4YSUA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 25.0 mgy
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 97
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysuA00
3GXUB 4DPCX 3QJTB 4HHGA 3CVDA 2OCCB 1HAUA 4ENZA 2VMJA 3PCYA 4KOCA 3KW7A 1WA1X 4L0PB 2EIMB 4WTQA 5LDUA 5F7BA 1PF3A 2IDQA 2VSMB 2XLLA 1CURA 1ZPUA 2N0MA 4G7SB 1L9PA 1QLEB 4FAAB 1NTDA 1PAZA 3ASOB 3TU6A 1BYPA 4DPBX 1A4BA 1EHKB 3RYMA 3NYKA 2IDFA 1NIFA 4P5RA 3FQYA 1ET5A 2FTAA 4RH4A 1X9RA 3ZDWA 2IWKA 1E5YA 3NJLA 3OM3B 1J5CA 4Q89A 2PPCA 3X1NA 4GYBA 1NINA 7PAZA 1KGYE 4A2GA 1SNRA 1AS6A 5TK4A 1BQKA 3SBQA 1RZQA 3TBBA 4K9JA 4DP7X 1AZBA 3AG3B 2DYSB 2RACA 3QPKA 1XB6A 1OF0A 1PLAA 2HX8A 1FFTB 4DPAX 2X87A 1JVOA 3S3DB 2R7EA 4E9SA 1J9TA 4A68A 3IE9A 1NICA 1KYAA 2YAHA 1NPJA 2P80D 2BP0A 1PLCA 6PAZA 5D4JA 1AANA 5EHFA 1JZFA 5B1BB 1ILSA 9PCYA 4G7RB 1V54B 1MZZA 1NWPA 3FS9A 1HAWA 1MZYA 2CAKA 1J5DA 3FQ1A 2ZOOA 3T6WA 4GY4A 4UF7C 2R7EB 1IKOP 3X1FA 3SBPA 1MG2C 2PPEA 4W1TA 2PP8A 2W88A 4A2DA 4E9YA 2BP0B 4A2HA 1OCOB 1NPNA 4E9TA 4A66A 2PCFA 1AZRA 2BW5A 3FSAA 4X4KA 3QJVB 3EF4A 4CSZA 2DYRB 2H3XC 2XX1A 3NP4A 5PAZA 3L45A 4YSQA 2YAQA 2PPDA 2HRHA 4UAHA 5B1AB 2UXFA 2GC7C 3S3CB 5AZUA 5B1JC 4G70B 4E9QA 3NSCA 4PAZA 3FYEB 3IBOA 2OV0A 2HXAA 2FQFA 2XVBA 2DWTA 4PCYA 6PCYA 2J57A 4F7KA 2UXVA 2J56A 4KNTA 1A65A 1NIDA 2H5UA 2X88A 4DP0X 2B08A 4YSPA 1X9UA 1BQ5A 4P5SA 4FA7B 4DP2X 3FU7B 3HEIB 1JZJA 1J9QA 1KDJA 5F7AA 1L9TA 1RCYA 3PXLA 4NB7A 4E9RA 1AQ8A 2YAOA 1KCWA 4NERA 3AG2B 3N2JA 1L9SA 1PCSA 2MTAA 1ID2A 1W8EA 1WS7A 2HX7A 1BEXA 5I6LA 3UABA 1PNDA 3AZUA 3EHBB 2QPDB 3U25A 2JFCA 2I85A 3CVBA 2VM3A 3MBWB 1GY2A 7PCYA 3FU8A 3NT0A 4AKPA 2YAMA 3G5WA 1OCZB 3UACA 1M9WA 3PAZA 4YSRA 2YQBA 1NZRA 4AKOA 3DKHA 3CVCA 3OD3A 3NSDA 3AG4B 3FPYA 1YLBB 4HCGA 1OOWA 3EH5B 3FPXA 2P80A 3FT0A 1T5KA 1CYXA 3PAVA 4EF3A 5D4HA 3ABGA 2ZONA 4AI7A 2TSAA 1PNCA 4DP5X 2J5WA 4GXFA 2BO0A 2PPAA 1PLBA 2VSKB 2BHFA 3DTUB 1IC0A 1KBWA 3FSWA 2UXTA 1MDAA 3X1BA 1A8ZA 3OMIB 2IH8A 1GY1A 4AKQA 1QNIA 2W8CA 1BXAA 1TKWA 1RKRA 3UAAA 3QQXA 4KNSA 1ZV2A 2E86A 2WO2B 3WIAA 1AAJA 5PCYA 3T71A 4GP4B 1SDDB 1BYOA 3V9EA 2YAEA 4W9ZA 1E65A 2GBAA 4G72B 3QJRB 2DV6A 2JKWA 4BDVA 1PZBA 1WA2X 4BXVA 3BQVA 2FQEA 2PCYA 5ANHA 3TASA 3GYRA 5B1JA 3DIVA 2GB2A 4N4YB 3FSVA 4HCIA 5B7MA 1JERA 3V9CA 1TEFA 1ZDQA 3ERXA 1JXFA 1CYWA 8PAZA 1E5ZA 2GSMB 1JXDA 1URIA 4GP5B 2GIMA 2CALA 2GHZA 4YVNA 1SF3A 5I6PA 4DP8X 1SJMA 1DZ0A 3SQRA 2XV3A 2AVFA 3WKPA 5A7EA 1E67A 1AZUA 1IBZA 1CC3A 1J9RA 1TU2A 2PPFA 1B3IA 1KCBA 3NSFA 1L9QA 4M4RB 2HZHA 1QHQA 5I5IA 1GR7A 3UAEA 5B7FA 2BP8A 4E9VA 3CDZB 4JKNA 4UANA 1WAEA 1GSKA 2EIJB 3JTBA 1ADWA 1SF5A 5I6KA 4DP9X 3OMAB 4HHWA 2GC4C 2OJ1A 5B7EA 4CSPA 5I6NA 2A3TA 4KO7A 3WKQA 1NIBA 4NAJA 5D4IA 1IUZA 2J55A 3IN0A 3CDZA 5TK2A 1GS8A 4YSTA 1F56A 2EILB 3PAUA 2XX0A 1AOZA 1SFHA 1WS8A 4YSUA 1ASOA 1XB3A 2XUWA 1KDIA 5I5JA 3QJUB 1SHXA 1AIZA 3NSYA 4A67A 5I5MA 2YAPA 2YAFA 3AY2A 4DP6X 1NDTA 2VW6A 1OCRB 1BXUA 2XWZA 1DYZA 5B1KA 2VM4A 3FSZA 1WA0X 5I26A 2FJSA 4QLWA 2AZAA 1AS7A 1R1CA 1JZIA 3FQ2A 1ETJA 3TBCA 1FWXA 3H4HA 1AG0A 2UX6A 4MFHA 3ABMB 3IN2A 3ZBMA 2IH9A 1MG3C 1N68A 3GDCA 3QJSB 4HAKA 1AR1B 2BZ7A 3WG7B 2ZXWB 1JXGA 2QPEB 3H56A 3NJHA 2QT6A 1XB8A 2MRYA 3UGEA 2H47C 1GW0A 1BQRA 3NP3A 2I7SA 3C75A 4HIPA 3FU9A 1JVLA 3NJIA 1OE3A 4HZ1A 1NWOA 2QDWA 2Y69B 1RZPA 4DP1X 3PLYA 2GI0A 4YL4A 3H4FA 4BK5C 3ZX1A 1OE1A 3S3BB 2Q5BA 3FU7A 3NJNA 3N55A 2FNWA 2HRGA 4BWWA 4BWTA 3NJKA 2NRDA 1TEGA 4KO9A 4YSEA 2DY2A 2Y1AA 3AG1B 1UATA 4Q8BA 1PZAA 2Q9OA 3T6VA 2CJ3A 3UADA 1AZCA 1ET7A 2YARA 2QDVA 3X1GA 3FYIB 4YSDA 2HX9A 3WNIA 2YXWA 3JT2A 2VN3A 4YSSA 2IWFA 4TXVB 5I6OA 1SDDA 3EH4B 4GP8B 4HALA 2XXGA 1J9SA 2CBPA 2IWEA 3T6XA 3NJMA 2IAAC 1SHWA 4JHVA 3T9WA 2VW4A 1SFDA 5FC9A 2WSDA 3EH3B 3T6ZA 4BDVB 1L9OA 1W6LA 2FQGA 4KO6A 4G7QB 4KO5A 3NJFA 1ZIBA 2AZUA 3CZUB 4YSOA 2BWDA 1PMYA 4KNUA 4DP4X 1VLXA 4N8UA 1NIEA 2BZCA 4YVUA 2CCWA 3OQRA 1FA4A 4HCFA 1AZNA 1AACA 4YSCA 2XV0A 3NJJA 4F2FA 5AKRA 2FQDA 3S8GB 2XU9A 2CUAA 1L9RA 4AX3A 4BWUA 4ZK8A 2XYBA 2YXVA 3ABLB 4E9WA 1A4CA 1E30A 2EINB 2FT6A 2LLNA 4AZUA 1KV7A 2IDUA 2XXFA 2FT7A 1A4AA 5I6MA 2DWSA 1PZCA 2PP9A 1M57B 2I7OA 4YSAA 2BP8B 1ZIAA 2JXMA 2UX7A 1V10A 4KOBA 1KBVA 1GS7A 3SBRA 2FWLB 4M3HA 1BAWA 1M56B 3WI9A 2WO3B 5E9NA 1W6WA 1JZEA 2TSBA 2HLEB 2XV2A 3ZIYA 1I53A 1AS8A 2IDTA 2PP7A 3AW5A 3X1EA 1OE2A 2ZWNA 1NIAA 4F2EA 1OCCB 1ET8A 5I28A 3PPSA 2UXGA 2PLTA 3CG8A 1JOIA 1XMEB 2AFNA 3D12B 3S8FB 4JHUA 1V55B 4WKXA 4G71B 4A2EA 4A2FA 3HB3B 3WNJA 1CUOA 2B3IA 2VW7A 2IDSA 3ASNB 2FT8A 1OV8A 1AG6A 1BXVA 1A3ZA 1N70A 1ILUA 1ASQA 2BW4A 4BXSV 3QJQB 1IBYA 1HFUA 3BVDB 1PY0A 1GYCA 3MX0B 3TA4D 1JZHA 3KW8A 1GS6X 3OMNB 1ZDSA 4E9XA 5B3SB 2BWIA 3IEAA 4QKTA 1ASPA 3NJGA 3ABKB 5IY5B 1EZLA 1JZGA 5AFAA 3X2QB 2EIKB 2AANA
chains in the Genus database with same CATH superfamily
3MA9H 5J6SA 3OKOA 1KG0B 3RVVD 2DPKA 2Q2LA 5F72S 3S4SB 3WO4B 2GJ6B 5K69A 2QV2A 4QXGL 3FT9A 5HYQB 2J1YA 3CLEH 1U8HB 5GRVL 1VPOH 3T0BA 1CIDA 1YPZF 3BD4A 1QLEB 5DJXA 4CGTA 2XTJE 3ZKXB 3X12A 3C5SB 3IDYC 1QRNB 2DIJA 3BPOC 3L4VA 3ZSSA 3KWUA 2EACA 1JE6A 2KH2B 3F7QA 2BSTA 3R06A 4NP4H 1A3LH 5KS9B 1TMQA 2V5MA 1J5CA 4Q0XH 2D0GA 4ZXBC 2OJEB 2JTYA 2X4TA 4JFVA 3HE6A 4LOUD 5FM5O 2X12A 2VKXA 1MJUL 1RZQA 1YNLL 4GFXA 4XN9A 3TZVC 4KDTA 4DT2A 2MJWA 3WN6A 3US0A 1ZLWK 3KL0A 2DYSB 2EC8A 1E2ZA 1UOLA 3H7BA 4GXVL 1R3IH 2HFGH 3AU1B 5KW9L 4YHKL 3GQFA 4ZODA 5EC2B 3ILPA 3SDAA 2GKIA 3S3DB 5IF0B 3K2KA 2WXQA 3AXLA 3DO4A 5JOFB 1KB5A 1KPRA 3QDGD 5EZLB 1QYGH 1ZT4A 1HQ4A 3VQ2C 1NM9A 3S34H 5D5MB 1AE6L 1RJZB 2OX5A 4G1EA 3RIFF 2X2HA 3K6IA 2G2NA 2FK9A 2V3DA 4AL8C 3REVB 1NWPA 5D70L 1MZYA 3U2SB 1NCAL 3AU1A 3U30C 4L48A 4OUOA 3TBYB 3NCJH 4PVLA 3VXPB 3TWCL 3G3LA 4QKXB 1E6JH 5IF0A 4ECNA 1JNLL 4ZO8A 5FIEA 1IV8A 2M83A 3GHEH 4JFHD 4W4NA 4D0DA 1QLFB 4MS6A 1ZT4B 1HQ4B 1IGJB 2AV1A 4GIAA 3SGEH 1N7MH 5IJCC 2HPOA 2BVOA 2R2BB 3DSFL 3D4CA 4LNRB 4BHUA 3REVA 3E1F1 4FRWA 2OS7A 4R3SA 4N25A 2XA8L 1EQWA 3V52L 3W0WB 3LH8A 1KXVA 4HOXA 3W39A 3NFSH 3O6ML 2YAQA 5J89A 1TZHB 1NAMA 3P77A 4UAHA 5ALCH 2G5RA 4G8IA 1T4KA 4PWFA 2BVOB 2R2BA 2GBTA 5EC1A 2VLJE 4AMWA 4FQJH 1HSAB 4MXWL 1YNTA 2XY2A 2XVBA 1NGQL 4JO4L 6PCYA 4P06A 1JI2A 3KJ4C 3WUWA 4RZCA 4F7KA 4GUCA 4APQC 4NQSA 1NIDA 4M02A 5IBLC 4ZMNA 2BOCA 2B08A 1UQSA 2NXZD 4PCKA 4JQVA 5TE6L 1MXGA 5J9PB 1YQVL 3MRKB 3STLA 4N2LA 4G8IB 2X10A 1U8OB 2WTRB 3NZUA 3OB0H 3O3BA 3SPHA 3NZHH 2WOBA 1HSAA 4RMRA 5CP3A 4YDVA 5GSVA 1NCHA 5DEGA 3BVNA 2YAOA 1KCWA 3HC4H 1G7LA 2O5YH 2C3WA 3GMRA 3CZSA 1U3HC 3JYCA 3LHAA 4CNIB 4OJAA 5DQ9A 3AZUA 5K9OB 1UVQB 3VWJA 4M5TA 4NBYB 4L3ED 5E4EC 4DGUA 3MRJB 4XPGH 1A6UH 4KKLC 4PJBF 4JHAL 4HJGB 1G7LB 3GMRB 4M7LH 3DKHA 3PXJA 3BAWA 4RQQB 3BAIA 3S2AA 1KB3A 4HEPA 2IXQA 3WFDH 2PTVA 1E4XI 2J1WA 1HE7A 1C5DA 1GJUA 1CYXA 2DQEL 2O5ZL 2CKBA 4P2OD 2WVVB 1XF2A 2BO0A 4LP8A 2VSKB 3T4AB 3ZO9A 5FO8B 1XSJA 1YY8A 2COQA 4RQQA 5CILH 5E08L 4PBVC 4N9GB 1DVTA 4UI2A 2IH8A 4F1ZA 4XC1L 3BCDA 4ZMQA 1WITA 1C5DB 5IT2L 1NMCC 3ZUCA 2WANA 4HXAH 5IROC 1QFHA 2CKBB 2VUKA 1YMMB 3BE1L 3I9AA 4KKAD 3UPRB 4GNKB 1YY8B 4TUJB 4PJIA 5KUMA 5CZVH 3DRQA 4ZMLA 2CDEA 4JCMA 1QBMH 3A4EA 2WQSA 4BFIA 4KZEL 2X6MA 1MCNA 3LD8B 1FC1A 4QRQA 1LWJA 1UZGA 3HE7C 2BNQA 4GMTL 1AHMA 1LDPH 3MV8E 1OM3H 4XXWA 5E9DA 1LLAA 2FZ3A 1RIHH 1FIEA 5KVDL 5C0GB 5D2LA 2ENQA 3UXFA 3GZKA 4AMXA 2CDEB 2UUDH 2JTDA 2HMID 3V9CA 2Z3FA 3BPCB 3ES6A 3FF8A 2G3XA 4AJYV 5C92A 1KT2A 3AREB 2ZWSA 3UBGA 5E8OA 5F7HA 1CICA 2GSMB 2W0PA 3O4LE 1VFOA 2DF3A 5EOCL 3NZ8B 1XHHA 1NCAH 3WKPA 4B41A 1EFXB 2K6ZA 4C47A 1WFIA 2QADD 4WZ9A 1KCBA 2QTVA 1ND0A 2HZHA 32C2A 4L8CA 2C1OB 1HX0A 5B7FA 4TF4A 1MNUH 4NAQA 3SPVA 4LNRA 5DSCA 3G9VA 4KY1H 3BSZL 5DA4A 3N1GC 1X5IA 4F15B 3O4OB 3MRPA 2V17H 1A4JB 3OG4B 3EO0B 4POYA 2GBUA 3ELQA 5EBGA 4ZX6A 4LSSL 3O4LD 4X8GA 3QFDA 5T1LA 1RULH 3HC4L 3HPLA 1BLNA 1QG3A 2JF1A 5HJGA 5CFAA 5FV2A 3IN0A 3CDZA 3OHXA 3SJVB 3BVVA 3MLVH 1WRFA 1ACYH 1U2YA 4Y19A 4O5LH 2V4LA 5I16A 3RY5A 5EG6C 4MX7A 4N9OB 4YDKL 4NZTH 5LBSA 4OZFH 3EO0A 5L88L 1G9EA 2X6BA 4PJ6A 1TJIL 3NSYA 4MQTB 5F21B 1FZOB 4GB9A 1EGJA 1JK8B 2YAPA 3W3BA 3LHPL 1CQKA 1P1ZA 1NH6A 1A7NH 3SJVA 4MMXB 4ODWA 3V5KA 3WHXA 1ZT1A 2D2OA 2EE0A 2H8PB 4BYHA 4OFKA 4M43L 4MNGA 5IVOA 3RZCA 1A1MA 3U2IA 2X70B 4PJAF 3BN9D 3PV6B 1JYNA 3BIKB 2HWZL 5FHAH 1AZZC 4ODXA 1CE1L 4ZSOB 3ECUA 4X0KB 2DL9A 3B2MA 4PG9A 3QJSB 2QQLL 2D31B 3HR5B 3CDCA 4OGXL 3IDYB 3V5KB 1MFEL 3D4YA 3WHXB 4XXCA 5FW6A 3N43B 3NBNA 3HAEA 2H47C 2NZ9D 5LNEA 4RCAA 2I7SA 5KAQG 5IT2H 3LPPA 1FLRH 5I8EB 4GMSL 3DETD 5CBEB 1B88A 1WISA 1MELA 2FBJH 3RHWK 3CZJA 3VDAA 1RZPA 4KVCH 2BS8A 3ULUD 3WLWD 4Y2DA 4EIUA 2R1XB 3VXME 1HL8A 2BY2A 5EUOA 4Z7WF 4KDVA 4MD0A 4FQ2L 1NMCB 2CHWA 2XRAL 1TEGA 1BVOA 3DJ9A 3VO0A 2XG4B 1CFVH 2VUOA 5IVXB 3INUH 1ZA3A 5KSBE 1G6VK 2ZXCA 4X7TA 1KLGA 1X7QB 3GDBA 2V7NA 4U6VL 3QORB 3D3VD 3C2AL 1CT8A 4AQEB 2J72A 3FYIB 4FN0A 1IC5L 4YC2C 4KDTC 1MSPA 2DEXX 4AGPA 3RWHB 3MTXA 4MMZC 2NQ3A 3G5VB 1IL1A 5IB5A 4CU7A 1HH9A 2IVFC 3K72B 2GYSA 5HPMA 4TKWA 1KN2H 5G5DA 1Q0XH 4EN2A 3EFOA 4G9DA 1OCWH 3MI6A 5I5RA 5HY9B 3KL5A 3PWPA 2BWDA 2VLLA 4NUPA 3OAUH 5E9DB 4JS7A 4MTMA 4AQZA 2AI0L 1ORQB 3ECQA 4LIQL 1U8QA 2F58L 4DGWC 3F64A 4MXVF 4U3SA 2Y2YA 3FFCA 3S5ZA 1J86A 4ZUTB 4HEMA 1OSPL 1JV5B 3ULSA 3ZKQD 4A7QA 2ADYA 5AKRA 3ILQC 1NLDL 3MO1B 3MLTB 2XU9A 2YBRA 3K2IA 4XB3A 1CDGA 3VVVA 3IJ7A 3BP5A 2YA1A 3EGXA 4X80L 3U0PB 4YQXH 3PWPB 4AZUA 3HOGA 4YHNA 1KV7A 1I8KB 2EH7H 1A9VA 2XXFA 1JPGB 4E36A 1TSRA 1A4AA 3NCFB 1N3NB 1HEZB 2CLVA 2OMWA 3HJEA 3SKUD 4A6YH 3LXCA 3AS2A 3S37X 4P9HH 2Y5QA 1H3PL 3KJ4B 3NFPB 4OD1L 4G82A 4HX1A 3ULUL 1MVUA 4H1LA 2GUOB 2LFEA 1YCSA 2NUPA 4PRPB 2WQWA 4X7CC 2WVUA 3BAXA 1MNUL 1DQIA 2QKIB 1JRHH 1L5GA 1I8KA 4M3HA 3ZMRA 4CN1A 4YGVA 3QZPA 4ZMVA 2DYPA 4Q0XL 4MDJB 3RURA 3FOMB 4HV8B 4MKMA 4PWKA 4OJDH 2E74C 3RVXD 3LNEA 1ZHLA 3X1EA 2NLJB 3VXRA 1MVUB 4WFGD 1UWEL 3HZYA 4OBRA 4ELME 2YRZA 1GGTA 1GA2A 5FV1L 3PPSA 4D3CH 1O7DC 2JXMB 3WO4C 4S1RH 4UDTA 3ZE0E 4BRJA 1YO4A 3VXUA 4IRSB 2MPAH 1OAQH 4HG4J 5I23A 1E4JA 2Z0UA 3VNZA 3TN0C 4MJ6A 4JHUA 1FZOA 3NIFB 1G1YA 3KE0A 4P2RB 1MLCA 1JK8A 5FM5M 5H37H 2ISDA 5KYNA 3K71A 2B3IA 2VW7A 1P1ZB 4FG4A 5CGBA 1XZ0A 2VISA 4GMSH 1BXVA 1A3ZA 1MFVA 2BW4A 2FX7L 4QY8B 2Y06L 1ESOA 1N0XH 2PO6B 4UYPA 4OB5H 2DQ6A 3C60A 4NXKA 1IBYA 1DQJA 5SWSB 4EN3B 3VMPA 3MGOA 5E70A 1AFVL 1GYCA 3Q6GL 2F7RA 3CXDH 4KZCA 4Z3GA 5IFHL 3MRDA 3LNGA 4MJ6B 2ICWI 4HOMA 3U4EB 4I77H 3RGBA 5JHLA 1G9HA 5J11C 1W0YT 2PN5A 4LCWE 3AY4A 2FO8A 2N0KA 2QFRA 2B1HH 2V9RA 3T0EA 5JW5B 5DQJA 4NQVA 1LP9E 3DYOA 4XZ4A 5D7SL 4HHGA 1D7BA 3HI6L 2VXSH 1MCCA 4X9GA 2OYLA 1BSIA 2OL3B 2ZCHH 3HI5L 3WFEH 3QQDA 2CJTA 1ZHBA 2NZ1A 4JDZA 4JQIL 5JOPD 3BPOB 1S9VA 5EF3A 2N0MA 1TTBA 2KPNA 2FLMA 3MBED 4KQ3L 1ZV5A 1R47A 3CFDA 1OAYH 1QX1A 3ASOB 4TVUA 3FB7A 3BT0A 4OLZH 5IROA 5JW4R 1RUAL 5SX5K 1QPKA 3CTTA 4ZOCA 1NIFA 2OL3A 1YPZB 3IRCA 5JW4M 5K9KB 3SCMA 3MODH 4JDZB 4KITB 3D4GA 5DS8B 3S4SG 1KXVC 2ENYA 3SDAB 3X14B 2Y7QA 4M5SA 4PGBB 1RUKL 3H2QA 3OLEA 1LWRA 2H6PB 4TRPL 3FB7B 1NINA 4ZPVB 1RZKC 3JWNH 3X1NA 1S9XB 2X4PA 4B95C 5IESH 3O6FC 1I7UB 3HMXH 4AVHA 2YUZA 4ABVA 4IJ3C 3S48A 5KVGL 5AB1A 2D2CC 3ROLA 4PM1A 1C5BH 2NNXA 1BAFH 1UM4L 3AG3B 3QQNA 3BGFC 4QNPF 1JZ4A 1HINL 4OF3A 3GI8H 5DJ0A 1A1OA 3G6JF 4I8DA 3RUGF 3JBG7 1FYTA 1N2RB 4BZ2A 4U6XB 1TQBB 3IE9A 3SE8L 2P8PB 4QRTB 5HXMA 4U1LB 4MQXD 3GSRA 1SOQA 4ZUTA 3ULSB 4JM2B 2FAUA 4X5QA 3V0AC 4J3OC 1CF8H 3NA4A 3C5JA 1WIUA 4OJCA 4LLDA 4GY4A 1Z9LA 4S1DC 1F4WL 2WWNA 4WI5A 2UZYB 3HKFA 3FUJA 2P8PA 1AHWA 1HEZA 1WLHA 2OMWB 5GSRA 2XN9D 3KM2A 1FJ1B 2PYEA 4E9YA 5AVRB 5J5EA 2XICA 3ETBJ 3VFVB 1U3HB 4G5ZH 1EZVY 1DBKH 1INQB 4H1LB 4JPKL 3WUWB 3AADB 2E4FA 2ITCB 3MRLB 2P48B 1PDKA 3ARZA 1SJEB 5IR1A 2Y9RT 2C1PB 3QG6B 4MA8H 4Y5VC 1N59B 4IJTA 5IQ7L 3FTXA 3FOMA 1DVUA 4JRWA 4IU2A 2LVEA 1FVEB 2P47B 1K4CA 4YDVB 1ZHLB 1UB5A 3CN3A 1XF4A 4G8GB 4F7MA 3BDYL 3WFHB 3PGDA 1JV2B 3BH8A 5J7CC 1SBSL 1CDYA 4TULH 3IDMB 4F9LA 1UM5H 2DWTA 4OLYL 1KIUA 1OSYA 4UDTB 1WUNT 2A83B 3H55A 3QCUH 2AEWA 5C0BE 4JFDA 1WEJL 4J8RB 3MLZH 4PG2A 4Q2ZB 4BA0A 5K9JL 1RMFH 3UL4A 5HYJD 1G1CA 5AENA 4PJFF 3ETTA 3PV7A 3NTCH 4UDUB 1BFVL 5JLZA 2HG5A 4I0PB 4XCFL 1J9QA 3CBJB 3WKMH 3TVMD 2KLTA 2P46B 1MRDL 2KBGA 1RCYA 3IDMA 4Z0BH 4HSAC 4AVJA 1P4LB 3WN5A 4X7SL 3VWKD 3WO3B 5HHOD 5EDSA 3GUTB 4LVNC 1KJ3L 5D1QC 3S36H 2WBJA 4G43A 4P99A 5L6YL 3L16A 5AB0A 1M71B 2QPDB 3AACA 4OSUH 3U0TB 3MBWB 4I0PA 3LH2L 1XT5A 4NPYB 4XCNA 2F7PA 1ZLUH 1PZ5B 3POCA 1EJOH 4FXKA 2IBZY 3MGTA 1D5IL 5CJQL 5JW5A 1OD7A 2V2TB 1UJ3B 3KPPB 5JHDA 4MLIA 1L0QA 2X53A 5D7SH 3FTVA 4XMXA 3UTSB 2QSTA 3FPXA 2UY7B 3HG2A 5F9AC 2D73A 1S7QA 3PAVA 4P8QA 4RZKA 4EF3A 4HLZG 1ZLUK 2PUQT 3BZEA 4OIIH 4FNRA 4N3TA 2NR6C 5HGHB 3HCVA 1NCBL 5CWSB 4LASL 4TQEL 1QA9B 4L4VA 4R96A 1M9SA 3MBXL 5DHMC 2ZSWA 4H20L 1MDAA 1Y0LA 2ZCZA 2VDOB 5I0WA 1JWSA 2C4FU 3HE6D 3SGDI 1HZHH 4P57A 4UQDA 1L9NA 2Y7QB 5EN3A 4HGMA 2XT1B 3S35L 5D2LB 3RL2A 2WLYA 2KQNA 4ABUA 1OOAA 4P5KA 1WBZB 1D5BA 1CF8L 4LOFA 1U8MB 1BQHA 3V9EA 2V0AA 4W9ZA 5E8NA 5I0ZA 2V7HA 2NY1B 4AG4L 3AREA 4BSWB 2NQDA 4J3OD 4KVNH 2ZAGA 2YOAA 4ZS6C 3S9DB 4R7VA 5J3HD 3ZO0A 4DCQB 4BFNA 1R5VA 2J8HA 2WZAA 2YPKA 3D08A 3LRGA 1O5DT 1U8MA 4Y0GA 1OP9A 3ATFA 4FFZA 1JZ6A 3MLPA 2FH6A 3N44B 4N2BA 4EN3D 3Q48A 4WO4D 4KPHH 5C0AD 4L23A 3ZDZF 3GSNA 1YYLL 1BF5A 3MRPB 4KJYA 1QW8A 4PJIF 3ZHFA 4ZMYA 4YBQD 1W9XA 4WSKA 4KC3B 3PL6A 1LE5B 2UZYA 4GIOA 4FYRA 5A7EA 4EZMA 4N28A 4YN3A 3IJ8A 2AXJA 1QBBA 1FG9C 4BZ2L 3ULUC 3H7LA 5FHAL 3B7RL 3MNWB 1H0DB 4W70A 4OJEH 4OGQC 4JRXE 1DUZA 3TJEL 2ITCA 1INDH 1BJMA 2DLEA 3CFBA 4P05A 2GG1A 3EH2A 4LCWD 4PMFA 3TBTB 5A2KH 3PL6B 5K9QI 2C1PA 3ULVE 2IQ9H 1G5GA 3DMMC 3BZDA 2WLIB 2BSDA 5I66B 4CU6A 3RX5A 4EDWH 2NY2C 1JPTL 2AV7A 4JRFA 1YN7A 3FB5B 2LV4A 1CFQA 4R4BB 2H8PA 1P4IH 2DM4A 5HYSG 2W65A 4DK6A 1JV2A 5LGHH 1AC0A 2DM7A 4NZJA 4H8HA 3M8OL 1SLWA 5DMGD 5J11B 1KN4L 4Y7MA 4I0PC 4IBVA 5E94A 2AQQA 3H42H 2B20A 4J8RA 4OZHA 4XOBA 4X0KA 2BVQA 2ID5A 1OT2A 1PQZA 4JJOA 4YJZL 2AMUA 4LSQH 2HFFB 2EXYC 4OM1H 2R23B 3MUGB 3VA2C 5C2BL 4AVKA 3QIWA 1R24B 3QDMA 1F0LA 3UFIA 2K9FB 5F8RC 2ZT9C 3GBMH 3VD9A 3F7YB 1XVSA 1CFSA 2NXYC 1P4LA 4GSQA 1FFPA 3QQ9C 2AXGA 4G80B 5AAMC 4C56B 4JO3L 2EVFA 3HS8A 1MCPL 3IDJA 3ARSA 3BQUC 3MV01 3HG3A 2VLKB 2AJ3B 5GISL 4AT6B 4F93B 3ZBMA 4NQUA 3ZKND 3AU0A 1B4JH 1XAKA 1XX9C 2JK5B 4RDQF 2R4SH 1HKLH 3H56A 4DOHB 1S7UA 2QT6A 2E6PA 1BQLH 3RVUD 1T83C 3F7YA 4P04A 5HHVH 4H0LC 1JPFA 3HRZA 3DIDA 1UJ3A 3KPPA 4PJCE 1D5IH 1JVLA 4AL8L 1URZA 4GIPD 4F2ME 3ASWA 1NWOA 2Q86A 3F83A 4H1LG 4M7LL 4LRIC 3ARDA 3ZTNH 5MI0C 2UY7A 3H4FA 1P9MA 4OW6A 4G3YL 1ZK5A 3W57A 3RKPA 3WFDL 1PSKL 3MBEC 4U4BA 4KXDA 1FFNA 5CWSA 2JSFA 4JY5H 2K45A 2JJTC 2ZSWB 5I74B 4F15C 3V4PH 3WFBH 2GJJA 1TQBC 2OTWA 4GRLB 5F3HB 4XVUD 3UTOA 4FGMA 3FOLA 2R29L 4LMQE 2DQUL 4B50A 1COBA 1WAAE 2ZNWA 4M7ZB 4CN4A 4HCRA 3MUHL 4B9CA 3FCSA 4N86A 4L8DB 1BQHB 4X4ZA 3WNLA 1L0PA 1XIWC 3JV0A 2NY3D 3EXLA 1Z3RA 2HTKD 4OKDA 4YXLL 1JF1B 2YBRB 2IAAC 3DRTB 1Z66A 3EG9A 3FO0H 4Z6AT 3T65B 2WSDA 5D1QE 2QADB 1YEJL 4WRLA 3U0PA 2BY0A 1KACB 4HKBA 4NKDB 1ZLVH 4C4BA 2HKHH 5D1XB 4JG5A 3NAAH 1DQLH 2D3VA 3VFSB 1LO5A 1F4HA 5ETUB 3FHQA 5AWNL 2DQFB 1XL6A 3ZYIA 5I8KH 4YK4B 2HN7B 5CLTA 3HG4A 2AJZB 2P8MA 2APFA 2KZWA 4YDJA 4R7NA 2Y22A 3GGWB 5T3XD 1WCQA 3EKCA 4BWUA 3E9TA 4U1JB 4LVEA 4HFWB 1R3LA 4YPGA 3O2WH 1T0MA 5D8JH 3ABLB 3VRJB 1AQDB 5GS0C 1OAKL 3U4BH 4GQ9H 5I8CA 2AC0A 1FSKB 2ZUWA 3FAWA 5JR1H 1OANA 4P4RB 4BCXA 4MNHB 2DB8A 3L4TA 3VQ1C 2JXMA 1I3RA 2A6IB 2MTPA 4HJTA 4W9FC 5DD0L 5H8DA 2DLHA 2FB4L 4TVSa 4XPTH 5I8CB 1RUML 1IGFH 4NOBA 4GG6E 4G9FE 1DVYA 2XN2A 1ZLWH 4UNIA 1UH3A 2IPUG 4POUB 4LO9A 1I53A 4OQTL 4QY8A 5E00A 5D6CA 4HVBA 1K8DB 2AKRB 5SWSA 5HDBB 2I07B 4ZUWB 4JG0L 3BZFA 3D05A 2J4WH 4GAJL 2W91A 4AE1A 2BINA 4IM8A 4EI6B 3TESA 4WJG3 3MJ9L 1XMEB 3CWGA 5JOEA 1RAMA 3IGAA 5TDPA 3A4DA 1N8ZA 3B83A 3MRQB 1IGCL 4JRYE 3PU7A 5E00B 4A04A 4IKJA 4PLJC 2NW3B 3LNDA 1ASQA 3QIWB 3O6FA 2DL2A 5KANG 2QBWA 1CVSC 1TNMA 4J3VA 4Z7AA 3RTQC 1QLRB 1E27B 2Y7NA 1H19A 3BP4B 4U6HA 1AXIB 1JZHA 3QI9C 3VXSD 2AJVL 4L8SA 3GSXB 1DN0A 1IM9B 4HK3N 4M8QB 3O2VL 5A2BA 4BSJA 1PZSA 4JFZH 3EJTA 1HXMA 2BWIA 4RAVA 5LNGA 1J8SA 5KVGH 5F88B 4AXWA 4Z7QB 3QXTA 3WTUA 3O6FB 1X4XA 1B4TA 2M1KA 3RGHA 5DZJA 1D6VH 5KVEL 1QLRA 1W72A 5MI0B 2E75C 2LTQB 2XZZA 3GXUB 4HUCA 2ZXBA 4Y2DD 4DPCX 3MREB 4N0UA 4XX1E 3AQZA 1YPZA 3RZWA 4E5XG 1B6DA 1C7TA 1DN0B 1OGAE 3DO3A 4X6DE 1HAUA 3EZJB 4GS7B 2Y72A 3SYAA 1WA1X 3ARDB 1JP5A 2ZNXA 5F88A 2K70A 3FW6A 3N41B 4NKOB 4O02L 1G7QB 1UEYA 1ZXKA 2VR5A 2H6PA 4WCYL 4ZPVA 1PD1A 5EUKB 5E6UB 3OZ9H 3RA7L 3FMGL 4GRLC 2KZBA 4X4MA 4UNVA 1GOFA 1H3XA 3CFEA 4KFMA 5H35A 4BJLA 2VRAA 3EYQC 1SXAA 2YKLL 5C0IB 1JJUA 4M5ZH 4PRID 1A1OB 3POHA 1CGYA 3VE0A 3HFMH 3DXAB 4ONFH 5DVKA 1TJGH 1U21A 2PPCA 3LZNA 2QADC 5DA0B 4F3FB 3GEWB 4PN6A 3MRRA 2XZAH 3B2PA 5H35B 1SNRA 2OJZH 4ZAKB 4F80A 2C8NA 2WQ8A 4LCWA 2X1QA 3ULVD 3P40A 4QOKB 4K55A 4C58B 1BM7A 5DHYB 5A16B 5DD1H 1U41A 3FXIC 5DEZA 4KKCD 4PW4A 3KWVA 3P3TA 2ICWA 5IZ7A 1JDCA 5KEZA 3QCVH 5E1IA 4NP9A 3N91A 2DQFA 4RFNC 3T0AA 4M8VA 3SQOL 1INQA 3CSYB 3P0VH 4C56D 1PLCA 3INUL 3PL6C 5EHFA 4W9CC 3GGWA 1QVOB 5AVQB 5CEZH 4WI7A 3TN0A 3N1QC 2W1NA 4Q6IA 2QMKA 4K7FB 3U46B 1OPGL 3EDEA 1M05B 3VI4F 2R7EB 3I6LE 3MLRH 2RA1A 5E2UH 5J1TC 4PRDA 4W1TA 3PHOB 4URKA 1BBDL 2PP8A 1A9BA 3JUZA 2Q20A 4YQXL 1WBYA 2YMXL 3BHBA 5IHLB 3L3OA 3ZGIA 5CJ8A 4A2HA 3BH8B 1AI1H 2A9CA 4HKZA 4MA3A 4E9TA 1HDMB 3QFGA 4O2EB 4A66A 4RRPM 5D70H 1KJ2H 3OKEB 1I4FB 1T21A 3EJZC 3QJVB 3AJ7A 1BCIA 4CSZA 3U46A 1MIMH 1QFUH 2XX1A 1HZKA 1WAAA 4HAFA 2WZ0A 3EBAA 5GRUL 4UDUA 1T0NB 2Z1PA 3DX9B 4NRXB 5KANI 3S35H 1WBYB 4FNUA 5BZWB 1JMZA 1QSEE 5B1AB 1U0QA 4YMPA 1NCJA 1UENA 3KNBA 1I3GL 3L3HB 4CSSA 4G70B 3VB8A 1VFMA 2X2YA 4KUCD 5T1KA 5B3NA 4WFHD 5ICZA 3M17B 1FAIH 3GRWL 1Q0EA 1X5FA 2EO9A 3RWJA 1G7HA 1WFMA 5F0PB 3TPUA 3V5HB 1UFGA 4TNVF 4YHOH 4G83A 3ULVL 4OFQA 5BZWA 4I13B 4YSPA 4B27A 2ORBH 5J4MA 5T1KB 3SDCC 3Q5OA 4IMLB 3SYQA 4FCHA 4LMQI 1L9TA 1AQ8A 5AAWA 2F54A 3AC0A 4P4KA 2ALAA 1OP3H 1Q9LA 2MTAA 5D93C 1VADB 5DJ8A 1MREH 2EXSA 4L8SB 4WW2B 3PNWA 2V6HA 3ISYA 4HJ1A 5C6WH 1HXMB 4RAVB 4WNSA 2FO4B 3KJ6H 3MJ9A 4X4XA 4BV1A 5JXEC 4AXWB 3IAGC 4IMLA 4DESA 4YS4A 3JV5A 2Q6WA 1M9WA 3ULUE 3T3PE 2CGYA 3EOTH 5AVYB 1JWSB 3FPYA 3GM0A 5T1LD 3BH9B 3HZKB 1PBYA 2ZX7A 5L0QB 2OZNA 5I1HL 5BRQA 2XJLA 1CLOL 3S6CA 1JI1A 1G9MH 4IRZH 4IIQA 2X05A 4KROC 4GUOA 2F53A 2R1WA 2VMFA 5MEPA 3VXTA 4QDGA 2J20A 3EGSB 4Y19E 1NBQA 2E47A 3X1BA 5LGHL 4CVXA 4J4PC 1BXAA 1FL6B 1SVBA 3N1FC 3QUXB 3B2DC 2CO2A 5SWSE 2WKOA 1Q9KA 2WLNA 1LP9A 3JV6A 3SPIA 2R1WB 3DBXB 2OMYB 4ZZKA 2WXGA 1F1GA 4HD9A 4F3FA 1F00I 4ATWA 3ZYZA 1DZBA 4KAQH 3GHPA 2AXFA 3QJRB 3E1ZA 2R29A 4LCWB 1KLFB 4XO4A 3MLYH 2P45B 2ZCLH 3QUXA 3UBXA 2BVYA 1E9PA 1WC7B 3EFFA 2CR0A 4JQXC 4UTBL 5I1AA 2D4FA 2X4UB 3TNNA 4U7MA 1V7ML 1SJXA 3K6NA 5FLUA 1NOLA 1Z9NA 4ERSH 3SD2A 1HXKA 3N85H 3EUUA 1YYMH 4GW4B 4GKNB 5DDHB 4HCIA 3RVXC 4FYTA 3DX8A 2XWTB 1PW3A 1JERA 1KCRL 3EOBA 2F5BH 1BX2B 1O9ZA 3ESVF 5KBMA 3OGCA 4QHKJ 5HGBA 3QQ4A 4F8TA 2OTPA 2NSMA 2W0FA 2ZKHL 3NCWA 3NK4A 3HNSH 4GKSA 4M56A 2GHZA 4HF5H 4OF7A 2NYZA 1PTZA 4JQIA 2VDPL 1ZJBA 2WUCL 4U7KA 3D07A 4TPRH 4TSCH 4EI5C 2QZ5A 1I8LC 1SXZA 4I2XE 2AAVA 3MQIA 5EFIA 4BA8A 3DX8B 2K0RA 5FWQA 3BP7B 4L4TB 2LU4A 2ARJB 2Y0SA 4EVNA 3UAEA 5B38G 1A7BA 3BIAX 1XGRB 5D1QA 2CIIA 3OL2A 4H0HB 2R69L 1DLHB 4JKNA 1D9KD 5CJOL 5LCVA 4O5LL 1FFRA 5I6KA 3W81A 3ILEA 3EJPA 4I3SL 12E8L 1EV2E 4W9DC 2R23A 3MUGA 1DDTA 3UZEC 1RZJC 5DLLA 3CCHB 3OXSB 1OTSD 1IUZA 5D1ZD 4UUJB 2ITEA 4YHIB 1I3GH 2JJTA 4HMEA 4RGND 2EJ1A 1WS8A 3KDMB 5HHPA 3U6RB 5D2LF 1CXLA 3V4VH 2C4XA 5AW8B 3L8QA 4PQXA 1R5IA 3O3DA 4BHUI 1OCRB 1PGRB 4F8PA 4QRUB 3FSZA 3WE6B 1WA0X 2EKJA 3HC0B 3V8CA 5I74C 4LP4A 1LGVA 2EDXA 2XZQL 3WFCH 3ARPA 3M7FB 2BIPA 4P4KB 3UJTH 1CLOH 2VZSA 1XR9A 2GVYA 1EMTH 4BIKA 5I6XB 3HKZA 1R5IB 1XBDA 1DEEA 5H2BA 4OLUL 4APXB 3EYSH 5GHWL 2ZWZA 1MI5A 3ALPA 1KEML 2ED8A 3B7YA 4FEMA 2Q6WB 4IRSD 5KVFL 1U93B 3ATAA 2DYPD 3EDFA 2KDGA 2VAAA 3C75A 3GRGA 2MMXA 5BO0D 3SPJA 4O51B 3MBEB 4W93A 3NJIA 4KXZH 4YFDB 3PE9A 5I1JH 1HT6A 5J8OA 4Q9QL 4LDCA 3ARGB 1MCWW 3OLGA 3VG9B 1UKTA 5B38B 35C8H 4KRNA 3FU7A 4Y2LA 4G1MB 4AM0A 4O00A 1SHMA 3OJ2C 5DJDA 1ZLEA 3QUXC 4NO5A 3VXTB 2NRDA 2A6JB 2QHRH 3T65A 2G0LA 3HUJA 4HMCA 1A3QA 1QASA 5FFGA 3F65A 3F7KA 4JKPL 5DHEA 2OA9A 3MJWA 1FL6A 3SDYL 2X4OB 1QTSA 1EWHA 4G8GD 3VFSA 3ARED 3Q2WA 3JV6B 4DPRA 3O3AB 2YXWA 5BRZE 2QR0A 3JT2A 4FOMA 5GZNC 5L2JA 1ES0B 1A6PA 1W2KT 2FSEB 2OR9H 3CZFB 3KGUA 1M6OB 4NO5B 4YDJB 4PU2A 1M7DB 1JS4A 2GFBB 1C5CH 3T9WA 3Q2CA 4HUNB 1J8HD 3TBVA 3VRJA 3I84A 4EI5A 4NUJB 1Z5LB 4PSPA 2CZNA 5HJBA 4PJCA 3BVUA 2VDQL 1U8CB 2QR0B 4DQOL 5DEFA 5T1KD 1SOSA 2EH7L 4K8RD 2VERN 4PWGA 4YVUA 1BFOB 5I1LB 1D6VL 1THCA 1AJ7H 1P5VB 4YSCA 1H3TA 1TCRB 1WFOA 4ETYA 3DV6A 5HGBB 3QQ4B 2FIRT 4DAGH 4YZWA 5HDOA 2J6EH 4AX3A 4UB0L 5C0NC 2OMXA 1IC7H 2CM6A 3MXWH 5MERA 2XYBA 3QEHA 4V1DA 4GKSB 2J3SA 2FT6A 2ZKHH 2IADA 3VXRD 1WCBA 1VACA 5CUSH 2Q7YB 3B9KD 3EO9L 2VM9A 4M48L 4MQ7A 3IB4A 3LKNB 4TSCL 1ZVYA 2AKRA 3K4DA 3MJ7B 4MD4A 5CR8A 5DZNA 4FA6A 3EJRA 2NX5D 5GGVH 3X3FL 3QR1A 1SXNA 4P2QB 4FFWD 5DRWB 4KOBA 1LO2H 3B9AA 4X50A 1IARB 4NHUB 4WQOA 1P4BL 1PFOA 4X9YA 4A7UA 1E2VA 4J6RL 1BAWA 2FEDD 4XOCA 3MRCA 1ZVSB 4YR6A 5B39B 2AEQH 1OGPA 4J3UA 4G6FD 5GJSL 5AG8A 2HLEB 2XV2A 3ZIYA 3UJJH 1LO0H 2BOBB 2EZ0C 3QZBA 1T04A 3GPEA 2XZAL 1LK2A 3GSQA 4FDWA 4HOZA 1AQHA 5DT1L 1M4KA 3MNZA 3DUSA 3GB7B 1UCBH 3E6HB 6CGTA 5E2VL 4FG2A 5DD1L 5FXCH 2J8UB 3ARDC 2CXKA 3SO5A 3W5NA 3WS6A 4YBLC 3NABH 2QHLA 2ZXDA 3ESNA 3WNJA 4CAGA 1ADQL 3PDDA 4ONOA 2E7BA 2WZPD 3S97C 3T8XA 3W82A 1ZS8A 1GYUA 3H6AA 1JPST 1LK3H 4MA7L 5EORH 5HGDB 2WSPA 2COVD 3PHQB 3RWIB 4YUEL 4K3DH 1OM3L 3CBRA 3TA4D 3VH8A 2CLZA 4M7KH 1R3HB 3D18A 4FMVA 4E2OA 5CAYB 4XN5A 3JTTB 5KYXB 1F4XH 3BP6B 3IEAA 4FF9A 5LGYA 5IY5B 4LVHB 3B3IA 3QQ3B 5ERWB 3H0TB 3H85A 3MLUH 3PABB 1U8IA 3TA3C 3CSBA 4GG6B 4HIEA 1U93A 3L4ZA 1HCFX 1KN4H 1DP0A 2BNRB 1UD3A 3BZ5A 4IOSD 4JY6A 3CVDA 4ZX3A 4KRPD 3BC9A 3ETSA 3MR9B 4KOCA 5HDBE 2EIMB 1D5RA 1T5WB 2HJLB 1CICD 3VW3L 4RFNB 1OALA 5MENB 2YJLA 1W0WA 4FQCH 3PABA 1FIGH 2JQZA 1ETZB 4RA0C 3ZK0A 1IC1A 3PGFL 1C08B 1S6NA 1RU9H 2X44D 1VESA 1MCEA 3S35X 1GMEA 2X1WL 5I75C 4LLUA 3FUDA 5IESL 1SY6H 1TZOA 2C9VA 3HHRB 1A47A 1BV8A 1SN2A 3NFNA 4WK4B 4RH4A 1X9RA 4JDTH 3GJFB 2QQQA 4B3VA 3NJLA 4CGUB 4K9EL 5GGTL 4MB5A 3RI5F 2NPLX 3FTYA 1MCSA 1QSEB 4CVZB 1UM6H 3NCYS 2BVPB 2ZOWA 3ZE0B 1DJYA 3VXSB 4WTXA 1E50A 3TBVB 3EYUL 2HT2C 2K6WA 5E7FA 5BCAA 5HHQB 4QCIB 3W9DA 5C6TL 4FMFA 4JG9A 1UWFA 2ATKB 1DSYA 3MCLL 4ETQA 1BAGA 3DX7B 1MFMA 3K4ZA 1NGYB 2AW2A 5FUCC 1RZIB 2ARJQ 2I5YL 4WY7H 1UM4H 3RTQB 1QBLH 5IHBA 5DWUH 1CL7L 1TDQA 1EXHA 4DAGL 4X7FC 1Y18A 5IVZB 3OAWA 3UROR 2NUTA 4HIJB 3BAKA 1VCAA 3BLKA 1NGYA 2PPEA 3L4UA 1AR2A 3EJSA 3LKRA 3MJ7A 3OJMB 4A2DA 2X2IA 1CXKA 4LL4A 1I75A 3F00A 4P2RD 5IW6B 1J1OH 5TF0A 2X40A 3DXAE 4MAZA 5D93B 1FDLH 1ZCRA 4MWFB 1P2CA 1U33A 2ADIB 2G4EA 4NHUA 3TPUB 1IFHL 1S7VB 3MAWA 4TSAH 4YDZA 5D2NE 1FVCB 4HIJA 1Z5HA 1JPSH 2XQBH 2WBKA 2P4AB 4QXTB 4QXUH 2XC8A 3CFUA 3H8NA 4NRZA 4NGHL 4QAWA 4QWWC 5IW6A 4LOEA 3S3CB 1AGFA 5FYJH 1RK0A 3FT2B 4ELKB 1M2OA 1J12A 2XKNA 2L04A 5DFAA 3UGUA 5FYKE 1Q9LB 1BIHA 2DQUH 4X6DA 1S7VA 2P42B 3FH8A 3LNIA 2XETA 2FGWH 3RIAF 4KNTA 1DBJL 5C7XL 1QHPA 5C70A 5A2JH 2X88A 4NBZB 5CO1A 4OQ1A 2BSRB 4C54A 4A7GF 4Z23A 4I0KA 1R0AL 3P9WB 5ID0A 4V2BA 4HUMB 1MHPL 3QWOA 2WQUA 1BVLA 3VVWA 5B8CA 4FLSA 4L8BB 4J3BA 4ONHA 1K3ZA 3QGVA 3BH9A 1G9NH 1ID2A 3MX0A 4JPSA 4AC2A 2OK0L 1D7FA 1BEXA 1YEWA 3DPBB 3Q01A 4XHJD 1NGZA 2X7LB 3ZIMA 2I85A 4NOFA 3TYFB 3U9UA 4OQTH 1HS6A 4X6BA 3UCRA 2CDGB 4AV0A 4QRPD 1USQA 1F6FB 2WV3A 3KCPB 3BWZA 1SYVA 5GIRA 1SEBA 2R1YB 3EFDH 4NJAL 5FECB 4K9EH 3U7WH 3AMKA 1G6RL 2TRYA 4FI7A 5AW7B 4ZOEA 2GJRA 4BZYA 4MJID 5FB8A 3GXDA 1OARH 4GAGH 5I75B 1M3JA 4X9BA 2UWEE 1PNCA 4ZQKB 3F12B 5CZXC 3RVWC 5ICUA 1I8MA 1C08A 1VDGA 2AXFB 2VIRA 3KHOA 3Q5YA 4HWEH 3ML9A 5C8JA 2VO8A 3A6CH 1R6VA 4JPWH 5E99H 2WLZA 1T22A 3OZ9L 4UT6H 3RA7H 1GY1A 4UT7L 5GZNA 1QNIA 4FQXA 3WIFB 2VC2H 4LBEA 4YFEA 1F1DA 3ETBF 2OXHA 1M7IB 3IWUA 25C8L 4AWJC 5FF6A 4DSYA 3HS0A 3T71A 1NBVL 3MZGB 2VIRB 1IKNA 1CI3M 3CVIL 4LSVH 1QRKA 1OSEA 2RBLA 4MMYA 1E4HA 2BVPA 4EN3C 1T22B 3B4NA 2DV6A 3WXWL 1MI5E 3X3GH 2P5EB 1Z3GL 1EAQA 5AOMA 3IYLW 2OJZL 3L3IA 5A3IC 3TIEA 2OCJA 5F1SA 2FQEA 3U9PL 5KBDA 3BJ91 4PJ7A 5D1ZB 5IUCA 3G9AB 5DF0A 5HI4C 1GGCH 2WLLA 1VGEL 5GGTA 5DMGC 3R7QA 4XB7A 2QSQA 3QPQD 4XVUC 4W9EC 4B0MM 5B7MA 3PG2A 4NNPL 1TQUA 5AKTA 5CLWA 2RCSL 5L2KB 4MCMA 8PAZA 1KTRL 5K39B 5LNDA 3OKLB 1OTUC 1KTJA 3HE6C 1AZUA 1IBZA 1J9RA 2HT3D 3WHE0 3ULUH 2PPFA 5ISZE 1KEGL 1TTFA 4PB0L 5E8DH 5J6HA 1P7QB 2VLRD 4N0UE 1H6UA 4UANA 1UKQA 5JW4N 4KJQC 2MFNA 4MXQD 5C0CA 3GSOB 4J3OG 4Z1PA 1OAYL 2B39A 3CMOH 4G9FA 2H3KA 3IFNH 1R75A 3QSKB 5IM7B 5B7EA 5LBSH 1FGVL 1LE9A 3K74B 1NIBA 2JKIS 4WHTA 1OP5H 3FRPB 5FHBH 4MZ3A 2AQTA 1AGFB 2J55A 2N1TE 5GPRA 3F05A 4YSTA 3RWDA 1LO4L 1TVHA 5ESVA 4LARH 1RIHL 2Y25A 1TQCB 3LPWA 5EBMA 2Z35A 4G9FB 3ZZSA 3SGJA 3PWPE 1KGCD 4WO4B 5H94B 4DP6X 5D96C 3SCMD 1D5MB 2VW6A 3WL9B 3FRPA 5I26A 2JELH 5IQ9A 4NQEA 4QHNB 1TJXA 2VDLB 4PBWD 5JZ7C 5EIQA 4A1RA 4ENEC 4P0DA 1ETJA 3TBCA 3QBTB 5D55A 2X4NA 4ZD3L 3B2VH 1AG0A 4LCIH 3IN2A 4L0YA 2CJSA 3ZT5A 2IH9A 3TZVD 2J1ZA 4AYSA 5ACZB 2BSSA 4OCSH 4QHMA 3RAJL 1FZJB 3CH1A 1QNZL 1YG9A 4HIPA 4PLNC 4PUBH 5AZEH 1ETA1 2VZ1A 1B2WH 1CGVA 4K0OA 4GT0A 3QUMH 5GS2D 3WNKA 1MAJA 2D7TL 3S3BB 1U8HA 2AP2A 1OZTG 2KT6A 3NJNA 3TVMC 1AQKL 2EDHA 1SJHB 2KYIA 3RDJA 1M7DA 3NQIA 3QEQA 1TFPA 3PF2A 4IBLT 5C8JB 1F6AB 3PWUB 2H6OA 2Y1AA 4NQCE 5G4OA 5CJ5A 3E0GA 2CJ3A 4OF0A 1SOXA 4AYDC 4DGVL 3EBHA 3O2DH 4LBEB 5C0AB 3HZMA 4OZIF 1U8CA 3QQ9D 4RMBA 4KI5D 1GHFH 1L7TL 5DJZB 2ODHA 4TULL 1N4XH 2HKHL 4Z9KB 5GZOC 2LVCA 1WZAA 4IS6A 3EH4B 2V5SA 3Q1SL 4J6RH 3T0EC 2UY6A 4IDJL 4JGMA 5FGSA 5IFAH 3QPXL 4JHVA 4JMXA 4IRJB 3SY0B 4ZMWA 1S9YB 1ZPLA 1QFWI 1L9OA 4KO6A 5EZIH 3ILDA 4PH8A 2PWEA 1XH3B 2PMZA 4MQ7B 1D5XA 2EEAA 3LHPH 2E7LC 4E41B 1LL1A 1VLXA 5IFJB 1NIEA 4HSCX 5EZJA 5L4FA 2I9TA 2YD8A 2AEOA 1VIWA 4DGIL 1AACA 2XV0A 4PRIB 4Y2OA 1S9YA 3DMMD 1HQRB 1TR7A 2ZF9A 1V3MA 3I75B 1T03L 4JZOA 3IMBA 4HUWA 2F5BL 2B5IB 2YD2A 1KYFA 5FR3A 1IILE 2LFGA 3FT4A 3UC2A 3SCMC 1UOWA 3WJMB 4FA8A 3APCA 4RFEB 1MIEH 3Q6FB 4U6VH 1IM9D 2XTLA 3M1OA 3U7YL 3DVIA 1YEDB 3PJSB 4JE4B 4WFED 2VDNH 1P7HL 5SWQB 4JZJB 2PTUA 4L1HA 5IW1B 1ZMYA 4R3SB 1FUNA 4DZBB 1B3JA 3UTTB 4R2GD 4YZFE 3MV8B 4X42A 3WI9A 4LXFA 3WJMA 4PJFE 2P8LB 4OD2A 1PZ2A 1RERA 4XXDB 2HPTA 4Y4HB 3RWIA 3MNVA 5H37A 2VZTA 2XRAH 2GPZA 2C9XA 2V37A 5IW1A 4UQ9A 5AB9A 2EEDA 2AS5M 3PIQA 2CLZB 4FQHB 1W72L 3RNKA 2UXGA 4ZMZA 2IDCA 4UTBA 4WI4A 1QSVA 3DDGA 5JDJA 3D12B 3ZL4L 3HB3B 2X9ZA 5T5FL 1RP9A 1CUOA 5BNXD 4RGNC 2ZYRA 4OCXH 3WEOA 4X9IA 1EZSA 1F8TH 4W6WB 1MJJA 3QH3A 4BXSV 1MW3A 1XGQB 4W9HC 5GSVB 3C6LD 3WIHH 5MP6H 1F3JB 4F7EA 1B2YA 2I26N 1HCYA 3FRUB 1HOCA 1RJLA 4PJIE 4S1DD 4XNYL 2PTTB 1UXWB 3EYVB 3LSOA 3KW8A 4L4TE 5D7JB 2A38A 4Z5RA 3K8LA 3PXHA 5FUOH 5K9OA 1SN5A 1ZLDA 2H0EA 3II1A 2G9HB 1ZWIB 2O6EA 2IH1B 2CRZA 2EVIA 1AP2B 1KCVL 2V8MA 4QI3A 5A2LH 1BM3H 3LEYH 3VFNA 4ZOBA 2ZOKA 2E4TA 2XPYA 5F89A 4I0CC 4PPTA 4LT7A 1T0OA 2AJVH 4F33A 4Z5RB 3X12B 3M1BA 1QRNA 3KL3A 4F58H 2B9BA 2IAMC 1MRCH 4NDMB 3R06B 1ID5I 2VDRL 5JYMA 5AZ2H 2X4QA 1QFWL 3KPRA 3OC5A 4JFUA 1L9PA 2WVVA 1XF2B 3DSNA 2HAZA 1RK1A 4O2CB 4FQXC 2X4TB 4PWHA 2IANB 4H25B 4XPGL 4HWZB 3RDTA 4Y2DC 5JXED 4BE5A 2VDKH 3MRGA 4Y88A 4OJFL 3NOIA 4B0MB 3B37A 2N56A 4QMEA 1CCZA 4OVVA 1O6SA 4RX4D 3FUMA 5EU7E 2W07A 3SEPA 1E7UA 2VOTA 4NZRL 5EOTA 2D7PA 2N3JA 1RK1B 2E9BA 5BVPL 4AEIL 3IJHA 1FF5A 2B2XL 4TUJA 4P9MH 1TZIA 3CN1A 4GRLD 2HG0A 4LLVA 4PV8A 4LK4A 5EZLA 5HDWA 3L3GA 1A0QL 4ATTA 3QZMA 1LM8V 1HH6A 3BW9B 2LW3A 4GKOA 4EQ2A 5F9WB 1BQSA 3RWGB 5AKVA 2HT4D 4ZMXA 1EBPA 5CEZL 35C8L 4PJEE 2EIBA 3DHPA 3IJHB 2FZ3B 1HHIB 3Q8CA 1CLZH 3OSVA 2DI8A 2VDML 4D0DB 2P80D 1VKXA 3FTWA 1MLBA 2G60H 4OY9A 1MZZA 1EHNA 2VITA 4I77L 3DIFA 4OGYL 3JVGA 3VXOA 1KBGH 4XP1H 3BOVA 1DN2A 3PHSA 1TZHA 5KYWA 2EDQA 2BP0B 1K72A 1MLBB 1NPNA 4F8OA 2GY7B 5FO9B 1AD9A 2DQMA 1YUHA 2VITB 4MAUH 4AENB 3RX9A 1T7ZA 3UTTA 1AXTL 1BVNT 2NNAB 2ZJSL 5AEAA 2AK4D 2VXVH 4KV5E 3I3EA 4NQSB 2Z92A 1P4IL 2WCSA 4M7JH 3KXFD 4BH7A 1AI1L 1T7YA 4XO5A 3MCKB 5IOPA 4NO0A 5KN5B 1J8RA 5B1JC 3O3BB 2ICWJ 1NBYA 1QUNB 2FX8L 4HBCH 3EDKA 1JNHB 1JF5A 5I16B 5C0DA 5DEGB 4Q9CA 5J12B 2PYEE 4N8VB 1KBKA 4XPFL 4XMWA 4CDHA 4LEEA 5I71C 1A65A 1LJMA 3D4ZA 2EYTB 3VFTB 4CC4C 1GPOH 4MKTA 1TMCB 1CI5A 1A66A 5KSUB 2IFFL 1DQTA 4OF5A 3QEQD 3D69A 4HMDA 2CDGA 3RGVC 4PJDB 1JNHA 4XI5D 1SYVB 2OW7A 2VDQH 3IFOB 3DROA 5GIRB 3PXLA 5KG9A 4HJGA 1CBVL 1NFDF 3AM8C 3TCTA 2VDRH 3FUIA 3KYMA 4XP6L 1UXWA 5D7JA 1E9OB 5ITFB 5DRXB 5EEZA 2QQNH 1ZWIA 1GOGA 4ZSOA 2IH1A 5GXBB 2X0WA 2WOYA 3FU8A 5JA9A 1D9KA 1EDHA 2XI9A 2MH4A 4WI3A 1T1ZA 3WXVL 4MNQA 5JXAH 1BM3L 4ZO7A 3US9A 2VT0A 1I8IA 4AQ8A 2FBJL 2ZYHA 3M1BB 5D71L 5HI5D 1GZPB 3RNQB 2VSDA 3SKJH 1NAMH 2K3HA 1OOWA 2YUWA 1YAZA 2LQRA 1U92B 1XF5B 5DHXB 4XVTL 3NIGE 4Y2DB 2X4QB 1B0WA 2DWYA 1LD9A 4YHPA 2HTLD 4PJ9A 5F6HI 4YPJA 3ZE0F 2KHAA 1QD0A 2EAEA 3HAEG 5B1CA 3P02A 2CA3A 4M3KB 4N2NA 3B2UC 3DRQB 2A1WH 3F7RA 1UWXH 1W8OA 4U1MA 5CN3A 2DKUA 3MV8D 4UU9B 5KJRH 4YIQA 1X7QA 3GPSA 3QQXA 1MCHA 2CO7A 5IB3B 2NOYA 3F01A 1DVFA 4KX7A 4UILH 4YHPB 3Q06A 2WLLB 2HKFL 2E7CA 4G42B 3VSQA 1NBCA 4XN8A 1A7OH 3GMOA 3DGDA 4H4NA 3AGVA 4ZUVB 2NQCA 4DOHE 3HPJA 2XV6B 3ZOAA 1F97A 4JFED 1P7KB 4P49A 4N6QA 2XWJA 3GIZH 3WEBA 2B5IC 2L3BA 5KJ7E 1NC4B 2MSPA 4OTXH 4UU9A 4YIQB 4C83A 2UWEA 2XACC 4Z78B 4KK9D 2CNZA 3EFOB 1A6AB 1OWRM 2AAAA 1DVFB 5I1CL 5LG6A 3I02A 1GGIL 3BWAB 2ROYA 5LCVL 4X7EC 1K2DA 4OIBA 2IV8A 2VRKA 1TU2B 3TASA 4P3DA 4H8WH 1EEZA 4NQXB 4QHUB 5G4MA 4N4YB 3TIDA 1ND0B 2YK1H 3LRHA 3O2WL 4XMZA 5D8JL 3MO1A 4FLRA 1V8HA 2G0KA 4R2GC 3VUAA 2O6CA 2YEZB 4ZT1A 4FC3E 3SDXA 3PGCA 2Z34A 5IBLD 3EIFA 1WTGT 3FU6A 4Z7WE 5I6PA 1JRHI 5CJOH 3KWWA 1DZ0A 4NO3B 4JLRB 1E67A 1DANT 1KMGA 1N3NA 2CLVB 3QIBB 2K7QA 4OCRH 2Z8WC 4YFLF 4WWKB 4KI5F 12E8H 2EIEA 3SOBL 5KYWB 3QO1B 4BD4A 5AB2A 1N6VA 3T2PA 3CDZB 2DQTL 5A2IH 4PRPA 1MCDA 1XIWA 1LMKA 2OQJA 2XTJB 3RFZC 5D7IF 4JM4H 1C8QA 4JL1A 2PETA 4Q9RL 4MX7B 3HW7A 1SF5A 4OFVA 4NENA 2VDPB 3TTYA 1S3RA 3O2VH 3WL9A 4U1IA 1NCTA 2A3TA 5EEYA 43CAB 1KCSL 4Z8FL 3VXRB 4QHNA 5HVHC 2BS9A 2XJKA 2OQJB 1YQ2A 3G6DL 4A37A 4BFBD 3N0AA 3WD5L 4ZMTA 1BQUA 3AQDA 4NQCB 2R0LH 4YH6A 3NK3A 2CK2A 3QEUA 5TFSH 2C3VA 1P69B 1E40A 3JV4A 4F9LC 1C7SA 1DJIA 4HIIA 4O02H 5ACZA 2A9NL 1Z9PA 5E2JA 3RDTD 4YLBA 4BM7A 5BQ7A 3GMQB 3W1ZA 4N2KA 2Y7SA 4WSGA 2AXHA 3C60B 3IFOA 1PY9A 1AS7A 1NAKH 1UH4A 5CMAB 2EZ0D 4UV7H 5L8LB 5CN2A 4Y5VA 4V1DE 3AROA 4OLWH 2CNYA 2UZIH 4L05A 2C3VB 3SDDD 3UCQA 1BJ1H 3ABMB 3HS0C 4HIIB 1VCBC 2E7LA 1AR1B 2AGJH 3AB0C 2K8MA 4EUPA 1BF8A 4J4PD 4GLRI 1S7WB 1XXDC 2PWDA 4GXUN 4G8FB 3CC1A 3QA3A 3CVHH 1TENA 5ILTL 4JUSA 3BKCH 5AOLA 5GS0D 1FDLL 1CL7I 1ZHBB 1A2YB 2NY6B 3IU3A 3ZX1A 4C57C 1CG9A 3M8OH 5FOBA 3RB7A 4EUPB 2Q8BH 5ID1B 5DXWA 1YMHA 1KCUH 1S7WA 1EO8H 4ZMPA 3P2DA 2NXZC 1FO0H 3LZLA 3JT0A 3MODL 1H6FA 5DZVA 4XODA 3SCMB 1XH3A 1JVKA 2J73A 4K5OA 2O5XH 3TO4C 1UACH 2ICEA 2EDFA 3X14A 3RPBA 4PWEA 3NH7H 4UT7H 3VGEA 3X1GA 3QORC 4FZEH 1SLVA 1MCPH 4IHOA 1FORH 4M61B 3FO1B 3SHSA 1EXGA 4JRLA 1MY7A 4ALAL 1DEDA 2DBLH 4PRBB 2OSXA 3UTSE 1YC7A 1NFIA 5HBBA 2R2HB 1RSFA 2FQGA 5ECGA 3UTPD 1U3ZA 3FH7A 2YSSB 3AXHA 2Z91B 1JXKA 3HAEH 3IWVA 4P3DB 4GAFB 1KELH 2Y6SD 1UTDA 1RZJL 3P77B 4N8UA 3OXRB 4KDWA 5EV7A 4CU8A 4QRTA 1S5HB 4PJAB 3EJYC 1JYXA 3NFPA 1WIPA 3QARA 1J5OH 4YFLI 3TBSB 1I1RA 2YEZA 2H32A 4AV5A 1MCRA 1KUMA 1PKQE 1GTFA 1K85A 3BGFB 3BKJL 25C8H 1CS6A 2RCSH 1THAA 3V55A 4JLRA 1AGDA 5FW7A 5AZ2L 4N87A 1DBBH 2DWSA 4XXDA 3JWDC 1MH5B 3L7FA 3ZKMC 2D3NA 2WWKT 5IBTL 4GAGL 3QO1A 4CBZA 4FQHA 5INDA 3UJIH 2H2PC 4MA8L 3Q0HA 3U2JA 3SBRA 3SDDC 2IOMA 1Z9OA 4NX0A 4KMTH 3VXUB 5E9NA 2ENSA 3FQTB 1B9KA 3TV8A 3E8UL 4RA3A 4U1IB 1LXMA 3SYOA 1FVEA 4AEIH 2L7QA 1F3JA 3PGDB 1E5AA 1NANH 4O2FB 4TTDD 3RDTC 1BXXA 3A3YB 2OKMA 4DVRH 2QZQA 1U58A 3GMMB 4ONGH 1X5KA 1ZSHA 2BK8A 3RU8L 3BWUF 3HG1B 4LGRB 3QJZA 4A2FA 3U83A 5FUCE 2FH8A 1TQTA 2YPLA 4CKQA 5JLZB 4R97B 1I9RH 4P2RE 1ULVA 3S37L 5EN2B 3FQNB 2ESVD 2WP3T 4QRAA 3T4AA 1N70A 5FO8A 1FFOB 3T0EB 3WNPA 1N5AA 2CGRL 2BSCA 2YD1A 4F33B 2X0UA 2NSXA 5CU5A 1DVFD 2GJ6A 5EULV 1W15A 2DMBA 3KBFA 1GH7A 1WP6A 3OMNB 3GJFK 2E9WA 5IV2A 4Z3TA 1YMMA 1MPAH 4U2YA 2GHWB 5BZXA 2B1AL 2ETWA 2EYSB 2IAMB 1URLA 1JZGA 1PZ5A 1J1PH 4R7XA 1CFNB 4WUUE 1KGWA 4RSVA 4O9HH 4TOYH 5I19H 2ZP9A 3ULVF 2DW5A 2X4SA 3S5LB 3TO4A 1MJ8H 1YJDL 2WNGA 3CBKB 1CQYA 3QA3B 4ENZA 5IV2B 5K9KA 5F7BA 4KKZA 4XAKD 4ZX5A 3TBWA 1YECH 3BXNA 5E2WL 4OZFB 2G2PA 3Q9PA 4OFYD 5AAPA 3L3GB 3TO4B 5L8KB 4QT5B 4JPQA 4JZNB 3RX8A 2CHNA 2WB1A 2YD6A 2HCZX 5AAWC 3MJGX 2A5UA 5CSGA 2FRGP 5C09D 3K2MC 3NZ8A 1ZLSH 1NUFA 2BC4A 4Y9GA 1GXEA 1NLDH 1FYTB 1N2RA 4IHOB 3QJFA 4PVMA 1WFJA 3FO1A 4U6XA 32C2B 4JFZL 1BQKA 1FVDA 3BPLB 4LSPH 3T3PB 1F90H 4RESB 3TBBA 1XCWA 4HHAB 1V7MH 4HIQA 3TT1H 1KJMA 3U2SA 4UTCA 7FABH 3D9AH 4MYWB 3C5JB 3F8UB 3VDCA 2NY0D 1OF0A 2BC4B 4JQVC 4K2UH 1BA9A 1G7PA 2BOLA 2BNRD 4LCUA 1ACXA 4FXGA 4U7SA 2N4IA 5LXGH 3DARA 4K8RH 1Y1UA 1MCKA 5GSRB 1X5HA 4H26A 4LU5H 4Y19B 2WVSA 1U3HA 2SEBB 3QJHA 3MXVH 4I1NB 2JKSA 3E2HB 4XN7A 3EOAB 1SJEA 5IR1B 4LCUB 4UZGA 5TQ0L 1U30A 3SBPA 1MG2C 2O5ZH 3AITA 1N59A 3MCKA 2IAND 5GRWA 2O6DA 2ZUQB 3FZUD 2BRQA 4NWUH 4PGJA 4MMXA 4XVSL 5JIIA 3V6ZB 1DL7H 4X5PA 3RU8H 2W9DH 5INDB 1T2XA 4P3CL 4HEPG 5TE4H 4YO0B 3TOPA 1FZKB 5IP4A 3O3EB 4L1SA 1TZGH 1I9RL 5TD4A 4C59B 3VFRA 2N7AA 1XTLA 2ZOLB 4JFDB 4JB9H 1KPVB 4TYUA 4WO0A 1UD8A 4N1HB 5PAZA 2CRIA 1A6VH 3CFTA 2HRHA 5HYFA 3OAYK 4PJ9C 2VQ1B 4F8NA 1CFQB 5T1DH 4PP1C 4PGDA 1QWNA 1U4FA 2WPGA 2A9DA 4OCYH 4C4UA 3WGVB 1JXJA 1E9OA 4PLKD 1USZA 1UVQA 1T66C 4Y1AD 3VXMD 2HT4C 1YYCA 4K4KA 4HOWA 2BVQB 2WBJB 2DJMA 1J1PL 1H6EA 3QG7L 1X9UA 2KDYA 3IFPA 3II3A 4JE0A 2CSPA 4W9GC 2DDQL 3MRHB 4DUVA 1JZ2A 3HEIB 1VZGA 4ANUA 2HFTA 4WU5B 1QHOA 2AITA 2ADFL 4XCCL 4KRPC 3K91A 4OVUA 5IIEA 2OMZA 1I8IB 4NSKA 4WGVB 3HN3A 5C0FA 3LIZL 4QO1A 4FXKB 2QVTA 4GUPB 1I1YA 1OAUH 1KBPA 4AGMA 4HLEA 1SOKA 3LPOA 2R2CA 1TYEB 2YLHA 4KU1A 3EDJA 4RISH 4HUVB 4N26A 1I9IL 4JFTA 4JRYA 4G6AC 3QI9A 4IKKA 4PD4K 1S7UB 2Y2TA 5C0CD 1F3RB 3KLLA 1BVKB 5A6LA 1AIFB 2WWMD 2F68X 2ICES 3P0VL 1I1YB 2YQ2A 1GCYA 1ZXQA 3RWCA 3IJ9A 4GSDH 1YLBB 1MAKA 3A6CL 3HN5A 1E7VA 1L0YA 5GS2H 3QUKB 5I15L 3EAKA 3UBXG 1Y7VA 1WAAF 4OCLC 5CFHA 4UTAH 3UPRA 4RWYH 4JO8A 2WN2A 3Q7JA 2ZCHL 3HI5H 5DHVH 4DO4A 1B0RA 3IBEA 3TBWB 5IEKB 1AIFA 1IBGH 3WDHA 3TT1L 5JW4Q 2G9KA 2J12B 1D5BB 4KQ3H 3HNTH 1G6RH 3OKNB 4KX9A 1XDTT 3OB8A 1VFAB 1JIBA 1A8ZA 1PS3A 3WBDA 5MHSE 3QUKA 3LZQA 3DDFA 3PUCA 4R7LA 4DGYL 4L9DA 1I3UA 3BUTA 4XNMB 3WCYA 2OTWB 4GRLA 1RJYB 2R29H 1ZRUA 1ZV2A 3NSXA 4NQED 1NBZB 5IB2A 4Y9BA 2EYRB 3V79C 4DCQA 4NO2B 2A74B 1ZGLA 2YPKB 2X41A 4KTYA 1DBMH 2Q2EB 3BPCA 2KMWA 3MXVL 3MYZA 1UA3A 4G72B 2P26A 4N2HA 4PJ7F 3BWSA 4Y7OC 2APSA 3IMRA 4IBUA 4GG8A 3HB3D 1F8TL 5EPMA 4BDVA 1RJYA 3QB7C 5FO2A 3LXAA 1UD2A 1XCXA 1P4BH 3NMEA 3GZPA 4N20A 2GEEA 1EFXA 5ANHA 1BEYL 1FAKT 2X4RA 5I8OL 5C0EA 3GYRA 1EVTC 2IJ0C 4N0YH 4FXGB 5B1JA 4NQEE 2BIHA 2GB2A 4UINL 1EEQA 2HN7A 1CFMA 2ZWLT 4LPVA 2FLRT 5TQ2H 1XIWB 3FAXA 3H3KA 2BIMA 3HZYB 5HI5C 4IMKA 1Q94B 2CBMA 4YXLH 2QPUA 1H8SA 3VGFA 3CFBB 5AVXB 1OSZB 3SD5A 1D6EB 2A9ML 5ADOL 4JRXA 1KXTB 4K7PX 3A67H 5I1GL 1OK8A 4L5FE 3HPLB 1JHLH 3RPIA 1RV6X 1FBIH 3CFCL 2AV7B 4M4RB 4A7VA 5LN4A 1QHQA 4PHZA 1GR7A 4HIHB 2A6DB 1RVFH 1DQDL 4QOKE 2NY3C 1S78C 3TH3T 3MGOB 4YO0A 2Z0BA 3ZTCC 3KGRA 1I1AA 3BH4A 4U1KA 1FYHB 5HVHB 4R97C 2AJUL 4JRXB 1KXTA 2ZOLA 4XRCA 4XWGL 2VDKL 3KYOA 5FDWB 4WI2A 2EDTA 2ENPA 3MLYL 4X6CE 3DMMB 3V4VA 2R0WH 3TEUA 5E8DL 5TGBA 2PWHA 4U1SB 2WWMC 3VU2A 4RIRB 3O6MH 3HLKA 3BKCL 4YBQC 2EP6A 1AOZA 2VTFA 3L4WA 4J6IA 4YSUA 2X70A 1JGDB 1OWWA 5EO1A 5G2NA 1NGPL 3VXQA 4ABQA 5J6GA 5KYYA 2Y5TB 2HYMA 2BIIA 2PW2B 3JWOC 3QQDB 1WEJH 3L95A 1N8ZB 2D31A 2VLKA 1FPTL 4OFYA 3H9HA 5JHMA 5D7JD 5B1KA 2GBVA 3CFDB 3MV7A 1EHLH 3F7VB 1OGTB 3E3QE 1KFGA 3NH7L 1E27A 5J6GB 5IVXF 4RWYL 3HZVA 5IJKA 2NXYB 1SVZA 1DVFC 1IM9A 4M8QA 1A2YA 1CBVH 1Z0MA 1J8HB 2ZF8A 2R1XA 2PXYC 2ZOUA 4N22A 1WD8A 4ODSH 4OSUL 3N42F 2BZ7A 3ZTJH 2UZPA 3HG0A 3RBSA 3VTAA 1BVKA 1WGOA 1XB8A 1W8NA 2YGNA 2MIZA 1BQRA 3MRFB 1ZA3B 2H3NB 2YPVA 4MB3A 1JNNH 3NUKA 3J8F7 4K71B 3QULB 4XPFH 3WXVH 5GS3A 5D7LB 5DC0A 2CH8A 4NM4H 2V7NB 3NEXA 5E51A 3LNFA 4N5UA 3TEWA 3BEVA 3KLDA 2E6QA 5E95B 4JFEB 1OE1A 2X3AA 1OM9A 5D71H 3RUGA 4U0RC 4PREA 1QFOA 3QXWA 4JHWL 3MRFA 1AOHA 4NXSA 1IL1B 1CDBA 3ME0B 4R4FH 2AJYH 2DY2A 4LPUA 4WENB 3FO2A 4WY7L 1BZ8A 1NFIB 2DQIH 3VDBA 3O6KL 4WFFE 4G9DB 2OR8A 1HWHB 3H9YA 3HFML 3UADA 4LLDB 1TKWB 1BHGA 3OR7B 4JFEA 3SIKA 1R4XA 1MN4A 3FQXA 5EZIL 4P46D 1IIIA 1U8QB 3RJOA 3B8SA 3DV4A 2VN3A 3C08L 5KTEH 4X6EA 1JRHL 3DGGA 1J9SA 3MLTA 4WIQA 2FEEL 4XBMA 4WI0A 5A16A 4GG8B 1DO5A 4R7NB 2HT3C 4FXGC 5HVFB 3QHZH 3ARUA 2C7UA 4XE5B 5EPMB 4BDVB 4L3EA 1CXEA 4U1JA 5GGQL 1MCFA 4HFWA 3QCVL 3PP4L 1TETL 1PMYA 5FS5A 3OMZA 1TQVA 1DTUA 2J7LA 3L7FB 4IU2B 3DGGB 2WLMA 3OZLA 3B2XA 3A4AA 1DCLA 1XF4B 1S7XA 3GSWB 3CSYA 3PPEA 3WFCL 4ALAC 1BVNP 3W9EA 5KVDH 4BKLA 4NUMA 2C7UB 2QKIA 2YZ8A 3O4LB 5EBWA 1KIUB 4LCVA 1OD9A 4HU2A 1Y6KR 2X09A 4WWOA 4YGVB 1JCVA 3BSZA 3KR3H 2Y36L 1WO2A 5F96H 1A7OL 2FT7A 4R8WH 3BFOA 3BHBB 3V6OC 2WN3A 5CZVL 4O2FA 4BKLB 1CK0L 1OT1A 2A6DA 4MA3B 4EOWH 4YSAA 4PRNB 4PJHE 4HS6B 3FB6B 4B97A 3OKEA 4IU3A 5ENWB 1BMWA 2XCMC 3KEDA 5CSBA 2AEPL 4G7YH 5FM8A 1A4KA 1B0GA 4JRYD 2BCKA 3S5YA 4XRCB 4IDLA 3QDGB 4KY1L 4PW9A 5I19L 5IOKA 3R0MA 3DX9A 5TJWK 2AJUH 2ZSVA 5EN2A 2MQ3A 1NEUA 1FFOA 4DERA 2ZICA 5AQ0A 5AYUL 5DJYA 3WFEL 2HFEA 2P5PA 1F58L 3MOAH 3M17A 1SVCP 2HLFD 3VCLA 1A4KB 5ACMA 3E8VA 1G7HB 1XBRA 3KPNB 3T1FA 2PW2A 4A2EA 4CL7A 4FKKA 2J6EL 2IDSA 3I6KB 4W4OA 1AG6A 2DOCA 2PXYD 4LOVA 4NN7C 1KB9K 4LSQL 4U0QB 5DQJB 1S7RB 1E4XH 4L5FH 3VCLB 4DHLA 5E8EA 3HG5A 5FGCB 2NX5B 3GBML 3RLSA 4HG4K 5ESQB 2YK1L 4R0LA 4HWBH 3QISA 1E9QB 4LSSH 4WUKL 5F7EL 2GJZA 4P57B 4X5WA 2DN7A 2NW2A 4X4XB 2XWXA 3VFPB 5C08E 1EBAA 3QNYA 5EBLB 2P43B 4Z8FH 4K94H 4N1EA 4G6FB 3VXUE 5F7NC 4ODSL 2D0HA 4Z7QE 4QT5A 5IEHB 2AGJL 1Q38A 4R0LB 1IC7L 3MXWL 3VXRE 4Z7QF 5LAPA 5AVVB 1RZGA 4MCZA 5FX3A 2NW2B 3SKNA 2OXGB 3Q44A 5D2NC 1S7TB 2EIZB 2IDQA 3RUGB 1CURA 4PJ8B 1ZPUA 4UBDC 3NVQA 3QJFB 2Q76A 5FAAA 4G8EA 3KMDA 1S9XA 5CD5D 5DUPL 1SYSB 1BYPA 3ELAT 3KBEA 1EZVX 1EHKB 3UTTE 3IFNL 3GSNB 3KCWA 1CIUA 2I60L 2V9QA 1SN0A 2UZIL 5D4QA 2OXGA 3ZRCC 5GS1B 5C6PB 4WNJA 5JPMC 1LP9B 1UGKA 3IF1A 4PSRA 4XGZA 5BRPA 3ARRA 2E8YA 4FNQA 3DV4B 4X6CF 3UH8A 4U1LA 1Z3GH 3EGDA 2IBGA 2QKIC 3CZNA 3C6SB 3C5XA 1U42A 3KD4A 2DWEB 3MNWA 2VSCA 2X89A 4PGCB 4I18B 1DUZB 5FGRA 4PRHA 3EFFB 1Z9SB 3EOAA 2GCYA 4TNFA 5JIDA 1DVXA 3CC5A 2FSDA 2F54E 4FHKA 4GQPH 1SBSH 4JKWA 2R7EA 4XVOA 1E5UI 4HH8A 1JNLH 3CIQA 3FB5A 3VFVA 3T0DA 2W65B 1RUMH 3U1SH 1Z0NA 3O3EA 4GW1B 1HHHB 4HF5L 4QGTA 5AOZA 2JQAA 4GXVH 4LLYA 2R39A 4P23C 1I4FA 1J05A 4OZHB 1VZIA 4J3TA 4HDIB 3ZHKA 1P5UA 1WWBX 3O8XC 4L9LC 1K4CB 1MQ8A 1OT4A 3ARYA 3MV7D 4NWTL 1ROWA 5EFIB 5EOQH 3VYPA 3V4PB 5JR1L 2R56L 3FSOA 5AW2B 1KGXA 1YDPB 4AZ8B 2LAGB 4HS6A 1CFSB 2EDDA 4TUOB 3SBWA 2EUVA 1CK0H 3RKDD 1SM3L 3FSAA 1PJWA 1M1XA 4JK0D 4MHHG 4MA1C 4J3XA 3D85D 2BCKB 3IFPB 4YOKA 2AQSA 3MRHA 4MQSB 3V0DA 5TE6H 3NEEA 3IETB 3RWEA 4QO1B 4PAZA 2WIIB 1K5NA 3WN5B 1M1SA 4U1NB 5GJTL 2WKLA 2E9JA 4JVWA 3MRMB 4N90D 5CGMA 1SY6L 1NCUA 4R90L 3U6RA 1KLUB 4AQ8C 4UZUA 4M7JL 4Y16C 2V2XB 2OFQA 3NCCB 1WHOA 5I8OH 2YC1B 3QI9B 4DP2X 5DJCA 5CCHE 1Q72H 3ULAB 1G7IA 3WNOA 5TH2A 4I3SH 3PP3K 4S0TD 5JHDB 3QXDA 3NCEB 5C1MB 4X99A 3NRFA 1WS7A 4PS8A 2CRMA 4WFHE 1PZDA 4KKBD 5ESQA 4QRRE 5CEYB 1RZ8B 3QAZB 4TQPA 5F3HA 2YC1A 3FMGH 5JIPA 1IKFH 1BP3B 4U3XA 5IMLA 1RZFH 1X44A 4IJ3B 4P5TD 3FOLB 1GY2A 7PCYA 1KJ2A 1VEOA 4RGMB 1I9JL 4JR9H 3VM7A 2XIDA 1EK3A 4QYOB 5FYJU 3UACA 2HH0H 3S5LG 4RFOL 4ZFFA 4AJWA 2VJXA 4Y16D 1Q8MA 1DBBL 2RALA 4YHLH 4NLHA 1IBHA 3TJEH 3IDXH 2Z1KA 3LKPA 5KVMC 1NBZA 5IB2B 4GW5A 3RL2B 4FFYL 3NSJA 1CJYA 5JXAL 2HLFC 3I2CH 1LWHA 1RL1A 2V7HB 5E6ID 4WW1B 4YNYB 1T2JA 2P8MB 1JAEA 1KOAA 5E2WH 5EU5A 1MUJB 4NKMA 1KLFA 5DD5H 2H45A 4LKXB 4WWKD 1R3LB 4YPGB 1CGUA 5E4AA 1NEZB 4M5YH 2JIXA 1GVIA 2ZUYA 3KPSB 3SO3C 2A4ZA 3OG6B 2HLAB 2OR9L 3CZGA 3VG9C 4AY0A 4HC1L 3ULUF 2OK0H 3UO8B 4MMXC 2XA3A 2Z9TA 1QPXA 4ZQTA 3LRKA 5L9DH 4H8WL 3C6SA 4HT1H 3R19A 1C16A 3GSVB 4FQ1H 2FJFA 3IU4L 1MNNA 4QRPB 4I18A 1NEZA 2AJSH 2QVIA 3UEZA 1GYWA 5INCB 5CR1A 3HC3H 2QHRL 1A9EA 4PB9L 4TLTA 5MENE 3F3HA 5GGRY 2OM5A 1U8PA 4QHLA 4X5XB 4U4IA 2ZOTA 2TRHA 1BQLL 4NZ8A 3A47A 4GG6F 5CGYD 5SWZA 3OHMB 2PYFB 2I07A 4JKKA 4RMSA 4ZUWA 3RJQB 3TBTA 3OHXC 2B1HL 1KCVH