4YSUA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 25.0 mgy
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 97
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysuA00
4UAHA 3H4FA 2DWSA 1ZIBA 5AZUA 4A67A 2FT7A 2J56A 3V9EA 6PAZA 4ZK8A 3OMAB 3TU6A 3NSCA 4ENZA 3FU8A 3IEAA 4KO5A 1BXAA 4BXSV 4NERA 1IC0A 2FNWA 2P80D 1GSKA 2UXVA 1AOZA 1JXFA 2VSKB 3NJFA 2WO3B 1L9QA 3PCYA 2IDQA 1BEXA 3FYIB 1A8ZA 4N8UA 1EZLA 2GC4C 2UX6A 2IDFA 3SBQA 1TU2A 2YAHA 2BZCA 5I5JA 3UACA 3WIAA 2AZUA 5ANHA 1A65A 1XMEB 3NJJA 3QJRB 4CSPA 4HCIA 1TEGA 2I7OA 1XB8A 1NWPA 2BWIA 4KO9A 1SHWA 2E86A 3S3DB 4UANA 5B1AB 4WTQA 2MTAA 1JXDA 1I53A 1JZEA 1N68A 3PPSA 1PLAA 3NJKA 2H5UA 5F7AA 4AKPA 2UXGA 3FPXA 3N2JA 3X2QB 1DYZA 1BQ5A 1V55B 4QKTA 1J5CA 1FA4A 4KNSA 5I26A 5PAZA 4FAAB 4BXVA 3T71A 3RYMA 2P80A 5E9NA 1UATA 4E9SA 1AZRA 4CSZA 4W1TA 4Q89A 3H4HA 2ZXWB 4HALA 2AZAA 2WSDA 2VW4A 4YSCA 1L9TA 2IH9A 2GIMA 3N55A 4HCGA 2CAKA 2CBPA 3OMIB 4W9ZA 2EIKB 4E9YA 3BQVA 3DKHA 5D4IA 4G72B 2HX7A 2QDVA 1E67A 4YSOA 3WKPA 1CC3A 1AS6A 1KCBA 3EH4B 2XU9A 1E30A 1NTDA 2J57A 5D4JA 1NIEA 4KOCA 1NPJA 4PCYA 1JVOA 2XV2A 3FU9A 3X1FA 3WNIA 2OV0A 2PLTA 2FTAA 2R7EB 3UAEA 1XB3A 2UXFA 4DP7X 4YSRA 4BDVB 2GC7C 4PAZA 3QQXA 3FQ2A 3NP4A 5FC9A 1W6WA 2BZ7A 3NJLA 4HAKA 2X87A 4AKQA 4HHGA 3EHBB 3X1GA 4AKOA 1ET8A 1URIA 1PY0A 3S3CB 5F7BA 3AG1B 2BP0B 1J9TA 1PNDA 1KV7A 1KGYE 1BXUA 1BQKA 4HCFA 3SBRA 2A3TA 2UX7A 3UADA 1L9RA 2GI0A 1SHXA 4DPAX 4E9WA 3BVDB 2W8CA 4HIPA 2EIJB 2YAPA 4K9JA 1AG6A 6PCYA 1NDTA 2XV3A 3OM3B 2H3XC 1NZRA 3NT0A 4A2FA 4YSDA 1OE3A 1ILUA 3KW8A 1SFHA 4G7QB 2JFCA 1N70A 1AG0A 1WA2X 2YAQA 2YAOA 3CDZA 2WO2B 2XYBA 3EH3B 4JHVA 2PPAA 4M3HA 1PCSA 2VSMB 4KNTA 1PLCA 3NSYA 4MFHA 1JVLA 2BP8B 3T6VA 1PF3A 3PXLA 3IN0A 3ABMB 4TXVB 1W8EA 2YXWA 4KO7A 1BYPA 2FT6A 3FT0A 3ZBMA 4Q8BA 4DP1X 1AZBA 3IN2A 2YAEA 3T6XA 1IBZA 2FQGA 2HZHA 2VM3A 3FU7B 1NIAA 5I6LA 4BWUA 4BWTA 1ID2A 2FWLB 2H47C 2Y1AA 1EHKB 2QT6A 5B7FA 2PP7A 1E5YA 2DV6A 2PPCA 1NPNA 1GYCA 1JZJA 2YAFA 2VW6A 4GXFA 3X1NA 4HZ1A 2GB2A 2RACA 1A4BA 4DP9X 2ZWNA 5D4HA 1L9SA 5B7EA 1PNCA 3ABGA 3SBPA 4DP6X 3CG8A 4GP8B 3OMNB 5B1JA 2BWDA 7PCYA 4G7RB 3C75A 4GYBA 7PAZA 1QHQA 1WA1X 1TKWA 2VMJA 4F7KA 3TBBA 1BQRA 3NYKA 4A68A 3QJSB 2YXVA 2IDTA 1GY1A 4YL4A 1JZIA 3V9CA 3HEIB 1SDDA 1ZIAA 3ERXA 1WS7A 2HX8A 1ZV2A 4JHUA 1M56B 2B3IA 1ET7A 2MRYA 4AX3A 2GHZA 3AY2A 3UAAA 3WG7B 1AS8A 5B3SB 4DP4X 3HB3B 4YSUA 1R1CA 1AIZA 1AAJA 1PZBA 1WS8A 3T9WA 1PZCA 3CVBA 1KDIA 2FQFA 4E9XA 3GYRA 4JKNA 4UF7C 1ZDQA 2CCWA 3FQ1A 2OCCB 3GDCA 1HAUA 1BYOA 1KDJA 1AR1B 2J5WA 4P5RA 2CUAA 2AFNA 1RCYA 2IWKA 1OOWA 2XWZA 3AW5A 2EILB 3QJVB 2EIMB 3ASOB 2AANA 3WI9A 4YVUA 4F2EA 1KBVA 3FPYA 1GS6X 3NJNA 2DYRB 5B1KA 2FQDA 2PP9A 1CURA 1AANA 4E9VA 4GP5B 2PPEA 1SFDA 2GBAA 5I28A 1MZZA 1NIFA 1F56A 2HRGA 3L45A 5B7MA 4YVNA 1MZYA 3EH5B 2AVFA 4BK5C 3GXUB 1CUOA 1HFUA 4DP5X 1YLBB 4G70B 4AZUA 2YARA 2XUWA 3FS9A 2UXTA 1IUZA 1VLXA 3QJUB 8PAZA 2QPDB 1E5ZA 3NSDA 4DPBX 1J9RA 1RZQA 2N0MA 3DIVA 1B3IA 1SF3A 2IAAC 2QDWA 1JXGA 2DY2A 2OJ1A 4GY4A 4A66A 1WAEA 5AFAA 3FQYA 1ADWA 4G71B 4A2EA 5I6OA 2PPFA 1M9WA 1OF0A 2I7SA 2VW7A 3AG4B 3DTUB 3ABKB 4N4YB 2Q9OA 1OCCB 4DP2X 1JZGA 4YSPA 1J9SA 4FA7B 4P5SA 2BW5A 2YQBA 1NIDA 2IH8A 5PCYA 1KBWA 2TSAA 3PAVA 1TEFA 3H56A 2IDUA 1FWXA 3JT2A 1J9QA 5TK2A 3ABLB 3CVCA 1ASOA 1MDAA 2BO0A 1A4AA 2YAMA 3T6ZA 1MG2C 1J5DA 3AG2B 1GS7A 2LLNA 2XV0A 4EF3A 5I5IA 1OV8A 1ET5A 1NINA 3AG3B 2TSBA 3FSAA 3QJQB 1KYAA 1AACA 2PCFA 3TA4D 5I6NA 1IBYA 1QLEB 1RZPA 4RH4A 4NB7A 1SF5A 1MG3C 3ZX1A 3ZIYA 1CYWA 2DWTA 4NAJA 1AZNA 1PAZA 4YSAA 2BW4A 2I85A 1OCRB 1JZFA 1GW0A 1NIBA 3CDZB 5IY5B 1SJMA 2FQEA 2HX9A 3NJHA 3PAZA 2VM4A 2XX0A 3X1BA 1OCZB 4HHWA 4F2FA 3FYEB 1PLBA 2ZONA 1CYXA 2CJ3A 3PAUA 1IKOP 3FSZA 3WKQA 3QJTB 3NJMA 1JZHA 2EINB 1OE2A 2R7EA 1FFTB 2BHFA 1HAWA 2PPDA 3MBWB 1RKRA 1ZPUA 4KO6A 4BDVA 1X9UA 5I5MA 1OE1A 5AKRA 3IE9A 1XB6A 3IBOA 3UGEA 2XXGA 1QNIA 1V54B 2IWEA 4DPCX 4GP4B 3PLYA 4A2HA 4DP0X 3OD3A 2JKWA 2FJSA 2XVBA 5EHFA 1DZ0A 1L9PA 4X4KA 2BP0A 3SQRA 5I6MA 2XX1A 2ZOOA 2JXMA 3CVDA 2FT8A 1GR7A 3NP3A 1M57B 4DP8X 3NSFA 1ILSA 1GS8A 4AI7A 2NRDA 1E65A 2W88A 3ZDWA 4BWWA 1AQ8A 3WNJA 1X9RA 4L0PB 2QPEB 2X88A 3S8GB 3X1EA 4YSEA 3FSWA 3TBCA 3AZUA 2Y69B 2HXAA 4WKXA 3OQRA 1ZDSA 2B08A 2VN3A 1JOIA 3FSVA 1ASQA 1PMYA 2GSMB 1W6LA 3MX0B 4A2GA 1AS7A 2PCYA 1AZUA 3ASNB 4E9TA 4YSTA 1AZCA 2IWFA 3D12B 4G7SB 1OCOB 1SDDB 2BP8A 4E9QA 1NWOA 3QPKA 3TASA 3UABA 3S3BB 4KOBA 3S8FB 4M4RB 2XXFA 5I6PA 1WA0X 9PCYA 2HRHA 3T6WA 1A4CA 5I6KA 2HLEB 3EF4A 3JTBA 4A2DA 1PZAA 2CALA 1ASPA 1BXVA 2Q5BA 3KW7A 1GY2A 3CZUB 3FU7A 1KCWA 5A7EA 3NJIA 3U25A 4YSQA 2DYSB 1NICA 5TK4A 3G5WA 5LDUA 2J55A 1BAWA 5B1BB 1V10A 5B1JC 1T5KA 1SNRA 1JERA 2PP8A 4KNUA 3NJGA 4E9RA 1A3ZA 1ETJA 2IDSA 2XLLA 4YSSA 4QLWA 1L9OA
chains in the Genus database with same CATH superfamily
1BMWA 2PUQT 2WWKO 3QUMA 3UFIA 3T65B 4XBPA 1M7DA 5DLML 5E2TL 5B4MC 2Y5EA 3VXUD 1J0ZA 1QYGL 1WCQA 1WZ1L 4LQ1A 1PY9A 4Y8AA 3V5HB 3VGDA 2ADGB 5HGGS 1CIUA 4R4FH 3WIHH 1HKFA 4ONGL 3IKCA 3MRBA 4P2RA 5DMIL 2UWEB 3CFUA 2WXMA 3A0OA 1Z5YD 3P4MA 2FNWA 3EO0A 3T0EB 2HH0L 1PBYA 4H0HB 5C09A 4AIXA 4BQ8A 4JRXA 2CO1A 3D09A 1WP6A 4KQ3L 3REWB 3O6LH 2VN6A 3SY6A 1X6NA 4N8UA 4AEIL 3DXAB 3KPMA 2OXGA 4FA8A 3GS4A 4GJTB 1H5BB 3SBQA 4DAGH 4UQBA 4JFZH 2NY6B 4K15A 1Q1JH 4LOVA 3NAAH 5I5JA 4RISL 3N1FC 5SX5H 4H8WL 3F58H 4JQIA 1MCPH 3QRBA 5EOQL 5MENA 3QVAA 3INOA 5HHMD 4WW2C 5DK2A 1MNNA 1I9RH 3B6SB 25C8L 3GSWB 1U8HA 4LSRH 3QORC 3L81A 3OKOA 3QCTH 3QZWG 1I53A 3CMOH 3NH7L 1RULL 3NJKA 2VR3A 5C0CD 1HHJA 5GS0L 1QNZL 4YPGB 2ZKWA 1XR8B 3F05A 4UTBA 2MSPA 1B4RA 4P5KB 4AITA 3DGGA 4L4TD 5FA4B 2CHWA 4LF3A 4U6YB 3WKNA 1ZMYA 5GGTH 5AB2A 3MRLB 4HC1L 5CEZD 2CLZB 4N0UA 4RGNB 2YGPA 1YEDA 2XQBH 2YLHA 4W9JC 3T71A 5KVGE 4Y4KB 3VAEA 4AW7A 1F3DJ 1RUKH 5FS5A 3AC0A 3VXQA 2WQ8A 2IALB 5JHLH 3PL6C 4YSCA 4K3EH 1L9TA 4HJUA 2C1PB 4R0LA 4UQCA 4XP6H 3BPNB 3MRJB 1K85A 2VGLM 4LCUA 4NZTH 2VIRA 3MLSL 4J23A 3AS3A 2HX7A 2BRQA 3ZQ9A 3CBRA 1OD7A 4KJQD 3CQPA 3BH9A 3ZUCA 1MRFL 4UM8B 1YEWA 4L8DA 2GVYA 3I02B 4XVUC 3PABB 1L0YA 3X14B 5IQMA 1CG9B 4OCSH 4MNGE 3NA9H 4WI9A 5BV7H 1UG9A 2UXFA 5GISL 3BPCA 2OMTB 3VFVB 3BUDA 1E6JH 2BZ7A 4C56E 1NLBH 2X0WA 4QI3A 3L7EB 1J05A 1EO8H 1BAGA 1XWVA 2HVKA 3U9UB 4GKOA 4LAJH 1MCWM 2VDRL 3S3PA 2DTML 1KGYE 3EFOA 3PGFL 4MJ2A 5A2LH 3CLFH 3VXME 2OMXB 1RLBA 2HKFH 4JY5H 1Q94A 4NN6B 4QIRA 3L6FA 3GRBA 5JHDD 2YPLD 2ZJSL 2W8CA 4ZOAA 1BZQK 4PM1A 1CFQA 4PRHE 4Z1PA 3KVDD 3G5VB 3U4BL 1UH2A 1A3RL 4QXUH 4A2FA 4BYHA 2XBDA 4UNVA 3GSXB 4PJCF 3NRQA 3MRCB 1TSRA 3QZNA 2MCG1 2GTWB 3EF7A 4NO0A 5IMMA 1X5AA 5LN4A 1N5AA 5F0PB 1U0QA 3ARWA 1JFQH 4N5UA 1AHWB 4ISVA 3HVNA 4JJOA 4KNTA 1T4KA 1TTRA 4WI4A 5DQDH 3V5KB 1JVLA 2A74B 1FFPA 3E1F1 3VXNB 1MUJB 2ODHA 5F21B 1EFXD 1G7JB 3O81A 4KMTL 2EDNA 1TLMA 2ZPKH 2GITB 4AV5A 4TMPA 1U91A 1UQSA 2ICWA 4UDTB 3K5RA 3SPHA 3U7WL 4DP1X 2B4CH 3QCVH 3B8YA 1ULVA 2J2ZA 1PY4A 4A7GF 1AFVL 1F1DA 3AWGA 2EIEA 4UINH 3LXAA 4EUPG 1E5BA 3MXVH 4X6DB 1KACB 3L5IA 5LAXB 4LIQL 1CICD 3L16A 4HXAL 1MAML 2ZX9A 2D31A 3KPSD 3I6LE 1R3KA 5JYMA 3I6GB 2EDHA 5KS9F 3GKWH 1E5YA 2EH7L 3G6AB 2VDRB 3MRGA 5J1AB 1D9KB 3UTPD 4UOW0 2RACA 2WSPA 4PGBA 4YHLH 4Y4HA 3RBGA 3PWPB 2HJFB 3L95A 3WDJA 3HN8A 5E6YA 5JMRA 1Y18B 2WB7A 4P2OB 5ICXB 5LGKA 4YDJA 5D1XB 4BKLA 4PY8J 3PDGA 4IGBA 5D72L 5KBKA 1WIUA 4P5TA 2FO4A 1TKWA 4MNGA 2Q6WB 3NYKA 4YXKH 3BAEL 3FU0A 5DWPA 1F6FB 2ED7A 1EWHA 5AW1B 5JLZB 4PV9B 3SZKC 3BMWA 3ERXA 2DQGH 3FC8A 3RP1A 5H35A 3D39B 3W2DH 4LARH 4BM7A 2A1WH 2JKSA 3VQMA 1D7BA 4KZCA 5D70H 3UAAA 3S5YA 4B9FA 1EIBA 3QI9A 4E0RB 4AQZA 3V0IA 1XF3B 1PZBA 2J43A 4FQQA 7FABL 4QRRE 1PZCA 5IMLB 2XZAL 4JJHA 1L3NA 4Z23A 5I1LA 1GYUA 4CA4A 2GTZA 5BS0E 4X4XA 1FSKC 4CDHA 1BYOA 4XBGA 3OAYK 3QNXA 4PRHA 2X1PA 4ESKA 4BHUI 1LK3H 2YA0A 4M48H 3BJ91 4LQFH 4U05A 4DGIH 1LO0H 3WI9A 5ILTH 1BQHB 2AP2A 5E6ZA 2MHAB 1PIFA 1C12A 2IPKA 3FB6A 3NPSC 2PP9A 2HB0A 3RRQA 3N6YA 1DBMH 3JWOL 3BWUF 2HCZX 4ZYKA 2C7UB 2A6DA 1K4DA 5TQ0L 1UJ3A 4RGOL 4NRYB 1C08A 3QNZA 1K4CA 2DQEH 2NW3A 2DTSA 1J8HE 2D4FA 3CC5A 1TVDA 4V1DB 2CLVA 1NAMH 2NXZD 3VSTA 4R26H 5CCJA 2AC0A 1LP9A 2BY2A 1EXUA 4CVZB 1GMEA 2GJ6A 3ZDZB 5KVFL 3KXFB 4AMWA 4OLXH 1I1YA 3SDDA 2C9UA 3HPJB 2H1LM 5LXGL 2YS4A 1V3JA 4HEPG 2Z34A 1E8YA 3ABKB 1FBIL 3DOHA 3MV7D 5SWZB 2CKBH 3BZEA 2QHRL 3K2IA 3N41F 4PP1D 3I50L 3O6ML 1JWUA 3V4PA 1QP1A 2YQBA 2AVGA 2Q7AA 3GXTA 3W56A 1T04B 1T1XB 4Z5RA 3EKCA 1M71B 4CMMB 2YA1A 4YHPA 4Z76A 1CBVL 3G5YB 5GS2H 4E41D 1ZGLM 4R0LC 4OIBA 1OOAA 4UQ9A 3E8UH 5EN3A 1JYXA 3NCYS 2WWKT 1OWRM 3FU5A 2MPAH 3PS6A 1DBAL 1ET5A 1QACA 3FCSB 5MERA 1NM4A 2BOCB 4GQQA 1P6AB 4NO5A 5EC1B 5KJ7E 3NFPB 4KH9A 3MJ7B 4QRFA 1J0JA 2AXFB 3GMPA 3R4RA 4WKZB 2QGEA 1XGQB 2A4EA 4YHIB 5IEKA 3EYOB 1GZPB 2ZCHL 1PW3A 5HHNB 1BOYA 1I3GL 1KTDB 2ZSWA 3SPIA 1OCRB 2IAMA 1CXKA 4HOMA 2WYHA 1D6EB 4QRRA 1FLRL 3HRZA 1LEGB 4P48A 4HAFA 1Q9KB 1TETH 1N0LA 4WVRA 1D5XA 5LB1A 1OCZB 3QEQB 1RPKA 2X1QA 1YECL 2NY4D 2Z0BA 1UYWH 1XBRA 3US9A 3ROOB 4ETQA 2ATPA 1C16A 3BESR 3WKQA 4AG4H 1TJMA 2EVJA 2N1TE 2E0PA 2PWHA 3BVVA 3MBWB 4QXGL 1ZPUA 3CDGA 3MLWL 3KE0A 5D9SA 4W9HC 5F7LB 2BVOA 3BWZA 1ND0B 5D2LA 4AT6B 2N0KA 2Q2EB 4LSTL 2ZKHH 4U2ZA 2BIPA 5EN2A 1DZ0A 5K9QG 3DX7B 2XDHA 4A2MA 2ZE0A 1YA5A 2Q7YA 3RL1A 1GCYA 1LHZA 2KZKA 3SDXA 2ERJC 3BD3A 1J8HA 3LJ3A 3UIYA 1DVFB 5C0RL 1ILSA 3UBFA 4Z3FA 5A43C 4M5YL 2ATAA 3RB5A 3V7AE 2ZXAA 4K5MA 5ICZB 4K94H 4NBYB 5HPOA 2JSFA 2LGNA 1ZT7B 3C5JB 3I9GH 4U1LB 3AZUA 1D5IH 2IGFL 1AQKL 3FTZA 4NKMA 1HHKB 3O0LA 1F4YL 3RKDC 3AUWB 4DVBA 1OZUA 4IKIA 4PJEF 4EKJA 4PJHA 1AS7A 5JXEA 3CN1A 5BMFL 4KZDH 2VZSA 4JDTH 4B3VA 4E9TA 1RMFL 3WMPA 1U42A 5EFIB 4FQPA 3HHSB 4WI6A 3B2DC 5GRJL 1CF8H 1FNEA 1CDUA 3BPLB 3UPRA 1TTCA 3PV6B 2OX5A 1E42A 2XA3A 1HINH 3F5WB 3QQDA 3T6WA 3PJSA 2SODB 5EWIH 4ONFH 3N43B 4Q74A 4HWZB 4WU7A 4L3ED 4P46A 2WLLA 1KJ2A 5FM4A 4OZIB 3RI5K 4HPHA 4LPTA 3LEYH 3NJIA 4HD5A 3VG9B 4Y4HC 4FL4B 1ZCRA 2BCMA 4POUB 4CU7A 5TK4A 1CZ8L 4ZQKA 3WUZA 1BAWA 3HN5A 2OZ4H 3WD5L 4Z77A 3CK0L 3VD4A 1G7PB 1JERA 3B5GA 3HIZA 4WZ9A 5BZZA 1RH8A 1ETJA 3SE6A 4IGBC 5INDB 1MLBB 5LNDA 1RURL 3QDGD 5BOPA 4P5TC 5BRQA 3CZSA 1OM3L 2FIRT 1AHMA 1WFTA 3LCYA 4HPOH 4MMYB 3K81A 4NKDB 2FGZA 5H37A 5MHSD 2OZNA 2RFXA 2R2EA 3AT8A 5GGVH 5FYKE 3MOAH 4AZ8B 2F54D 1NUGA 2Z6FA 4HP5A 3UYRH 1AOZA 3V6ZB 1YUHA 4JEGB 4A7UA 3EG9B 2BNRD 4K3JL 2BOBA 4XNQB 3A4FA 4OF0A 4FZEL 1S2EA 4L2LA 1WCBB 4PB9H 1KLGA 3CVHA 3T3ME 3QFDB 1U8MA 3DMMD 2G9HB 1KJVB 5AW7B 4EJ1C 3L4TA 1WWWX 4Y19B 1A65A 3ARGA 3C8DA 1DO6A 3JV6B 2D7TL 3NRFA 1VFBB 3MLUH 2Y3AA 5JMOC 3FFDB 2UZIL 2X4PA 3PPSA 4WJG3 2R9HD 4XMKH 2OJEA 1JK9A 1SMDA 4P06A 3MRIB 3ZDXB 1N0XH 1UJ3C 2DOCA 4ZXBA 3B56A 5LQBH 2NUTB 2E9IA 3P9LB 2HG0A 3B34A 2IQ9H 4IRJB 3D25A 1SXSA 2F9BT 3SKOA 3IJSB 3WXVH 2EDJA 1MFDH 1X9QA 4IEFB 5CGYC 2DLFL 4Z95L 4NENB 2WBXA 4CSZA 4GLRI 5DD0H 3TIDB 1IAMA 4JFED 5AOMA 5F8RC 4DCQA 2CHZA 4AIEA 3SDDC 4I0CC 3BHBB 3LX9A 4GSQA 1VCAA 5CZKA 3U82B 3UTTE 1WTGT 1O9WA 1QA9B 3K2MC 3QCUL 1QTYT 5D7KD 1A1OB 5D4IA 3GLZA 5F9WB 2VXQH 1QX1A 2P3YA 5ADPL 3GXPA 4P99A 1WWAX 3BH8A 1AS6A 4HVBA 4OGXL 4KKAD 5GSVB 4LBEB 4UV4L 4OVVA 5DUBB 4W6XB 2XTSA 4XMVA 4ZJ9A 3UMNA 1EGJL 2V7NA 2X6UA 2BCKB 5H94A 2WXPA 3U2SB 1XD0A 3QYMA 5JA8B 4WEBL 3BUQA 5KZCB 3UAEA 4ODUB 1YYLH 1LO4L 5AVUB 4YDLC 2L7QA 2E6QA 2F61A 3QQXA 4G6FD 4LNRB 1MDTA 1HSAA 1QQDA 4N8PA 3RWJA 3GJFH 2XN2A 4ZUWB 2Q3AA 3U4AA 4I2XB 4HUVA 3ZRCC 4LE8A 4BIKA 4NUGH 1BD2E 1YJDC 3X12B 3QS2A 2JCCB 2ZUUA 4N6RA 4OAWB 4MA7L 2BSRA 2FUTA 4ELMF 1WWBX 1CU4H 1DEEB 2IAMC 1ETZB 4F3FB 5MEPA 3MRKA 1RZGB 3KR3H 3CFDB 3S36X 2DQIL 2GI0A 4WWKB 1U95A 1A7OL 3CZGA 3ZHFA 3HRZC 3OBAA 4MD0A 3ZO9A 3GSRA 5CJOH 2WNGA 2W1NA 3IVKB 3DECA 4KAQL 3BIKB 5JIDA 5EU7E 3GSUA 3NN8B 4FJYA 3UAFA 6PCYA 5T8IA 4WJ5A 5F1NA 4EN3B 3HC0A 2HWZL 4U3XA 1LDPH 4PCSA 2EIZB 2HFFA 2VO8A 3TZVB 5C8JA 1TPXB 1N70A 4FG0A 3HI6H 3O8XB 2WMPB 4JZJB 2J5LC 3HG1A 5JZ7D 3QWQB 1IKFL 2R23A 4WIQA 2XYBA 1M05B 1SEQH 4OJAA 4NQXA 5IB1B 4JO1L 5HGBA 1PLCA 1RU9L 2H9GB 1YY9D 1YN7B 4Y4FB 4B60A 3IPFA 2UWEE 2C3GA 1H0DB 1MCFA 2CDEA 2GJZB 1WBXB 4MWFB 4RGMC 5C0ND 2VRKA 3VJ6B 1JPEA 3PY9A 3EBAA 3I3BA 1CXHA 1HHGA 5C0DA 1DFBL 5IF0A 1JGDA 3EGDB 3IPBA 5L9DH 3JUYA 5DYOA 1CLOL 2FT6A 3LEVL 5C6TH 3ZBMA 3QWRD 3IN2A 5LWYL 2YAEA 4KV5E 3DXAE 3AADB 5ESQB 1MFNA 1LDSA 1NSNL 4JPWL 3H53A 1H8NA 3ARBB 3CHOA 2Q8AL 5GHWL 4XRCB 2VDQL 2FWLB 2VABB 4HWUA 1EHKB 4FYQA 3NEEA 4L9LA 5IJVB 3G6JA 2PP7A 4X50A 2A0LD 2DV6A 1QMUA 4JDVA 4R5VA 5EBGA 3VX0A 3RA7H 5K9JL 3FCTB 1C7SA 3ZYOA 1ECYA 2VZOA 5T1KD 4NP4L 2Q86B 1GGUA 5JXEC 1UFGA 4U4BA 1KXHA 3E1ZA 4CU8A 5C7XH 4LDLB 2P5WB 1MJJB 2I60H 4YJZL 5IEHB 3U0PA 4DP6X 4MYPA 1CTNA 4QWWD 1QZNA 4HFUL 5CCGE 5E00B 5BZWB 3JT0A 4GYBA 5CEZH 4NQSB 5HDRA 1TTAA 2PR4H 5D7SL 3TBBA 4RFEB 1FG9C 5EO1B 3ZE0F 4RGNE 1W91A 5DJZA 4MLIA 1BBDH 1RIUH 4P46C 4Y9GA 1EJFA 1NCUA 4WV1B 2ID5A 1VSCA 2VDML 1NGQH 5AW5B 3IU4L 1SEBA 2X9ZA 2ZUVA 3BSZL 1ADQH 3IBEA 3CU7A 3VYOA 3CFQA 3QFGA 3FN3A 4KJPC 5GSRB 4LKXA 3BLBA 2JKXA 1HXYB 4JCMA 1F11B 3Q8AA 4S1QL 2IPUK 2IANA 1YEGL 3VTAA 1FZOA 2CNZA 1JN6A 4LAQH 1SMOA 4ZOCA 3ECUA 1HAUA 2RA1A 4MA1B 2DI7A 4U7SA 1CE1L 3APCA 2FGWL 4P5RA 4H1LH 5AAMA 3X3GL 3IMTA 2YGQA 3QIUB 5IROA 3S5LG 2VDQB 3AW5A 3B9KB 4HUXA 4WW1A 1SLWA 5TDPA 2BPBA 4LLQB 1M7XA 2R39A 5DO2D 5HTSA 5KOVC 1G4MA 1PD1A 2ZX6A 4PTTA 3VMPA 5HVHB 1K5NB 4L5FE 3D30A 2DIEA 4Y2OB 4LVHB 3OF6A 3TWCL 3QZMA 2V0AA 3ARUA 3V5HA 3RWDA 4LSQH 2YUWA 2ADGA 4ZSOE 1KYUA 1OZTG 4OIAA 3NFSH 2UWEA 4MJID 3F04A 4U0RB 2QQNH 3GK8H 5T1MB 3QUZD 3T0EA 1B6UA 3MJ6A 1JHKH 3O3AB 2DI9A 3ARGC 4AQ8A 3H42L 3OLIA 2Y7MA 3REWA 3TT3H 3UEQA 4G70B 3PGCB 4OFDA 2Y1ZA 2AABL 3SE9H 3MBXL 4UQ3A 3DXAA 1MFAL 3OLDA 1IIIA 1H5BA 4HZLB 4DPBX 4J3OD 3KBFA 3KG5A 1UENA 2OJZL 2H3KA 4TNVK 3S36L 1U6AL 3T1FB 4HK3N 4WSKA 4XOAA 5I1EL 4ZXBC 2XPGB 4NSKB 2Z8SA 3SCMD 4Z7OF 1N6QL 1M9WA 2VW7A 4XPAL 1KLFA 1TQBC 3B6SA 2YN3A 3GSWA 4QF1B 2DLHA 4QHLB 2DICA 5FKPB 1MCCA 4JJ5B 2GPZA 2XTLA 3OAUL 1J9SA 3FH7A 2WQSA 3SE4A 3MBEB 3NIGB 4W68A 1T5XB 2IH8A 4PVMA 1CS6A 5CP3A 1FNHA 1TQTA 3NACH 3VWKD 4YPGA 1UOWA 1XR8A 3C60D 4TSBL 3F6JA 4P5KA 1SXAA 5FA4A 2D03H 3IDXL 4U6YA 3MRLA 5GZOD 2ZKMX 2CLZA 4EZKA 5DC2A 2P1YA 4Y4KA 2XC8A 4OLZH 4X6DE 2A5UA 2IV8A 3HAEB 1CDBA 3TEUA 4D7BA 2IALA 3PQYE 1E8WA 1RZPA 4RH4A 1MG3C 3BZ4B 1Y6NR 4KUZH 3EJCA 4A04A 2C1PA 4XMPL 1JZFA 5IUSA 4WCYL 2Q10A 2EVGA 3MRJA 4NKQB 1SJMA 1CJYA 1SBBA 2CCVA 3ZUNC 3E8VA 4JPKH 3BWAB 3FB8B 4PLKD 1JPST 1IC7H 4AV4A 2BERA 3EYQC 4UM8A 4PJ6A 3QORD 4QAWA 4ZO7A 1V7NH 1YEJL 2FZ3B 3I02A 1Z0NA 4QCIB 4R90H 4Y16D 3PABA 1HJBC 3X14A 3K6DA 1IKOP 4EZMA 3LH9A 4I3GA 1CG9A 1MQKH 1KTRL 1OE2A 5FYKU 4X7DC 1E4WL 2D7QA 1Y0LB 4KO6A 5IFAH 3O2VL 2OMTA 3VFVA 2E7LA 4DKEH 3POCA 4L8BB 5BO1L 3HI5L 2F8IA 5CSBA 1P6FA 4I3SH 3K74B 3L7EA 1IC4H 2WLIB 3D39E 5DEJA 3U9UA 2GUOA 4KY2A 3PLYA 4PJGF 1SBSL 3CH1B 1BZ9B 3VMNA 2L0DA 1Y1DA 5LBSL 4JM0A 1IZKA 2A77H 4YPJA 5T3XL 6TAAA 4M6OH 2OMXA 4P9HC 1XGYL 4YIQB 5I30H 3MRFB 5TE6L 4HC1A 2Y3NA 4G1MB 2FAUA 1RPQA 3VWJB 1JRHH 2CO7B 4KKLC 5D7HA 2D0FA 2ZXCA 2FVNA 1YMMD 1F4WH 2X88A 4LKCB 3G5VA 3EDFA 4U33A 3KPQB 4LIQE 3IMRA 1M1XB 3V52H 3GSXA 4ANXA 2KPWA 5HYIA 3OZLA 2VN3A 3GUTB 1JOIA 2GTWA 2GY5A 3KJ4B 1NC4B 3CSTA 3D9AL 4UTAL 1XGRB 2DWEB 3LD8C 1J18A 2NY0C 2QSQA 2VTFA 1AHWA 3AY4A 4YLBA 5HGAB 3UZQB 5J3HD 1CFBA 5E2VL 4J3WA 2DJMA 2WWOA 3VXNA 2A74A 1OCOB 1SN5A 1MUJA 4GRLD 1G7JA 4L3CB 3BMVA 1JUFB 2X0VA 1FNFA 4R7XA 2FIKB 1UGNA 4G7VH 3O4LB 4PRIE 3C5SB 2XXFA 1MFVA 1FFQA 1OY3B 2CA3A 4R4BB 5J06A 2VXUH 2GITA 4M7LL 4L9LC 4UDTA 4U1KB 5IJDC 2B1HL 4K73A 4LDCA 3OKDB 3QC6X 3DTDA 1HXMB 2NUPB 3N1QC 4KGLA 4TL4A 1ZV9A 2MWCA 2VE6A 3K91A 4QXVA 1R3JB 4X6DA 3BFOA 5C07B 5IBTL 4U3HA 1NICA 5LAXA 1JZ3A 2MKLC 1YAZA 1V10A 3GI8L 1YQVH 3KXFE 4XP5H 2COVD 1IBFA 2C9XA 2QMJA 3I6GA 1F4XH 2MQGA 1SQMA 1SOXA 3I85A 3G6AA 4AE0A 3IFOB 1AR1D 5SWZE 3RU8L 5J1AA 5D6DA 1D9KA 1FGNH 2VH5H 4FG6C 4Z7UE 3MGTB 3PWPA 2BJMH 4H26B 4Q0XH 1Y18A 5C0BD 4P2OA 5ICXA 5I15H 5DTFB 3IDUA 3QJOA 3NCWA 5D1XA 3BLPX 1S7VB 2OR7A 2D0HA 2O6DA 5D5ME 1N12A 1A64A 4KKNA 3Q6FB 3HUJF 4N8CH 5HDQL 3A6BL 3VD2A 2Q6WA 3KZ8A 1PDKB 2BSSB 2WVTA 4N2EA 4Y9BA 3WENA 1BPVA 2YPVL 2EACA 2QPSA 4BFNA 3OWRA 3EXJA 5J13B 3LQAC 5JLZA 4PV9A 5D71H 4XNUL 3FT1A 1IGIH 3MU3A 3D39A 5DEGB 2CU9A 3OGCB 1NFDF 2J8UF 5AAMC 5EU7C 4EN2A 3MNDA 1CBJA 1TCRB 4XOCA 5IROC 3K2KA 4E0RA 1XF3A 2EUZA 2VR7A 4WHYH 5IQ7L 4PWKA 4X7SL 4K23L 5D2NB 3HG0A 5IMLA 1IFHL 5J11B 3LB6C 1OO2A 4OFVA 2BX5A 3QEQE 1K72A 1NUDA 2EXYC 1VGEL 2QBWA 3MTRA 1JZEA 4N85A 2JIXB 3EJYC 5KVFE 2GCYB 2JQAA 3H9SE 1DHKA 4ZD3H 3QWOB 2VDKH 5CZVH 3OPZH 4JFFE 3FPXA 1Z0MA 3DVNB 5IREA 3X2QB 3Q2CA 1XSKA 2B9BA 3T0EC 1DYZA 3LH8A 4GQ9L 4LOFA 4AQ8C 1BQHA 2Z4TA 3CQFA 3S48A 2MHAA 2ED6A 2VISB 5JOEA 1RP8A 1X5GA 2J6EH 1EVTC 3FUHA 2FB4L 1EAJA 4FULA 1H5BC 2C7UA 3UCRA 4J3TA 4UBDD 2NY6C 4NRYA 3IJEB 2JKNA 2CJUH 4GAGH 2WSDA 4XCNB 1NFKA 2WLHA 3EZ8A 43C9B 1JV2B 2GIMA 2J4WL 2VOTA 2LVCA 4KDWA 1MF2L 3BCDA 3REVB 4W9ZA 4V1DA 1AH1A 3PPEA 4OSUH 4GSUA 2BSCA 4CVZA 3KPTA 4MCMA 1Q72L 4NNPH 3SE4C 5FUZL 2CO2A 3HA0A 2DMGA 2O5XL 2H0EA 2DEXX 4HHAB 3NK3A 5DVPA 3KXFA 4DPRA 3QNFA 4P9HH 3S8WA 3OLGA 3X1FA 3HPJA 3R8QA 4OBSA 3VGEA 4WFEE 4XCFH 2DL2A 4ZW6A 1IM3B 1MAKA 1REIA 4HU2A 1HVXA 4LDOB 4RGNC 5SWZA 4PP2B 5E2WL 2OSLB 3NJLA 4Y4KC 1UJTA 3MLZL 4HHGA 3ULVE 2XKUA 3Q48A 3L7FB 1T04A 3CX5K 4NN7B 1T1XA 1ZTMA 3SJVD 5HDBB 1ZJAA 1M71A 4CMMA 3MAWA 4ABVA 5TFSH 2JXMB 5D5MA 2EADA 1GTNA 3J27A 1JYVA 5GGVY 3UTZB 4NAMA 5BVPH 4I8DA 2YRBA 4OZFH 4WI3A 5ELIA 3UADA 3BPNC 4OZIE 4OJCA 1XEDA 3UC0L 1JE6A 1E5CA 1UM4H 1TENA 2Y36H 3RTQA 4X9GA 3Q05A 3FCSA 4NEHB 4QTFA 1UWEH 3KWVA 1MCDA 2BOCA 2ZCKH 5EC1A 3NFPA 1XCXA 3MJ7A 2AXFA 4WKZA 1XGQA 3KHQA 1EVUA 4YHIA 5TE4H 3W5NA 1M6UA 3EYOA 1GZPA 4ICWA 1ES0B 5HHNA 4XBMA 1KTDA 3NEOA 4W9LC 4B9PA 1D6EA 1RSFA 4H8WC 4JFXA 2WO2B 2E7LC 1LEGA 5DR5L 1Q9KA 2PPAA 4XCCH 4R9HA 3L13A 4XI5D 3N85H 3QEQA 2MCPH 3S37X 5KG9B 2GHWB 3I3DA 3LRHA 1FPTH 3H9SA 3MLYH 3AB0B 3IN0A 4K2UH 4RQQB 1SGKA 5KAQF 3ROOA 1OLZA 3L3OB 5GS0C 1S3RA 2FK9A 2F18A 1QSFD 3MBWA 2NPLX 1OAYL 3L8QA 4RAVB 5SWQB 4YDZA 3VXSB 2XZZA 4NN6C 5F96L 4Z7QF 4Q8BA 4R8WL 1ND0A 2XCMC 3AWFA 3BKYL 4AT6A 2HP4A 3HJEA 4ELKB 2JI3A 4YZFE 2EDEA 1ID2A 4FGMA 4JGUA 4ZPTB 1FDLH 5JUEH 5A1AA 3DX7A 1ODAA 4OFYD 1FH5L 3RZWA 4NXSA 5DLLA 2X4OB 4J2XA 1DVFA 4AL8L 1QFUL 3VI4B 3WO4B 1ZVNA 2WLNA 4B9GA 1RUQH 4FFYL 3P3UA 3X1NA 4MQXD 4JFQB 1AHWC 1A4BA 2BVQB 3AY4C 3NIDF 4W70A 4F8NA 2L7EA 3I6KB 4QKXB 5ICZA 1TMQA 4YHOH 3HFMH 2A74C 2F15A 3ARZA 2WINB 4PJFB 4Z7WF 3UJJH 1ZT7A 3C5JA 4U1LA 2OR9H 5DJ0B 3ZDXE 4URKA 1OGTB 3QT2A 2FEEI 1I1AD 2OTWB 1HHKA 3VH8B 5DCCA 4W93A 4Z0BL 1P69B 3VFPB 1KB9K 1BOGB 1PCXA 1BX2B 1QBBA 3VFOB 1DQVA 4YL4A 2R4RH 5CGBA 3DPDA 4HMDA 5EFIA 3HHSA 1U58B 4M6MH 1I9JH 1EZVX 2NY2B 3ZL1A 4DIXA 1EHAA 2B3IA 3RWIB 2VLKD 3QQNA 3TCTA 5GXBB 1J5OL 3SO5A 3PV6A 1AS8A 1G84A 3F5WA 4DP4X 5A6LA 2EH8L 1OT1A 5DJAB 5DVNA 4HWZA 2FQFA 4WO4B 3O2DL 4EO5A 4OZIA 5D6DC 1D9KC 2NQ3A 3LRSB 2CCWA 2J25A 3D4ZA 4I88A 4QRTB 4MX7B 1NCJA 3F7RA 1EHXA 3GBMH 4TSCL 1TLKA 5F0LB 1EQWA 4P2OC 2YWYA 3CZKA 4FNLL 4OCWL 1H3UA 1G7PA 5D1XC 4AQEB 4H8HA 4GI8A 5EUOF 5INDA 1MLBA 1EAOA 5C0EB 3LNDA 4EI0A 5L7XH 4Y2DD 3GXMA 1KB5H 5KVDH 1ZWIB 1CK0H 3GB7B 5KTEH 1BVNT 3C6SB 3LNFA 4YHYB 2VSDA 1FJ1A 4MMYA 3T2QA 1JNNL 4NKDA 3D51A 3TN0B 1U3YA 3SD5A 1KZQA 2JCCE 3ZMEA 5GGQL 4QEGA 4AZ8A 5ID1B 5J56B 5EEUA 3HOGA 3V6ZA 1XCQB 4QGTA 1XGPB 1YLBB 2DYPD 3EG9A 3KH4A 5DLMH 1VZHA 2V9TA 2YARA 2XUWA 3FSOA 1QYGH 1TZAA 4H0GA 3U0WH 2O93L 2ARJB 1WCBA 2G2RB 4TNVF 2C4FU 2Y5QA 5DMIH 1A3LH 3QFDA 3PREA 2G9HA 2EYTB 2YKKA 1KJVA 3ARDD 5C6WH 4GT0A 2VM9A 4Y19A 1ZOXA 3FQYA 2F19L 4L2YA 4G71B 3JV6A 3S35X 3MKKA 5HYSB 4C4BA 5E99L 5I19H 1NCBL 4OUOA 4AVIA 4PJ8B 1K3IA 2W95A 2CA4A 3QHZL 3FFDA 4AEIH 5IVNA 2XWEA 3NCJL 4NBZB 4PG9A 3VFNB 5F9OL 4FA7B 2FWOB 2A2QT 2BW5A 3M07A 4R4ND 1AE6L 4JHBA 1CFTB 3WLWD 1X5IA 1LE9B 3MRIA 3K6NA 4C56D 3RVWC 1C5BL 1FWXA 3I2CL 2ED8A 4Q7DA 4S1DD 4IIZA 5EOQH 2NUTA 1E3FA 1QFPA 3P9LA 3FRPG 3S37L 5AOZA 1KBGH 4PJ9B 3QI9D 4FFZH 4IRJA 4OB5L 5DD1L 1GS7A 1TZIB 3BVNB 3IJSA 4L1HA 1OV8A 3VXMD 4LP5A 3NH7H 3U6XA 1MCKA 2E8YA 1RULH 4IEFA 2XY2A 5CUSL 4NENA 4ZTOH 4LPXA 4L8SB 2COQA 3TIDA 4AIZB 1TXKA 1LE5B 4JRWA 4TVPD 4F8QA 5J6HB 3T3PE 1CL7L 4S0HA 1G5GA 1QBML 3BHBA 1QW9A 4OUUB 4HC1H 1NMBL 1QA9A 4K5LA 5F3HB 1LNUB 4NZFA 4RVBA 3ETSA 1A1OA 4L1TA 2PMZA 1GJWA 1EDHA 1PD0A 2FD6H 4BV1A 2P5WE 4N1EA 2EC9T 4KZEL 5EO0B 2QSCL 4LBEA 3OHXB 5DUBA 5GSVA 3SYCA 4F2FA 1CLYL 3OXSB 3M1CA 1IAIL 4JX0A 1CDJA 3QIWB 4FNQA 4NFDA 4KNQA 1USZA 2BCKA 3VD0A 3LKOB 3QBTB 3WJLA 3GMQB 4XVTL 4GG6F 4X7CC 4ODUA 5E6SB 4MS8D 4FQ1L 2CIKB 4LNRA 1A4JB 3MLSH 1Q0EA 3UJIL 4J7RA 4N2KA 4ZUWA 2XETA 4FQXB 4I2XA 1FQ9C 1MRFH 1GXEA 2KLRA 2LU5A 3JWOC 3W82A 3X12A 2OBGA 3QR1A 2JCCA 4OAWA 2X12A 3RWFB 4NNXB 3VB8A 5G5DB 4X7TB 4BQCA 4DF9A 1DEEA 3IETB 4F3FA 1ETZA 3DTXA 4DP8X 5B3JF 4TTGA 1RZGA 4FFTA 3CFDA 3I6LD 1FGVH 4WWKA 1NEZG 3WY1A 4KY1H 1MCOH 3IVKA 5IMOB 3GXFA 5M95B 5FCUL 4C4KO 3BIKA 5KBNC 3VD7A 2BNQE 4IU3B 2EEXA 3ZKXB 4OJFH 4CILA 4ACTA 3L3JB 3NN8A 5D7IF 2APTA 2DB8A 4EN3A 3TBCA 2VDRH 3TZVA 2EIZA 2R29L 1AGFB 3NGBC 4DGVL 2Z9TA 3O8XA 5ECJE 5LCVH 5DYFA 2WMPA 1L6ZA 4JZJA 2EVHA 4UNTA 3FSVA 4OGQC 3TONA 1PMYA 3FQRB 3UCQA 1M05A 4A2GA 1DLHB 5IB1A 3QPQC 3D2UB 4PJXB 4TTDC 2IWGA 4QY8B 2H9GA 4YSTA 2VUKA 2BSDA 1BF5A 1YN7A 4Y4FA 3PP4L 3U4BH 1H0DA 2GJZA 1KTCA 1A3RH 1WBXA 3QG7L 3GNML 4MWFA 5BO0D 1LD9B 3MNMA 3MRQB 4KOBA 3EZJB 4PRDB 3VFGL 3VJ6A 4O4YL 3ZKNC 3DOSB 3A67H 3QQ3B 5E23A 1EGJA 4B9KC 2WXKA 3EGDA 4OZGB 4M3KB 4ONOA 1DVFC 1IBGH 1KTKE 3EF4A 1NEUA 3JTBA 2OK0L 4J3OH 4J3OF 5ESQA 2EYSB 3ARBA 4CDGC 2DYSB 3TX4A 2G3NA 4XRCA 2RH0A 3BQUB 2H8PB 2C3VB 2VABA 4G6JL 1G7LB 5E08L 5BS0D 4M1CC 3KPPB 2HTKD 5IJVA 3L2MA 3L3HB 4KNUA 3SPJA 3EYVB 3GMNB 1EJ8A 2ITFA 2AQ2A 3H55A 3FCTA 4QLWA 1E4KC 3FOMB 2Z31B 4S2SB 2Q86A 4A67A 3BVTA 2B15A 3NIGE 2WN3A 4MNQD 4ZK8A 5IEHA 2P5WA 1MJJA 2HAZA 4HXAH 1L4IA 3GSOB 3S35L 1LYQA 4MB1A 5E00A 5BZWA 3M88A 3BPLC 2WZ6A 2V9QA 1IC0A 4NQSA 1DJYA 1J0HA 3CD4A 3D0LB 1T2JA 4RFEA 5EO1A 4PWEA 3N5AA 2X2JA 4F57H 2IDQA 3KGTA 1HE8A 4A1RA 1A7QL 1B2WH 4ABWA 4WV1A 2JB5L 2KC0A 2FX7L 4G8IB 1R4XA 3VG9C 4FL4C 2DM7A 4AM0Q 1KCKA 3X3FL 3BD5A 1MHHA 2HLFC 4NJ9H 3WTUA 1HEHC 2CRYA 5DJ2B 5GSRA 4X4ME 3KGSA 3C5ZD 3QJRB 1HXYA 1F11A 4HCIA 2E9BA 1S9XB 3MUZ1 3TJEL 4AYFB 3BH4A 5LBVA 3WN5B 2HPTA 1F0LA 4HPYL 1D3CA 4FNTA 2VXVL 4YXHH 2GG1A 1JGIA 3MUGB 1HYSC 1GGBL 4NWUL 4NUJB 1SMAA 2GW5A 4JL2A 5EOCL 5EU4B 1DVZA 4YZWA 1J0KA 3B9KA 2X4QB 5JW3H 4LLQA 1DJXA 4NWTL 3EGSB 5I0WA 2AGJH 1A7BA 3MCKB 3LNGA 1EA9C 1FA4A 1K5NA 4UOJA 1E0OB 4Q9QL 4Y2OA 3VRLE 2C8NA 3QXWA 4QRPB 3TP4A 3AWEA 1OCWL 4JM4L 4MMZB 1QFOA 3WIIH 4P46D 4PSPA 2ZXWB 5T1MA 4X8GA 1USQA 3HE6D 4Q52A 3GLAA 3Q2VA 3ETTA 4GT7A 3O3AA 4HCGA 4UOW1 2CBPA 4NQUA 4GFTB 2AEPL 3SDCD 3PGCA 3PWUB 5GRUL 2BC4B 4R2GB 5IOKA 4UTCA 4KRPC 4YNYB 43CAB 4X5PA 4WEEA 4HZLA 5FV2A 3VSVA 3B7YA 1IGYB 1JP5A 3QUXD 4MB5A 5CXPA 3DJRA 1OF2B 4ZBJA 2EJ1A 4N0YH 1NPJA 2X1WL 4PCYA 4X98B 3T1FA 2I9TB 2CJSA 4JG1L 2BSEA 2XPGA 5MP6H 3BSZA 4NSKA 2FEDC 2OMYB 3ZDYB 4QF1A 4QHLA 5FKPA 2PYEE 4JJ5A 4I5BB 3SO3B 4BGLA 3NP4A 4IRJC 3QZWB 4AGNA 5TF0A 1SVZA 4AVHA 1H8SA 3KBEA 2K6YA 3MBEA 3S98A 1T5XA 4NHCL 4LVEA 1NANI 3R06B 4B5ZA 4EIGB 3O4LE 5C70A 1U8CB 4ZOBA 3LPPA 2WBKA 4GNKB 4ABQA 4DTGH 4LDEB 4J28A 1BXUA 3TTYA 4E5XA 2QFPA 3BN9C 2XY1A 2X2UA 4U4IA 4D0DB 1L9RA 1G9ML 2QHRH 3EYSL 4FQIH 1VKXB 5F9WC 4ES9A 3I50H 3O6MH 5C07E 2V5RA 4L1SA 3HAEA 5AOLA 3ZGHA 5CBAB 3O45B 4YEFA 1CVRA 2H3XC 3SBWA 3NT0A 2R2CA 3BZ4A 4FQ2L 2KMWA 4QXTB 1OE3A 1ILUA 1NEPA 5TE7H 2MKWA 1XVSA 4X9FA 4X4MA 3WJLC 4HS6B 2WWNA 4XVSL 3UG4A 4LU5L 1B0GB 5T3XE 4M61B 3TF4A 2R0WL 2ZOWA 4Q6KA 1DBAH 3BWAA 3FB8A 3KCWA 3VFWB 4G1EB 4L3FA 2XFXB 1BQUA 5ANME 4ZW3A 5E0FA 2FZ3A 1MWAL 4QCIA 2G9KA 1WBZB 1NUFA 4G6AD 4ODTH 3B2VL 2ZCHH 3HFFA 4JFDB 3V8CA 4DFHA 4OZFG 1ZK9A 1Y0LA 2YXWA 1TTBA 3IDMB 4FXGB 4L8BA 3UZVB 5HVGB 3TESA 4WWKC 2WLIA 2WXQA 4HCRA 4J12A 1YECH 4F7EB 5IVXB 1PX3A 1OTUC 4PGCB 3MLRL 3TEWA 2O4EA 1BZ9A 3CH1A 2QT6A 4EN3C 5F9JB 1S9YB 5ADOL 3TZVC 1R17A 3AMLA 4PTUB 2C4XA 1TPXC 4QXGH 4HS8L 3O8XC 5DRWB 1NPNA 4JZJC 3OSKA 2CXKA 4YIQA 4OGAC 4N3TA 1RUPH 3MRFA 2QQKL 4B0MM 4G1MA 1IGCH 3AQXA 3SGJA 3VWJA 2CO7A 2AQSA 5T1DL 5D7EA 1KCVL 2P42B 1BM7A 5KAQG 4LSTH 1FZKA 3B3IB 1D2OA 4LKCA 3SBPA 2F7RA 4Y4FC 1F1GA 2YJQA 3KPQA 3ZHNA 1M1XA 3EYQD 1XV8A 5EBWB 4YBLB 3VYPA 1QFWI 2J6WA 3GUTA 1MRCH 2YBGA 1NC4A 3FAWA 3Q9PA 4OLVL 3CX2A 4PJAF 1B0WA 1XGRA 2DWEA 3FMGL 1WD9A 2PYEA 5ID0B 3UZQA 5HGAA 1MY7A 3TXAA 3JWNC 3BT2L 4HGKC 5JQ6H 4TLUA 4OLYH 3QUYD 5C9KA 1BV8A 1DQLL 2P5EB 2V3FA 4KI5E 4XP9H 3W81A 3ARBC 3MR9B 4L3CA 1JUFA 2FIKA 1U8OB 3O4LA 1IGJB 3C5SA 4OI9A 1OHQA 4R4BA 4U7MA 5E5RB 1N5YL 1MWAB 3O9WB 2ZSVB 2Y06H 5HGHB 1F4YH 4O2EB 4RX4D 5EIIG 1T22B 4XH2B 4BZ2H 2YSSA 4U1KA 1AKJD 1AAJA 2FJHB 3HE7A 3OKDA 1KDIA 1HXMA 1P4IL 2NUPA 5FFOA 5GGSB 3LXUX 2AITA 3IFLL 1XL4A 4OFKA 1R3JA 5E6IC 4EUPB 5ES4B 1S5IL 5C07A 1QHPA 2VRQA 4M1DL 4L1BA 5GRJH 1UZ6F 2I5YH 3H2WA 1MQ8A 4N0CC 5AB9A 5IW6B 1AY1L 4XTRD 1UXLA 3D50A 4NX0A 1N59B 3IFOA 5M7QA 2AANA 3VGBA 1DSWA 5LBSA 3F7KA 3H6AA 1ECZA 3K1KC 4F92B 4IJ3B 3L5WB 1KSRA 1T20B 1IM9D 3MGTA 4I13B 4ODSH 5ANMA 4H26A 1RK1B 4WV1C 4C4KT 4LHJB 5DTFA 2Q8BL 4ONHB 5DJDB 2YMXH 2GBAA 1IAOB 5I28A 1S7VA 1MCLA 3HR5B 2AV1B 2DWYA 5IVZB 5D7JB 4EMZA 2CM6A 4PS4L 4Y5XB 3Q6FA 4GMSL 4KH2A 3GWJA 1OP5H 3KYKL 1HCYA 1PDKA 2BSSA 1TZGH 4UTAA 5EU6B 1N6VA 4XNDA 3FS9A 2IV9A 2VO5A 3DNKA 3UTTD 4MA1C 2QPDB 1E5ZA 5DEGA 1JF6A 3DIVA 2C7FA 3OGCA 1EDQA 2YK1H 1PFCA 1K9TA 2ENPA 1NAKL 4UILL 4Z7VB 2NNCA 2Q20A 1TCRA 3QIUC 3B9KC 2NCMA 1H6EA 3V0FA 1HC1A 3PWLB 1TVBB 5D2NA 4OCMC 5HVHC 1HILB 3A4EA 4LVHC 1XSIA 3EOTL 4K8RL 3WS3B 4XNMB 5TJWK 2JIXA 4HLZH 5HYJB 4RMBA 2GCYA 5HYQB 5JXAL 3HKFA 1NDMB 3NRPA 2FBOJ 3QWOA 1ITBB 4U0RC 5DHYB 3DVNA 1RZ7H 1BDYA 1J9QA 2GEQA 3GI9H 4FXLA 1DJHA 4A6YL 2BO0A 1RZJL 2DQJL 1U9KA 1BD2D 2D7TH 3EHBD 3LH2L 2VISA 1FHGA 2HT4D 1UD6A 1P0SE 3ISRA 5BJTB 3RPKA 4HA1A 1BLNB 1NKGA 2UZIH 4UAOB 1JBJA 3SY0B 1WGOA 1UACL 4V33A 1FE8H 4YS4A 4ZG1A 4GIOA 5I8KL 3ESPA 4F1SA 3IJEA 4XCNA 5D1QB 43C9A 1JV2A 4JGMA 3REVA 3QO1B 3VI4E 4R5TA 3TT1H 2X10A 3VDAA 1OSYA 3FQWB 5A3ID 3BDYL 5DF0A 5EMYA 3Q9QA 2YPVA 4R83A 2DLFH 3MBEC 1M6OB 4KK5C 3VGFA 4HHWA 3D07A 1PLBA 3ZE2B 3WFHB 4HHAA 4U6VL 1MFBL 4MA8H 3DARA 5DQ9B 4CN6A 3LRGA 2FBJL 3FTGB 4TUKH 2PPDA 1IM3A 5DUML 1LK2B 4L0YA 4PP2A 3CFMA 5IR1B 2OSLA 3QYNA 3Q0HA 1CD9B 2ZUTA 1N4XL 1ACXA 2A4CA 5AKVA 4OGXH 1E7UA 3L7FA 4KKBC 4TNEA 2JKWA 3DXAD 3SBWC 3EUUA 3V55A 3WV0A 2JXMA 4WEBH 2R56H 5ERWB 3UTZA 5GJTL 1S7QB 3JWNH 4XPHL 3UL4A 4DWHA 1JZ4A 2HFGL 4A6YB 5CLYA 4KDTA 1OARH 1W16A 1V7ML 2EO7A 2D8KA 2IBGA 1HX0A 3OKEB 4FQLH 3W11C 1WHPA 2RCSL 4P0DA 1ZLSH 4WSJA 4FMFA 4XBEH 3GXNA 4NUPA 2ZXQA 4MA7H 1ES0A 2X44D 1NQBA 3WHE0 4RRPA 4NO3B 3WKMH 1A6VL 3ATBA 2XT1B 1FLTX 1J5HA 4FLRA 5E4AA 2X2IA 4J3SA 3BFQG 2PCYA 4FYRA 2PXYD 1OB0A 3RY6A 4FABL 5KG9A 4U1MB 4PWFA 1NCWH 2JMRA 4MCYB 4IOFC 4RQQA 3TASA 1OP3K 3L3OA 1GAFH 3FZUD 3ZIMA 3IMWA 1YHPA 4MCZB 4KXCA 4BE5A 3POHA 4HMCA 3BD4A 2KS0A 3FAXA 4XPFL 4RAVA 5FGBA 5I74B 5SWQA 1EX0A 5IZ7A 1IKFH 3VXSA 3M1BB 1OW0A 5DQJB 4W9GC 4JQVA 3B83A 3SGJC 3VWJC 4ELKA 1RU9H 4MXWH 3LZQA 2VN4A 4B7LA 4ZPTA 4NGHL 1CFSB 1AO7B 1VF5C 4DO6A 4JN2B 3IDGB 4UQDA 2N56A 3CN0A 3OHMB 4E9RA 2X4OA 2XLLA 5J5EA 3KJ4C 1FVDB 2Y7OA 1CLOH 4A38A 3L48A 3VI4A 1DQQA 3FQUB 1U3HB 3KGRA 4QOKB 1JCKA 4JFQA 4Z7NE 3BWSA 2BVQA 1JNLL 2VT0A 3I6KA 4J4PD 1F02I 4LSUL 5GHWH 2WINA 5EZLB 3VFUB 5E4OA 5DJ0A 1OGTA 4WUKH 2OTWA 5TQ2H 3T0VA 3VH8A 3DHMA 3ATEA 4JFWA 1J10A 4ODHH 2CIIB 3GRWL 1WEJL 1ETA1 4G9FE 5J12C 1BOGA 1NANH 1ZTXE 3HG2A 4J3OG 4NJAL 2KHAA 1QWUA 1TO5A 1OGAB 2DQCH 2GSGB 2APXA 3QISA 3CNKA 2H6UA 4I7ZC 3ULUL 4TVPH 3UGUA 1U58A 1U30A 5KSAB 4LO9A 3RWIA 5HHOB 1I1FB 2OLDA 5D7SH 5DJAA 3MLXH 4R4FL 3WIHL 4WUUD 1NFAA 4MXVE 2XBTA 4WO4A 4LCCB 1T2XA 1EEYB 3LRSA 4UANA 1NCGA 4TPRH 3P0YH 3N44B 4QRTA 4MX7A 2VDMH 4PYGA 1VHPA 3IU4H 1F3RB 2ZF9A 4AQEA 3MTXA 3VB9A 5AG8A 4RA3A 5C0EA 4S1QH 5K33A 2XXMB 4DAGL 1ZWIA 3GB7A 1RI8A 1JD9A 4FAAB 5HDWA 1Q1JL 3C6SA 3NAAL 4FEMA 3F58L 1VFAB 1XH0A 1V5JA 1DSFH 3SHSA 5J13C 1CE1H 1X4ZA 2UZXB 4Y7OC 3RUGF 2FGWH 3TN0A 1VIWA 3VM7A 2ILLA 1I9RL 3X3GH 1Z3GL 4PJDB 2OAAA 4MJ5B 5ID1A 3P77B 3BPOC 3QCTL 1QFHA 5CR8A 5KSUB 3CMOL 3PQYD 1MIEH 3RHWF 5I0DA 3QR0A 4PQXA 1XCQA 4WWOA 5D2NC 5DT1H 1XGPA 5J11C 2X6MA 3TWCH 5I1IL 3DKHA 4P05A 4PS3A 2ARJA 2G2RA 1UXSA 3CMGA 1CC3A 1J86A 5GGTL 4QRQB 3TFBA 5EA0L 3ALXA 3U1SH 3WAKA 5D4JA 3QNYB 2EYTA 2XQBL 5BUPA 1HCZA 3EUDA 3L08A 4R3SB 2HYMA 1RUKL 2VKWA 5F70A 4KITB 2NTSP 2DEWX 3H42H 4D9RE 3T4YB 1B0RB 5HYSA 1U2YA 3FFCB 5JHLL 2OW6A 4PJXE 4PJ8A 3LKPB 3LN9A 4J8QA 1MW1A 2XJLA 4JRYB 3O2DA 1MFAH 3VFNA 2FWOA 3DUUB 1QFWH 4K3EL 4AKOA 1CFTA 4IKKA 1ZXQA 4KI5C 4XP6L 2M83A 3UJTL 1LE9A 2YFOA 1F86A 1SJVA 4H20L 1T89A 1QBLH 4NZTL 3KWUA 2LU7A 4OZGE 2EUXA 3IU3B 1GIGH 4PJ9A 4WK4B 2NR6A 1TZIA 3BVNA 1A7RH 4OCSL 2DKUA 4R5XA 1CDIA 3NA9L 2XKSA 4L8SA 5BV7L 4HIXL 1LE5A 4AIZA 4UZSA 5F0JB 1E6JL 2V33A 5J6HA 4OUUA 5ABZA 1EO8L 4I85A 5F3HA 3BGMB 2G3MA 1P84J 3E6HB 1LNUA 4ZT1A 1MNUL 3TM6A 1QRND 3CFNA 2VDNL 2NX5D 2UUDH 3EH3B 3CLFL 3NSYA 3OHXA 3VDBA 4FTVB 4MFHA 3OXSA 4IBZA 3SKUD 2HKFL 1H9DA 2FJGB 5A6IA 3PXLA 3QIWA 4NN7C 2O6PA 3WHXB 3LKOA 5T3ZL 3CAFA 3GMQA 4B41A 1AXSB 2UYLB 2JJWA 4I87A 3MRRB 4ZFZB 3NABH 2CIKA 4PRID 2J21A 2B59B 2FH8A 1A4JA 3T08A 4KDTC 2P46B 2ZD0A 2FQGA 4FQXA 1MI5B 2X09A 3DHJA 3QAQA 5HJDA 2L3BA 1BPLB 1FL6B 1AI1H 2R59A 5E9DB 3RWFA 2I69A 4NNXA 3T09A 5D1ZB 5HBBA 2P8LB 1Q0XH 2EXWD 5G5DA 1E4WH 1RD6A 3IETA 1ZVHA 1GYCA 2A9DA 3KXFD 4JN1H 4K5NA 1EV2E 1A6AB 4KJWC 4JHWH 3KDMB 5IMOA 2NNXA 4H8UA 3M7FB 3RY6C 2FWUA 5KOMC 4ANWA 4IU3A 5BUAA 5B7EA 3L3JA 2M26A 2ED9A 5JW4M 1YDPB 2CKNA 5D55A 3AB0C 3P2TA 1B6DA 4FX5A 2B4CL 3QCVL 5BV7B 1T80A 1AGFA 3L3OC 4Q9BA 5E1QA 5LBSH 2VMDA 2CK0H 7PAZA 4OV6F 1M1SA 3MXVL 4D9QD 1BA9A 5FGBC 1XGYH 5TE6H 3FQRA 1QZ1A 4HZAA 1DLHA 4JGJA 3C8HA 1OW0C 2H0JA 2YXVA 3D2UA 3GLDA 4PJXA 7TAAA 5L0QB 1ZE3H 3LKQB 1CDCA 4JQVC 4QY8A 3HLKA 1W2KT 1K8IB 1M3IA 4O2CB 3V0DA 3RTQD 1LD9A 4PRDA 3MRQA 4MDIB 1IE4A 2Y5TB 2Y22A 2XTJD 3DOSA 4YHLL 4HJ0C 3LRKA 4TULH 3QQ3A 1MHEB 1GYAA 1WAAE 2AXGB 4OZGA 5DMGC 1T7WA 5F7KC 1DCEA 4YSUA 4UZGA 5HHXH 5F7EH 2G5BB 3WO4C 5E2VH 2Q1EA 4FMKA 2EYSA 1GH7A 3TYFB 1BF2A 5LXVA 4PJCB 3BQUA 2H8PA 2C3VA 2F5AL 1G7LA 3KPPA 2IWKA 4YXKL 4F8TA 2X4UB 3L3HA 4M7LH 3EYVA 3GMNA 3RIAK 3ZDYE 3H9SD 1MEXH 2DQGL 3VD9A 3GSQB 3W2DL 3FOMA 2Z31A 2A1WL 3IDNB 1O5PA 4JFFD 4S2SA 1FAKT 2X9XA 1R3LB 3S2AA 1XGUB 3AREB 3BI9X 2IVFC 4ODWB 1E28B 3D85B 1AANA 1DE4B 1DBBH 2DD8H 2ZAHA 3GSOA 4X80L 2NY2C 4G8FB 4Q6IB 3T0WA 2QVTA 3VFTA 3FB5B 3L3DB 2BY1A 3D4YA 3D0LA 5GZND 3S9DB 2R29A 2H0FA 3RU8H 3EFFB 1HFUA 4NQDB 5A7BA 1J1XH 5AWNL 3LIUA 4IBSA 1LK3L 4P23C 4PJ7F 4WO4C 5LN8A 4G8IA 3HC4H 2XWCA 2VQUA 4JY4B 2KKQA 5IW1B 3O6KH 5ILTL 4DFIA 5KS9B 2N0MA 3P9WB 3NUKA 3KLDA 5C08B 1NOFA 1S3KL 5DJ2A 3IJ7A 3A6BH 4YR6B 2P8PB 1S9XA 4AYFA 4WTZA 3VDCA 3WN5A 2DQMA 3OB0H 1A6ZB 4JLRB 4YSPA 1RQ5A 3OPUA 4P4RB 4XC1L 5C0AB 4AL8C 4WFED 4XNUH 2EDRA 2DQEL 3O11B 1H9VA 3MUGA 3V4VL 8FABB 4TOYL 4NUJA 3CPLB 3TN0C 3UROR 2QELA 4AX3A 3S5LB 5EU4A 4BSVB 1THCA 1NAML 2X4QA 5HD8D 4PVBA 3DV6B 3ULVD 5EU5B 3EGSA 3B2UC 3APFA 4ETYA 3MCKA 3FHAA 4AQ1B 1IFHH 1A4AA 4XB8A 3N1PC 1J8KA 4F5CE 4QRPA 1OANA 1P2CB 2R83A 4X83A 1LWRA 4O02H 4XN7A 4MMZA 4GUOA 3PAYA 3GM8A 5IVXE 4OTXL 5AB1A 2YJLA 1U41A 4Y9EA 2KLTA 2CKBL 2WNWA 2IC2A 5AW3B 1TITA 2EABA 3SGDI 5C0FB 3RDTB 4YX2H 3PWUA 2BC4A 4F20A 5GGRB 4B95C 4TV3A 4YNYA 5AAPA 43CAA 1YYCA 3PAZA 3MLVH 4HLZG 4PJ8C 1EK3A 3UXFA 4ZX6A 3V6FB 2WXNA 5CZXC 3KPNB 4L37B 1IGYA 2BVPB 1OF2A 3ARFB 4F8LA 5J0BA 1CYXA 4X98A 2FDBP 3KPRB 4UNIA 2I9TA 2MPAL 2XPYA 3ARRA 3PAUA 5FWQA 5KVMC 1UWGL 1F18A 2GTQA 2OMYA 4WENB 4ZMVA 2XVGA 2P24B 4XNZB 4LCWE 4I5BA 2WXOA 2J1KA 4PJ9C 4JHAH 2XZCH 3B9DA 4AVJA 5CJQH 5C1MB 1ZA3B 1Q72H 1VZGA 2ZOTA 3LKSB 1QNIA 5DGQA 4HJEA 3R06A 4N2NA 3V4VB 4L8SC 1U8CA 1S4IA 3T3MF 3K5SA 3T4AB 1PJWA 1KBPA 4N1CA 1NAMB 4P4KD 4CBPA 1F58H 4D0DA 3DGCR 3ARVA 4PV8B 5L4FA 1DQDL 1SJHB 2YD3A 2NRDA 3D34A 1Z9PA 3RGHA 2ISDA 4YGVB 5CBAA 3O45A 1I8UA 3WNJA 5HI3C 3OHXC 4Y1TA 1HJCA 4NP9A 3ZKQD 3SDAB 3QIWC 4QXTA 4X6FB 2J88L 1MFUA 3CLWA 1CQYA 4HS6A 2CKBB 4IHOB 4PYHA 3N41B 2JKJA 1B0GA 1H3PH 2NMSA 2ZKHL 4M61A 5IQLA 3DI3B 3G9VA 1X5FA 4FD0A 4G1EA 2XPZA 2XFXA 4PJFF 5D96B 3VFWA 3EADA 5JQIB 1CTMA 4FQXC 4H2CA 4NZ8A 4HG4J 1WBZA 1UB6B 4JFDA 2ZUXA 3S3JA 1MY5A 5ABDE 5G4OA 4BA0A 1DLFH 3RGBA 4UQAA 4JO4L 5IHHA 3IDMA 2NY3D 5I6KA 4FXGA 4K94L 5DVLA 3UZVA 3F12B 4OCXH 2YD0A 3I9GL 2P26A 4F5CA 2BS9A 3CSYA 3T2NH 1IQWL 1D5IL 4WTWA 1Z32X 3TJHD 3KW7A 3BN9D 4I9WD 1MH5B 2TAAA 2Y9RT 4ANUA 1HHIB 1X4XA 3GMMB 3ZKXC 4F7EA 3TBSB 3G5WA 5LDUA 3NPZB 5IVXA 5CU5A 4PGCA 5I1KL 5F9JA 1I7ZB 1S9YA 1U93B 4JDTL 4PTUA 4OGYH 5DRWA 4PS8A 2N3JA 1CF8L 3SDYH 4X9YA 2JJVA 3H4FA 4R8WH 3SKMB 3WNMA 4JMNA 3F8UB 4Y1AB 3ARSA 2ESVE 3B3IA 5EWIL 2X6BA 1BW8A 2H0PA 4XAKD 4W9KC 4ONFL 4EQ2A 5KSVB 5EBWA 3MODH 4LGPB 2DAVA 3CXHJ 1ODUA 2X05A 2NOYA 2OZ4L 4FFYH 1EJOH 3U4EB 5ID0A 3QDJD 4NQCD 3UTSE 3N0PB 3RGVB 3U79A 3EJUA 2P5EA 3AUVA 3MR9A 3LZRA 2IDFA 1U8OA 3BQUC 3HNTH 1IGJA 1ZS2A 1MWAA 3VM5A 3L9EA 3O9WA 2HTLD 2ZSVA 5D1QE 5HGHA 4O2EA 3R19A 1T22A 4XH2A 2EKJA 1V3LA 1OTUD 4HPOL 2FJHA 1KLUB 3SEPA 4LL4A 2W07B 4OKDA 2Z31C 5GGSA 4MCNA 5GGVL 4HFWB 4XR8C 2F7QA 4EUPA 3KBPA 3RIFF 3UYRL 1PLAA 5IW6A 2H5UA 4PY8I 4PJEB 1S9KC 3ELQA 1KENH 5FAAA 5LKNA 1N59A 2QV2A 4MRCA 4PB9L 4EIUA 1BQ5A 2B39A 2J71A 2EDTA 4HBCL 1QEXA 1OT2A 2HSIA 4P2YA 5E8DL 1P1ZB 3L5WA 1T20A 1YQ2A 5FM5M 2FYYB 3IMUA 4UM9D 5A16B 1RK1A 2D73A 4TSCH 4ONHA 5DJDA 3DIDA 1IAOA 4CL7A 1E2WA 3HR5A 3N1MC 1HT6A 2AV1A 3KGUA 4HUWB 4CC0A 5IVZA 5D7JA 4M4PA 5EZIH 1KGXA 2UZYB 4RETB 4Y5XA 1ZLVK 5L2KB 2OYMA 4HLEA 4UNUA 1DEDA 2EEBA 2OL3H 2PWEA 2GAZB 3FU3A 1AD9B 4MAYB 3WN5C 1YZZA 5EU6A 2VQ4A 1N0XL 3PJNA 1EAPB 1I7RB 4IKLA 4IKJA 5LQBL 2HFTA 3ROLB 1E8XA 5HPMB 3QJFB 4M9PA 1KCBA 5IIEB 1H3VA 3LZNA 1OLLA 4XGZB 2B5IB 1DR9A 2IQ9L 5GGQH 4EIBA 5DFVD 4Z7VA 3FU9A 4AJWA 3WXVL 5GQBA 3PWLA 1TVBA 2UZPA 4LMQE 4QT5B 4LESA 3FUDA 4UV7H 2ORBH 3TEYA 1HILA 5DD0L 2VITB 1K5WA 1OSPH 3MZGB 2BP5M 3TH3T 3WS3A 3KNBB 2PR9A 4XNMA 5HYJA 5HYQA 4MMZC 1NDMA 4RIRB 4PGDB 4XE5B 5DHYA 4PB0L 4DJMA 3OJDB 1B88A 3GBEA 3D52A 1FCCA 3SBRA 2H4EA 2A3TA 1BP3B 2UX7A 5BJTA 4R2GC 1JHLL 1BLNA 3UTSA 2R0LH 3SY0A 4IBLT 3JVFC 1YYMH 2BINA 1AO7E 1YYLL 1YPZF 4L23A 3P3YA 1BBJB 3TA3D 1C5BH 5IFHH 2YR3A 3I2CH 1BFSA 2BNQD 2JLPA 3KW8A 5D1QA 3FUNA 3VMOA 2WXFA 3QO1A 1WA2X 1PD6A 2YKLL 1CD1B 5DZLA 3FQWA 3LKRB 2NY5H 4NUGL 1AZVA 3H3PH 4YQXL 3SO3C 3FQNB 4L5FH 5FGRA 4IJTA 4WSGA 1M6OA 2VC2L 4JG0H 4HIJB 2BIIA 3WFHA 3V0EA 3KR3L 1KGUA 4C8XA 4HT1H 2LHAA 4CN4A 1O0VA 3LPWA 5AUMB 5DQ9A 1QBMH 4HEPA 2NY1D 5CJOL 3FTGA 1KV3A 1LQBC 1NMBH 1LK2A 1Z66A 4DOHB 2YEVB 3WEMA 1N3NB 4XMLH 3HBPA 5IR1A 4GAYB 3ZO0A 1JSYA 4GAJH 1LDPL 4KK6C 1IBZA 4N2DA 3ILPB 2XRAH 3HI6L 2ZOKB 5HHOE 4HJTA 3DC0A 2H47C 5KSBF 1SEQL 3MYZA 4K7PX 1Q1PA 2ODIA 3LN5B 2EDFA 5I9QB 5ERWA 4BUGA 1S7QA 1ZLUK 1W72H 4FQ1H 5EH1A 3FOLB 4A6YA 5SWSB 5E6RB 3U1QA 2R2HB 3OKEA 3FCGA 1RV6X 3CN3A 1MCWW 3WY4A 3AMKA 1P5UB 5C6TL 5ISZD 3O6FD 3MBED 3CU1A 6FABL 3EAKA 1L3WA 4ZO6A 1TEYA 4NO3A 1VEOA 3NZ8B 4W4NA 1QHQA 1FORL 3ATFA 3GJFB 3QUGA 3L54A 3QARA 5DS8B 3VNYA 1T66C 2VJXA 4FXGC 3WN6A 1BAFH 4X8JB 4DN3L 4BH8B 5DZ9A 1XXDC 1JJUA 4U1MA 1JZIA 5GGUB 3HJ0A 3QPXH 3OC8A 2L7JA 3WUWG 4MCYA 3RA7L 3NK4A 4IS6B 3NCBB 5T33H 4ELMB 2MRYA 1CXEA 3MV01 4PS7A 2AK4D 1JWMB 2R29H 4MCZA 2G5UA 3CV5A 1ID5I 3WG7B 1ACYH 5L88H 5C7XL 4WWID 4C58B 3BN3B 3M1BA 4KGJA 2BRRH 5DQJA 3ZL4H 4I0PB 4FRWA 3C9NB 3M6DA 3PUCA 1JZ7A 5CEZL 2F58L 2UVFA 2OCCB 4M3JA 1G9MC 2YRPA 2PR4L 3SGDH 1CFSA 1G6RH 1ESOA 3QG7H 1AO7A 3VFGH 4NQQA 2K0RA 2EDYA 4JN2A 3IDGA 2AMUA 3RIAF 1P9MA 1RIUL 4OW6A 1OOWA 4YBLC 1BFVL 5I17B 4FYSA 4P9MH 1FVDA 4GEJA 1L5GA 1PZ3A 3D8MA 4XN1A 2KERA 1AMXA 3OKLB 4I77H 3DURB 3FQUA 1U3HA 4JRYE 4QOKA 1ADQL 3P1VA 3QJXA 3JUZA 5EZLA 3VFUA 1IFRA 4X5LA 5E08H 4Y9FA 1MZZA 2ITCB 1KJ3H 3O9WC 4JMXA 3LSOB 3PYCA 2CIIA 2YUVA 3JZYA 2OKMA 5A2FA 2BHZA 4G43B 2C26A 1OGAA 4PJIF 4W9DC 2R1XA 2GSGA 2IF7A 3NBNA 2I9LB 1CD0A 5H37G 5KSAA 2K7PA 1A4KB 4PN6A 5HHOA 4PI0A 3VWJD 1NCTA 1YCSA 4PVLA 3AM8A 1I1FA 4XXDB 4LSQL 4N90E 4NI6A 2VXTL 3CJJA 4YE4H 4XWGL 4LCCA 1EEYA 2QQNL 3BLKA 3GK8L 3RY4A 2LU4A 4L4TB 4IJ3C 1NC4D 2FX7H 3RVTC 1WZLA 4FTVE 1JHKL 1OWWA 2PYED 3TT3L 1SHSA 2YMTA 3ZE0B 3TEZA 1DQIA 3BZDA 3SE9L 4O51B 3FTWA 3DETC 5D7JC 4Y5XC 1ASOA 4ZMOA 1U4FA 4QNPE 1UKQA 4PCTA 4UT6H 4AGPA 4HPYH 2FHCA 2W0LA 5DA0B 1VFAA 3VSUA 4EF3A 3HE7D 3V7AG 5HI5C 2UZXA 3HG5A 3LZPA 4WFFD 3MV9B 5IT2H 1KTJA 1NM9A 3TV3L 5E9DE 3OX8B 5I0YA 4OZHE 5H4YA 4PJDA 2Z92B 3PWJB 4MJ5A 2WW8A 3P77A 4NWTH 1FL3B 3HKZA 5KSUA 1YC8A 4IK7A 2X3AA 4U31A 3NACL 4B96A 3GRWA 3F7QA 1SUHA 1G0XA 4Q97A 2VQTA 1OCWH 1CPUA 1QTSA 4K7PL 4W9IC 2D03L 1M9SA 4Z7UF 4QRQA 3MA9H 5SX5K 1SY6H 4HK3J 3QNYA 3QS3A 5BZDB 2V5TA 4R3SA 3BUBA 2Y07L 4OLZL 5J6GB 1MRDH 1O5DT 1B0RA 3T4YA 5AENA 3FFCA 4KKCC 2ENQA 2AEPH 5GRUH 1P7HL 3GHBH 3WIHA 3LKPA 4JRYA 4B9IA 5KVEE 4ALAH 4Y0GA 4UAOC 4LL1A 1KUMA 4GAAA 4JM2D 1PSKL 1V54B 2IWEA 2WCGA 2IGLA 1CIDA 4DP0X 5AEAA 2YPLB 5JHDB 2AEQH 4JPKL 3FRPB 3Q01A 5D1QC 1A9BB 3IU3A 4KK9D 2XACC 1V7NL 3QEHB 4R90L 1JYNA 1LM8V 2LTQB 1I3VA 2H7WA 3TL5A 1CI3M 1Z9OA 3JSSA 4NHCH 2MOGA 4LHUD 4O5LH 2K8QA 4YFDB 1ZLWH 1UZ8B 4ZS6D 2IOIA 2QPEB 3FTYA 5D7LD 4Z7OB 3P4NB 4DKEL 2ALAA 4KRLB 4Z78B 4Z0XB 2VLJB 2H1PH 4I3SL 1QWHA 1IC4L 1UD8A 3BGMA 1EFXB 2QEJA 3E6HA 2Y7LA 3E3QE 4GO6B 3QR2A 2VYRE 2ZCLH 3LHPH 2ZWLT 3MRHB 4M5ZL 5E7BA 2EQDA 4PW4A 2A77L 4FTVA 3QDHA 1PG7X 4K8RC 1M42A 1SXCA 5GGTA 4HSAC 3WHXA 3UABA 4PD4J 3MOBH 5I30L 5JPMB 4F27A 1QPXA 1P5VB 1AXSA 3U4KA 3L3KB 2UYLA 1K2DB 3O4OB 3X13B 4XVSH 4CBZA 3MRRA 1CICB 4ZFZA 4NQDE 2ZYRA 1MXDA 2VDPL 1N18A 3KPSB 1BQLH 1WVZA 2B59A 4ZFOL 3TEXA 1RZJC 3V52L 5B38G 5JHLA 5JTWA 3LVTA 3U7YH 5JW4Q 1MI5A 1UA6H 4NZJA 1KCSH 5KS9E 1FL6A 1A14H 4KK8C 3DROB 2KH2B 5E9DA 3EH2A 4M7ZB 5D1ZA 2P8LA 2HKHH 1IV8A 1S7WB 1RK7A 1JTPA 5GRWA 4NAQA 1NEZB 1R24B 5CD5D 2AJZB 2IXQB 3B7TA 5C0AE 1A6AA 4LVNB 3ZTJH 5IHZB 3KDMA 2YGVA 2PN5A 3IGLA 3V9EA 1IM3D 4IDJL 4Y5VB 5DA4A 4KO5A 1YDPA 1JZDC 2BXYA 3KD4A 3MLRH 4P2QE 3ULVF 1E4XI 1IBHA 4NCC1 1OIOA 5HY9B 4NERA 3W9DB 4ENED 4ZZFA 3K71B 4HS8H 5I74C 2HT3D 2XWBB 1M7IB 5AW6B 3MRPB 1G1YA 2EDWA 4LRNH 4DQAA 2WGXA 5CR1A 4HWBH 4XP5L 1MCBA 1TMCB 5LG6A 2FX9L 3LKQA 4PJGB 4ES8A 1F4XL 1YEHH 2EDMA 3STLB 1K8IA 3BAIA 3CFCH 3LY6A 4O2CA 5C2BH 4LEXL 5I71C 1GJIA 4EDWH 2EE3A 3AT9A 4PRPB 2X2YA 4MDIA 4LGRB 4X4YB 2Y5TA 2VH5L 1P9MC 3SODB 1MHEA 3VXPB 2AXGA 4KUCD 4DN4L 3NJJA 1HL4A 4XN9A 4CN1A 4Q0XL 2G5BA 1J7VR 3FMGH 1P1VA 2Z91B 3RWHB 1NWPA 3M7OA 1JS4A 2VDPB 1U3HC 4ZFOB 4KO9A 4JFPB 1GMIA 1DQLH 1XH2A 3OR6A 3BUTA 4JPIB 3TYFA 4N8CL 1DP0A 4PJCA 1OSEA 1N5YH 1EUUA 3KPRE 1AGDB 2Y7QB 1IT9H 1DVSA 4LOUC 4L0ZA 2X4UA 4V2BA 4J3VA 1TJGH 5T1JA 5D71L 1TJHL 3GSQA 4PWHA 1RIHH 3M8OL 1PPIA 3IDNA 3IFLH 5FOJA 3UMTA 3KYOB 1R3LA 1S5IH 1XGUA 3VTTA 3AREA 1IARB 4ODWA 1E28A 3D85A 1DE4A 3WL9B 1F00I 5KSAC 1ZLVH 4G8FA 2DQUH 5E6UB 4Q6IA 4Q89A 2VJ0A 4JKPH 5JW4R 3FB5A 3L3DA 1MOEA 5CAYB 2J7LA 3AM8C 4A7GA 3HLAB 4QD2E 2NY7L 2H2SD 3EFFA 2CAKA 4P3CL 4NQDA 4ZD3L 4GSXA 2OP4H 2VDKL 3MJ8B 1XHHA 4LCCC 2A73B 5CZVL 3IAGC 2FUQA 4G7YH 4F2MB 2QDVA 3O41B 4JY4A 2QGCA 4R97B 5DC9B 5ITFB 5IW1A 5KS9A 1U92B 3EH4B 3MV7B 1PKOA 5C08A 1BREA 4ERSH 3GZQA 4KOCA 2WQVA 2XV2A 4PS4H 2J6EL 4WF7A 2CJTA 4DO5A 1VAHA 4YR6A 2P8PA 4AH2B 2PLTA 4P2AA 5CIPH 1A6ZA 4JLRA 2HUEA 4P4RA 4BDVB 5C0AA 2CJUL 4QRSB 3L5XH 1V27A 3O11A 5F6HI 4E41B 8FABA 2X87A 3X1GA 3V0HA 3CPLA 1CF1A 3S5LA 1T6VN 3HUJB 4BSVA 4MQTB 4G8AC 2WLKA 5BXFB 3S3CB 3DV6A 5F3BB 5EU5A 4RMTA 1JHTB 1PNDA 2NY2D 1T2QH 2ZYHA 1TNMA 1KV7A 3GBDA 4AQ1A 2YZ1A 4XX5A 1PG7L 4WI8A 1P2CA 1SHXA 1NFDB 3ATDA 3LKNB 4XCFL 5JXAH 3HZVB 1RPUA 1Y7VA 2V5YA 2J72A 1JTTA 1KFAH 4YSDA 3VVWA 4AYDC 5JOPD 5C0FA 4A6YH 5FM5O 3FTSA 5GRZA 5CEYB 3RDTA 2JFCA 1X5HA 3LH2H 2NY4B 5GGRA 5CLXA 5JNYB 1WUNT 4Y1AE 1HL9A 2PO6D 3Q1EA 2VDKB 3KPNA 4L37A 4XMWA 2BVPA 1KNOB 2YXMA 5BVPL 3ARFA 5JOFB 3KPRA 4MJ6B 4LFHD 4XB3A 3V4LA 1UM4L 2Y36L 5FO7B 4YHKH 4ZTEA 1VESA 1EHLL 1CGYA 2F53D 2P24A 2ZCKL 4FN0A 4U6TA 5CJXA 1AJ7H 4BINA 3GHEH 2R69L 1ZA3A 3G3LA 4M29A 4YXLH 4WTXA 3NCYP 2XN9E 4JBSA 3LKSA 4URTB 3IT8D 2Z7YA 4U6HB 5KJRH 1FP5A 3HHRB 4RA0C 3V4VA 3PGDB 3FHQA 4WGKA 3AXHA 1ZLUH 2Y1AA 5EBLB 4HETA 2Q3XA 3T4AA 3WY3A 4AENB 1JGUH 3N85L 1NAMA 3P4LA 4ADGA 4AY0A 1E9QB 3LDBB 1FPTL 1I4FB 2ITEA 3DSFL 3JYBA 3MLYL 4K2UL 4PV8A 5DZPA 1NUNB 1SJHA 2CUHA 4LGSB 4HZ1A 2AW2A 3B2MA 4YGVA 5F7YC 1FF5A 2JI1A 1F3JB 4RMSA 1I3UA 3CG8A 3TYGH 3DX9B 4HAGA 3PF2A 4PJEE 3SDAA 4X6FA 1YNKH 2CG9X