 4U0RB 5A6LA 4S2SA 2AK1H 1C8QA 1SBSL 1CFQA 4U6HB 2EEBA 4Y88A 4QWWC 4PJFA 2AJUH 4KOBA 4XB8A 3EDJA 2ZX8A 5EOCJ 3SDCD 1NM9A 1FYHB 4KKQA 4RIRA 1CXLA 3SQBB 1SVCP 3CVDA 3OGOE 4UZSA 1HILB 4ORGA 3P11H 4HAKA 3PE9A 5EDSA 2DH3A 2J56A 1OF2A 2BP0A 2J12B 1X44A 5HHNB 4AL8C 1DFBL 3FN9A 3SO5A 2IAMA 3RIAF 4EI5C 1OTUD 5F3HA 3II2A 5KYWB 2JJWA 3UEZA 5BOJA 3I6GA 5DD6B 3NZHH 4PWKA 1UA6L 2X4SA 3HZYA 4L4VE 1QABA 5EN2A 5CEZE 4K3JL 1CBVH 5BUAA 4XBGA 4ZG1A 5BW7C 2EE9A 1N5YH 4NO0A 3FB8B 2J71A 3V4VB 5JA9A 4JREC 4ZW5A 3EYVA 1BFTA 1N26A 2GJPA 1OVZA 1RIUH 3Q2VA 4NZUL 1RJZB 4HUXA 1JUFB 4G3YL 3EFFB 3JWNC 5I30L 4NJAL 5K9OA 4H40A 3B9DA 2APSA 4IGBC 1KIPA 5D55A 4OZHE 4M1CD 4WDIA 2DTMH 1WC7B 2NCEA 3CXFA 3QVAA 5DD1H 2IF7A 2H0FA 4P0DA 3S2AA 1ET8A 3OZKA 4ODUB 5AVSB 4LPUA 3HPJB 4Y4KB 5FIEA 1ZOXA 2I9LB 2I24N 3M6DA 4Y9GA 2OR7A 3MC0A 3O4OC 4AWJC 5EEYA 4JFEE 1DFBH 1GOGA 2Y5EA 1UWXK 3IYLW 3NJGA 2WINA 4Y4HB 3AT9A 3C5XA 2EKSB 3K72B 5SV4A 1J8KA 3LS4H 2JI3A 3KLKA 1SJHA 3CFNA 3BVNA 3FF8A 3G6JF 3MRHA 4QIRA 4XP4H 3V6OA 3PDOA 1A1OA 4JHAL 4ZOCA 2L7JA 4MD4A 5IV2B 2AJVL 1EAPB 2GABA 1G4RA 2UXTA 3QEGH 4I0PC 4TSBL 1KYUA 4ZO7A 3S37X 2EICA 2YPKB 3T08A 2IDFA 4IIZA 4PJBF 1DO6A 1NEZB 5A16A 5EWIL 5GISL 3MVSA 5E6ZA 1G7LA 3H53A 4ZOEA 1RIUL 4NZUH 2X89A 3S35H 3VI4E 2XFXB 1NCAL 5F9WC 3WNNA 3PWLB 1MAKA 3QJVB 5C07A 1V7NH 5FYKU 2PCPB 4L29B 2GKIA 2NY5H 2C9RA 2XVLA 4L05A 3H3PH 3E6HB 1C12A 2E9IA 4NKMB 3VXPA 5CD5C 2DMGA 1C8PA 2XKUA 2NY6C 4ZUUB 1TMCB 4APQD 5DMKB 3UABA 1FWXA 1CFSB 1JTTA 1AMYA 5E8PA 4HW6A 3WNKA 4NN5C 3DO3A 2Z1PA 3RTLA 4OLYH 4UOW1 3Q06A 4OF5A 1FA4A 5IM7A 2AQTA 1CR9H 3P4MA 4MNGA 5JYLA 2FQDA 1YA5A 2XG4B 5HBBA 3QJRB 2W5PA 1A3RL 4OGYL 5C0CB 2Y06H 5EF3A 3QWRA 5EUKB 4J1UB 1JSYA 3BXNA 5DQDL 1X5KA 1Q94A 3LNFA 4QCIA 1BWMA 3NCWA 5I0WA 4K8RC 4ODTH 4AQEA 1TF4A 4GMSL 5DJZA 4AQ8A 4XBPA 4Y1TA 1MWAH 2WBWB 4YHMH 5GRWA 5CZRA 3UDWA 3M1BB 2ZSVA 2JLLA 5JW4Q 2F54D 1BQKA 1P5VB 1NC4D 4Q2ZA 3G6DL 2C7UB 2JKTM 2NXZC 2PR4H 3DXAE 3MGTB 3OLEA 3H3PL 2CO1A 3SDXE 4YMPA 2VDOH 2X09A 2Z7UA 4ENED 3RVWD 4F7EB 3OMNB 4M7ZC 1NC2B 1P5VA 1L9QA 4Q2ZB 3UTTD 2OMZA 3V8OA 1BQ5A 3EG9A 3X12B 4POUB 1IC7L 2P5ED 4O58L 1ZLDA 1PX8A 4JBSA 2XTJC 5CN2A 5HYQA 4JL2A 4AIZB 1N67A 5ITFB 2OQJB 4ZT1A 2BNQD 1ICTA 4BJLA 5B3JE 1EV2E 3CN3A 4WI4A 4DF9A 4HWZA 3RWDA 1A6UH 4WNSA 3TESA 1I7ZA 3C5SB 3E1F1 4FXKB 3U6RB 4RGMB 4KAQH 1NCOA 4B9PA 2MJWA 4K71B 2PTTA 3EYUH 4AT6B 3T65B 3OF6A 4HKBB 5A7EA 3VWKA 1A25A 4HDIB 4RWYH 2NLJA 1JK8A 4OZFB 5G2NA 1D5IH 4O2CB 1QUNA 3TBBA 5EU6B 4ODHL 2MSPA 3F83A 1MREH 2JTDA 1Q9LB 1DQML 3S5LA 4DP0X 4S0HA 1ULVA 2HRLA 1J8HD 4FTVA 1UURA 4EIUA 4LOUD 2ZQKA 1KNOB 2KBGA 4XPGH 5TH2B 3C5ZA 1XGTA 3GBMH 4KK8D 3MMEB 2NY7L 3G5ZA 4GQZA 5AAWC 3VXNA 3WL9A 3D09A 5FEBA 4E42B 3MRLB 4NKIL 5G5DA 4UT9A 4PW4A 5FA3B 2CLVA 4H88H 3JTBA 5ICUA 1TJIL 4HIIB 4HK0B 1QACA 4PQXA 2YPKA 1VHPA 3SE4A 1KLUA 3T3PE 5L8JB 3ZE1E 1HILA 1A6UL 3FW6A 1E9PB 1S9VB 3DV6A 3PNWA 3X1BA 1U41A 3TFKC 2YAHA 4MD0A 4HIXL 2EDYA 3CXDH 1H3VA 4PREB 3ZBMA 3T0BA 1EBAA 2BSRB 3EYUL 2EE6A 1UT1A 1JXJA 1MSPA 4X0NA 1RZGB 1XR9B 4JO4H 3TN0A 3LNEA 4KXZH 1VLXA 3WXWL 4GSRA 4JFEB 4U1IB 4D7BA 4FQ2L 5K39B 3MRPA 1AGFA 5B3JF 3MO1A 3GD1C 4XOEA 2WNKA 4YFLF 3QRFM 4L3EB 3BPNC 1FJ1B 3U46A 1RK1A 4AQAB 3BKCH 4GMTH 3MV9A 3ZTCC 1F02I 3ARQA 4HHAB 3SGDI 4R83A 4WY7L 5B4MD 1HJBC 1DSYA 2BY3A 2SODB 3CSYB 4JPKH 5JDJA 1BCIA 1I3VA 3CX5J 2WXRA 4V1DD 4GQ9H 1MLBA 5D6DC 4Q9QH 1JPEA 2BVEA 1JZ2A 1PD6A 1YEDA 3R4RA 4FG6C 3CDZB 2J57A 1XF2B 3VJ6A 5F9JB 2A2QT 1MHEB 3GSVB 3GI9L 1JL8A 2IPUG 4TULH 1QSFB 2BS9A 2EIEA 2VRAA 5CP3A 1L5GB 1BQLL 4Z77B 5TQ2H 1UKTA 4XVUC 1Q9OB 3V6FA 1DJHA 2CRZA 3T0DA 2MH4A 1FAIL 1PKQA 3QNZA 3WAKA 5DJCB 3KR3H 1Z3GL 4GI8A 3WFCH 1U93A 2G4EA 3WXWH 1RFDL 3JUYA 1R3JA 2NY4C 1IEAA 4F9PA 3WDHA 4N2BA 5GS1C 2ZUTA 5GS2D 2PCFB 5CSZA 4QHMB 4OUUB 4ZPTA 4TNVK 3R8QA 2BVOB 2UZYB 4O02B 4RZKA 3THML 4EUPH 4FLOA 4YDKH 2WNXA 4WUUD 5C0AB 3GXFA 2JKSA 2MOGA 2VLRB 3C60B 1U0QA 5D1QE 4KWUA 1HQRB 2DWYA 3IMUA 1U8CA 3X3GL 3GZKA 5IJCC 1A4AA 2QTEA 2XKNB 1T04B 4G8IA 4ZFFB 5KANI 4JMXA 2W80C 3BUBA 4UINH 1ED3B 3GBDA 1JD9A 4A6YL 1N18A 2XA8L 1I9IH 4HIJB 1SOQA 3NAAH 3T4YA 1K4CB 3HUJF 4CADB 1FNFA 3Q6GH 1B2YA 4FQIH 4X7CC 4NUGH 2EDDA 4RMUA 4AENB 3GTVA 4N2GA 3LAFA 1RIVL 4QRUA 1QSEE 4P8QA 3UC0H 5CIPH 5DJYA 3I75B 3LXAA 1MFAH 1L9NA 3HCVA 4X4MA 2FD6L 1EGJL 2X2UA 1M42A 4H8HA 5D2NA 3IJEB 4NNYA 1MHHA 3RWIA 43CAA 1PG7W 4PJCF 1UD6A 1EHNA 1KXTB 2DJSA 3V9EA 1MNNA 1EEQA 3J27A 1AKJB 4CN6A 1B3JA 1RJCA 3FTWA 1WITA 5DD0H 5CCKH 4WJ5B 4CAGA 4UDTA 2YAQA 2GAZA 5FAAA 1KENH 4E9SA 2XG5A 1MVUA 2ICEB 2ENYA 3FCTB 3VYOA 3S88L 1I9RH 2XVGA 4K5LA 5LGJA 1K5WA 1PIFA 4XP9L 1YMMA 9PCYA 1AS7A 2K4WA 3CBKB 3OAYK 1YPZF 2BOBA 1KC5L 2F8IA 2OMXA 2NUPA 4OI9A 3EDEA 3JV4A 1HI6B 4M7LH 4P5TA 1PG7L 3W0WE 1ZAGA 3MYZA 4F37K 3V4PH 2QFPA 5BUPA 1KB5H 1DJSA 3RJDA 2J7LA 4NP4L 4UTBH 4LSSH 3QG6A 3QDGE 1INDL 2AMUA 4MWFB 4TKWA 4WQOA 2FECI 1BVNP 1F4YH 2WUCH 3NJLA 2VT0A 3IDJB 1GYUA 4YQXL 4OIIL 1UD3A 5B3SB 4IEFA 1W2KT 2X9YA 1HDMA 4OSUL 4Q14A 1E4XI 4Y19B 3TC9A 2DEWX 1OAXL 3ARPA 3OXRA 1USZA 1BVLA 1F3JB 3A23A 3BCFA 3ZKNC 1AR1B 3TZVC 1RPUA 1FLRH 1G6RA 4MX7A 4Q58C 4XOCA 3RY6A 3WY4A 1EMTL 4APXA 3HJ0A 4OGXH 1BIHA 5EIIG 2F8VA 2RCSH 4BK8A 1DJGA 1IKNC 4YXKL 1EZVX 1P1ZA 3A0OA 5CGMA 3AWGA 4YH6A 3S98A 1NCUA 1GKOA 3W81A 1KY7A 2OJ1A 2LLLA 4G80B 4TUKL 3RKDC 3VA2C 4DO5A 4JE4B 5EUOF 4ZFZB 3SHSA 3RFZB 2FJHB 1DVFC 3F12B 1C5BL 1FFRA 4Y2LA 5C0AA 1I1AC 4IKIA 4M5TA 1QG3A 3G6JA 5CS7A 1UWXH 2WMPA 5SWZA 4KO9A 3LZRA 4NQSB 4NS0A 3CVHA 1J11A 1R4XA 1QEWA 2D3NA 3B34A 2PCFA 4KHXL 5CSZB 4ZXBD 3TA3B 3TNMB 4BFEA 3QPXL 5AKRA 4N6QA 2VC2L 2VISB 5MEPB 4DO6A 2WZPA 1KGJA 5M94B 4M7KL 1AFVL 1KJ2A 4NYLA 3RVUD 1WBZA 3RX9A 1H8NA 3V5KA 2IALB 1H0DA 2D9CA 3CVIH 4KQ0A 5BRZD 5IB4A 1RZIA 4JZJC 2H0JA 4OM1L 5KN5B 2W88A 1SF5A 4FP8H 4GBXA 1W9XA 1UG9A 5KBKA 3CSPA 4W6WB 3H85A 4P4KD 4PJEE 4XVJL 5CJQH 4WI7A 3W9DB 4R26L 4HKBA 4YHNA 3TO4C 5E51A 2EH8H 1MOEA 1WUZA 1MHCA 5MEOA 3N55A 1MRFL 1KJ2H 4NZRL 1KELH 3QIUB 2BINA 3VTMA 5BJTB 5D70H 5D93B 3IDIA 2V9TA 2HVBA 4HUMB 4DGIL 3INUL 1SHWA 2R4RL 2MNWA 5KYUA 5FYKD 1XGPB 5C0CE 4OF0A 3HZMA 5EBMA 5FC9A 5CP7A 5LN8A 3CX5K 3ULSB 4F7PB 1S7WA 3BC9A 5AWNH 3L3KA 4EI5D 4FG6D 1EVTC 3ZUNC 3ZVVA 1AXTH 2VMDA 3VD3A 2P5PA 4ONGL 2MCMA 1GOHA 4L8CA 3JV4B 3O11B 2XWJA 4DQOH 4W9DC 5L0QB 4FKHA 4Q97A 3B1UA 1DQIA 4G11A 2IQAA 4P4RA 4YLCA 3WEMA 3D69B 5F7MC 3ARSA 1XAUA 1HOCA 1WTLA 5EB9A 2YSSB 3NZ8A 1IQWH 1A6AA 1XVSA 5EZLA 3WFBL 4OZIB 4UTAH 1SDAB 2MOVA 3UTTE 2I32A 1X9RA 3FFCE 1CTNA 2B5IB 4JB9L 4M5YH 5K33A 4HP5A 5GIRB 1MFDH 3P30H 2P5EE 4NZRH 1MCRA 2OP4H 1FGVH 2I69A 2TRYA 5G5DB 3KWVA 5JDSB 1TFPA 5EULV 4BKTC 3VRJB 3AT8A 2IXQB 1WZAA 4PJ7A 2P5WB 1T66D 3K2IA 3VXRB 3KPTA 3L5XH 1G0XA 2A6DB 2ZUVA 2VITA 4CU6A 1E27A 4JCLA 4UQ3B 4PRHD 4ZQTA 2IH3B 4BWUA 2JCWA 1THAA 4XMLL 4HFWA 2EXSA 4MFHA 3VCLA 5KWYC 5ANME 3SDDD 2ZCLL 2R1WA 3QWOB 1O75A 1E27B 4TV3A 3N1PC 4NENB 4MCYA 4CUCA 1ZT4B 3U7AA 2OI9B 3QORD 1UHVA 5KSAB 4AEEA 1Q1JL 3K91A 3NDYE 1JRHH 1PLAA 3HC3H 3KW7A 3MN8A 2X53A 4HGKC 2B1HL 2Z31A 2ARWA 3KVPA 4L0ZA 5IFAL 4BH8B 3Q5YA 1IQWL 4RAVA 3MJ7B 2VLKB 3MRGA 1TTBA 4UILH 1OB1B 2IWFA 1G4MA 3Q7JA 4X5WB 3D9AH 3LKQA 4GAJH 4J3UA 5C08B 1TCRA 2VDQL 3IDGB 2Y0SA 1VACA 3TO4D 1U8PA 3QUXA 3LOWA 4MJ5A 1LO3L 3QBTB 4PJDF 3ZE2E 3FUKA 4KI5E 3MJ9A 4M1CC 1KYDA 1RHHA 1YAIA 2CBPA 2I5YL 5C0EA 1OCZB 3DIDA 4KXAA 3TO2A 1P5UC 3QZNA 4Q89A 3QAZC 3SGKC 1KLFA 1C16A 2NY3B 1QNIA 3JQOB 2VLLA 3GRGA 4ODBD 2VDLB 3KYNB 4Y2NA 4XN8A 4NSKB 3CPLA 3IPFA 4I3RH 2CCWA 2D31B 3KEHA 4LARL 3GUFA 3MCKA 5JUEL 4PGJA 4W9IC 2FJSA 3FN0H 3BZEA 3MCYA 5IMLB 4G59C 2WKLA 2R29H 4JL1A 5DZ9A 1I9EA 2BZCA 3VVVA 5ALCL 3S5LB 2GHWB 5KVFL 3O8XB 1CQKA 4N2FA 1JBJA 1MJUL 3CX2A 2VLJD 4JKNA 3KLHC 4CDGC 5EEVA 4L1SA 1DBJH 5TF0A 5GGSY 1KYOJ 3JTSA 1WLHA 4QRPE 2E7DA 3DRQA 4BQCA 5BZDA 4J7RA 5TFSL 4O2FA 3GSNA 5IMLA 4M03A 4W4NA 3VXOB 3KHQA 5KSVA 2UX7A 3OKEA 3MRCA 1T66C 2BHUA 1SNRA 2IWEA 4MQXD 4DESA 5I0XA 3R18A 1D5RA 3X2QB 4LPVA 4TLTA 3U1PA 3ZL4H 2QHRH 3JWNG 1LXMA 1NLBH 3NUKA 4JFFA 4MXQD 4X4XB 3BGAA 5EZLB 1URLA 4U1IA 5CZVL 2RBLA 1U2HA 4OZIA 3B3BA 3U0PA 1Z9PA 4AEIH 2KLTA 1J5DA 5KYXB 1TLMA 3N43F 1PW3A 1AQ8A 3MRIA 3T6VA 2LE9A 2VDMH 5FW8A 3GSNH 3MTRA 1S5IL 4P99A 3VFRA 2XN9B 5ECGA 1UM4H 3G6JB 3LPPA 5KBNC 2OR8A 3PWPB 4NQDB 3E2HC 4PJ9C 3RVVC 1CL7I 4GFXA 3M1BA 1A1OB 1ZANH 4X5PA 2HKAA 5BS0A 1HINL 3NH7H 3O3BA 4OZHF 3TVMC 3W56A 1NMAL 4BSVA 5L88H 2FUTA 3SZKC 1L3WA 2O6DA 2R2BB 1H6UA 4YK4B 4QXVA 5M95B 3WJMB 4LU5L 3IKKA 5D1QD 1RULL 2W9EH 2Y6SD 2CA3A 3VW3H 3O2DH 2EE3A 4BDVA 5DHVB 4NQEE 4TM9A 3ARWA 4YHZH 1K8IA 5IG7A 4DP1X 1MIEL 5HJBA 1WBXA 4RISL 4UU9B 2CIKB 4DP2X 1QHPA 3PF2A 3CFBA 3JV0A 4N1HB 3AG3B 4IRZH 1A0QL 2CJUL 3WO3B 1CFSA 4YHPB 2NMSA 3VWJC 2J3SA 4YAQA 3D25B 5GGUA 3A67L 3L6FB 3FAXA 2J5LC 2DQTH 3D0VB 3EGXB 2CMRL 3WAJA 1IM9B 1YY8A 2GTQA 4KGLA 3RL2A 4W81A 2WANA 2EDRA 4XBGB 4GSDH 3L95A 2BJML 4PVLA 5JQ6H 15C8H 5SWSE 1A6VH 2J8UF 3WCYA 3CVHB 4F20A 4NFCA 5KVFE 4C54A 4K9JA 2HH0L 1OCWH 2X7LB 2LLGA 4GB9A 2MHAB 5I6OA 5GGTA 1XIWB 4OCWL 1DVQA 3LS4L 3PL6D 2PO6C 4TNGA 2APWA 5HHNA 1CFVH 4ZFZA 3RFZA 1MG3C 1SM3L 3FTUA 1QQDA 4XP4L 4GAFB 4POZD 1I1AD 1IC5L 4BSJA 2DLEA 4YL9A 2ZCKL 3KYOB 3NP4A 3QSKB 3LXBA 1OSYA 4RDQF 5LB1A 5CLWA 2BW4A 4A38A 3EKCA 3IJ9A 2D4DA 1RUKL 2CA4A 4G6KL 1L0XA 3B9AA 4OJYA 3W0WD 3AGWA 4TRPH 2BP8B 1QRNA 5F7BA 3B1TA 4OZFG 5AKSA 2F8OA 4MXWL 1RUMH 4LOEA 3I6SA 4HQQH 5I8OH 1XV8A 3VXSB 4JRXA 3CPUA 2NY3C 4QKTA 2WN3A 4QRQB 1AY1H 1MQ8A 4Y19E 1BQRA 2W0FA 3W82A 1JD7A 2Z35A 1VFOA 3ZO9A 4OT1L 2JQZA 2XQYA 2YD3A 3JWDH 4N2MA 3EYVB 5IB4B 5CZXC 5E1IA 4WI9A 1ZWIB 3KJ6H 3CQFA 4C83A 1PZAA 4Z7NF 3MXVL 3CHOA 5I1JH 3QC6X 1TYRA 4H1LH 3MV11 3QIWD 4HPYL 3K1DA 5B38B 4AYDC 3S36H 1DSFL 1T5XA 1YEEL 4BA8A 3QYNA 3KGTA 2EIJB 5AOZA 2QVMA 5F9OH 5HDOA 3C87A 4JN2B 1YN6A 2GBVA 3IJYA 2VXQH 4ABQA 4LSDA 1KDJA 1XWVA 4YOKA 4ZMZA 5BXFB 5J9PB 2PUQT 3VTAA 4N2CA 1MRCL 2V2TA 3HE7B 4XNUL 4JGMA 4FFZH 1ZHBB 5DQ9A 4ZAKA 4ZPVA 3RIFF 3AXLB 1GPOL 4PJ5D 5AENA 1JGDA 1CIDA 2JK5A 4WV1C 1A9EB 2AFNA 3ARGB 4X7SL 3UZVA 5F89B 3DK0A 1H3PL 2IBZX 4Y4HA 4LCYA 4R7VA 1M6OB 1TETL 4ZBJA 3N41F 5E6IC 3SYPA 5E56A 2WBJC 4DOHE 3DVFA 4NP9A 5B1KA 1YO4A 1CO1A 4FXLA 1ZT7B 4P2QE 1E3FA 1M2VB 2XV2A 4IGBA 5EDXA 2LV4A 4GUCA 4KK6D 3FZUD 4AL8L 4BKLA 2VSKB 3HG5A 4L3EA 1W91A 3TJEL 4XGZB 4J3TA 4X6CA 3VYNA 3RWCA 5KJRL 2DI9A 2O5YH 3JWOL 1G7QA 4MAYC 3CC5A 4NYLB 4O02H 4UQDA 1MRCH 3FH8A 1DR9A 2GJZB 3FU7B 2ICEC 5C0BA 5IJBC 4IBVA 1KJVB 1VEPA 2N7AA 3DDFA 2CLRB 3I9GL 5HJDA 3HBPA 2FT7A 3WUWA 1S3RA 1MN4A 3O4OB 1BVOA 3QIWC 4PRAB 4AMKL 2G75A 2CKBB 4PVBA 2ODIA 3TEYA 1KN2L 1ZTXE 3U9WA 1F2XK 5D4HA 5DJ8A 4GT0A 1DLHA 2FJFB 5HHQA 5JOFB 5TDOB 3GMNB 3SPCA 4IRSB 1INDH 1TTAA 1X9UA 2OL3L 1Y6NR 1MDTA 4FC3E 4ZYKB 4L8DA 3BLPX 4MA3A 1JZFA 4OZGE 1OT2A 4Z0BH 3SKJL 2R0LL 3GRWH 2NW3B 3PWJB 4OJEH 3V0VB 2FVNA 2AABH 3WNJA 1IC0A 3PGCA 2GW5A 2H0EA 1J1XL 4Y4KA 1B0GA 3VXRE 2BLFA 3BGFB 3QXDB 4Z7WE 2EXYC 1UZ8A 1OL0A 7TAAA 3QULA 3SDDB 2YS4A 1K4DA 2LOEA 2MKWA 3BPLC 3NK4A 4W68A 2J6EA 2GFBB 2YD0A 5ANMB 1LTXA 1TG8A 1OALA 1U8JA 4NWTH 3S3PA 1EJ8A 2YKLH 5DT1H 4ZMYA 3GSQA 3EADA 3POCA 2CUHA 3U36A 5CBAB 1PKOA 1OP9A 1ET5A 2CXKA 2IV9A 1GC1L 3GSWA 4IMLB 5CNHA 1QW8A 3KYMA 1U95B 3FNKA 4ZW7A 5KVGL 4X0KB 1H9VA 4AIEA 2Q76A 3WN5B 4N9GA 4FQXB 1M9WA 1BFVH 2R56H 5GGQH 2BSRA 2AXWA 1UOLA 3LQMA 1FSKB 3WDJA 3PIQA 1YY9C 4JHZA 3LKNB 1G7IA 3HNVL 4NM4H 1RZJL 2XIBA 5D72H 2EZ0C 3ZDXB 2VM3A 2VO5A 4UUJB 3ZKSD 3TFKD 4FI7A 4EJ1C 4RCAA 5A6IA 3HR5A 4B5EA 3PFUA 1ACCA 4MAUL 1TEFA 2WNWA 3IFPA 4ZFOL 2B15A 5CHNB 3UGXA 2VWEE 5CN1A 2GTWA 2XQYK 4YSCA 1ACYL 1XCTA 4Y1AE 5DHMC 3A4FA 3BDYL 1TTCA 2GBUA 2NY6B 1KV7A 2CHXA 3TN0D 4WEMB 4JKPL 4YBHA 1TSHA 2AQ3A 2OCCB 1FO0L 1MFUA 4DKEL 5FHAL 2BSDA 1CN4A 3CE1A 1OHQA 4YDKL 5B22A 1GHFH 3L3JA 1QW9A 3FB6A 4NQVA 5HHOA 1W6LA 3CFJA 1R3HB 4ACPA 3HMWL 1PS3A 4P04A 3TLRA 3CMOL 3NQKA 3RUGE 4UIMA 1FHGA 1O7DC 3FUJA 3LN4A 3G08B 4YSEA 2VLJE 3HE6A 2H5UA 3T6XA 1TU2A 3MRFA 4QRPB 4YLBA 4A6YH 5MENE 1YEWA 2WXNA 3HI1A 1EDHA 5LGYA 1HZLA 4QHKI 2HJFB 3SDYL 4RGOH 3FH7A 3BH4A 3DPBA 4FQIL 5E6RB 4ADGA 1LP9A 3ZN6A 3ARZA 4PWGA 1X5GA 1RY7B 4YS4A 2Q8BL 2ZPKL 5ES4B 3QCTH 1HHIB 1NFAA 1P2CA 1I8IA 4LCYB 1BD2E 5I75B 1G7HA 4P9HH 1WF5A 3WIAA 2HG5B 5I1IL 2YFOA 3DDGA 5AKTA 5KJ7E 1ND0B 4YJZL 1Q0EA 1JGDB 1L9OA 2AHIA 2O5XH 1U93B 3LX9A 1BAGA 3A22A 3FXIC 4GO8A 4JFPA 4KK5C 5DSCA 4L4TA 4IMKA 1CU4H 1FYTD 1EUTA 2B3RA 2BIQA 3QR0A 4PJCE 4WUUE 4QXGL 3IBOA 3CLFL 1FHNA 1P4IH 4HH9B 1KNOA 3MJ9H 1AO7D 4D3CH 2FX9L 1S9XB 4AG4L 4C56A 3P4OB 2CIIB 2B0SL 2GJ6B 4K71C 1YN7B 4N24A 4OCXH 4ZTPH 2C34A 2ZCLH 1QSZA 4IBTA 1XGUB 2O5ZH 1BX2A 2VSMB 3EJZD 3FRPG 3QRLA 5DD5H 3DUUA 2E27H 5DZPA 3TP4A 5F70A 2VR8A 1AE6L 5F1NA 4HCIA 1H3TA 5AOLA 4U6VL 5E6UB 2VDPB 2F1BA 4JFZH 4MDJB 4DK3A 3O3EA 3GK8H 2X4RA 5HVHB 3EH4B 3HC3L 2WLHA 2CD0A 4TPRL 1BPVA 4ZX3A 1Z5LA 3LNDA 2EDLA 4RMTA 2Y1VA 4GH7B 3ENEA 3GMMB 2BSSA 4G7RB 4NQCB 5MERA 4AIZA 4UOJA 1S7RB 5DI8A 4JQIL 2FGZA 2WIIB 3CLEL 1LD9A 3KNBA 3IXTA 3MQIA 3AQDA 12E8H 2AXJA 1TITA 2Y24A 5EOCL 4L9DA 3CFTA 5FA4B 1EZUA 3LKRA 1G7PA 1KCVL 1I1AA 4GSXA 5F88B 4KK9D 3U2SA 3PL6B 5C70A 2IC2A 4P5MA 3LZOA 2GPZA 2XC8A 4PJXB 4LQFL 2YAOA 4M8UA 5C9KA 4TMPA 1UVQB 2F53A 1X7QB 2KERA 1I1AB 1NH6A 5D7LB 1OTUC 1OV8A 1T0NA 4Z3JA 2AXFA 4ELMA 4HWBA 5B1JC 3GK8L 5B38A 2F8XC 4MNQB 1RZ7L 1YMHB 3IRPX 4IQHA 2XOTA 4OAWB 4MMYA 1CK0L 4XMPH 7PAZA 2F0CA 4LK4A 4CMHC 4NPYB 3O4LB 1CGVA 3F5WB 1LLAA 2H32A 1R34A 5ICZB 1EWHA 4RAUA 4BELD 3VD7A 5C0IA 3KGSA 3ULAB 3D87B 3WJLA 3ULVL 1XH2A 4HIPA 4P05A 5BOPA 5HP5A 4WHDA 4JG1L 1YNLL 1U33A 3QUZC 3QUXD 4HCRA 1OQXA 2H3NB 3GHEL 4GI6A 4R26H 2DF3A 3F5WA 5CZVH 1JZ5A 1KPVB 4M1DH 1IUZA 3MR9B 5H37G 4R9HA 4UM8A 2Y7LA 3HZVB 4P59H 3FT3B 1LJMA 3LNGA 4ZUWB 3FQWB 3CC1A 3PAZA 2DTML 3ULUC 1A6WH 4JKLA 3QQDA 1T0NB 1UM4L 2ADIA 2R83A 3VI3F 1JCVA 1NBVL 4GW1A 5ANHA 3AG1B 4PMEA 1KCBA 5GRVL 3DVGA 4LP4A 4WFFD 1T80A 4WI0A 3QISA 3JVGA 3BWUC 3VFVB 3ZYZA 1N59A 2V17H 3MA7B 1NCDL 1Q9KB 3D4YA 4TNEA 4YPGA 4QY8A 1KGUA 4HJ1A 3T9WA 2YWYA 4BV1A 2ZSVB 4NBXB 4OCRH 3OG4B 1E50A 2WVUA 5TPWL 3U4KA 3CZLA 1QLEB 2JB6A 4OZIF 1D5XB 3FOMB 5D2NC 5E1AB 32C2B 4W9ZA 5JPNC 2WWNA 4WI8A 2ID5A 1DQVA 2CLRA 1R19A 4IYKA 1F8TH 5D71H 1QBMH 4B0MM 4JB9H 5DYFA 2WXQA 3D0VA 3RI5K 4E9TA 4ANXA 1T4KA 2X28A 1CGYA 5CJ5A 2BP5M 3IFNL 1VFBA 2WWMD 3BN9C 2OSLA 4DN4H 4FNSA 1H9DA 2XN1A 4JE0A 3NACL 1JFHA 3KCPA 3AITA 4FABL 4E0RB 4NUPA 1DN2A 4IM8A 3HKZA 1B2WL 1CVSC 4OTXH 4JDZA 1OCOB 3D18A 4BFNA 3P73A 4LHUG 4DUVA 2YD5A 5I1HH 4EXKA 4HS8H 5GJSH 5ID0A 3GUTB 4UANA 3II3A 2GG1A 4QD2E 1DBBH 4HH9A 4XPTL 4GBXC 4RFEA 2HTLD 5B39B 2HVJA 3DRTB 2YGVA 3RWHA 2D0HA 1OWRM 1CDYA 5IOPA 4U33A 4FMKA 3VXUB 3MRJB 3PP3K 4WY7H 3O3BB 1IAMA 1CGXA 3RKDD 4PJDA 4YX2H 1HT6A 1UADC 2C1PA 1ZHBA 2VXVH 5DQ9B 4ZSOB 4ZAKB 4UDUA 1OAYH 3HN3A 1AD0A 3GMRB 3HVDA 5DQDH 4PGDB 4ELKB 3RFZC 2AQSA 2ZWSA 1ONQA 3WKPA 4ZMOA 1YEJL 2DM3A 1TLKA 4MS6A 4A55A 4KXCA 4DVBA 5TK2A 4G3YH 5IHHA 3RDTA 3VG0L 4RVBA 4HC1A 2C1PB 1E65A 3G6DH 4YIQB 4B96A 3AWEA 4NQCA 1MW2A 3BAYA 2ZX7A 1H3GA 5D6CA 5MERB 3TCTA 2V8LA 4YGAB 5ETUA 3RDTC 3ZE0E 1ZWIA 2X6BA 1S7VA 1DQJB 3V5HB 1E3XA 3UPAA 2O6EA 1G7MA 4Y1SA 5IROD 1DBBL 4XPTH 1XGYH 5HHPA 2IH9A 1J05A 4M93C 1KTLB 5HHVH