4YSUA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 25.0 mgy
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 97
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysuA00
1SHWA 4DP2X 3X2QB 1AIZA 2DWSA 1IKOP 1PCSA 1AS6A 2CAKA 3BQVA 4CSZA 2Y69B 5I6NA 2VW6A 1X9UA 1NWOA 3FSWA 1BYOA 4DPAX 1PLBA 4HHWA 5I5JA 4Q8BA 4YVUA 1M56B 2BW4A 4E9RA 3SQRA 3DKHA 3PLYA 3RYMA 4NB7A 3HB3B 2EIMB 4AKQA 1J9RA 4M3HA 1KBVA 1TKWA 2FT7A 2WO3B 2BO0A 2FQGA 3QJUB 1VLXA 3T6XA 3CVDA 1PNCA 1JZHA 4BWUA 1KYAA 4G70B 2PPEA 1IBZA 4YSQA 2BP0A 3ABMB 2AZAA 3QJVB 2IDQA 4F2EA 1GY1A 2B3IA 1A8ZA 4GXFA 1AZRA 1ZIAA 3FQ1A 3WNJA 3PAVA 3FQYA 3CZUB 2FQDA 1E30A 1RKRA 4FAAB 2DYRB 4X4KA 5I6KA 1MZYA 2XX1A 4L0PB 4W1TA 2YAOA 1A4CA 3DIVA 3H4FA 2PP8A 5PAZA 3QPKA 2VW7A 1ADWA 1NTDA 4NAJA 3FQ2A 1OF0A 3FU7B 1JOIA 5E9NA 3KW8A 3WNIA 3TASA 1WA0X 3PAUA 4QKTA 1WA1X 3TBCA 4KOBA 4EF3A 1MDAA 4KNTA 2J56A 3X1NA 5F7BA 2OJ1A 2WO2B 3T71A 3EH5B 1PF3A 2FQEA 1AZNA 3ASNB 3FPYA 2HLEB 1EHKB 3NJMA 4DP8X 4KNUA 3FU7A 2HRHA 2IWKA 4MFHA 2RACA 3L45A 3OMAB 2ZOOA 1KGYE 3QJRB 3X1EA 3H56A 1NIFA 1PZAA 1UATA 1CURA 4HZ1A 2H47C 1WS7A 5B1KA 4DP1X 2PLTA 2YAPA 4BXVA 1RZPA 4AI7A 2BHFA 2YAMA 3FSVA 4PAZA 3ABGA 3NSDA 2BP8B 4KO9A 3PXLA 2IDFA 1TEGA 1NINA 2OV0A 3T6VA 4YSRA 1L9QA 2YQBA 2XUWA 1SDDA 1YLBB 3IEAA 4KOCA 2Q9OA 1X9RA 5B7EA 4YSUA 4BWTA 2AANA 3S3DB 5I5IA 4DPCX 4FA7B 2UX7A 1KDJA 4F7KA 4A2DA 4HIPA 4DP7X 3UABA 4DP6X 2HRGA 1ASQA 4KO5A 4G7SB 3AY2A 1SF5A 3IN2A 1BQRA 1A65A 1PY0A 1AANA 1PLCA 4W9ZA 2QPEB 1NZRA 4N4YB 2XWZA 1AS8A 1EZLA 1JVLA 5B7MA 4YSPA 3NP4A 1B3IA 1CYWA 2XLLA 1NIEA 2R7EB 2J55A 4G7RB 2IDSA 2YXWA 3S8GB 2XX0A 2XV0A 5ANHA 3T6WA 2P80D 4AZUA 4DP9X 4WTQA 4A2FA 3NYKA 4BDVA 3IE9A 1RCYA 1AZCA 3QJSB 3N55A 2PPFA 5D4HA 2BZ7A 2IH8A 3UACA 3GYRA 1W6WA 3PCYA 3NSYA 5B1JA 4E9QA 1SFHA 1BEXA 3PAZA 3X1GA 1E65A 1L9TA 2PP9A 2WSDA 3OMIB 2YAQA 4AKOA 1JZEA 1NPNA 3X1FA 1N68A 1PLAA 1AG0A 2DV6A 1V54B 1L9PA 1IUZA 2AVFA 7PCYA 4K9JA 1GS6X 1SFDA 2DWTA 2UXGA 1BQ5A 4GY4A 1MG2C 8PAZA 4DP4X 2P80A 2UXFA 1GS7A 1QHQA 4KO6A 1NICA 5I28A 1GY2A 1AQ8A 1ILUA 4ENZA 1XB8A 2IAAC 1ETJA 3NJIA 1N70A 4PCYA 3MBWB 4GP8B 3ZDWA 3IBOA 2H3XC 3FPXA 3BVDB 1ET5A 1AS7A 4UANA 3JT2A 1RZQA 1ZPUA 5TK2A 3EH4B 4KO7A 3AG1B 1HAUA 1GW0A 2VM4A 2XXFA 3CDZB 2XVBA 2ZXWB 1GSKA 1KV7A 4YVNA 1OE2A 1AOZA 3UAEA 1DZ0A 1NPJA 2XU9A 3UAAA 1CUOA 1JXFA 2JFCA 2CJ3A 5I6MA 1JZFA 2QPDB 1E5YA 2XV3A 3S8FB 2PPCA 1GR7A 1OCCB 2FQFA 2ZONA 1SF3A 1T5KA 3NJJA 1JZJA 2QT6A 4G71B 6PCYA 4HHGA 4ZK8A 3TU6A 1XB6A 1JXDA 3NJNA 1BXVA 3UADA 4Q89A 5I26A 2AZUA 1ZDQA 4DP5X 3MX0B 2PPAA 1NIAA 2FWLB 3NJKA 2OCCB 1V10A 3NSCA 1IC0A 1KBWA 1PZBA 3AG2B 4YSTA 5I6PA 4A2EA 4G72B 1AG6A 3GXUB 1ILSA 5I6OA 2YAFA 2I7SA 3S3BB 2VMJA 3UGEA 3H4HA 1HFUA 1A3ZA 1V55B 1J5CA 4BWWA 4YSCA 2CBPA 3AG3B 1OCZB 1M9WA 2JXMA 2W88A 1A4BA 1E67A 2BP8A 3AW5A 2MTAA 4YL4A 4HCFA 3FT0A 2EILB 3N2JA 5IY5B 3CVBA 3WG7B 1ID2A 3TBBA 3ZBMA 4CSPA 2AFNA 3ABKB 1BXAA 4RH4A 4AKPA 3G5WA 1L9RA 5A7EA 5B1AB 1NIDA 2CUAA 1NDTA 4A66A 2B08A 3SBQA 2VSKB 1J9QA 2J5WA 2J57A 3FSZA 1FA4A 2GBAA 2YAEA 3QQXA 2ZWNA 2VW4A 1W8EA 1AAJA 2XYBA 3NT0A 4TXVB 1GS8A 1W6LA 1FWXA 2GC7C 2BZCA 2UX6A 1WA2X 1KCBA 1SNRA 4E9TA 2VN3A 2DYSB 4GP4B 1IBYA 3CVCA 3AZUA 3NJLA 5AZUA 3WI9A 3DTUB 4G7QB 3EH3B 2R7EA 2H5UA 1CYXA 4JHUA 2BWIA 1AACA 1J9TA 3WKPA 1J5DA 2QDVA 4E9SA 5I5MA 2GHZA 1ASPA 1L9OA 4WKXA 3ABLB 5AKRA 1OCOB 1WS8A 1E5ZA 5EHFA 4HCGA 2GC4C 5B1BB 3SBRA 2PP7A 2YARA 1OCRB 1URIA 3OQRA 2GI0A 2BP0B 3HEIB 1HAWA 1ZIBA 4HALA 2GSMB 1BYPA 2HX7A 2IDTA 5TK4A 2IH9A 1CC3A 3ERXA 3NSFA 4P5RA 2TSBA 1ZDSA 4YSOA 3QJTB 4E9WA 3FYIB 2I85A 1ET7A 5FC9A 3KW7A 3IN0A 2FT8A 2EIJB 2NRDA 3TA4D 3FU8A 2JKWA 2IDUA 5I6LA 4HAKA 3ZIYA 2HX9A 1XMEB 2YAHA 4BXSV 1FFTB 2HZHA 4M4RB 3C75A 4DPBX 1OE3A 5B1JC 2DY2A 1M57B 4GYBA 2FNWA 3GDCA 4JKNA 3QJQB 1QNIA 1OE1A 1BAWA 4F2FA 2XV2A 3T6ZA 1PMYA 1R1CA 4YSDA 2PCFA 1JVOA 1AR1B 1KDIA 5F7AA 4GP5B 1PNDA 2GIMA 1OOWA 4BK5C 3PPSA 3X1BA 5B3SB 4QLWA 1QLEB 1XB3A 3AG4B 4DP0X 1TU2A 2X88A 5PCYA 2LLNA 4P5SA 2IWFA 2MRYA 3NJFA 1NIBA 3V9EA 3JTBA 1PZCA 3EHBB 1JXGA 2FT6A 1BXUA 1DYZA 2X87A 4YSAA 5B7FA 1JZGA 3CDZA 4JHVA 2EIKB 4A2GA 2VM3A 3FSAA 3NJHA 4A2HA 2BW5A 2Q5BA 1OV8A 1A4AA 3NP3A 1ET8A 3OD3A 2CCWA 2E86A 4E9XA 4AX3A 3S3CB 2UXTA 4UF7C 1GYCA 1AZBA 1AZUA 1MZZA 4YSEA 1SDDB 2CALA 1F56A 2YXVA 2FJSA 7PAZA 1WAEA 2XXGA 3FU9A 4A67A 1TEFA 2FTAA 4YSSA 4A68A 1SJMA 2A3TA 1NWPA 3D12B 3FYEB 4UAHA 3SBPA 1JZIA 2IWEA 2N0MA 3ZX1A 3U25A 2W8CA 4E9VA 1PAZA 3CG8A 2Y1AA 4KNSA 2PCYA 2QDWA 1SHXA 3WKQA 2GB2A 3FS9A 1L9SA 3V9CA 1I53A 3NJGA 6PAZA 1BQKA 5D4IA 1KCWA 9PCYA 2TSAA 2EINB 3WIAA 1JERA 3OMNB 2VSMB 2PPDA 1MG3C 4E9YA 4NERA 5AFAA 5D4JA 5LDUA 1ZV2A 1J9SA 4HCIA 2I7OA 2UXVA 4BDVB 2HX8A 3OM3B 3ASOB 3T9WA 4N8UA 1ASOA 2BWDA 2HXAA 3EF4A
chains in the Genus database with same CATH superfamily
5AB1A 1BW8A 1SHWA 3W11C 1YAIA 4PJCA 1B4RA 1NC4D 2ZUQC 3UXFA 1PCSA 5GS3A 1S9XB 2CAKA 3L7FB 1RD6A 1LQSR 4MXWL 3U30C 3ZXAC 1UA3A 3DX7A 4Q8BA 4UQEA 3WE1A 1NDGB 1KTLB 1KN4H 3DBXA 3H3PL 4RNRA 4X8CA 3PLYA 4L9LB 5FM5M 3EGSB 3WIHA 4XCEA 5T5FH 2LU4A 3N9GL 3Q3GA 2KDYA 4HAGA 4PS4H 4ZXBB 3QIWA 2Q8AH 5I2IA 2DKMA 1NUNB 3O6FC 2Y6SD 2XPGA 2BNRA 3JWDL 2ICWA 2CRMA 4HUKB 4LCCB 5CJOH 5MENB 5CZXC 1Y18A 2G9HA 4Y5VB 1D6VL 5AOKA 5JQ6H 1YNLL 1B88A 4JCWA 3NCYS 2YGOA 1L6PA 4ONHB 1H5BC 1WIPA 4J5VA 1V05A 3LKPA 3QNFA 1BFSA 1Z6JT 1ZCRA 4DH2A 1HOEA 4MA8L 5DK3A 2DYRB 3CHXA 4W6XB 2AJZA 2NY0C 3QQ3A 1NTDA 1U92A 3ZGIA 3PHQA 1BFTA 4JDTH 2R23B 3UG4A 1VGKB 1SJEB 2P8LB 2VXQH 4LIQH 4E41E 3PHOA 5DZNA 1BD2A 1QD0A 1TXKA 4G80A 5HYEA 4LHUD 3C6SA 4KRLB 1U95B 4AZ8A 3HNSH 4ENED 2QELA 4PUBH 4FTVD 1XQ4A 2Y7OA 5I6XB 3ARED 5HPMA 3M8OH 2V2WA 3UTSE 3SODB 3N3EA 4PJBA 4CNIB 3NQIA 4JO2H 1PZ3A 3LRLA 3NJMA 5KVGL 3MA9L 3CSYA 3FU7A 1UFUA 1A6UL 3ZDZF 3EUDA 5GGVL 3LZPA 4ACPA 4W9GC 2RACA 5INCB 4WDIB 1L9NA 3O9WD 2AEIT 2ZOOA 4O02B 4DO5A 2YGQA 3WIIL 3H56A 1L5GA 3FZUD 2X2HA 3VRIA 4AL8L 4N9OB 4DP1X 4JFUA 2C9UA 4OB5H 1FYTE 5L4MA 3LN9A 1N64L 4RIRA 2F61A 3SDCB 2VH5H 2FGWL 3FSVA 1OGAB 1WWAX 4NM4L 3V0WL 4F7CA 3QYMA 2EKJA 3TO4C 3MRKB 1KCRL 3PXLA 3GMRA 4FQJL 4KQ3H 3T6VA 5IKCA 1UXSA 5I1AA 1L9QA 2DEXX 3GSRA 3CH8A 1SYSB 1DVXA 2JQMA 4U1GB 1F4XL 3RNKB 4WK2B 3HR5B 3SPCA 3NA4A 1GHFL 2HT2C 4OZHF 2AANA 1IGFH 2K9FB 1YEDA 3SN6N 1L0QA 1T1YB 4ZW3A 3LRSB 5FV1L 5BV7C 1XL6A 2Q87A 2QSCH 4NJAL 5KSVB 4PV9B 5HDBF 2AAAA 3BZEA 3AB0B 4NRYA 3VXSB 1JWSB 1B9ZA 1IV8A 3OZLA 2IALA 4HS6B 3U2SA 4R0LB 3CHSA 1BQRA 2QR0A 4M7LT 5KSBF 4X99B 2X89D 4G7VL 1A1OB 5EO9B 2Z3FA 5EZJB 1KIRA 5I1DB 3S4SB 2CNZA 2R7EB 5HBBA 5C0BB 5CSGA 5DO2D 1NKGA 3QCVH 3BP7B 2J1ZA 3BE1H 4YHOL 1R5WA 3VCLA 5T3ZE 3ABZA 5DI8A 2VXUL 3T6WA 4S1SL 1RMFL 3P1VA 4ZW7A 5BS0B 1VKXB 1M53A 3KPRD 4HS3B 5I17A 4P5KA 2OMYA 1HESA 4ALAC 3ILDA 1F8TH 1UUNA 2G5BA 3EG9A 1SLUA 3S0PA 4DZBB 3CBKB 4NUGL 3OLIA 3CSFA 3DO7A 3OQ3B 3MZGB 1KLFA 2W91A 1ODUA 3NSJA 5F71A 4C83A 5JHDB 2BVQB 2YRZA 3PWNB 4R26H 3EO9L 4L5FH 5AW8B 4JM2A 4MSWA 4P23C 4L4VB 1HC1A 2GJZA 1E6OL 4QRUA 4ZMZA 5FYKD 5IIEA 4NQEE 3TYGH 1XT5A 3V6OE 3G08B 4PS3A 4MS6A 1A9EA 3KLAA 7PCYA 2GCYA 2PW2B 5BRZB 1ZJBA 4P3DA 5I76B 3B6SA 5EA0H 5L4FA 3WL9A 1A7PH 2IH3A 1GY2A 4K7PY 1HT6A 3NFPA 2KT6A 1CD1A 3O2VL 1IE5A 3RB7A 3MNVB 2LHAA 3L9YA 3WFCH 4ILDA 3CLFL 4I0PD 2J1XA 2H3XC 2K1MA 2MPAL 3FPXA 4PQXA 3RVWD 4URTB 1JZ4A 5EU4B 1X7QB 1ZK5A 1LO2H 1XF5B 2FLRT 1VDGA 3GSOA 1AHWB 1YJDH 4I2XE 3GMLA 4R4ND 1GW0A 1R3HB 4QEGA 4LSTL 3SQOH 3EJZC 2A1WL 4O51A 3D52A 3IKCA 1QRNE 4UQ3B 3AC0A 2A99A 5L2JA 5I6MA 1T1WB 1HILA 3B2XA 3V8CA 2UY7A 4AENB 5I66B 2I07B 3SB3A 6FABH 3WY4A 4UT6A 5EIIB 2XBZA 1WZ1H 3N42B 4L05A 4JVUA 4HIHB 1INEH 3IGAB 3VWKD 3FO9B 4ZK8A 4XMLL 1JV2A 4X5XB 4ETYA 4M7ZB 1J5HA 3BZ5A 2X3CA 5E2UL 2B4CL 4JJOA 4XGZB 1SUHA 5E4EC 1X5LA 4C58B 2GPZA 2NDGA 3QAZB 5L2KA 5E1AB 3SKJH 3P0YH 5IESL 3NJKA 4LCVA 4Y5YA 5CN1A 3C09C 3P2DA 2XTJC 4KRPB 1II4E 4M6NL 5I6PA 4LSSL 5F88B 4CBZA 1CDBA 1NGPL 1IGJA 2DQMA 3DMMA 3NJXA 5J13C 5GXBB 1FO0B 2JB5H 4BQ9A 4J8QA 2DRUA 1FYHB 4NO5B 3OAYH 4YSCA 4N9GA 1FZKB 1MJJA 4FFVC 3LN5B 3EH2A 3TO2A 1RAMA 4GRLD 4NOBA 5EFIA 5EEUA 2VWEC 4NP4H 5G4OA 3K2MC 2P5EB 1WUZA 1PZ2A 2WINB 4E42B 2XJKA 4Z9KB 4R7NB 1XFPA 1XHHA 1ZHLB 2D3LA 1T7VA 1NOAA 5EBWB 4Z7OB 5ENWB 5F7FA 5SWZD 3BRGC 4PJIF 2C9RA 4MNHB 2X5PA 5AKSA 2ZG1A 4JRYA 3F62A 1QG3A 1X5XA 2IADB 4PD4K 3LIZL 1JK9B 1S9YB 2BX5A 1OTUC 2EVFA 3ILPA 5HGHA 3Q6FA 2DYPB 1I9IH 3L3OC 2VLRA 2NCMA 2EQDA 1F2XK 1UVQB 2IF7A 1UD8A 3P4MB 4PWFA 1FCGA 3FO1B 5DQ9A 2FX8H 3MAWA 3UPAA 1NJ9B 4FI8A 1J0IA 2VKWA 2MCAA 2DJSA 3QUMB 1OAKL 3ARFC 1P4IL 3GSNH 2UUDH 4GP4B 3BSZL 1T03H 3VFGL 5ACMA 4YJZL 1N12A 3VTAA 3NJLA 4HC1H 3NFNB 1IB5A 4JK0D 5K39B 3E6HB 5KYWA 1OAUH 3ARBA 3OHMB 5A2IH 2WLZA 2XOTA 4JHWL 2Q2LA 3WHE1 2WNKA 4MJID 4PP1C 2VR9A 3G3LA 3I9GH 1L9OA 3KGSA 5SX5K 4UTAL 4Z77B 5EHFA 4S10A 3SBRA 4P9ML 4HCRL 5FWRA 1WITA 3DX8A 3D33A 3UBXG 2GY5A 3T8XA 4PS7A 3U0TB 2GSMB 2JCCE 1NM4A 2EDEA 4XNQA 1I7ZB 5TK4A 3WDIA 4AYBA 5EN2A 5C0NC 5DVKA 5BNXD 1MRDH 2YBGA 3N1MC 2HVJA 2YHGA 3BH4A 2D0HA 4Z3EA 1T2XA 3TTSA 1FL3B 5EIVA 4MVBC 1MNUH 4R84A 3DUSA 4KWUA 4CC1A 4NWTL 1JMZA 5A7BA 4E5XA 2LU3A 1CF8L 3KPQA 4GKNA 1SYVB 4WUKH 3HG1B 5C2BL 4FHKA 1ZLVK 3SKMB 4TSAL 3RDTD 2H3KA 2ZXEB 32C2A 1AGFB 2VQTA 4IOIA 5E6RB 2BNQE 4JO5A 1FNHA 2OMWA 3NCBB 2XTJE 3NZHL 4GRMB 4Q58C 1IRAY 5DUPH 4ZFOL 3HR6A 1YEIL 1WAPA 3KYKH 2XXCB 4G6KL 2OFQA 1PNDA 4P2OA 4P2QA 4UV4L 5T3ZH 1IAKA 3V0AC 3V6ZB 1B3JA 3W9EA 4RA0C 4AOFA 3ZL4H 4QLWA 1MI5D 1RXLA 1URZA 2J71A 4RX4A 1ORQB 4N2CA 1X9LA 3BAEH 4HKBB 5EUOB 5K9OB 1U6AH 2Y24A 4O2EB 4GG8A 4L1SA 2MRYA 3VA6A 4P9HL 1OP9A 5F96L 5FO9B 5DMYA 2J8UF 4KK8D 3JTBA 4QJ3B 2AK1H 2I24N 5ICXB 3S36H 5DHDA 3VG9C 1AQKL 1JXGA 5F2FA 4CU7A 4HWBH 4MX7B 4UMGA 3D2UA 1JZGA 3CDZA 1BIIB 1XO8A 4P46C 5ESQA 5MEOA 3KGTA 4O02L 1A2YB 3TJHD 5DJXB 4ZFQA 3KBPA 1A4AA 5C09D 1A7RH 1SOSA 4CSTA 5CWSA 3OD3A 1XGUA 4HGWB 3TA3D 1MCEA 1YC8A 1N4XL 2EKSA 4LRIA 4WWPA 1AXSA 2AQNA 4MQXC 4J2QA 4HLZH 3ZR5A 1I3RB 5LBGA 5GS2D 3H54A 3QP3A 1IGMH 3D39E 1PX8A 1SDDB 1KACB 4NENB 5E8OA 1ZK9A 1UACL 3ZY7A 2WGNB 1OANA 4A67A 4OKVA 3US1A 5IP4A 1RULH 4LCWB 5GHWH 4A68A 5GGQH 4UAHA 4WWNA 3FC8A 1DVUA 2A5UA 5FOBB 4TULL 3IS1X 2HVKA 4A63A 5FECB 3U25A 4AG4H 3ARDB 1DQMH 2ADYA 3Q6GL 3RFZB 1SHXA 4U7MA 4XMPL 2CXKA 1S78D 2FBJL 1FGNL 5C07B 5D4IA 2WYHA 3Q8CA 5GISL 5KBPA 4P3CL 5AVQB 4YPJA 3QR1A 4IRSC 1UT1A 2ERJC 5KSAD 3VW3L 4EUPA 2VSCA 1NBQA 4DKFH 4JFYB 5DRNB 2H9GA 4J3WA 5AFAA 5BV7H 1DE4A 1CT8B 2C7UB 1F00I 4NOFA 5E9DD 5K59E 1FSKC 1ZSDB 2K8MA 1K85A 5GJSH 2NXYD 3QWOA 1NSNH 5CGYC 1TZIA 1PZ5B 1OGTA 1E6JH 5AVWB 2D03H 4KFMA 3TCXA 1TQCB 4P99A 3NIDF 3DI2B 4K3EL 4PJEF 1UOKA 2O6EA 2RA1A 1CYGA 4NXKA 1QLRB 4AJVA 1G87A 1HHJA 4Y2NA 5MP6H 5JOFA 4MA3A 3GHBH 1BEYH 4DUWA 3Q3GB 5JHBA 4GEJA 3GMOA 3Q44A 2XN9A 1MAKA 5I2IB 2XZZA 4GI8A 2DMCA 4WVRA 1MFAL 4WY7H 1C5CH 2JJTC 1S6NA 2E4FA 2W07B 1TMCB 2WBJC 4YVUA 4MJ6A 2VIRB 1U93A 5DZPA 4YUEH 3FFCB 1I1AA 4H2AA 2EIZB 1JNNL 4G8GD 2KYIA 4JRWA 4ALAH 1J9RA 3BQUD 4N86A 3O0RH 4BCXA 4RWYL 1CXEA 2WVVA 1YECL 3ZE0F 3U9PL 2OSWA 2BVEA 1T6BX 2AJZB 4LAQL 2ITCB 1G43A 4LPTA 2APBA 2V6HA 1DO6A 1X5HA 3WY2A 1XZWA 1W80A 2J21A 1UOVA 3PHOB 1BD2B 1R24A 2ID5A 4JG0H 3U1SL 4DCQB 2ZUUA 4BH7B 3PAVA 5E08L 2GTWA 2PTTB 2Z31B 3PQYE 4IU3A 2WNXA 1A4JB 2PMZA 2YD9A 3O3BA 4L37B 4S2SB 2MQCA 5I1KL 2NR6C 3BLBA 4MTMA 4L1HA 3VMOA 3FHAA 1YEEL 4ZSOE 5IF0A 3JVFC 5GSRB 2J25A 3CSYB 3FU7B 4MD4B 4X4YA 4BZ2A 1KGXA 1FH2A 4PN6A 3WNIA 5L8KB 4KMTL 1K2DA 4QTHB 3TBCA 4KOBA 4X6DE 3AMLA 2CUIA 2MH4A 4GW5A 1NCCH 3CN0A 2ZX5A 4F93B 4NHUB 1TDQA 2Y5TA 2WQRA 3AXIA 3CSTA 4Y5XC 3H7LA 4OR1A 1Q72L 4HG4K 1FFRA 1YEKL 1IZKA 1H3VA 2X0UA 1IQDA 2G4EA 5ANMB 3OWEA 5E7BA 3WSQH 4I1RA 1M7DB 3V52L 5IBLC 2X2IA 2Y4SA 3DRTA 4MFHA 5IKCB 2WYZA 2IOOA 1IVLA 2XCMC 2HKFH 3PUCA 1BCIA 4H20L 3HS0B 4ODTH 4OU3A 1RV6X 4R96A 1NIFA 1BG9A 2QHLA 3RX8A 4I5BA 3BAKA 4KK6D 2ZUTA 4BD4A 3SDDD 2NT1A 4BQ6A 1FO0L 3FT3B 1JGIA 3H1ZA 1QABA 5E4OA 2FR4B 1IEBB 4B3EA 4TQEL 5GJTH 2RR3A 2WKGA 1N5AA 5I82A 3KWUA 1KWGA 2XG4B 2YQBA 3CC1A 4U6YB 3POHA 1LO5A 1YMMB 2QR0B 1MAML 5JORB 4X5QA 4G59C 3MLYH 4IDJH 3WS6C 5HI5C 1ZGLB 1W0VA 2ZP0T 1FN4A 4PJHF 5F7KC 2AQ3A 4FULA 3S5LA 2BRRH 3MRIA 5DVLA 4HUUA 3WENA 1OPGL 2XG5B 1B4TA 1NGZA 3O3AB 3RWJB 1IAOA 3QXVA 2EYRB 3CMGA 3D30A 3FRPB 3GJFH 3TBWA 1DANU 4HIPA 4GW4A 2OMXA 4AYEC 1QZ1A 3C08H 4NX0A 4ZUSA 4MJ4A 5IG7A 1IFGA 5I17B 4W9ZA 4A55A 3HVNA 2YA2A 3VI4B 5KS9A 3NIGF 3IDMA 1E4XI 3QUML 1M42A 3X13A 4F5CE 4HA1A 5J11C 3LQMA 2IDSA 4CDHA 1KLFB 4HUNB 1CLOL 5D5MA 4UZSA 3K2UL 4F8QA 4TKWA 3LV3B 4A2FA 4QRUB 1Z5LB 3P4OB 1USZA 5CKAA 2APXA 1QOKA 2ZP9A 1L7TL 4QOKD 3U7WL 5D4HA 3MLTA 2GCYB 1U8NA 2CU9A 1GL4B 3QR0A 5FLUA 5JIQA 3L4ZA 4WFFD 4QHUA 3DX2A 4MAUH 5DVMA 1L9TA 2O61A 4GO8A 1F86A 2YAQA 2ZOKB 5D1ZC 5D1ZI 3CSGA 3U7YL 4TLUA 3GSWB 3WOVA 5ABZA 1K8DB 2W38A 1XF1A 3O2DL 1IEAA 4OAWB 3HZ3A 2R0WH 3AWFA 4MGXA 2EZ0D 2A74B 2DWTA 2IIJA 1S3KH 4G8EB 5BPPA 4S1QH 4JKPH 1KNOA 4O9HH 1R3LB 4YAQB 3MUJA 4IRJC 1R3KB 4P57A 3C8KB 2WJ5A 4UZUA 1LLAA 3WFDL 4L8BA 4QTIL 1LEIA 4XP5L 1N70A 3T0EB 3WIFA 5DRWA 3B9AA 5DJZA 3VXUD 4KRMB 4J3OH 3K8LA 1UHVA 2BCMA 4XXWA 5IVOA 2JELH 4TYUA 1IX2A 4W68A 3V95A 2G60H 3TVMD 3WD5L 3LQZA 4TV3A 3RWDB 3S3SA 2GEEA 2VXSL 4Z7VF 1HL8A 3NCCB 3VE0A 1GSKA 3VA2C 1F5WA 4MMXC 5IROC 4LLQB 3D3VD 4JFXA 4ATWA 1FPTH 4V1DD 3N6YA 5A2FA 3WUZA 4TM9A 1NPJA 3H9SD 3ARGC 3UAAA 3C8DA 4ZOCA 3HAEB 4AGOA 4XVSL 4Z0BH 1LEKB 3WNOA 4AQEA 2FQFA 3CMOH 1IGJB 3DMMB 4OFDA 4MS8C 1A6AB 4UINL 5DC2A 2B0SH 4GAJH 1P2CA 2ZYRA 3T2NH 1DQQB 1K4CA 1XB6A 3VFRA 3QH3A 5C71A 4Q9QH 3LEVL 1MJJB 3NJNA 3PWUA 3WO4C 1PX3A 4Z8FH 4DP5X 2ZKHH 3ZTJH 3GDBA 3WKML 2DTSA 2K4WA 2CLZB 5IK3B 1AR1C 4KXBA 1PZBA 2EO1A 1TQBB 2AMUA 3IU4L 1BP3B 4FLOA 2X4NB 2CKBA 2J2ZA 3D0AA 1VCAA 2DH3A 2ZXQA 1UA6L 3QWRA 4OZIE 1SY6L 3MV8D 3N41F 4EN3B 5C8JB 3BP5A 2E6PA 1NC2B 3DX4A 3ILPB 3LHAA 3Q6FB 2VLRB 4Y4FA 1XZ0B 1WAAA 3O4LB 1SHSA 4X0KA 2VOTA 1QFWH 2R8SL 2CG9X 4GAYB 1FBIL 4M48H 2UZIL 1G6VK 4NQDD 3RWFB 5H94B 1ZVSA 2KI6A 2N7SA 1ID2A 3OR6A 4NUJB 4YFDB 4L3ED 2BVPB 4KROD 2BC4A 1A64A 3QDGD 1WICA 3BKYH 2LU5A 1CFTA 2IGTA 4UTBH 4QYOA 3UROR 2W59A 1KGCD 3FFOA 4GQRA 5EO0A 1AD0A 3RIAF 1V7NL 1T3FA 4D9QE 2NY1B 5FA3B 3WIHL 2X44D 1RUPH 1U3HA 3P9LA 3DX8B 4HBCH 5SX5H 3ATBA 1H0DB 1IFRA 2VQ1A 4JRFA 3L3HA 3P3SA 1DBML 3LPOA 4HXAH 1QTPA 1A4KB 4FXLA 1KJVA 4OV6F 1FFPB 2ICEA 1AKJA 1D2PA 1M3IA 3LHPL 4G7QB 1J8RA 4UAOB 1A6PA 3GKZA 4HMCA 4ODVH 3VI3B 5E1IA 2BWIA 1AACA 3FAXA 3DUSB 2XNAB 3LPPA 3F8UB 3LXBA 3LZQA 3TPUA 5AKRA 2HVBA 3MKKA 3OKOA 4AM0A 5I18L 4GXUM 2YARA 1YY8B 5IEHB 4K55A 2NTFB 1HOCB 1BM3H 2HX7A 2ZSVA 1IC1A 32C2B 3MODL 4WW1B 5HGDA 1ZLVH 4EVNA 4HMEA 2IH9A 4OF0A 4LSRH 2R0LH 3HMXA 2TSBA 5IOPA 2SEBA 1KBGL 4YSOA 3T3PE 4UQDA 2AJSH 2BSRA 4JY4B 5DFVC 2PXYB 3C60D 1UQSB 2EIJB 5E99H 4Y16B 2DLEA 3HMWH 4M5ZL 3ETBJ 2EDOA 2DLHA 1XMEB 5D1XA 2EC9T 1G1OA 2ESVE 2KMWA 4ZUTA 2HZHA 2VDOL 4DPBX 5JOEA 1RP9A 3MVSA 1SGKA 3FB8B 2R4RL 4RFEB 2P9RA 1KXTA 4DFIA 1DBAH 2H1PL 2WQXA 3QIBD 1Q9WB 1RJLB 2NQDA 3D2UB 3FO2B 2WGXA 1JVOA 3KLKA 5IT2H 5EU3A 5FGSA 4MHHI 4X9IA 2FX9H 2H0FA 1RUMH 2QQNH 3HHSA 3JTTB 4LCYA 4JQXC 5D7LE 1Z9SB 3OGCA 3S36X 4UT7H 1XGUB 2NT0A 5I0WA 1P4UA 4W9CC 3ZDYE 3FCGA 1I7TB 4ZRGA 2YWYA 4RETB 3S37L 1PZCA 4ELKA 3ULVD 3N50A 4M5TA 1TJGH 2NY4C 5K33A 3SPVA 1S9KC 4YHML 1CBVL 3L3DA 4QRQA 5T3XL 1UB5B 1MNNA 2Z8VC 4PTTB 5CLYA 4GQ9L 2AQSA 3CC5A 2NW3B 4JFDB 4QYAA 3LNIA 3RI5F 2X6VA 3GKWL 3ZRCC 4YFEA 5IVXA 2BW5A 3MTRA 5JXEA 1OV8A 4OGZA 1Z0NA 4K5NA 3AGWA 1G7JA 4C57C 1FZJA 4ZTPL 4FXGA 2X10A 4E9XA 1CLCA 2CRIA 4P0DA 1CGSL 1TMQA 3OKYA 3HNVL 3QI9A 4OFYD 2UZPA 1FHGA 2DTMH 1G7IB 2K70A 5D7SH 1MZZA 5F1SA 3DX9B 2V3FA 3PP4L 1IC7H 2N3JA 1XGYL 4L8SC 1TNMA 1YUHA 4K71B 3I84A 3U6RA 1RUAH 4EUPB 4WW2A 2H9GB 4J2XA 2CLVA 2H4EA 3LKQB 5KAQF 3MJWA 4TUKL 2EIDA 5JUEL 2DWYA 1UM6L 1DVQA 2JKRM 1NBZB 2HLAA 2G30A 2V17L 3I6SA 3K1DA 4NKQB 1HHKA 3GHPA 5F7DA 1SJHA 3QG6A 4U3XA 1I9JH 4X7TA 3ZO0A 1QSFD 3MOBH 3O11B 5JPNB 4R9HA 2A9ML 1GC1L 1NAMA 2OTUA 1AGCA 2XN9B 3WJJC 3M1BA 4N25A 3BVNB 2KZ1B 1ACXA 1ETZB 3I2CL 1UJTA 3RIFF 3T9WA 1MCCA 3WU1A 3AJ7A 3QIWD 1A14H 3DETC 1ASOA 4M43L 4WO4A 2VRQA 4A7GF 3FSOA 1XSKA 2HXAA 3WN5B 2BNRD 4LSPH 1KB5A 5AW2B 3RX9A 4BFOA 1YN6B 4M9OA 3VG0L 2NY6D 2QADC 4XWOD 1E4XH 3SPJA 5ID1B 2X1QA 3PWVA 4N0UA 2P26A 1KYOK 1L6ZA 1AFVL 3WHXB 4WQOA 4IJ3B 1X9UA 2Z8SA 3N43B 4ODHH 2E59A 4PRAB 1MLBA 4F7PA 4N1EA 2WZPA 4X6EA 3OJDA 2FO4A 1BZDA 1IARB 1Z3GL 4WFHD 5EOCL 3MOAH 3S48A 5BO1H 4OBSA 3VQ1C 4NB7A 2IH1A 2MKLC 4WNSA 4O4YH 1IM3B 3ZSTA 2FQGA 4K7FB 4ZUWA 4QCIA 2W0KA 1VCBC 1OAXL 2IV9A 3OC8A 3HRZA 5HHQB 2P1YA 2X1OA 3BOVA 3MV7A 3HZMA 3TNMA 5BUAA 2KC0A 3TT1H 4NZDA 3NZUA 1G7HB 2WWKT 5E6UB 3FUHA 1T83A 4PEEA 1PKQE 2V33A 3FQ1A 4GW5B 2YD2A 4HAFA 3SKOA 2FQDA 3JZYA 5CJBA 5DRZA 1P84J 1EV2E 2WIIA 3ULUC 2LTQC 3TC9A 4POYA 1BBDL 3EHBD 4WRLA 5C9JB 3N06B 4KQ4H 1JCVA 1ADWA 1RZFL 1XTMA 4XI5D 1XBRA 2DLGA 1OF0A 3RGVA 1UGNA 1F90H 5IHHA 4BZ1H 3G5XA 4MAYB 3TASA 2H3NB 1OP3K 3DDGA 1LE9A 4MASA 3TBYA 1LJMA 2G2NA 3EFDH 3NFSL 3QFJA 1RQ5A 2QGDA 1OHZA 5T3XD 2AV1A 4I5BB 3LN4A 3OL2A 5DMGD 1YNTF 3N91A 4E5XG 4EJ1C 3EH5B 1MHEA 2Q3ZA 1HCVA 4RGMB 1SBSH 4BFGA 2P48B 4HUWB 2VQUA 2OXHB 5DC4B 1AQMA 3CDFA 4XXCC 4TOYH 1OSPL 3AS1A 1LO5B 1MXDA 2ADGB 3RP1A 2Z7WA 4XBPB 3SGKC 4PBXA 1NEZG 1FC2D 2CO3A 1FV1A 4HKJA 3S5LB 1UWGL 1MWAH 3MFGB 3K46A 4I0KA 1MVUA 3QRLA 4B9YA 3ZKXC 1QBAA 1NGZB 2YUXA 4U3SA 3DSFH 2JXMB 3MCLH 1IAOB 2FEDC 5A2BA 3TBWB 3LKRA 4ZX5A 1UZ6E 1CTNA 2WOYA 5HYSA 1CGUA 5EU5B 4PJ7B 1O9WA 4QRPE 5E24E 1MIEL 4LLMB 4EIZC 4H13C 1T1ZA 4X9BA 2R69H 2V2XB 5HYJB 5FIEA 2HFGL 4U1HB 1ZA3B 3C6LC 3N42F 3X13B 1V7ML 3G5VA 4OCXH 2EDQA 4A7UA 4XRCA 1G84A 2I32A 4Z7UB 4EMZA 4DP7X 1GKOA 5C70A 1JVKA 4OCSH 3MJ8A 1T6WA 3PGDA 5B22A 1PY0A 4XBGA 4OZ4A 2D7TH 4LF3B 1MFUA 2QPEB 3BSGA 4FQQB 3U0WL 2O4EA 3DIFA 4XNBA 3VFWB 1AS8A 4OJEH 3TEYA 1OP5K 4JM2D 1F3JB 1S7RA 1ACYH 1VB9A 4AUYA 1IO4C 2B1OA 1A3RL 5GRXG 4PJFE 3L3IB 2O61B 3WDJA 4EXKA 3OB8A 3VSUA 4ZZKA 4XNMA 5IQ9B 3DHMA 5ESAA 2YGNA 2VM9A 4J27A 5AOMA 3H7BA 3ULUE 3V0IA 4Q4EA 4UB0H 1IAMA 3LD8B 4GUOA 3MRHB 1IEAB 3RVXC 3CFBA 3TT3H 5KVFL 1J7VR 2J5LB 3TURA 4Z7OF 1FNFA 4Z7AA 4MA1C 4DZ8B 2OJEA 2VLKB 1X4XA 3NH7L 1A02N 3QHZL 1OT2A 3FQ4A 3DO3A 1C08B 4P57B 1U8KA 2CM6A 4I8DA 1LEIB 3QO0B 4KMLB 1NEUA 5C86A 1J8HA 5KBKA 3GO1L 3CVHA 3DHUA 4JPVL 4KKRA 3CFEB 4PGDA 4Z7WA 1W72B 2JI1A 2L7EA 2GBVA 3ROOA 3Q5YA 2DQFA 3GSVA 3DPBA 5IQLA 2XA8H 4QHNA 2WWKO 4X98B 2VDLB 4P4KA 2DIEA 1MCHA 1UCBH 3MRGA 4OJYA 1OLZA 1ZXKA 5B21A 1MCDA 1V3MA 1WDAA 3VE0B 2AQTA 3QUZA 4APQB 2ZKWA 3L6FB 3U1PA 4JFXB 1N5YH 3NJIA 3EJCA 4ODWA 2NYZA 4NSKB 3ALWA 1GZPA 5CSZA 4TTGA 4OSUH 4N2BA 4NO2A 1HL4A 2IPUG 4AQEB 1ET5A 1VAHA 4IBTA 2DIAA 4LARL 4BELD 2KS0A 3PWPB 4PJ8C 5L2KD 4AYSA 5HHXH 1NMAH 1H8SA 3HUJB 1K4CB 2IPTL 4V2BA 3VFRB 3UJJH 4IKKA 1TQTA 4YVNA 5CCKH 3UCRA 3RUGE 2EO9A 8FABA 4YC2B 2DQUL 1JZFA 3S3PA 4Y4KB 2O72A 2IXQA 4JO3H 3QEGH 1KGWA 2J2ZB 3HPLA 1DBJL 1NANI 1ITBB 2C34A 1T5KA 2VT0A 4JDEB 1JZJA 2PETA 1EO8L 3KPSE 1F4HA 1U9KA 4JO4L 5GGRA 3Q2WA 4ELDA 1TFHA 2GW5A 4MB5A 5EBLA 3T4AC 3BVVA 4WU7B 2R1XA 4Y4FB 5ISZB 2Y3NA 4X0KB 4PW4A 2C8NA 2Y6SC 2R4SH 4LVNC 1WLHA 4P5MA 3QVAA 3D4CA 4XPFL 5EUOF 1G7PB 4QD2E 4KUCD 3KZ8A 1TG8A 4GKSA 1E2VA 4A2EA 4G72B 5IWLC 4PJ5E 2EDNA 3E38A 3BFWA 1ZGLM 4HETA 2Y9RT 5GGUA 2A0LD 5C3TA 4KTDL 5TDNB 2DJMA 2DBLH 5JMRA 1WCBB 1A8JH 3GS4A 3R06A 1M9WA 2QTVA 1HXYB 4NNXA 1T3FB 1R4XA 2YPLE 4KI5C 1IZJA 3EFOA 4N68A 1U3HB 3VFUB 1AXTH 1H19A 3NABL 3ARBD 3D7PA 4HCFA 3G6JE 3DWTA 5IBTH 4PY7A 3S34L 4JZJB 2J3SA 4GSRA 2ARWA 1FORL 4CMHC 3ILQD 3GLAA 2ZCHH 3VGHA 4YR6B 3QHFH 4IHOA 3F5WA 1MRCH 4FFZA 3QUKA 2OM5A 2ICEB 1DVSA 1KGJA 2VSKB 5D2NE 4AQ8C 4YHZL 1BFOA 4M6ML 1DDTA 3BEVB 3ZYZA 3QAQA 5EEZA 1CXKA 3AAZA 4Q9RH 4G8FB 1FVEA 4Z3HA 1W6LA 2ZYSA 2ZOUA 3T1FB 5DTFB 1WA2X 4ODUA 3MCKA 2V3EA 4JG5A 1N26A 4NKIH 4PBDA 5LBSH 3O9WC 4HOZA 5GS1C 1H3TA 5HGDB 4KJYA 3UTQA 4GG6B 1KIUA 3RB5A 3RKPA 4PJ9D 5DWUL 3FZUC 3WI9A 5IOPB 3VWJC 4YO0A 2BSRB 3QDMA 3SKNA 1R47A 1F4YH 2H5UA 2OX5A 4AQAA 4NKMB 1P6AB 4W9IC 3ZIMA 4E9SA 1XF4A 2AI0H 2DQGL 3KYAA 5I5MA 1OCOB 2IGFH 2XWEA 3MR9B 3S5ZA 1IKNC 1JGEA 1NMBL 5KG9A 4H25B 3WFHA 2EXTA 2CK2A 3LVTA 5FHBH 4P2QD 1WT5C 4GMTL 4GBXB 4A6YH 5DA4A 4KJPC 2FBRA 3N40P 5LQBH 4RX4D 1C8PA 2WXKA 3L3JA 2CMRL 2FK9A 2ZWZA 2J1WA 3KDMB 2ZXAA 1MCKA 2KLTA 5EU3B 3MRCA 2WC7A 1LNUB 3EYFB 3OBAA 3IN0A 4ZTOH 4Y2DC 1KXVA 2HT4C 2YAHA 5AZEH 2NZ1A 3GBMH 4IOFD 4M1DL 4HXBL 5B1JC 3ATDA 4P5TC 2BSED 4CC4C 3HBPA 1QLEL 4UQ2A 1XF2A 4LHJB 2K4AA 1MCPL 5TDOB 3SPVB 1RIVH 1P4BL 3L3DB 2MQGA 4N2DA 1VIWA 3R0MA 3CLEL 3B2UC 3MZTA 3N85L 1TTUA 4PGCA 3TLRA 5IVXB 3ULUH 2EH8H 2GJJA 3AG4B 3UTPD 2E9GA 1KFAL 1HDMB 1VGEH 1BXXA 1C12A 4AYFA 1FNLA 1PIFA 3HZVB 4XC3H 2I9TB 5C0IB 3SZKC 1FJ1B 4KI5E 4ZO6A 3MACL 5JHMA 5CGMA 4WTZA 4G6ML 1G9EA 3FO0L 4YHIB 2FT6A 1BXUA 4YSAA 5FF6A 5B7FA 2RD0A 4XVJH 5F7WC 5HYQB 1BLNB 3W9DB 1GAFH 4J3TA 4FQ2H 5E2VL 5LGJB 3JSSA 4F37F 1ZLDA 3AU1B 2ZKXA 4B9JA 4M7JL 2F15A 3F58H 1DJWA 3JWDC 1TTRA 5FW6A 2E9BA 5H35B 4NZUL 4XMWA 1FE8H 3ET9F 1AZBA 5F7DB 2R2CA 2FWOB 1GCYA 5MI0C 2OI9B 1DUYA 2EDXA 3QG6B 5EBMA 2YXVA 3RG1C 4F58H 5KJRL 4AEIL 2P8PB 2MWCA 2OTUB 3HNTH 5J7CC 1MCOH 4UDUB 3DVNB 3GPEA 1CF1A 1HIMH 4KUZH 4XCCL 1ZANH 3RVWC 4NQVB 4UV7H 4ORZC 1U4EA 4R83A 4KNSA 2HTKD 1U8JA 4PRDB 3KNBA 5MERB 2BSTB 2FSDA 4TSCH 1L9SA 2P45B 1IC5H 2VMCA 5EORL 1A7NH 4N6RA 1OB1A 5G4MA 9CGTA 3OAUL 3PG2A 4R4NC 3CXFA 4NKOB 2XZCL 4G9FE 1JPEA 5ILTH 4O5LH 4ZAKB 4DK3A 1AGDB 1HXKA 4K23L 1CI3M 4M3JA 5DHEA 1CWVA 5GGTA 3WJMB 5C6TL 2R83A 4AYDC 3PE9A 4ZS7H 1I1AD 4N0UB 5C0DA 4HWZA 4B53A 3E8VA 4C4KT 3M46A 2AXWA 3BFQG 1VFOA 2WQWA 2X6MA 1NCIA 2UXVA 2X7LA 3O8XA 4M7KH 3HTLX 3ML8A 5GGSA 3VXPB 1AY1H 5CP3A 2YK1L 4X6EB 5DYFA 1J10A 1CXHA 1E9PA 3CFDA 3VWKC 3EF4A 1LXMA 4PW9A 4AL8C 4ZUWB 3R1GH 3SDXB 4N20A 1B2WL 4MNQD 4QCIB 3MBEA 3P73B 1AS6A 35C8H 3COOA 1JN6B 3FCBA 4PVLA 5E8EA 4ZUVA 4E9QA 3EYQC 3HW7A 2VYRE 1D3CA 4XX1E 4J4PA 1PDKA 1TLKA 3HZMB 1PLBA 4DN4H 1ZHKB 4DPAX 4FQXA 4KPHL 2A6DA 1NGQH 1MJ7L 1HL9A 1H15A 1RIHL 2F5AL 1M56B 1MQKL 2YWZA 3FUJA 3NDZE 3DKHA 2XWRA 4IU2A 4JO1L 2OXGA 1MREL 2DOCA 4OCRL 5C7ZA 1PCXA 2VITB 4EI5A 2BNUB 4K0OA 4LVHC 4JFFA 3HC4L 3KPRE 4OD2B 3VI4F 5AALA 5DRZB 2BO0A 3U9WA 3MREA 2EVJA 4TVPL 3AY4C 2V8LA 4GRLC 3BGAA 1BIHA 2VDLL 5IW1A 4HF5H 1GZQA 1Z0MA 2L04A 4OD1H 3UO8B 4C4UA 2ZICA 4NCC2 3CBJB 1U8QA 3RIAK 3KWWA 3BKCL 2AZAA 3M6DA 5DMIL 2DLFH 1NFIA 2IANA 5KSUA 4HJIA 3B9KA 3KS0J 1F1GA 2UWEE 2A6KA 3KYNB 4GRWB 1X9QA 4IKJA 4OT1L 3TBYB 5L88H 1OP3H 1DVFD 3BW9B 4LEXL 1RK0B 2FJGA 2PYEA 3CX5K 3LN4B 3FMGL 1F3RB 2QKIB 2DQDL 4UQBA 3TP4A 3K6NA 5AD0B 5DJ0B 4YQXL 4DEPB 2PWDA 1YEGH 4JX0A 4NAJA 1AGBA 3FB5A 1BPVA 1BG1A 2IBZX 4N2FA 5GRVL 3VFMA 5E9NA 3NACL 1JHLL 2R29H 4HUCA 3P30H 4OVUA 5LCVA 4E41B 5D96C 2JJWA 2OL3A 1ZOXA 4KNTA 2ZIDA 3P0VL 5FV2A 3W1ZA 3WTYA 1WVZA 3GEWB 4HKJB 3X1NA 1T0PB 3QEQD 4NXSA 4DKDC 1UB6A 2QVIA 2IBBA 1T5WA 2FQEA 3PNWA 1QBLH 4Q56A 3UTSB 5CD3A 2OW7A 3HC3L 3EYVB 4M1CD 5TQ2L 4KZCA 4WEEA 4G6AD 3BP4A 2X4QB 5FW7A 2Q6WB 5CD5D 3KPLA 1EEYB 4ZX6A 1BREA 3QPQD 4AGLA 2GITA 4BKLA 1J05A 2ADJA 4OLVH 4EN3D 4YXKH 4B9GA 5L7XH 1ZMYA 4F7MA 4Z7NE 2NZIA 3QDJA 2NNFA 1G7MA 3Q9QA 3VD0A 2IVFC 1FYTB 1JUFA 3HI6H 3D9AH 5D9SB 4HFWB 5EV7A 1NBYB 1KN4L 2CIKA 3EJTA 1PEZA 1MH5B 3G04B 2ZUQB 3VSTA 1JS4A 2OPCA 2WP3T 4XBGB 2G2RB 4OZ4B 5D8JL 5IJDC 1X5YA 1M1XB 3TZVD 3U30B 5EZIH 4PJAA 4PS4L 1AYOA 2Q8AL 4YSUA 4YGVB 5KAQG 1OP5H 2V5RA 5CJOL 4LGPB 4DPCX 1M71A 1KDJA 2UX7A 1MFMA 2YBRA 5JQ6L 3RI5K 2HSIA 3NGBB 4H5SA 4Y1TA 3WAKA 4Y89A 4NN7B 5FYKU 3L1GA 3K4AA 5FUZL 1A65A 4NC0B 1AANA 4C4KO 4KK8C 4JL1A 2CO7A 4JCLA 3QQ9C 4HS8L 3F7LA 3O6FB 1XH3A 1CS6A 4GAGH 1C16B 3U48A 2OJEB 3B5GA 5SWZE 2X41A 2VQ4A 3E7JA 5IUCA 12E8H 2QVMA 3HA0A 4FCHA 4DGIH 4PB9L 2B4CC 1U8KB 2XQYA 2A6JA 4X2UA 4HKXA 3TJHC 2CJTA 1ZRUA 3HMXL 4U6VH 1UWYA 2VJXA 4LIQL 2FZ3A 1JWMA 5AOLA 5CBEB 2OR8A 3MRFB 3L3GB 4DP9X 2VL5A 4WTQA 3CVHB 1S2EA 5AVRB 5KANG 2B5IC 3U36B 5KBLA 3HNSL 4I85A 4PUBL 2VISB 2X4PB 4QIRA 5J5EA 2BY0A 5H2BB 4FJZA 1WBYA 2DQEH 4PB0H 3M8OL 4X7DC 3SYCA 3QO1B 3UACA 1ZHBB 1DDHB 1DJIA 1SFHA 4HJUA 3BUBA 3QUZB 2ZXDA 4TVPD 2PP9A 3BKMH 4MDRA 3V0GA 1LEGB 4N2HA 2AJYH 1CD8A 4NO2B 3U4EB 5I5RA 1G9NL 2VR5A 5FO8A 4MJIE 4KXDA 5ESVA 3BRDA 1Z3RA 1ZT4B 3K5SA 3KR3H 3MXWL 4PVNA 3GI9L 3CLWA 5F9WB 2N59A 4NQEB 3BVWA 1CN4A 1Z5YD 4TUJA 4X5RA 2BMKA 1TFPA 4FZ8H 8PAZA 3QA3B 4MZRA 3RIFK 4DQOH 3QIUD 3E1ZA 4X8XA 4G43B 4X5PA 4F8OA 3STZA 1BHGA 1BFVH 1H3WM 2FD6L 3DROA 3VI3F 3OXRA 5J56B 4GKOA 5KJ4A 5AOIA 5DS8B 3UC0H 5BMFL 4EDWH 5IB2B 1GGTA 25C8H 4BCZA 1KLUA 2NXYC 5AUMB 1HJBC 1E5AA 4F15B 1YSOA 5EUKB 3C5ZA 1GOGA 4BM7A 1TOXA 1IGFL 4F8PA 3WTTA 3QZWG 3PL6A 2QSCL 1DSFH 2ITEA 4I2XB 5EBLB 1HCFX 2Z1PA 1OE2A 4ODXA 3WTUA 4C4BA 3LS4L 2CCLA 4L9LC 1BZQK 3QWRD 4K9EH 4WV1A 1G7QB 2XU9A 1QRNB 3KBFA 5CUSL 5HTSA 4AYGA 4RISL 2OMUA 1BOGB 4MXWH 1MI5E 2VNCA 4JVPA 4ZXBC 4FLQA 5BV7B 3KPMA 1FNAA 3QORA 5AVSB 1OM3L 3QCVL 4TRPL 4W9DC 3BE1L 2DJUA 4MMYA 3H3PH 1DCLA 3R8QA 1ERNA 1BZOA 3OV6A 4FS0A 4WFED 5T1JA 1BVOA 4AYID 5I26A 1RJYA 2E3VA 2IAMD 3ES6A 5A2CA 1NIAA 5D70H 3FQWA 2VRAA 3N9GH 1S7WA 4LBEA 2Y7MA 1S9WB 3F05A 2IWGA 3JVGC 1ZTXE 4W4NA 3SE3C 4ANVA 5C09E 2J6EA 5JHLA 1D6VH 4E0RB 3MNMA 4LLYB 3REWA 1S7QA 2BRQA 1E9OB 3F83A 4CVXA 3B7TA 4R26L 2CBPA 2HRPL 2CBOA 1ONQB 5HHNB 4MA8H 3MX0A 2ODIA 3TYGL 1KB5L 3SYPA 1AKJD 4YL4A 3D87B 2D73A 3QW9A 3TNNA 3MCKB 1PTZA 5I6XC 5EA0L 3ABKB 3LSOA 3EDEA 4P9HC 1A7PL 2JJUA 4UQAA 4QHLA 3SGDH 1R3IL 1FLRH 1NBCA 4KJYB 2CUAA 2XDHA 3TWCH 3UDWA 1OKEA 2FJHA 3JQOB 2HH0H 4KMQA 5BZXA 3WEXB 4YO0B 3FQTA 2J57A 1SMDA 4FEMA 3WFCL 3IETB 5HYSG 1AAJA 2VCOA 1YYCA 4FX5A 4HDIB 4KJWC 1LO2L 4F7EA 3CDGA 3ZL1A 3WFHB 5KG9B 2L7QA 5E5MA 3A47A 4K3HA 4HUVB 1DLFH 4HKZB 1VEMA 2F7RA 1V5JA 1A6UH 3SGJC 5GGVH 2C1OA 2D31B 4MXVE 5E9DE 5JR1L 1E8XA 5D1XD 1TYRA 1QO3B 5EOQH 1NLBL 4OCWL 3MRCB 4AV0A 1FDLH 5EULV 2DWDB 4AL8H 4WK0B 3BFOA 3UBXI 1P1ZA 2OMNA 5I1EH 5B1BB 2PP7A 6FABL 1N64H 3FUEA 1WZ1L 4IM8A 4NQQA 4NZFA 3T04D 2FGWH 5BVJB 5IJBC 5J6HA 2NX5A 5J3HC 5SWSD 4I1PA 4I48B 2XFXB 3V0WH 2WKOF 2F7IA 3GM0A 3MBXL 3DX6B 4FQJH 2KERA 1KLGA 2R1WB 4FFYA 2W9DH 4R0LC 3SKJL 4BBWA 4M8RA 5FC9A 1CZ8L 1F4XH 3KVQA 3PYCA 4HUXB 5AZ2L 5JQHC 2WAHA 4JANB 1GH7A 2FO1A 4KK5D 5MENE 2E9JA 4NJAH 2FDBP 2DDQL 4HBQA 3N43F 4WGVB 4X6BB 4WHDA 4JEGB 2GT9B 3RWGB 2G3NA 2X38A 2FNWA 4Y88A 5E4EB 2LOEA 4ZD3L 5JXED 5B38A 2CUMA 2ROYA 2H8PA 5DHVA 5FF6B 3DV4A 3AU0A 2D2CC 2BNQB 3NVQA 4W70A 4WFGD 4ZOEA 5AW7B 5IQNA 1FNGA 2JKNA 4LPYA 2XTJB 1U8HB 4I4WB 1KV3A 2FHBA 1HQ4B 1YYLH 3QI9D 2E7HA 1QZNA 4YDIH 3KCPA 4GOSA 5AVZB 5D6DC 3MMEA 2EUZA 3LNDA 4FJYA 1PLGH 2NSQA 1ZLWK 4L0YA 3LRGA 3HBZA 1K8IB 1MCRA 4ZMYA 2F8IA 3MJ9A 4YHOH 5JA8B 2FIRT 4ZW5A 2DQHL 3GJFB 5AEAA 3H6AA 2A73B 2VXUH 5J8OA 1UJ3C 2WXQA 2OCJA 1OGAD 4WAFA 3DGCR 1DUYB 2UVEA 3HRPA 2XWJB 1TTFA 2FX8L 1ADQA 4U1KB 1BVLB 4V2CB 3LH9A 3RPBA 4F33B 4I77H 4NUGH 5EC2B 2MEJB 1WF5A 1ET8A 1T03L 4ELMA 4AEHH 1A6VH 3QZNA 3ELQA 4OCLC 1GYCA 1U8JB 1CTOA 3KNBB 5DZAA 1E6OH 2EZ0C 2AF2A 3O81A 3RL2B 3NCWA 1DQKA 1TENA 3D39B 1EXUB 3I9GL 3FTUA 3L2LA 4CN6A 4R7VA 4MJ5A 2ED9A 3ARFB 4OJAA 2HYMA 1K5NB 3PP3K 1K5WA 4QWWD 1AHWC 1JZIA 4PJXA 4U2ZA 4WWID 3STBA 3EGDB 3O2VH 1S46A 3VXMA 4LPCA 5T1KA 1TSHA 1MRDL 3O3EB 4N2KA 1S8DB 4BFFA 4PRHA 5GSVA 5LAXA 3UX9B 1E40A 2MPAH 4QXGH 3TVMC 4D7BA 3GMMA 5D7JA 3GZPA 2ZCZA 4BH8A 3RBGA 5E6IA 2OKMA 1U8IA 1QPKA 4BUQA 2WZPD 2F6AA 3QUYA 4DKAA 1P5UA 4QXTB 4UU9B 2R1YA 2R2EB 4QJ4B 1QMUA 1RURH 3C9NB 3MYJB 4PJ7F 2E8ZA 2WXIA 5DUPL 4IU2B 3QCUH 1HE8A 5IMLA 2KLSA 3L5WB 3CVHL 4EI5B 5I1IH 3MV7D 1DVZA 4KRPC 1L3NA 1U6AL 4FOMA 4I3SL 4NDMA 1I8IA 4XMLH 5BRZD 2B4CH 3QXAB 3TX4A 5AB9A 4Z7UF 1RSFA 3II2A 1ZTXH 2VXTH 3FF7A 3IS0X 5AAWA 5I5JA 1JXJA 3LCYA 3UTZA 4HWBL 5IESH 3D0LA 1OZUA 1DSYA 2V7HA 2IANB 1UKTA 3B9KB 4EKJA 4FMKA 4M6NH 4XP1L 4LSSH 5KYUA 3RGVD 5GS2H 5D7IE 1QATA 3ZYJA 4Q6IC 4QOKE 3T6XA 4QO1A 4FQPA 1PNCA 3VG9B 3ULSA 3W0WA 1E8YA 3QFJD 3QNXA 4H8WL 3GIZH 3FB5B 1VA9A 2NYYD 4LOUD 1BOYA 1IGML 2XWTB 5FLVA 1X4YA 3WLWD 4P46B 43CAA 4PIBA 1LO4L 4W9FC 1KXQE 1AZRA 2Y23A 1XCWA 3EGXA 4TLTA 1RULL 1UT9A 5GHWL 1E30A 4X4KA 4ANUA 1UB6B 3HE6D 2YAOA 3PQYB 3VQMA 3LIZH 4BYHA 1P7QB 5PAZA 1DQML 1QR1A 5ELIA 3UMNA 4ZSOB 3VFVA 2VLJD 3RTQD 2C4FT 3MRMA 5DR5H 5GIRA 2H1XA 2HJFA 4CU8A 2E5EA 5IMMB 3VXUE 2FNBA 4PRPA 5H8DA 4X6DB 4DKFL 3BSZH 2CO6B 3V0EA 3VFGH 2WO2B 4PMEA 2E7LA 4FYQA 4F7MB 4G83A 3M86A 3L7EA 1G7MB 1WISA 3ZHKA 1NGWB 4R6UA 3HOGA 1PD1A 4MZIA 2A9DA 5DT1H 1E6JL 3VUAA 3D3VE 1M4KA 2ERJB 4V1DE 4P9MH 4HCRH 3H9SE 1NCDL 1UXWB 5FGBC 5I8CB 4UBDC 3GHBL 3LZOA 4MB3A 3QJRB 1ACZA 3PWJA 1PZAA 2EDHA 3MJ6A 2EUWA 1UATA 5DJAB 3UPRA 3HUJF 4WIQA 1FSKB 3H3BC 4EDXA 1INQA 4HIEA 2WMPA 3C60C 4WY7L 3OSKA 4A39A 3OX8B 3HZKA 3KPOA 4FFZL 4PAZA 3ABGA 1XX9C 3ZE1E 2FE0A 4WENB 4FFWD 5CEYA 4NWTH 2IDFA 4YUEL 4WTZG 4CUCA 1D7DA 4MKMA 1CF8H 4ALAL 2I9LB 5C2BH 3O0RL 3QUXA 3VH8G 3WN6A 1XH3B 4TSAH 2IQAA 3FQXB 2YOAA 3GUTA 1Y0LA 5B7EA 4GT0A 3HE7D 4WI0A 3S3DB 4J8RA 3ZQXA 2WBJB 2BSBA 2A6JB 2AHIA 4RMRA 1PJWA 4HIQA 1AHMA 1T89C 3V0HA 1JWMB 5BXFA 2LW3A 4Y1SA 4TSBH 2VL5B 4JG0L 4F37K 3B8SA 3T1WA 4ONFH 4Q6YA 4QRPA 3ULVC 1DJGA 1VACB 1WBYB 3Q1EA 4P9HH 1J8HD 5F96H 1RJCA 4WJ5B 3MNWB 4L3EE 3MJ7A 1ZHNA 3CCHA 1KEGL 3VDCA 3F64A 2DQIL 3I6GA 4FI6A 1HYSD 1D5ZB 4P4KD 5T1DH 3HB3D 3F2LA 2FIKA 1LGVA 1R17A 2C9AA 4PJ6A 4O02H 1KGCE 3CFJB 2B14A 1CGXA 3NYKA 1VJSA 1D7CA 1NCCL 3V7MA 3ZZ1A 4ZMXA 5DVOA 1W9XA 3SPHA 1MW0A 4RFNB 5IVNA 4TUJB 2Q1EA 3MC0A 4XTRD 3ZT6A 5F9JB 3CFUA 3WSQL 3ZHLA 1TVHA 5DJ6B 4AMWA 2N56A 4PG9B 2R2HB 1UACH 4HJSA 4PGEA 5AVUB 3D06A 1RK7A 1ZVHA 2HKFL 4KKCD 5J89A 5F7HA 1KLUB 1BJ1H 3B3IB 1L9PA 2FYYA 4TULH 4Y5XB 3OB0K 3DGDA 3C5ZB 4NO0B 1KB3A 5AKVA 5CLTA 3PL6B 4GG6F 3AUWB 1T80A 3GHEL 3CFTA 1WFMA 3L4WA 1ILUA 4MNGA 5GJTL 4KZEH 2OSXA 4GSDL 4RZCA 5GISH 4P3CH 4OLWL 4XPBH 2VL4A 3RPIB 4F3FA 3VW3H 4WV1B 3L95A 1CVRA 1ES0B 4IDJL 4KTEH 5ACLA 3QJFA 5JOPD 2CDGB 2BRRL 3QIWC 1U41A 4A7TA 3VXQB 1NCGA 3UZQA 3W38A 4H0GA 3PJSA 5HHME 2EIEA 2ICWI 2QGCA 4LDOB 4LLWA 1SUJA 1KV7A 4XWOC 5ADOH 4M8UA 3LY6A 1T0MB 4A2MA 4MD5A 2D2OA 4R2GC 4Y19A 1EHAA 2EUXA 3D48R 3WE6B 4HIJB 2N01B 4WHYH 1TYEB 2K3TA 3MDJA 4P59H 4TF4A 4XN4A 3NCEB 3EW3B 1L0XA 3K0YA 3NJJA 1KPVA 3S97C 3S96B 5AB0A 2QZ5A 5FFLA 1RI8A 5DQJB 1FNEB 4JRXD 3ULVE 3S7GA 1N59B 1JNNH 1F6FB 3OZ9H 1JV5A 3E3QC 4JN2A 1SPDA 3JYBA 4FG6C 3MX0B 4IGBD 1YECH 3ZLQC 4UDTB 3U9PH 2ZAGA 3NBNA 2AQPA 5J11B 5GGTL 1OXYA 4JPIA 4LAQH 4QKXB 3WFEL 3FQNA 1RZKL 4YSTA 2ZT9C 1QSEA 1XAKA 4MAUL 1D5IL 3C5JA 3CUPB 1DLHB 4RAVB 5B3JF 2Q7YB 1Q0YL 3H4HA 2GUYA 2OLDA 1V55B 2WQVA 5AW3B 4OZIB 5DJ2A 2XSKA 2XZAL 1EBPA 2WTPA 5KTEL 4LESA 5E08H 3EHBC 3LZNA 3HAEG 2B1HH 2X4OB 4CADB 2W88A 4FYRA 2ZOLA 2R0WL 4IMKA 4MD0A 5DJCA 4W81A 1KIPA 3BLKA 5E5MB 1S3KL 1TCRB 2X9YA 3ISWA 3TBBA 1YEEH 4S1QL 5DK2A 4JKPL 2GBUA 4O9HL 3JV5A 5HJ3A 1UD5A 3ZZLA 2WN2A 4PJ5A 5CMAB 5D1ZB 4PJCE 3O45B 4KMTH 4B41A 1UASA 2JKXA 3WYRA 2JNZA 5DMGC 4FHJA 4ZYKA 1XSJA 4X8JB 1FA4A 2M2DA 3F6JA 4FQCL 1Q1PA 2OQJA 2V2TB 4AH2B 4KY1L 1HHIB 2VN4A 2R51A 3FCTA 3IDYC 3T65A 1Q72H 4RDQF 2FATL 2G60L 2YN5A 5G2NA 2Y6TE 2AXGA 4UQCA 2KQMA 1KB9K 3ML9A 4UIMA 5EC1B 5F7NC 4IS6B 2DYSB 2GQHA 3V52H 5B3NA 3ZUCA 1U8PB 4GPVA 5LVEA 5AZUA 4HULB 1IL1A 1TKWB 2BP5M 4H20H 4BJLA 5D2NA 1BPLB 3FULA 3OAZK 3GXFA 1H9DA 3BIKA 2BNRE 1ASPA 4Z0BL 1EJFA 5G5DA 2QQQA 3CMOL 1ZV5A 2CIIA 2YSTA 3SCMD 1FO0H 1ITCA 3SDYH 5C1MB 2GI0A 5DVPA 2PO6A 3T2NL 4AWJC 1XCQB 2C3HA 3BH8B 5B38B 5CFHA 3MLWH 4NN5B 4GKLA 2Y7QB 1WHOA 1NKOA 2A9NH 4LKCB 4Z8FL 1MAMH 1FNGB 5DCCA 3NTCH 3RVVC 3T3PB 4WFHE 1GC1C 3SDXF 1KIQA 3KCPB 4H44C 1MWAB 1KWKA 1ECZA 4XHJD 1BVKA 4XMTA 2ESVB 1BD2E 2DN7A 2HAZA 5BJTB 3WO4B 3RZCA 3V5HA 4ZFFA 4WJG3 1AD9A 4R7DA 4PV8B 4XXDA 1QQDA 4J12A 4YEFA 3IXTB 4JM2C 4Z0XB 1AR1B 3ZRFC 4RMBA 4PJBE 4MKTA 1BQSA 1U2YA 3QUMH 4HZLA 2YMTA 3MRQB 1ECYA 4DP0X 4HD9A 5ALCH 4GW1B 1NFDA 5D7LB 4AY0A 1SVBA 1CQKA 2BOCB 1NIBA 2XBDA 4M61A 1CLOH 2WLKA 3CH1A 4QXVA 1XWVA 3K2UH 3DJTA 4UTBL 2E6JA 2HG5A 2O26U 3A67H 3WUWA 3ZDYB 4GRWF 1GYUA 4NEHB 4BE6A 1M2VB 4MDJB 1YN7B 4LLDA 1L7TH 1Z1WA 3U7WH 3ZPDA 1DUZA 1RUPL 1SQ2N 1CFSA 4Z3IA 2HLFD 5HGAA 4XN8A 1YMMD 1DQJA 1EUTA 3PXHA 4ES9A 1ZVNA 1T66D 4K3GA 4D3CH 4ZT1A 3WEAA 1E2ZA 3NP3A 3D18B 2F8OA 5T3XE 1JZ8A 4GSQA 3V7AG 4OQTA 3H85A 2OK0L 2X6BA 3IU3A 4UF7C 5I73B 5GSVB 3IXAB 4HK3J 3MV11 5LAXB 4N8VA 4ODVL 3O2DH 4N2NA 4OKDA 2FSEA 2DLTA 2NMSA 1S7UB 1GJIA 1KPRA 5E23A 3O8XD 2BPBA 4YZFE 2CDEA 3TCLB 5CNHA 1F2QA 3JV4B 1DEEA 1Z9LA 4LHUA 5CEZL 2F58L 2QPFA 4YHPA 3TYFA 3ZX1A 4NBYB 4XAKE 4QTIH 4FTVA 1MIMH 4XP5H 4QY8B 5CIPH 4LSRL 4TNVF 5D7HA 5EN3A 4Z7QE 3MBED 2QDWA 3ECBB 2N1TE 2AJSL 2QLVB 1X4ZA 2DBJA 2NZ9C 5E99L 1KBKA 3Q06A 4Y5YC 1EMTL 1FHNA 2VZSA 2TSAA 3DVGA 4FQXD 2JKLA 4D8PB 1ZS8A 2N7AA 3DOIA 3GSUA 3DMMC 1E9QA 2VXSH 1MG3C 2UZYB 2XRAH 1I8IB 1V8HA 1ZKAA 3BUPA 2IGLA 3RVTC 1Q38A 1ZV2A 1DBAL 3VNZA 4PWEA 4IQHA 2PTVA 1X44A 4KKAD 2GAZA 1P6WA 3H0TA 5IT2L 4N8UA 1U4FA 1D2OA 4XVSH 4MDIA 3QXDB 1JGUL 2FX9L 3INUL 3ULVH 2CM5A 4X6CA 3V6FB 4MYPA 2WW8A 1IBGH 1AIZA 3E2HB 1IKOP 3O4OC 4F8NA 4UT7L 1TQBC 4UINH 4OFVA 4TTDD 4L3CB 3BQVA 2B59A 1LK2A 2IOIA 1G1CA 2P47B 4XMUA 2CPUA 1H5BA 1MW2A 2XV6B 2YS4A 2F53A 3NRQA 5TH2B 4EN3C 3IJHB 3GSXB 2PYED 2CDFB 1CDUA 3WKMH 2VDPB 4AJYV 4E9RA 1R3JB 3PHSA 4WEMB 4EI6A 2EYSB 3LEYH 4X5LA 4HV8A 3AGVA 2A0LC 4AKQA 1TYJA 1KBVA 1CFNA 1MHHB 3VD1A 2Y2WA 1AYRA 2XIIA 1Y6KR 1SY6H 3VAEA 3WEMA 2Y2YA 4Q2ZA 4LL4A 1PGRB 1CICB 1M7UA 5EU6A 3P4NA 4WZ9A 1QR1B 4L8DA 2XN1A 2BP0A 3MRMB 3BGMB 3ILQC 1FBIH 1IC7L 2Z35A 1UWXK 1FP5A 2NY1C 4LHQB 4PRPB 1I8MB 4KRNA 3TBVB 2P28B 4HQQH 3TGXA 3WNJA 5AAPA 2KZKA 1PKQB 3AQDA 1WHPA 3GMQA 4FE9A 4H1LA 3L7EB 3H4FA 2BVTA 1T1XA 3HKZA 4PJDA 5A40E 3UZVB 1GIGH 4UAOC 1V7NH 2H2PC 3GXMA 3PDOA 4K07A 5E95B 1J5OH 2Y1VA 3WIHH 3QDJD 1YY9C 4IMLB 1MFEL 4UNUA 2WLIA 1MDAA 2ATKA 3PWJB 5F1NA 3J27A 3QHTC 2YD0A 3UPRB 4JNXA 1BZ7B 5DK0A 1QP1A 2X9ZA 4HIEB 5I16B 5CO1A 3DURA 5L2KE 2DH2A 4BIKA 1ND0A 4JM0A 2YRPA 1JP5A 2YQ2A 3EYUL 4DP8X 1O9VA 4KNUA 2AJ3A 4LNRA 4JG1H 5I24A 4P2OC 4UOQA 4GO6B 4LSPL 3V6BR 5I18H 2E8YA 4OZGA 5DQDL 3QUXB 3FT4B 4AIXA 3S88L 2A38A 1BZEA 1Y0LB 4ZS6C 4JREB 3I02A 4X9HA 1QVOA 4J8RB 1EAOA 2UZXB 5BO0D 1KBGH 1VADA 1WP6A 4C55A 5IB1B 1BF8A 5CEZD 1MY7A 2IO5A 3BAIA 5BO1L 1U0QA 4MZ3A 3TM6A 1U8OA 5B8CA 5BZDB 5I19H 2WQUA 4JFQA 4JRYE 2Q86B 1IM9D 4QRPB 4O4YL 2VDOH 3K80A 1N6UA 3NEOA 3ARZA 1QHOA 3UEZA 2Q9OA 4A6YB 4U0QB 4LRIC 2CHWA 4QF1A 2VLRE 2ENYA 1FFNB 1ZHNB 2H1PH 3CCHB 3IDNB 1L0YA 4YLQT 1FAIL 4WLCA 2X05A 3I6GB 2O5ZH 4LSUL 3U0PA 2A6IB 2A9BA 3BPNB 1YPZE 4DP6X 2YGPA 4OCYH 4AITA 3IN2A 3A6BL 1EVUA 1QWNA 3MLRL 1NCTA 4Q6KA 3VFOA 1WWCA 2XICA 2BLFA 4NYLA 2AEWA 5C0AA 2HMID 4YHMH 1AC0A 1CBVH 4WNQB 5T3XH 4ABUA 4I18A 2JK5A 2YXWA 5E5LA 4NZ8A 5KW9H 1N8ZA 4PJFB 5F0PB 3V4PA 3ISRA 1T0NB 3GKWH 1ZLUH 5IB3A 3EFDL 1JNHA 1ZT7A 1TVDA 1CL7I 4K71C 2FYYB 4Y16D 2LTQB 4FRWA 4PHXA 4ZTPH 1Z9NA 3C5SA 3MRDA 1CGSH 2AXJA 2QQLL 3HNVH 4W9KC 2IMMA 2DQTL 2CHXA 4HEPG 1CE1L 1PZDA 1YCSA 2F74A 4PWHA 5ITFB 3X11A 1KCUL 5SWZA 3PP4H 3CN2A 4LCUA 5SV3A 4ZPTB 4IBYA 3JWNC 3L95B 2WVUA 5ICZA 2EVHA 2COQA 1PLAA 3IFOA 2YLHA 2AVFA 5CM1A 2NNRA 1PEWA 2R15A 2ZD0A 2AJVL 3GS7A 3DDFA 3PIQB 1F11A 2KH2B 2B9BA 4YXHL 2BH0A 3DOHA 3DV6A 1K9TA 1UM6H 3MCLL 4P2QE 5FYJU 4DESA 1YDPA 2CLRB 2V17H 3KH4A 1HCZA 1NICA 2K7PA 4U1MA 2HTLD 1MHCA 2J73A 3RWCA 1YEJL 3QRBA 2DWEB 3OXSB 4L23A 1B90A 1FI8C 1JHTA 1I1AC 3QORD 2A9MH 1GC1H 2V5MA 4PCYA 2OZ4A 4PGBB 3ZDWA 1CE6A 2P7TA 4PBWD 1U91B 4IBSA 5ACZB 5C08A 3MNZB 1F6AB 4J3BA 1QFWM 3BN9D 1MFVA 4OGAC 3ZKXB 1F45A 2YXFA 4UANA 4ICWA 3OZKA 4OCXL 4QXWA 4DK5A 5C0JB 4MMZB 3I2CH 2FH8A 4IJ3C 3WTSA 5DMJB 4S11A 2JCCF 1XGQA 5DLML 1IAIM 3RY6C 3Q43A 1J1OL 1PYWA 4IEFA 1PQZA 2ARJB 3KPPB 4OCSL 3CXDL 3F7YA 1RHHA 1X6LA 4MBOA 3VG0H 1N67A 1FL6A 2D7TL 1HXMA 3C6LB 4CKQA 1E27B 3IMSA 3EJYD 3K1KC 4HJTA 5DFTA 2QPDB 4N90E 3FQNB 2PPCA 3CFMA 1QSEB 2ZONA 3D85B 4NN6C 5D1QA 3UTPE 1RL1A 2WANA 3BVXA 4B60A 3K5RA 4JY5H 1Z3GH 3KPSB 3RDTA 3J07A 5K1VA 5M94B 3I6KA 3NEXA 2PPAA 3GC3A 4OM1H 5IJKA 1XCTA 1CO1A 4JE4B 1AQDA 2MQ3A 1V10A 4HD5A 1IC0A 3L3OA 3BYTA 3STLB 4L29A 4JFPB 5T1LB 4LSDA 4PJ5B 5TQ0H 2Z8WC 3UGEA 1E7UA 3D0VA 4FNPA 1J5CA 3PGCB 5EU7E 4GFXA 2VAAA 4MAYC 3AG3B 1D5XB 3U9UA 1PZUB 2MHAA 1TVBB 2H0JA 3U82B 4MA1B 3K2IA 4UT6H 2YPLB 1BBDH 3FT0A 2CGZA 2ATPA 3FQRB 2CK0H 3ZBMA 2AFNA 1UCBL 1RZFH 4QNPE 2AAVA 3APFA 3G5WA 2BP3A 3FOLB 5C09A 1N5YL 3TA3A 4BQCA 4FL4B 3EH1A 4OLXL 2XN9E 4ABQA 2NX5D 4Y2OA 5TJWK 4OSUL 3QQXA 5D2NB 2ZWNA 2X4RB 3NZ8A 2F5BL 3BIKB 2NSXA 2RTTA 2FYVA 5G5DB 4YDLC 5SWQB 4YX2L 3OAZH 1LDSA 3CFKA 1NDMA 4DN3H 4M1CC 4G6JL 5HHXL 1NMAL 4P2CG 4G6AC 5GRVK 4G6FB 3PJNA 4M1GH 5I30H 1JHKH 4WSKA 4ZPVA 3FFDB 5IB5B 1OSPH 3MRBB 4YOKA 1SXBA 3PDGA 3D51A 3J2PA 2VDPL 4BSWB 4D0BB 1F4WL 1CYXA 1QWHA 3MLSH 4XP6L 2GHZA 3W56A 5JPMA 2B77A 4A37A 3QEGL 3FN0L 4MWFB 5IW6B 3LZFL 2Y7LA 1NC4B 2DM4A 5A6MA 5K59F 5DZ9A 2QLYA 3T4YB 3W3BA 3NSFA 4P5RA 4XXDB 1MIEH 4J3OF 4NUQA 4JFED 3MUHL 2BS71 2M83A 2HFGH 5IR1B 2R4SL 1XGTA 1UADC 3LH8A 5IJCC 1M7IA 3TJPA 5EPMB 4HAKA 2HX9A 1G6RA 4HZLB 2CO1A 3M7OA 2F54D 4F1SA 3JTSA 2BOLA 1EHNA 2EDBA 2HFEB 1WGVA 1LE5B 3N40F 4PJGA 1PG7H 5FUOH 5MHSD 4UUJA 2C5DC 3HPJA 1LP9A 4G3YH 3WUWB 5HHPA 2CO4A 1XH2A 3T6ZA 4B0MM 4ATTA 4YDKH 1ZA6B 1P5VB 3CK0L 4Y9CA 3VACA 3U0WH 1BYNA 4Y0GA 2OMTA 1BF2A 2BOBA 1DUZB 3BZ4A 3DUUA 2O6PA 4GP5B 5HGAB 3C2AH 2J5LC 1RLWA 4GI6A 4IIQB 3LOWA 4G8GA 2P49B 1A3RH 2LLNA 3B9EA 3BQUA 5IW3A 4PTUA 1MRCL 2HN7A 2PR4L 1MAJA 2AW2A 3IFLH 5BRQA 2OSYA 3GRWA 4N8VB 5ECJE 5C0FB 2CZNA 5E8PB 3AM8A 1QYGL 3T0DA 4G9DB 3VXMD 2EIKB 4O2CA 4XXWC 5T1KD 1EFQA 3QC6X 3OVUB 3U7AA 2X9WA 4PRHD 4R4BB 1OAYL 3T0AA 3A22A 3NH7H 4HX1A 5D7JD 4NKIL 4JFTA 5AVTB 3VTMA 1CD0A 2YJLA 4U1SB 1ESOA 4IRSA 5FWQA 1E4WL 2EDWA 3AREB 1RZ8A 1B4JH 3QZLA 4QHMA 3QUYD 1EHLL 1OTTD 1AZUA 5DJYA 3DX0A 1F4YL 5B39A 2ZCKL 5FO7B 4ZG1A 5DJDA 4IBZA 3G6AB 1QUNA 4X6DF 1DZBA 1ZS8B 4WUUA 3UH8A 1EJOH 3T08A 3GSUB 3O9WB 5GS1B 5E56A 3DA0A 3EO1A 2Z4QB 2MCPH 3B56A 3CZFB 3RNQA 2E74C 1SLXA 3GMNB 4ADJA 2EXYD 4YBHA 1Y07A 5DEFB 3IPFA 2PWEA 5KS9E 4LLAA 3CZLA 4HJJH 4YC2C 4FTDA 4LARH 4R7LA 3PREA 2Z7ZA 4Y1AA 1XTLA 3T0BA 2ADIA 3GBML 3N1PC 5D5ME 3CWGA 1MCIA 3VGAC 2IPTH 1W0WA 1Y1DA 3N1FC 4PREB 3TL5A 4ETQA 5IJVB 3KEHA 5HY9A 5HJGA 1U30A 2J4WL 3WTXA 4CN1A 1RIVL 2V3DA 2H1LM 3BUQA 4X6FA 4Y4FC 1ETA1 5I1CH 1J88A 5J6GA 3UBXA 3W0WD 3WDHA 2DQUH 4W6WB 4WJKB 3IYLW 4KBPA 3BWAA 3ULUL 2EH8L 1TZAA 3EXLA 2MJWA 4RDQG 1B0RB 4ZMPA 3IJYA 3QB7C 1QKZH 1EO8H 2G0LA 1VGEL 5EF0A 2W1NA 1JGDA 4XC3L 1MVFA 5LN8A 5IVZA 1NGYA 2NY2D 2AEQL 3LKSA 2FX7L 1TZHA 3SY0A 3BPCA 4XVJL 4CW1B 3QQ4B 4OY9A 2NR6A 2QVTA 1CL7H 1N3NA 4DVBA 1QA9A 1U3HC 1AGEA 4GMSL 2X42A 4EUPH 3TTYA 2NLJA 5DHYA 4OBRA 3WMSA 3F12A 3L4VA 4PRNA 4EKXA 3KPRB 4Y2LA 3F58L 3MRJA 1EXHA 3V5KA 1PU0A 4KTDH 1EK3A 3ATEA 4U1IA 2CWRA 5DYOB 2ICEC 3VRJA 1FE8L 1FG2B 4TVPE 1BX2A 2IDQA 1ZV9A 3ZDXE 1O9ZA 3NABH 4F58L 3BO8A 4QT5B 1MJ8H 4TN9A 5E94A 3VFSA 1FNSL 1FORH 2UWEB 3HNTL 3G6DH 1YMHB 1M7XA 2IEPA 4S0HA 4Y4KD 1MZYA 2R2BB 2XX1A 3GT6A 1ETB1 1HIML 2H6OA 1DFBL 3KE0A 4UV7L 4NQTA 4DGYH 3DOSA 2LT9A 2CSPA 4YHZH 1CTMA 1QASA 2B1AH 3OSVA 1KY7A 4M4RA 3WMQA 5J06A 3MO1A 4GFTB 4NFBA 4WU5B 1DQDL 1A7NL 4HK0B 4YDNA 5ISZD 1SVCP 3DXAA 4U1NA 1U58B 1ORSA 3K81A 3CN4A 2DQJH 5D1XC 2WWMD 2ZYHA 4PWKA 3EXJA 1OSZA 4I0PB 2CRZA 3EKCA 4N85A 1WD9A 3WJLA 2V5SA 3TIEB 3POCA 5DWUH 1HEZA 3RJDA 3KXFD 4WKZB 2BSSA 3ZHNA 1XH0A 4M7KL 3ILEA 5AAMC 2DQGH 4HH9B 4RQQB 1U8OB 5DD0L 1G9NC 4LDCA 5CBAA 4WI2A 1F18A 1SQMA 3R1GL 2MMXA 2Q0ZX 3ARVA 4U31A 1TSRA 2DMHA 3CVIH 3EO0B 1WAAE 4JR9L 4XC1L 5FGCE 3KLHD 3KLSA 5FCUL 4G1MA 2HFFA 4GXVL 4BZ2H 2CMRH 1UYWH 2YA1A 2WXRA 4Z7NB 4KK5C 1Q1JL 3VWKB 2EE2A 1JPTH 3W39B 2MPVA 3PWLA 3QNZB 3PRZA 4M1DH 3DYOA 3TN0B 2D3JA 4QRSA 4S1DC 1QLEH 3VFOB 4FXGC 4HF5L 1BQHA 5LDSA 4OD1L 1BZ9A 1P4BH 4UIKL 3FK3A 2JK5B 2ZJSH 3N85H 3FCSA 4A2DA 1HSAA 2DLFL 3SO3C 2XQ0A 3IJEB 4LVHB 1R5VB 3GFUA 3ZZQA 1ZT7B 1SF5A 4XMKL 3S37X 1LILA 4GRLB 4JFOB 3TV8A 2AXFA 2LGNA 1JVLA 3MUUA 3DO4A 3NP4A 1JRHI 2LLGA 1Y1UA 3FO0H 4G6MH 1ZTMA 3X11B 3OLDA 1HWGB 3D8MA 5SWZB 3RWIA 4OZIF 5BUPA 5CSBA 4EEEA 1W2KT 5KANI 5ETUB 2R29L 4A7QA 1V3JA 2GSIB 3QXWA 2VABA 5D72L 3MV8A 2CKNA 2BHZA 5E2VH 3IFOB 1E2WA 4BDVA 2AV7A 4IRJA 1AP2B 3QJSB 2ZAIA 4B96A 3X14A 4AUJA 4M7JH 2IH8A 5C3IA 1PS3A 4NQDA 2K6ZA 3HG4A 3J8F7 3PV6A 1BQUA 4ECNA 2XIBA 1I8KB 1IQWL 3FB6B 1Z9OA 4YHNA 3IRZA 5JW3H 1E65A 5D1XE 2V4LA 5KJRH 5D96B 3ZT5A 4WO4C 1F1AA 4AEIH 1JHTB 2XVKA 1XF3A 3QDGA 4L18A 1N68A 3A6OA 4P3WA 3PJLA 4OLVL 4M62L 3R7RA 1SMAA 3WGVB 3SQBB 3FCUB 3I3DA 4XCCH 4YXKL 4MJIB 5L7XL 1RZIB 2BCKA 4K9JA 3KPNB 5JIDA 2UXGA 4XR8C 2CBMA 3ARGA 4DP4X 3CDYA 4Y19D 2UXFA 1XGRA 1GS7A 5SWSE 2BJMH