4YSUA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 25.0 mgy
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
total genus 97
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysuA00
1NIBA 3T71A 4KO6A 4NAJA 4HCIA 3KW8A 1NIDA 2IDTA 3GXUB 1ET7A 4DP2X 2IDQA 3QJUB 4PCYA 4DP6X 1NICA 2PPDA 3EHBB 1NPJA 4YSDA 4HIPA 4G72B 4A67A 1JXFA 1E5ZA 1M57B 2DYRB 1OE3A 2XV3A 1DZ0A 1TU2A 1N70A 1JZFA 3ABKB 4E9WA 3X1GA 4EF3A 4WTQA 1W6LA 3IN0A 3QJRB 3TA4D 4K9JA 1WA2X 2UX7A 2J5WA 4F2FA 1AS6A 3PPSA 3CG8A 2OCCB 2PP7A 2Q9OA 2WO2B 5E9NA 3NJHA 1AR1B 3SQRA 2QDVA 3V9EA 3FQ2A 3FSAA 3CVDA 1J9RA 1NIFA 2GSMB 4DP7X 2Q5BA 4YSPA 4N4YB 2YAPA 2OV0A 3S3DB 2QPEB 2I7SA 2N0MA 4BDVA 1L9RA 2DYSB 3NT0A 2HX7A 5FC9A 3NP4A 3ABMB 1RCYA 4G7SB 2UXFA 3WNJA 2B08A 3ASNB 2YXVA 4GY4A 1JZGA 2BW4A 4E9QA 3FPXA 2EINB 4AI7A 1MZYA 1OOWA 2OJ1A 3OMNB 1JZIA 7PCYA 3S3BB 4HZ1A 4FA7B 1PNCA 2GC4C 1E67A 1NTDA 2IWFA 4QLWA 2QT6A 3NJIA 3CDZA 1AANA 2GB2A 1SDDA 3QJSB 2CALA 2XV2A 3WG7B 2FJSA 1OCZB 3AG1B 2VMJA 4KO7A 5AZUA 1CUOA 4HAKA 1E65A 2GBAA 3NJNA 2PLTA 1ADWA 1BQRA 1PZBA 2A3TA 1J5CA 1KBVA 1NIAA 1ZIAA 8PAZA 5I28A 3HB3B 2I85A 2EIMB 2GI0A 1WA0X 1BXAA 2PPAA 1W6WA 1NIEA 4CSZA 2FQEA 4W9ZA 5EHFA 4E9VA 3DTUB 3SBRA 2RACA 1J9TA 1ASPA 3GDCA 2YAOA 2PCYA 2BW5A 3T6WA 4BWTA 4MFHA 3U25A 3X1BA 2FWLB 2XX0A 1L9SA 2IH9A 1AZCA 1GS8A 2PPCA 2PPEA 4YSCA 2CUAA 4YSUA 1A8ZA 1W8EA 2BO0A 5B7MA 1NDTA 1SNRA 2ZOOA 1MDAA 1PNDA 4DP9X 2YQBA 2IWEA 1ILSA 1KDJA 1BQKA 4NERA 1RZPA 3IN2A 4DPAX 1NWPA 5I5IA 2JFCA 1AACA 4HHWA 3SBQA 1EHKB 1R1CA 4F2EA 1MG3C 2DWTA 7PAZA 5LDUA 2P80A 3CVBA 1V55B 3X1FA 3JTBA 2EILB 2CAKA 4KNUA 3FYEB 4YSSA 4QKTA 2JKWA 4BDVB 1AOZA 1ILUA 1BXVA 1GS7A 2BWIA 1GY1A 1WAEA 4P5SA 3OMAB 5I6OA 1A4CA 2XUWA 3CZUB 4KO9A 2FQDA 2HZHA 2YAHA 1GSKA 1FA4A 1ZV2A 1TEFA 3PAUA 5D4HA 4E9SA 4NB7A 1M56B 3QQXA 4N8UA 4YSAA 3S8GB 3ASOB 2W8CA 4E9TA 4AZUA 1PZAA 3CDZB 2FNWA 1SDDB 4WKXA 1TEGA 1FWXA 3AZUA 5B1KA 1ET5A 3X1EA 3TASA 1NWOA 4M4RB 1JOIA 1UATA 1J9SA 1JZJA 2PPFA 3N2JA 3EF4A 4G7RB 4GXFA 2IWKA 3FU8A 2AVFA 3QJTB 5F7AA 2XYBA 1MG2C 1URIA 2NRDA 2UXTA 2W88A 1JVLA 2XVBA 3EH3B 3IBOA 3PCYA 1JZEA 1AQ8A 6PCYA 2HRHA 2VW4A 3FSWA 4UAHA 3GYRA 3FSVA 3FQYA 1OF0A 3FU7A 4UANA 4HHGA 4L0PB 1KV7A 3IE9A 3NP3A 4YSEA 1AAJA 3UABA 4DP4X 3FSZA 4E9YA 2XX1A 1OV8A 2FQGA 1SHXA 3AY2A 3N55A 3UAEA 3UADA 3ZX1A 1DYZA 3H56A 1GW0A 3IEAA 1KBWA 4FAAB 2XLLA 1QLEB 4BXSV 1KCWA 2DWSA 5F7BA 3NJMA 1BEXA 4BXVA 2HX8A 4KOBA 1AZBA 3L45A 2WO3B 4BWWA 1L9QA 2Y1AA 2YARA 3FU9A 4A2HA 1MZZA 4KNSA 4DP8X 3OM3B 1VLXA 1XB6A 2YAFA 1GS6X 5AFAA 3S3CB 1ID2A 1ZPUA 2LLNA 2BZCA 2IDFA 3TBBA 3ZIYA 1NZRA 2BP0A 2YAMA 3JT2A 2BP8A 1ET8A 5B1JA 1OE2A 2H47C 1A65A 3T9WA 4F7KA 4YSOA 2VW7A 2YAQA 2BHFA 1JERA 2H3XC 4YVNA 1ASQA 5I26A 1AZNA 5B1BB 1E5YA 1IUZA 2XXFA 5AKRA 2ZONA 2IH8A 5B3SB 3WNIA 2UXGA 2X87A 1KDIA 3V9CA 3UAAA 1SJMA 3HEIB 4A2DA 3AG2B 9PCYA 2JXMA 4DP5X 2GHZA 1IBZA 2FT6A 3PAZA 1BQ5A 1BAWA 4JKNA 2MRYA 1B3IA 4A2EA 3D12B 4W1TA 3FQ1A 3BVDB 2HLEB 4KNTA 1OCCB 3X2QB 1GY2A 2MTAA 3CVCA 5TK2A 1QHQA 2VSKB 2Y69B 5PAZA 4ZK8A 4AKQA 2XU9A 1V54B 4AKPA 1WA1X 1EZLA 3FU7B 1WS8A 2HRGA 1RKRA 2XWZA 2FT7A 4P5RA 2E86A 3FS9A 5ANHA 3EH4B 1PAZA 3KW7A 2TSAA 4G7QB 3PLYA 1F56A 3UACA 3AW5A 1CYWA 1NPNA 2YAEA 3G5WA 4DP0X 2J55A 1AS8A 1BYPA 3WI9A 1ZIBA 2DV6A 2IDSA 4HALA 5I5JA 4CSPA 4GP8B 1WS7A 1I53A 5B7EA 1IC0A 2CBPA 1SHWA 1L9TA 4A68A 4ENZA 1ZDSA 2P80D 4A66A 3RYMA 1M9WA 1PLAA 2PCFA 4JHUA 4YL4A 1XMEB 4GP5B 3TBCA 5D4IA 3DIVA 2BP0B 3AG3B 2BP8B 2PP8A 2FTAA 3NJGA 3WKPA 3DKHA 4Q89A 5B1AB 4Q8BA 2AFNA 1L9OA 2J56A 1SF5A 3ZBMA 4DP1X 5I6NA 3QJQB 5PCYA 5IY5B 1GR7A 2CCWA 3FT0A 3PXLA 3FYIB 1E30A 3MBWB 2AANA 3NJFA 2AZUA 1PLBA 2XV0A 1CURA 4JHVA 2GC7C 1AS7A 2VM3A 3T6XA 3ABLB 4E9RA 3H4HA 2FT8A 1BXUA 2IDUA 4YSTA 3WIAA 2R7EB 1J5DA 5B1JC 2EIJB 4A2GA 1AG6A 3PAVA 3UGEA 3TU6A 1RZQA 5I6LA 3ERXA 2BZ7A 4AKOA 1HAUA 1N68A 3C75A 1QNIA 2J57A 3NSFA 1SFHA 2EIKB 3QPKA 1PF3A 2ZWNA 1IBYA 1KGYE 1IKOP 3EH5B 1ETJA 2VW6A 4KOCA 1JZHA 4BWUA 3NJJA 2B3IA 3OMIB 6PAZA 1PY0A 2HXAA 2XXGA 4G71B 3T6VA 3S8FB 4YVUA 1TKWA 1HAWA 3BQVA 1A3ZA 4HCFA 2PP9A 2TSBA 2WSDA 1L9PA 1BYOA 3NJKA 3WKQA 1XB3A 1KYAA 1AZRA 1PMYA 2H5UA 1XB8A 3NYKA 4UF7C 4PAZA 3H4FA 1GYCA 1KCBA 5I5MA 1HFUA 2UXVA 3NSYA 4BK5C 3X1NA 5I6PA 1SF3A 1X9UA 5D4JA 1NINA 1AZUA 1J9QA 1OE1A 2ZXWB 1JVOA 1T5KA 4AX3A 1AIZA 1ASOA 1SFDA 1X9RA 3FPYA 3T6ZA 1JXGA 4TXVB 2CJ3A 1PCSA 2R7EA 2VM4A 2VN3A 3NSDA 2AZAA 2FQFA 4E9XA 5I6MA 1CYXA 1OCRB 2QDWA 2VSMB 3NSCA 2I7OA 4DPCX 3OD3A 1A4AA 1AG0A 2X88A 5A7EA 4HCGA 1YLBB 2IAAC 4GYBA 5I6KA 3ZDWA 3NJLA 2YXWA 5B7FA 3SBPA 3AG4B 2UX6A 1CC3A 1V10A 3ABGA 4G70B 3QJVB 2DY2A 5TK4A 4YSQA 3OQRA 4RH4A 4DPBX 2GIMA 4A2FA 1PZCA 1FFTB 4YSRA 1OCOB 4GP4B 1JXDA 1A4BA 2QPDB 4KO5A 4X4KA 2HX9A 4M3HA 2BWDA 1PLCA 3MX0B 1ZDQA
chains in the Genus database with same CATH superfamily
4TSAH 4U3SB 3ZE1B 4NAJA 3S2AA 1CXEA 1L0YA 1UOKA 2I07A 4N86A 2Q86A 3MNZB 4RFOL 4LP5A 3LIZA 1E2WA 4PJ8A 2G75A 1KZQA 4ECNA 2PTUA 3EHBB 1NPJA 3SKOA 3TO4C 4B96A 5BUGA 1ZHLB 4GKNB 1I9IL 1OD9A 1ZTXL 2PYED 4M02A 5I0VA 12E8L 2JLLA 5IMLB 4HZLA 4L48A 3ZSSA 4YE4L 3MV7B 4XZUA 5DD0H 4K9JA 2LAAA 5KVGH 4PR5A 2VDPL 5D2NC 5JO5B 1GXEA 1G94A 2VDPB 3CN1A 3CG8A 4X4XA 2FJUB 1J8HB 2QZQA 1HHHA 3ARTA 3X12B 3NJHA 5JZ7D 4LSUH 5JDSB 2VLJA 5I75B 2VN6A 5GS1A 2BY2A 3BQUA 1OAYH 2SEBB 3ARFD 1RERA 4KHTH 3SDDA 5CCGE 5MEOB 2Z4QB 3CDGA 4HOWA 4YDNA 1LO3L 4RZKA 3CZSA 2AJXL 2X0VA 2J44A 3SE8H 2CIIB 3V6BR 3P4LA 4IRSC 1JPSL 1IKFH 1UJ3C 1AD9B 3CFBB 1ZHNB 3KCPB 2A6JB 2R29L 5IWLC 3MV8E 1R3JB 4XNZB 2ZZUT 4ZPTA 4RMVA 2H2PC 3MJ9H 3LQZB 4D9QE 3IDGA 1GOHA 3W0WB 4QHUA 3O11B 4Z76B 2ZIDA 2O5ZL 3VSVA 4XC3L 3VQ2C 3D18B 3ULUE 1VFUA 2N7BA 4WEBL 3POHA 1LP9F 1OSZB 3QUKA 1V3MA 3LZFL 1CE1H 3QJSB 3S4SG 2F1BA 4G11A 5A2FA 5HSFA 2HTLD 5AZUA 1UOVA 3KGSA 5CZVL 3BSGA 4JAMA 3SKJL 1YPZF 3NJNA 3U1PA 2FZ3A 4AH2B 1T2QH 3FH5A 4KRPC 4F15C 1VHPA 2OSYA 4JQVA 3ZL2A 1PD6A 2B20A 2NXZB 4H13C 3WFHA 3BAIA 5GGVH 2PW1A 4XPGL 3U46A 3RL1A 5AVRB 5SX4H 2NR6C 1N0XH 3HJ0A 1ZK9A 2M1KA 4BKSC 3PQYB 5C7ZA 1V7NL 2IQAA 4XN1A 1MN4A 4M5ZH 4LLAA 5A1AA 1I9EA 5D7JD 1T4WA 3SBRA 4J3BA 3PNRB 2RACA 2NNAA 1DANU 2K6YA 2YAOA 4QRQA 3S98A 3S96B 3CFCH 1T89C 2FWLB 4HJ0C 1QD0A 3I3BA 1GS8A 4UZUA 1U3ZA 5DTFA 2MOVA 5EBMA 1I1FB 4ZMPA 1WZMA 2OMBA 2OYPA 3JWDC 5D2LF 3K71A 3D85D 1TG8A 4U0RC 4NNPH 1PKQA 1MDAA 4IIZA 4NQCA 5CBEB 1MRFL 4LO9A 5CEZE 2J3SA 4Y88A 3IXTB 4ZODA 4BZ1H 4XP1H 2PR4H 4YS4A 4L4VD 1A4JA 3UTTD 3L8QA 2P80A 3MRPB 3KJ4B 4HJIA 3JTBA 1RJCA 4JDVA 4PTTB 3VI4F 5D72H 1OK0A 2A74A 4JFFA 5JOPE 3RZCD 5E0FA 2CO3A 3DO4A 3HNTL 5H37H 5CIPH 1NMBL 4KX9A 1ZVNA 1XR9B 1CD9B 1Z5YD 4OCXL 4R4NC 5C0NC 2MWCA 5TQ0H 2CMRL 4FQJL 3DPBB 3EYFB 4P23A 5F7EL 1J05A 2WGXA 2Y9RT 4NO2B 4YXHH 1GKEA 2NQDA 5KSAD 1RUAL 4PI2A 2XWDA 4RNRB 5E8PA 3M86A 5KANG 3HC0B 3EOYG 4N8UA 4U6VH 5KG9B 1L7IL 5IHZB 1JZ6A 3K3QA 4DOHE 4WI9A 5HGDA 1QPPA 3KJ6L 1UWEH 1AJ7L 3PHOA 4W9JC 2RB8A 2P5WA 2R23A 2QVMA 1NFDF 1ROCA 4AYID 3B9EA 3N2JA 1MCRA 2XN9B 1G7MA 4ZUSA 5CINL 4OIIL 1J87A 2VMCA 4JRLA 4WEUD 3FU8A 2N01B 1YPZA 2B0SH 3HOGA 2K4WA 5E56A 4F20A 4DETA 5HHOE 4EIBA 3G3LA 1J10A 1RUQL 2CDFA 3PWPD 3QIUC 4ZUTA 1XF3B 4Z3EA 5LQBH 1NCUA 1MHEB 3SO5A 1JZEA 1N67A 1Z9SA 2NYYD 3RUGE 2IALB 5HI3C 3RGVD 4UAHA 3FSVA 4P4KB 4XMPL 4HS3A 4KROC 4AJYV 1HI6A 2NZ9D 2ZXQA 1D3CA 4F24A 4MJ5B 3MLYL 5H8DA 3D48R 3Q05A 1KPVB 2JWYA 4DP4X 4QGYA 1OV8A 2FQGA 4ETQA 4HS8L 4HIHA 3UAEA 1X9LA 3DGGA 5E4OA 3UADA 5HJBA 2UY7A 3LKNA 5KBKA 5FUCC 1QATA 1AFVH 3JTSB 4ERSL 5TE6H 3S48A 3GBDA 5F7BA 5KYUA 4MAYD 3SYPA 3BEVA 5D2LA 1FFNA 1W80A 4F7EA 3WIIH 2C1OB 3HRPA 5E5LA 1DQIA 4PJGF 4XMLL 3ES6A 4MYWB 4JG1L 3GRWA 5F9AC 2VLRB 1YC8A 1X5ZA 5JIHA 4OCNC 4KNSA 1H3TA 2F58H 2Y3AA 3GEFA 3V6OA 2W9LA 2DQIL 1LDSA 2E9GA 2WVSA 2Z8SA 3LRMA 3BT2H 4ELKB 5M7QA 2O5YL 3VI4A 3I50H 2X4NB 4FA8A 4GW5A 4LCIH 1CIUA 5C70A 1HH9B 1V3JA 3DJSA 5DJZA 3DGCR 5IR1A 3HHMA 3NGBB 3L17A 4FHJA 4HLEA 2GJ6A 2RTTA 5CBAB 4ZMQA 4FJZA 1NMAL 2FWUA 5IW3A 3TT3H 1IQWL 1E9PB 3GSUB 4MD4B 3WTXA 3GI8L 4JFEE 1T6BX 2CIKA 3V0EA 1B4TA 2NNCA 1ZXKA 3IJ7A 3OHXC 4XP5H 3UBXA 4IOIB 2DWYA 5SWSB 3SCMA 4HJSA 2B16A 3O6FA 2NCEA 1QTPA 3NZHH 4NFCA 4OBSA 3ZHDA 1QYGL 4Z7NE 4XX1G 2FT6A 4ZFZA 4KZEL 4OZ4B 2ZUQB 4L1TA 1BA9A 2PWHA 3TFBA 4GQZA 4MDIA 3U2IA 3UL4A 5E7FA 4PG2C 3MRRA 4HGMA 4MX7A 1C1EL 1SBSH 3L5IA 4AKQA 5DSCB 1UWYA 1NGXA 2F7RA 1BBJB 3HJEA 1RZJH 1U92B 4W9EC 3B9AA 2PYEA 3JWNG 1WS8A 2DM4A 3B34A 2BVPB 2EKSB 3D0AA 1R46A 2QQLL 3FS9A 2CO4A 1ONQA 3WJLA 4H44C 2VYRE 1MJUL 4OCRL 5BO1L 5I1KH 2UZIL 1I4FB 3EO1A 4N8PA 4AQAB 5IJDC 4M6OH 1E5UI 2YS4A 3AB0C 2YUWA 4GI8A 1KIQB 3D06A 2ZYIA 2YRLA 2XFGB 5GGRA 3S37X 4HKJB 1BYPA 4LSVL 1Y6MR 4UNUA 3P4OA 1U8HB 4PJHB 1S7RB 2EC9T 1GGCH 1SJXA 4OJYA 3LS4L 4K7PX 5K59F 4P04A 3UGXA 1CGYA 3ARFA 4OCWL 4PJGA 3VFWB 4JRXB 1HVXA 4AGQA 3FCTB 1OGTA 2FSEB 5EBLB 4EUPH 4TQIA 4W70A 2BP5M 1UD6A 1KJMA 2QTEA 4HSCX 5BOPA 3CFKA 2ZOWA 3MNWB 2P42B 4WEEA 5EZIH 1TEYA 1X3DA 3E38A 5J6HA 3LZQA 1FO0A 5LO7A 4YDLC 4N0UA 4APQD 2AGJL 2EYRA 2BP0B 4NRZB 2RCSL 3VJ6B 4PWIA 3E7JA 1DJWA 2FWOA 3RVUD 4YWGH 4X99A 5EUKB 2Z0UA 1O9WA 4GMTH 3H2WA 1SLVA 2GT9A 4PWKA 1VJSA 1YEWA 3U0TB 5LN4A 1PYWB 5DRNA 1NCCH 2IBGA 3IDIB 5JPNC 3FUJA 4ODXB 1OT4A 2OZ4L 5DK2A 1M7DB 4OF3A 5CN1A 4NP4H 2AABL 2FT8A 5EU3B 3H3PH 3L5XL 3L7FB 3MSPA 5CJBA 2ALAA 2KS0A 2VXQH 2EIJB 1J88A 2AJYH 2VABB 3OAZH 4NWTL 5TE4H 1HNFA 3OLGA 4TTGA 1E40A 4IK6A 1ZAGA 1FZOA 1A6PA 3HI6L 3OAUL 3DUSA 4GQPH 3VSQA 3AAZB 1N68A 2JJTA 3QPKA 5EULV 1IBYA 1H0DB 4XGZB 4R90H 3EUDA 3HFMH 5CJ8A 1XF1A 1JHKL 4ISVA 5C0AD 1MJ7L 2I27N 1LO2L 5GISL 4MQ7A 4QYOA 3D33A 1HAWA 2NY6B 3ROLB 5LGHH 4HCFA 2PP9A 3O3BB 1IAOA 1GH7A 1UH3A 2WSDA 4WFGE 4DGIH 4F27A 4ZNCD 1RVFH 2Q0ZX 4K71B 2WBJC 1DQQB 3ARXA 5I8KH 1AZRA 5FA3B 3D85A 4ABVA 4LB8A 5C0BE 1N2RB 1U8LB 3GJFB 1KB5L 3OXSB 3IGKA 1FG9C 1XTLA 4F9LA 1FH5H 4X7TB 1ND0B 2IG2L 2R0ZL 4TPRH 5CJOH 2CLVA 2W91A 3P2DA 3FPYA 3T6ZA 3FTYA 4L4VA 5E00B 3MUGA 2F53E 2CHDA 4NO5A 1LP9B 4RQQB 3RTQC 4QXTB 4UTBL 4X5LA 1AY1H 3KLAA 3QXDA 4RFNC 3DX7B 5DD5L 4R6UA 4N5ED 3RZCA 2ENJA 4OM1H 4OLZH 2CA3A 2PCFB 3NFSL 2HJFA 1P2CB 1Z6JT 3GWJA 4XHJD 4YFDB 3IBEA 5A3IC 4LCWE 4FQLL 2CLRA 2WQ8A 1VFAA 4P5TA 1I7RB 1TDQA 4LQFH 5KSAA 1AZVA 5F0MB 5JYLA 5KVDH 1F45A 5F3BA 3EO9H 4G70B 4O02L 1DFBH 1FL3A 4W9DC 2C9VA 3LNHA 2P4AB 1U4FA 4LVNB 5IVOA 5I8OL 5TK4A 5KSUA 4PJIE 4MCZA 1A7BA 3FTGB 4WJ5A 4GNKB 3W5MA 4MD0B 3PGDB 1YG9A 2AJ3B 3B1TA 1PZCA 5D7KD 3BGFB 1XL4A 3LPFA 1JXDA 4KKNA 4QHNB 4IK7A 3O0RH 3CSTA 2P1YA 4JQXC 5IOPA 4R96A 2MPAH 3F5WA 4OT1H 3MRHA 4Z7VF 2EE0A 1RZKH 3CVHH 1QLEH 3LKSA 1SOKA 5J1AB 1OP9A 3PWPA 4POYA 3D4CA 1T80A 1F4XH 3AMKA 4HCIA 3QDMB 3GXUB 4H8HA 1GHFH 1S46A 5EU4A 1MOEA 2H7WA 3DYPA 3H55A 2V5RA 1XHHA 3RGVA 3SGKA 7FABH 2COQA 4NQSA 1T7ZA 2MNJB 2OMYA 4NI6A 4NPYA 5JHLL 3SKNB 4FQXB 2NDFA 2AMUA 4DN3L 1DVFB 1OE3A 2Y6SD 1TU2A 2LHAA 1NUGA 2XZQH 3DNKA 4DKEL 1N6QH 2VLLB 4XAKD 1YA5A 5GS2D 3KM2A 1E4WH 4GIOA 3FAWA 4LZKA 4JY5H 4HH8A 4ZJ9A 3MV7E 4DZ8B 1ZPLA 1T3FB 4HVBA 2E46A 3NH7H 3MBEB 4FJYA 4LLUB 5KBMA 5T5FH 4MAYA 2AXJA 2VDRB 3F6LA 2PP7A 3RY6C 3FQUB 1RMFH 4NUJB 2V3DA 4PV1C 3VFMB 1N8ZB 3MRJB 4UT6A 4GIAA 2OR9H 2AQRA 3E2HC 1XWVA 1KGCD 4LDCA 2YAPA 5GPRA 3PWLA 5HI4D 5C07E 4ZMLA 2X10A 4U1HA 3CDFA 2C8NA 4WK4B 2N0MA 5FGCB 1A14L 1NFDB 3JT0A 2DYSB 5AUMA 5ALBH 3D39B 3L5WB 1RZ8A 5DD6B 3ASNB 3EBIA 4BSWB 4CADB 2QPFA 3HAEG 4HJTA 2IXQB 2WZ0A 4LLVA 1OOWA 1A2YA 2TRHA 2WXJA 4XMXA 4NQXA 5CUSL 2EDNA 3FOLA 4XO5A 2E7BA 5FV2A 4L9DA 4LCYA 1SDDA 4DSYA 2DIJA 1GZQA 1FF5A 2XWTA 1MNNA 2EIZB 3RX5A 1HCVA 1MFBL 2R4RL 3C5JA 5DJ6B 3V79C 2HLFC 3BKML 4WSGA 2Y25A 1MF2H 2VR8A 4U6YB 1YEIH 1DP0A 5D1ZB 1TQSA 3AABA 1A6AB 1MWAH 2GI0A 1WA0X 4FLHA 5IROC 5EMYA 1MHPL 2MCG1 2PPAA 4Z7VA 2PWDA 1BQSA 5AOIA 9CGTA 5F1KC 3GSNH 1XCXA 2OJZH 4FYRA 3SE4A 3WXVH 1AGDB 4LVHC 1M7XA 4MMYB 4EBQH 1X44A 2W9EL 4MNGE 4KUZH 1BM3H 1MCQA 3NCXA 5ERWB 3PQYE 1M2OA 4U4IA 4RAVB 5D7EA 3SPVB 3WGVB 3KR3L 5IP4A 5HDWA 1PZ2A 1JGVL 3LXUX 3QO0A 3VDCA 3DRTB 1A7RL 4LIQE 4M61A 2DQHL 2GCYB 2EKJA 4L37A 1AGCA 2P8MB 2LT9A 3BDYL 4A7GF 4JKPH 3V5HB 1EMTH 2J71A 4R7NA 2CBTA 5HYQB 1GZHC 3DSNA 3OKOA 1J0JA 5DFVD 1YNTB 3GZPA 3EFFA 1KDJA 2WP3O 4S1SH 4B7IA 4WWID 2J8UE 4F2EA 4FI8A 4OCYL 5AVYB 3HFFA 4X5XA 1AQDB 4JZOA 4CN1A 1V55B 4G5ZH 2CAKA 4JS7A 1QUPA 4ZTEA 4R8WH 2CA4A 4XNYH 1G6VK 2YOAA 2V2TB 2EYTB 4NM8L 1S7QA 4APQA 3QWQB 1WAEA 3QCUH 5LAPA 1UXWB 2DIAA 4FXKB 5EORH 5IMOA 1A4CA 1JV2B 2G2RB 1JZ5A 4PUBL 5DYOA 4MS8D 1U93A 1JV5B 1XGRB 1KB3A 1MXGA 2OPCA 1D6VL 3ARQA 43CAB 1R5VA 5F70A 5IBTL 3L6FB 5DZPA 1BJ1J 1EUUA 3VFNA 2J7LA 4YXKH 4YH6A 2VUKA 1F4WH 2FX9L 5JXAH 4GUPA 3SEPA 1TEGA 2XC8A 3MRGA 2P24B 2UZXA 3M7OA 3IAGC 2YN5A 4I0KA 4XP9H 2F8IA 4AGNA 2IGLA 1NCIA 1I8IA 1NQBA 2NY5H 3JV6A 5CZRA 1BF2A 1H3PL 1WO2A 4UAOB 1G6RH 3UC2A 3CN2A 1UWXK 5GGQL 4HWUA 3K2IA 5DA4A 2RQEA 2CKBL 2YO3A 2XN9E 3ULVC 4JK0D 2KDGA 2YLKA 4OQ1A 4JPIA 3RVVD 4G8FB 5E2TH 4CL7A 1LE9A 5C0AA 3QUYC 3U9UB 4Z3GA 3ZZ1A 3S5LB 3ZE2F 5DJ2A 3QXWA 5FB8A 3Q9QA 5T3XL 4OAWB 4PBVC 4TKWA 4LSDA 1U8OA 1N18A 5HJ3B 1Z9LA 3FSZA 4CVWA 3AREB 4Y16C 4JO2H 3WFEH 4V2CB 1BQLL 2EEDA 2QV2A 3N91A 4MJID 2NCMA 3OKLB 2R59A 4YO0B 2ADYA 1TJGH 4NT6A 3LN4B 3O45A 1UWFA 3SB3A 2TAAA 2WK2A 2AEQH 4K4KA 2IPKA 3O6LH 3L45A 4KKQA 1BGXL 4OGAC 2B1HH 3UTZA 2NLJA 2XXMB 3WN5B 5IK3A 4A1RA 4QWWD 2C34A 1I9JL 1MAKA 5JLZB 5CJQL 4A2HA 1IGTB 1TFHA 5HHVL 1Z3GH 3FL7A 3T8MA 4G6FB 4EAEA 1IM9B 1KJ2H 2RGSA 3NFPB 1FVDA 2BSDA 4JMNA 4YBLB 3QIWA 3BKCH 5ESQA 3HMWH 1ZANH 2BWQA 1W2KT 3LQAH 4F7KA 5JQHC 5F7WC 5K1NA 4IIQA 2FBRA 5F6IC 3RRQA 3EHBD 2W60B 2AEPH 3INUH 1YUHA 3HUJF 2H3XC 3FZUC 4PU2A 4NZRH 5M94B 4OGYH 2WZ6A 2ZX5A 3OGOE 2VL5B 4I1NB 5IB1A 3V4PA 1I3RB 3GXFA 2UXGA 2OSLA 2X87A 5IHUL 5GGTA 3VACA 5ICZA 3HE7D 1A1MA 5CEXB 1J8HD 1OO2A 1MELA 1QO3A 4QHLB 5E2VL 3SSGA 1BQ5A 1XEUA 2MRYA 2R2BA 4C57C 3D25B 4N2AA 4F80A 4P9ML 5J89A 4YL9A 4LDOB 4M48H 3F85A 4DJMA 1OPGL 2HVJB 1BIIA 4H8WH 4ZD3L 3UZVB 3FQXA 2NXYD 5F3HA 4JHWH 5HTSA 1E2ZA 4Y5XC 3CZLA 4L5FE 2XWZA 5MHSD 2V17L 1TJHH 5ANHA 2DH3A 5L9DH 2IPTL 3EG9B 3C6SA 4KRLB 3KW7A 2XTJE 4ONGH 1OM3L 4AZ8B 1HC1A 1PLGH 4BFRA 5JQ6L 3LRKA 1ICTA 1CYWA 2D31B 5DVNA 4RDBA 3BSZH 1DUZB 5BMFH 3LSOA 3L1OH 3M7FB 4GRWH 4JGJA 1H8OA 2QBWA 4C83B 3CHXA 4D0BB 3WS6A 4YK4B 4JFHD 3W0WD 2I26N 5FOJA 3FTUA 5DFTA 2AJSL 3VXOB 4ESKA 4M7JH 4HXAL 4G6ML 1LK3L 1TYEB 2DV6A 4OUUA 4OGQC 3TTYA 1E42A 2ZKYA 1JNHB 1A6TB 2D7NA 4RLDA 5DWPA 2HJLB 4PG9B 4QXUH 3T8XB 2CBPA 4ZXBD 4JG9A 1T1ZB 1YMMB 3GBML 4L1LA 2O5XL 4OZGA 3VXQB 5I1JH 5FA4B 4EI5D 3VFUA 1UOWA 5H35B 4Z7UA 4I1RA 4JRXE 2XVGA 1XMEB 3RWIA 3RWCB 5IIEB 4KDTC 5F9OH 5D4IA 1KGUA 3IDYC 2YKLH 4K8RH 3LRGA 3VE0A 2QVFB 1XZ0A 4R4FL 3BGMA 5HYIA 1F11B 1GOFA 4TN9A 5KW9L 1PFOA 5E6ZA 4Q8BA 3LDBC 4MD5A 1K3ZA 4PJXB 1SXBA 3PHQA 1E4XH 3MJGX 4DGVL 2F1EA 4KY1H 3U1SH 4IEFB 3HUJA 1AGFB 1COBA 2NY1B 2YEZA 2BVQB 3RAJL 3AC0A 2ZJSH 2ESVD 5CHNB 2Q3XA 4BH8A 4OZFB 1FC1A 3GMPA 2P7TB 4HIJA 1BXUA 1KGXA 4DEPC 2IDUA 2B7DT 2R7EB 1J5DA 5J7CC 4O2EA 4IMLA 2X4PB 2VJ8A 4OLYL 1MXDA 3LRSA 4NIKB 4AM0B 1MFEH 2A73A 1MHCA 4FQQB 4NQCE 3MLSL 1F1AA 3GB7B 4S1DC 3HIZA 3MNDA 1TTGA 4G9FB 2HRLA 1GYWA 4X7SH 3HMXH 3L9RB 3WKNA 4Y1TA 4AIXA 1QPKA 1TZHB 2XXGA 3LEVH 3S5LG 3S7GA 3V0VB 5C0DB 3ARRA 2AJZA 2UYLB 1R5WB 3I6GA 3MCG1 1S7SA 4MSWA 5I1EL 1U58B 4JFFE 3CPLB 5IFAL 1K8DB 2NTFA 4J28A 1F58L 3UO8B 2Z91A 3GTNA 1CICD 4XRCB 4UF7C 1QKZH 2C5DC 1CXIA 1A3QA 3QDJB 3NSYA 4I89A 2W07A 1NINA 1DHKA 4K7FB 3TS8A 1MCIA 1FORH 3OKKA 4GRLC 4AX3A 3BPLB 3LQMA 1BF8A 1Z5LB 1BJ1H 3GMQA 2JQAA 4Q97A 2K0RA 4HX1B 1U8PB 3KVQA 4HT1L 2GG1A 3WXWH 3WFCH 1LP9E 2C9XA 1S7TB 2JI3A 4UDTA 3QAZC 2JJVA 1Q4NX 1EPFA 1LQBC 3A6OA 4OD1L 1RJZA 1HJBC 1Q72L 5BW7A 1G0YR 2FJHB 5AW3B 3DBXA 3DI2B 4IKNA 1NBCA 4QAMB 3AG4B 3IU4L 3OWEA 5I23A 2PYFA 3LHPL 5MERB 3W3BA 2CDEA 4Z77B 4N6RB 1CQKA 2WQVA 3MRNB 4TRPH 2GAZB 1KXQE 3O41B 5BV7C 4YSRA 1BOGA 3EJZD 4KMTH 1WAPA 4NNXA 2QPDB 4P3WA 3VXNA 1EDHA 2QFRA 1NEZB 3B4NA 4NQDB 1SLUA 2OJEA 5CJXC 4N25A 3L5HA 5EOCH 4WW2C 3C12A 4JREC 1A47A 4FNQA 3D3VB 2G5RA 4YLQT 4EI6A 2ED6A 4R7XA 1E2VA 5ESAA 4X6FA 1TQBB 3RA7H 3NABH 3QDME 3V52L 3MODH 3N9GL 4A67A 1XV8A 5I9QB 3WHE1 3QFJA 5JW4R 4PTUA 3H7BB 2JKSA 2OL3L 4JHAL 2OL3B 3T2LA 5C0IA 4NKOA 2YPKB 3PJSA 3PIQA 4HYTB 4MJIA 4E9WA 4LF3B 3VI4E 2J88H 3L3IB 1JZ2A 3L3JA 4YX2H 4MNQB 1WA2X 3QZWB 1EHLL 2HT3C 1I1AC 4JANB 4RSVA 3IJ9A 2KPWA 4JKWA 4KDWA 1T1WA 3DLQR 3P77A 3HN3A 2ZSVA 4JFDD 1NANH 1QSEE 4Y8AA 2H32H 2UWEF 3S88H 4B9FA 1R3IH 1R3KA 2X3AA 3V9EA 1UADC 3FT2A 2W80C 3FCSA 4G9DB 4I2XA 5GGUB 3CC1A 3FSAA 4P2CG 4BSJA 3A67L 3KPMB 4K3JH 1BMGA 2VQ1A 4PRDA 1Q94B 2HFGH 3GJEB 2QPEB 4UTAA 4I87A 3SQBA 2ID5A 4QOKB 3VFPA 2QADD 3NT0A 1U42A 4MZRA 1B0IA 3WNJA 3MLTB 5FGCE 1NFDE 3OKNA 3RPKA 1SJHA 1LYQA 2F19H 4AI7A 2KQNA 2Z92B 2DQJH 4U1MA 2BIQA 4K73A 1XEDA 3EO0A 5IQNA 1PG7H 5K9KB 2A4EA 4B41A 4XMUA 5JA9A 5FYLE 1IC4H 2MKLC 4XCYB 1NTDA 3ZDZB 4ZTPH 1LTXA 3KYOB 4ZFQA 2YQ2A 5F93C 4HJUA 1BFVH 3WG7B 5FO7B 1S9VB 3HE7A 1CL7I 1LO0L 1TVHB 3T2QA 2IAMC 1BIHA 4ODUA 1EK3A 4HWBL 5KYNA 1R17A 5ID0B 1NOAA 1RH8A 4YC2C 2BHZA 4WFFE 3QIBD 3QI9C 3EBHA 4FFZA 3POCA 2NY3B 5HVHC 1K2DA 1YNLL 2X41A 1MIEH 3Q8BA 2IWGA 1XGTB 5C09B 4TQEH 1P4IL 4N90E 3EGXB 3WUZA 4XBMA 4PJGE 3NN8A 4O5LL 3GDCA 4RMTA 3LH8A 5AG9A 1KNOA 1W72A 2OX5A 1P5UB 1AD9A 1DQMH 5B1CA 1IL1B 5AL8A 4EN3B 3QJZA 1EVTC 4KZCA 2R29A 3C60C 4G6KH 4N0UE 3PHAA 2J4WL 3W0WA 4Y2DA 4YSUA 3GMLB 2EAEA 5FFOA 4Z76A 4PRPB 2DEWX 3T0ED 3L81A 2XZZA 1XIWA 4YAQB 3UTPE 2FB4L 4PRBB 2EH7H 1ILSA 3WN6A 4X98B 5HVGB 1XGUB 4WY7L 2EXWD 1RZPA 2H26A 5DK3A 3BP7A 4IRJB 2YMXH 2UWEA 3H9SB 4ZXBA 4GKSA 1MG3C 4NBYB 2DWTA 2L4OA 3S37H 3HNSH 3M1OA 4EI5A 4BKTC 3SO3C 1Y1UA 4JVWA 2VXUH 4OBRA 5K39A 2PTTB 3WIIL 2WXPA 3IFPA 4K7PH 4MB1A 1H19A 2Z9TA 1MI5B 5T3ZH 2PO6C 4HJEA 2ZF9A 1WZ1H 5DEFB 3DRQB 2E9JA 5F7KC 4EIGB 3MLVH 2F1AA 1G7PB 1IEAA 3D0LA 3L1FA 1XGYH 2Z31B 1M7IB 1Z2KA 3EBGA 1HZHH 3ARYA 1HXMA 3PDOA 4QT5B 4BRVA 2X1PA 5DRWB 1OTSD 2NY6D 3S96A 1ETB1 3C2SA 4X6BA 4ETYA 3NCFB 4HXBH 4HWEL 3RFZA 4YGAB 1MFNA 2R69L 2O6CA 2ESVA 1F1DA 3ET9F 3GUTB 3LZOA 2BCMA 2XBZA 3TNNB 4Q4EA 1GJWA 1BZOA 4WEMB 2ADIA 4Z78B 5EZJB 1D6EB 3EOAA 3QULB 2DBJA 4G7RB 4LCVA 5CGBA 5CBEA 1KMGA 1JPTH 2BNRB 2HJKB 4KKCD 1RIHL 3ARGC 3RHWF 3T0AA 3DX8B 3A6BH 4M62L 2V9RA 1RHFA 2DQ6A 2LAGB 2Y06L 3OG6B 5DD3H 4LOVA 3EH3B 3IBOA 4KKAC 4JGMA 3FK3A 3UTOA 2CHXA 3BKYH 2VW4A 2VDLL 2H1LM 2A6KB 4JFPA 1J12A 3OLEA 2Q76B 3VRIB 4N5UA 5GS0C 4JFXB 5GJSL 3BN3B 3U30C 1F90L 2FEEL 3CN4A 4HIXL 4ZT1A 5FYKE 3AY2A 4JPWL 4M7ZB 1CICA 4WI3A 4PJCA 3QZWG 4TVPL 1SMOA 1XD0A 3ATDA 3OSVA 5SWZB 5FHAL 2XZCL 5KG9A 1MCJA 5DHMC 1S9XA 3RQ3A 2NDGA 2E8YA 4JCMA 5CP7A 1FRGH 3G04A 1KCRH 4GSRA 3EYVA 1VADA 1UM6H 5FDWA 2CSPA 5A2LH 1GJIA 2FO4A 2VKXA 4WI5A 4OV5A 3F58L 1OLLA 3B56A 3QB7C 4OTXH 3VXPB 1G7QB 2CJUL 3EJSA 4PLNC 4X83A 2BX5A 5AWNH 4Z7OB 2FAUA 1XGQB 2ZKMX 4P05A 5HDRA 4FNTA 3SJVB 1D9KB 2EH8H 3TBBA 3ZDXF 1QWHA 1NCHA 1TJXA 3F7VB 1FNSH 4JCLA 1MHEA 3LVTA 4M1CC 4XWOC 5LAXA 4J4PC 2IALA 3PWPE 1ETZA 1EAPA 3ISYA 1BVKA 4HMDA 3S35X 3IB4A 3QFGA 4Z5RA 4FQXD 1F6AB 1WRFA 1JERA 1U8QA 4QHPA 1ASQA 1GPOL 4BGDA 4LRIA 1DEEB 3TJHD 4ZW5A 1AZNA 2HFEB 1CDBA 1FNGB 4AEEA 3BRFA 1ZRUA 3GXPA 3PV6A 2H9GA 1NGPH 4P8QA 5IREA 4KZ0A 5B22A 2VISA 4C56A 3BAEH 1F00I 5DC0A 1TPXB 3DURB 3U9PL 3UAAA 2WW8A 1JK9A 4NAMA 5DHVB 1UM4L 3V9FA 3FUFA 1PZ5B 2EDLA 5DUJA 2FYYA 5FYJL 1IBZA 1AR2A 1B88A 1HH6B 5DRZB 4J3OF 4NNYB 4XP6L 3QZPA 4DGWC 2P26A 1BAFH 4LMQI 5F7HA 1VEMA 1OCWH 1N5AA 2D7TL 4ONHA 5ILTL 2PXYD 2MTAA 3CVCA 3LEYH 3P9WB 5CO1A 2OCJA 4L3ED 5B8CC 1G9NC 3EUUA 1M7UA 3L9EA 3PXHA 2YBGA 4PBDA 2VXSH 1GC1H 5E8NB 4F37K 4ODHL 1NKGA 2HRGA 2VXTH 1TYRA 1CFTA 2X4NA 5JPMB 2F9BT 3EH4B 1HH9A 1JXKA 4G7QB 1KJ3H 4QRAA 1QA9A 3S3JA 3SGEI 4JFDA 4X9YA 5CNHA 4BM7A 3TN0B 1VGEH 1IFHL 3QS3A 1CFVH 1DVZA 3D0VB 3MOBL 2X4SA 1INEH 5G4NA 5BRQA 4HALA 3SHSA 4JO4H 1AHWC 1WS7A 1VDGA 3HA0A 4WV1C 2J1KA 2GEEA 3GMRB 3QEUB 4UINH 3VFVB 3V0HA 4TUKH 4AIZB 3GIVB 1T7YA 1YMME 4WUUB 5TFSL 2WJ7A 3PNWA 5D1ZD 5DJCB 4K9EL 2P46B 2FK9A 3I9GH 3CUPA 3TBCA 3AG3B 5EUOB 3BH4A 1RP9A 5AQ0A 1S7VB 3ZE0F 4Z0XA 3D1MC 3C08H 4Q89A 5MI0C 1L9OA 1NFIB 3LIZH 3VXUB 4HUKB 3LKOA 3RVXD 1A0QL 1SF5A 4IMKC 4R2GD 5EOQL 1NAMA 2WIIB 1I4FA 2AJVH 4OFYD 1J1PL 4Y7OC 3OKYA 4O9HL 5F9JB 4HC1L 1OY3B 5FX3A 2VZ3A 3FQWA 3SD2A 2B5IB 4HOMA 1ZGLA 3NCWA 4N0CD 1EO8L 1RIVL 2L3BA 4I0PD 5C9KA 3FBQA 1WWAX 3AM8A 1RZQA 3QIBA 2VLKB 3K72B 3PFQA 4FQIL 3IFLL 1S78D 1LNUA 3TFKC 1SQMA 4L8SB 2J57A 3FO9A 5GRJL 1IAIH 4LEXL 1N6VA 1PIFA 3LV3A 1AR1C 1WT5A 2B3IA 5KJ4A 1UM5H 2Q10A 1CD1B 2OK0L 5DJ8A 3MZGB 5L0QC 3E9UA 3AGVA 4YHLH 2V2XA 1T6VN 1R33A 1TKWA 1XX9C 3ESMA 1FZKA 2CO1A 3HAEA 5ICYB 4JL1A 2DWDA 4PRHB 1VA9A 5CU9A 4CC4C 3TJEH 1S9YB 1JDCA 1I9RH 3IRCA 4M56A 3EGSB 3E6HA 1MCWM 1S5HB 4D9RE 2Y7OA 3T0EA 2XI9A 2HTKD 3UOAB 5H2BB 2GJZB 1UB5A 1QEWB 3ZHFA 1VSCA 3QDJE 1T5KA 2OZ4A 3DOHA 4HUWB 3ULUC 3MLXH 2A38A 2WC7A 4NKIL 1XSOA 3CZGA 5MEND 4Z95L 5HDBF 1ZOXA 1ZEAH 1QBLH 1KTLA 1ZVYA 3C9NA 4Y5YA 3WY2A 2P8PB 4CRPA 4QRFA 5I1GL 1SOSA 2AQ2A 5GRYA 2FJGB 3WYRA 3CWGA 5KS9B 1A4AA 4WUKL 5G2NA 3MXVL 3T77A 4XE0A 3G6JB 1T7VA 2EO9A 1Y07A 3MRFB 1AE6H 2JB5L 3MRDA 3P9MA 4N8VB 3KYNA 1MREL 3UIZA 1IZJA 2N0KA 4NCC1 2ICWB 4PJAF 1WEJH 1EEZA 3MRLB 2ITCB 2I69A 4U3XA 3ZKXB 2APWA 1NKOA 5B4MC 3HR6A 2X4OA 1HILB 2V9QA 5EEZA 2XNAA 2G30A 3TO4B 4DZBB 3ZT6A 2ORBL 5IQLA 4U0QB 2ADGB 2F74B 5F89B 4XBPA 4PV9B 3HPJA 1J1OH 4GXVL 4LL1A 4QTIL 4WWOA 5D1QE 3STLB 2WVTA 5LGJA 1KB5A 2YRZA 3BZDA 3BLBA 4G1EB 4X7TA 2OSXA 3C6LB 1XR8B 3T4AC 4OIAA 3OJVC 3BWUC 3V6FA 4RA0C 4R0LB 3UXFA 5D2NB 4UCFA 4G8EA 4NQDE 1O75A 5I30L 5DXWA 3HCVA 5ABDE 1ET7A 3QEGH 3QJUB 3D3VE 4GAGL 4ZAKC 3ZK0A 4DP6X 1EXHA 1M42A 1NCGA 3QQDA 3ECBB 4Y1AB 5ITFB 3QWOA 4U1NB 1P2CA 2DYRB 5I1HL 3HG0A 3P0GB 3Q5TA 4BUQA 3U9WA 2VNCA 5E95B 3S97C 4UQAA 1JZFA 4HETA 2GTWB 4BFFA 2XRAH 5HYSB 2ICEA 2J5WA 3W9DA 3CXHK 4GUCA 1WBYB 4O02A 3TJPA 3ZMEA 4AQ1C 1JPFB 3M6DA 2IANB 4EXKA 2CRZA 1JGDB 4O2CA 4HIIB 1XAKA 3CX2A 5IM7B 1F86A 2A77L 1BQHA 2C3VB 2GIYA 2Y07L 5KVEE 3HC2A 3DX2A 2WIMA 4GSXA 4LL9A 5DR5L 5BXFA 5HY9A 1NIFA 5AW6B 3KXFB 3WBDA 1G9ML 1NBVH 1UHVA 1KCVH 1X5FA 4H0GA 2VDNL 5G4MA 3EFDL 5E9DD 2I7SA 4WU7B 2P48B 4P5KA 4GUQA 5J1AA 3QEQB 4KXDA 4YHKL 2CGRH 2YC1A 3FQTA 3TBVB 4EE2A 4FXGB 1UD8A 2DD8H 4QOKE 3TYFB 1AD0A 2W5PA 2NX5B 1XBDA 3H42L 1PIGA 4PWEA 5JORA 2ERJB 5LB1A 2DMCA 1MZYA 4FG6D 3V0IA 2NNXA 1J86A 3II3A 4WGKA 4YIQB 5E8EB 1MCPL 4LSRL 1U6AH 4PJEB 4PJAA 2D3NA 1N10A 1HXYA 4P46C 1I7UA 1AANA 1CE6A 1D5IH 1NAKH 2I9LA 3AQZA 3IFOA 4Z7QF 3ZDZE 1LK2B 3ZE2E 2CPUA 5GGSB 3MJ8A 1BZ9B 1FE8H 1U2YA 4ZMOA 4KTDH 5FDYA 2X05A 1G7IB 3T1FB 2GBAA 3MA7B 4UDUB 3S36H 2WQAA 4GW1B 2WKOF 1BCIA 1BD2D 3BIKB 3LNGA 2EEAA 5FGRA 3JWDL 1FL6B 4JGUA 3H6JA 2Q8AH 2LE9A 2PXYA 4U0RB 3LH2L 3IPFA 5J13C 4LP4A 2HRPL 4L3EA 4TL4A 3X14A 1XF5B 1YQVL 4NUQA 3UPRA 4KVCH 4I77L 3GRWH 4KKBD 5L7XH 4HK0A 1B2WL 4YBQD 4NO3A 4KQ0A 3CU7A 1UWGH 4BJLA 3VXMB 3IGAA 4JX0A 4PJ9B 4IBVA 25C8H 3ZXAC 1EJ6A 4L1SA 1TNNA 1ADQL 1CT8A 4BWTA 4JO3L 2XA8L 4Z3TA 2IXQA 1IO4C 3US1A 2EUWA 3ZIMA 3WEOA 5IW1B 3DHUA 4HUUB 3V8CA 4MGXA 2VRKA 5EDXA 4Q9CA 2O72A 2WYIA 2CUAA 2Q3AA 2VDMH 3ZHLA 4NZTH 3BZEB 4MWFA 2QHRL 5LBSL 2A0LD 4PRPE 4MA8L 4MMXC 2O30A 2WUBL 2OR7A 4R3SB 4GG6B 3HUJE 2P8LB 3GS7A 1N26A 3CIQA 1WD9A 3QO1B 4QF1B 2DLHA 1D5ZA 1JIBA 3CVBA 1Q90A 1LJMA 5JXED 3QCVL 5IHWA 3FFCD 3M17B 4MMZA 5TPWH 1K85A 3SYQA 4YSSA 2R4SL 2WV3A 3TPUB 2AV7A 4DO6A 5J1TC 1H5BC 1IQDB 3DV6B 3ZYJA 3DC0A 2EVHA 2FO8A 4G9FD 5B39B 4N8VG 5IT2H 3FKUS 3QJFB 3CXHJ 1TTAA 3BYYA 1X4ZA 2EYSB 4NB7A 3TBSA 4JGNA 3ZTNH 1X5YA 4OFYA 3VXRE 2W8CA 4ZNEE 1EO5A 2TRYA 4D8PB 4WHYG 3OJ2C 5FK9A 4CKVX 4LPVA 3TVMC 4J8RA 5L8LB 1JPST 4MJ2A 4QTHB 3Q5OA 3VGAC 3WJJC 1U8MA 5KVFH 1DN0B 4TLUA 4I0PA 3ZYOA 5CN3A 4ODTL 2JF1A 2RQ8A 3CFJA 3KPSB 4GXFA 4EIZC 1TJIH 2KLRA 2VDOH 4MJ6B 1JZ8A 1PKOA 4IU2B 3VGDA 1JMXA 4PV8B 3QHFL 2WLZA 3RLSA 3FSWA 3W57A 3HZVA 4GRMB 1VIWA 4NM4L 4QRSB 2XY2A 3FQYA 4XN4A 1NLDH 3AXLB 5DLML 1QUNA 3IPBA 1S7XA 1G87A 1BFOB 4WO4C 5E4AA 1L5GA 1QFUH 2O6PA 3M8OL 2FVNA 3V0AC 4YHZL 3P0YL 1JNLL 3Q43A 5EV7A 5HYSG 3I6KA 4A55A 2CO6A 2FYVA 2WQWA 4OSUL 4DK5A 1EZSA 4BKLA 3H9HB 3L6FA 2BOBA 2WB1A 1KB9K 3SE3C 4OZIF 2HX8A 2XFXA 5SWZE 3V6ZA 1WD8A 3WY1A 4BCZA 2WXOA 2XWJA 4OLEA 1F13A 4NPJA 3QEHA 4L3AA 4GW4B 3ZUCA 3FU9A 4Z1PA 5MENA 3DETC 3K2MC 2DQTL 3WFBL 1B9ZA 2LU7A 1SYSB 3BUTA 3K6OA 43C9A 1OP4A 2XSKA 2V7NA 4PGBB 2CKBA 4Y19B 2WXMA 4JM0A 3ZIYA 2Y36L 4J3XA 2G60H 4QXUL 4R97C 4XBGA 1TTRA 5F88B 3T9WA 3CMOL 4PJBF 3QUML 3N5AA 4ZMZA 5ITBL 4RIRB 4RAUB 4YDZA 1VZGA 5IUSA 5IEKB 5I26A 1XH1A 3M88A 2J6EL 2X4UB 4TQHA 3QFJE 1HKLH 1P4BH 4PB0H 1FDLL 3O9WD 4BFEA 3VFTA 4HKXA 4MNQD 3KL5A 4HIEB 5BCAA 1HHJB 4NWUH 2QTVA 2Q2LA 4NQEB 5IF0A 1HYSD 5D7HA 4RGND 4M7LT 2GHWB 3AMLA 1VFBA 4ZG1A 4RBPK 2KZ1B 3BIBX 4QXGL 5EBWB 2R1WA 2W0FB 4BH7A 4HFWA 3SQOL 3ZW3A 3EFOB 5DDHB 4BFOA 3OSKA 5GSRA 1OB1A 1ZA3B 1GY2A 1UXLA 1MFUA 2K4AA 3PHSA 2Y69B 4LBEB 5MEPA 1WIOA 3K8LA 4D0CB 2O6DA 4PJ5B 3O2WL 1K4DB 5HDBB 2OI9C 1BZ8A 5C2BH 1NBQA 2FT7A 4GLRI 3TBYA 4LHUB 3J8F7 2W0PA 4NDMB 4UI2A 5JR1L 1Y1DA 4PGJA 3QCTL 4XP4L 2BLFA 3SY0A 5E1AB 1XGPB 3K74B 3WTSA 3VDAA 4QRBA 5F96H 1KN4H 2FBJL 2GABA 4CNIB 4XCCH 2BZDA 1T66C 1X6LA 5KSVA 5TE7H 2F8VA 2GSGB 1IBBA 1NCAL 4I18B 4UBDC 2ITDA 2RA1A 3QPXL 2ZUXA 5EA0H 4N0YL 2QKIB 4HPHA 3PWUB 1C5BH 1I53A 1YYML 2EECA 4OZIA 2RMNA 3QORB 3VGHA 2R83A 4OF5A 3HNVH 5HHNB 1MFAH 3HHRB 2FR4B 2VO8A 2X1OA 5I8CB 5E9DA 1SLWA 4B9YA 4A66A 5JPNB 1YJDC 3ECUA 4NP9A 4P59H 1E8WA 1FIGL 2BDNL 1QZNA 3P11L 4WUUE 3BMVA 3RWDB 3TCXA 4QRPB 4AYMC 3DIVA 3VA2C 3UZVA 3O3AA 5D7IF 4KAQL 1C16B 1KBGL 3RG1C 5C09D 5IBLC 4PCKA 3NACH 1RIUL 2KLTA 5B39G 3TWCH 3IVKB 1IVTA 2ZAHA 4PJBA 1SEQL 3U2JA 2A9NH 1CGWA 3W11D 5I15L 1TJMA 4DP1X 3MYJA 2W38A 1EX0A 3VXUE 3BJ91 3CFDA 1G0XA 3UTQB 1B0GA 1KB9J 4S11A 4EN3D 2J8OA 3ILQD 4W4OC 3U36B 1NDGB 3B5GA 1CLYL 4OLVH 4P49A 1WBZA 2JK5A 1BZDA 5T1DH 1ED3A 5B1JC 5I71B 4A2GA 1CPUA 3WLBA 2W0KA 1WFUA 4PBWD 2WBJB 3GIZH 3ZKMD 4WSKA 2ODHA 1BD2A 3GI9H 1LXMA 1HE8A 1TZIB 1KN2L 1CS6A 1C5CH 4AKOA 5H94B 1K72A 1EXUB 2VLKE 3VXQA 2HFFA 4FS0A 2UWEE 1MJJA 1IIKA 1R24A 4KI5D 2C9UA 2HLAB 2HXAA 3QA3A 1FYTD 4JFSA 4G71B 2UY6B 1G4RA 3BQVA 1ZVHA 4I0CC 1MI5D 2FGWL 3GMMA 2ZWZA 3FTSA 3IF1A 4RFNB 1URLA 5AW4B 4U1SA 4PRHE 2DMHA 5BRZB 3PYCA 3FQRA 4AXWA 4DTGH 1IV8A 2G3XA 3I2CL 3FB8B 2IGFH 1A6ZA 4PP1D 1KLGA 4XNZC 1X5IA 3NCCB 5D5MF 1AIZA 5DQJB 5AYUH 3LN9A 4APXB 3N1QC 1PQZB 2GKIA 2WINB 4PY7B 4Y5VA 5DO2D 4ZX6A 4L4TB 2R7EA 1HHGA 5JXEA 1QBMH 3FFCA 3GMOB 3TEYA 4X8JA 3GRGA 4OZHB 3W39B 1CD8A 5E70A 4ZQKA 3SBWC 1O7DE 4U6HB 4AEHH 2F61A 3R1GL 4YPGB 5SX4I 2F7IA 5CGYD 5EU6E 4HWZB 5C9JB 2E27H 5LXVA 2VR5A 5D7IA 2NXZC 3QG6B 3SDAC 3SBPA 3RWGA 1V10A 2DMBA 3SDCC 2UYLA 1HL5A 3MLRL 1SJEB 3BCDA 4WWKB 4ES8A 2VKWA 1ZS2A 4DPBX 2G9KA 1QFWH 1W9XA 1DQLL 3FU3A 3IDJA 4LAJH 2V7HA 2A83B 3GSXA 3COOA 4JDEA 3CFEB 2Z7UA 4TVPD 4QHMA 5ANMB 4CILA 7CGTA 5L2JA 3OGCB 4LFHG 4OLWH 5LXGH 2HX9A 2FCBA 3QDGD 4F92B 2AMGA 2DB8A 3FQNA 3RIKA 5FPIA 1ZDQA 1HZKA 4PRAA 2NZIA 2MKWA 2OXGA 2EEBA 4WZ9A 4AV4A 5HVWA 3BUYA 3VB9A 1Z5LA 4X8GA 4YHIA 3AJ7A 4LLQA 1Q9OB 4ZO6A 2D9CA 1HNGA 3FMGL 4WKZA 2F8XC 3VGGA 4ZFOA 1UVQA 1VB9A 1S7TA 3LTVA 3MNVB 3S34L 4XNBA 3L3GA 2BSSA 5EZOL 4DKAA 4Y1AE 2BJMH 3E2HB 3ATEA 3AY4C 1YY8A 1NLBL 2FJHA 1NM4A 3BO8A 3CMGA 4UQCA 4WHTB 4IBZA 4JY6A 2IH1B 4PGZA 5IJKC 1PS3A 3ME0B 4HU2A 4F2FA 3FB7A 4XMZA 4ZMWA 2X6VA 1YEHH 4R7DB 1OARL 5LGKA 4S0SD 1U8JA 2IANE 1AQKL 1N4XH 4FFWC 5CMAA 5I66B 1PJ9A 2AK4B 2ATKA 3EGDB 3C5SB 3UZEC 1TVDA 4JLRB 4ZMXA 5C0JB 2R8SH 4QR7A 4C56E 1E4KA 4I9WD 3RIAK 3KXFE 4AMKL 3BUIA 1J8KA 1AKJD 1KPRB 2B8OT 1T04A 1HJCA 2K6WA 2CJTA 5B21A 1P9MA 4MDJA 3ECWA 4HCRL 2IV8A 2GY5A 1KBKA 1BVLA 4M6MH 3UBHA 1OWRM 2NX5E 3EIFA 3NSJA 5EO1B 3DYOA 1F4YL 3FO1A 4MQXC 3T6QC 2W9DH 4NQUA 1CTOA 2YBRA 4M6NL 3NIFB 1B4JL 5AOZA 2VAAA 4B27A 2IWFA 1KCUH 4XBEH 4KPHH 3WO4C 1CGVA 3L3IA 3O9WA 3T2NL 4ENEC 5C0FB 4MNQA 3CLEH 4P4KC 3B2XA 2XPGB 4ZUWB 3QPQC 2IEPA 3ZRCC 5D1XD 4HJJL 3T3PF 5ISZB 4XCEA 4XVUC 4NIYE 3TN0D 1JRHL 3EYOB 2EVJA 1NIAA 3KL3A 4JFDE 2B59A 3VG0H 2EIMB 3T8VA 2JJUA 3IFNH 1JK8B 1FLRH 1R3LA 1QRND 1CFBA 1W6WA 1KYUA 2BVEA 5DQ9B 3GJEA 1NA8A 2DLTA 3QQ3B 5BRPA 4KGJA 4PWGA 4E9VA 3W37A 5I76B 3AFLA 3UP1A 4LLMA 2FX8L 4MNHA 2A9MH 4Y4KD 4WJG3 4DPRA 4J39A 2PR9A 3KYMB 4OF6A 3VXME 4XNUL 3VD3A 4DGYL 3FT9A 3QH3B 4FNLL 4EDWH 5GRUH 1T0OA 4FABH 1YNKH 1C12B 2PPEA 4GMSL 2G4EA 3QHTC 3Q6GL 3ZDXE 1JCKA 1CI3M 3UC0H 4KWUA 4YN3A 3VM7A 4F7MB 1NDTA 5H37A 3V4UH 1PNDA 4PJ8C 3KYOA 3OKEA 3NGBC 1YDPB 5DU7A 4OLXH 4LEOB 4L8DB 5T1KB 1OTTD 3O6MH 2HMID 1S2EA 4JDTL 1EHKB 3ROOB 1F3DJ 1I8LC 2FLBT 4AG4L 4HWBA 4PRIE 1IGJA 1Q0YL 3ARDD 5D70H 3WD5H 1EFXB 4H8PA 1X7QA 2VSCA 3QBTB 4XI5C 3SDYL 1RUKL 1H15A 3WIFA 4O2FB 3P4MA 3US0A 2ZUQC 5C09A 2HZHA 3W9EA 2Q7YB 2RFXB 4OTXL 5C6TL 2WWKT 1F5WA 4R9HA 3ULVL 2R9HD 2P52A 3PUCA 1CDIA 5T1LD 4DQAA 3L08A 2NY7L 2VITB 4YQXL 1P5UA 3BEWA 4ADIA 4FQHA 3T4YA 4C8XA 2GFBB 5I1IL 4AZUA 4LMQE 5E7BA 3TC9A 4F7CB 5GS2H 1NFAA 2XTJC 4WI0B 4DKFH 1FWXA 3DUUA 5ABZA 3X1EA 4NUGH 5HHMB 4M4RB 2MEJB 5C92A 1HSAB 4FXTA 1YYCA 2K70A 4X0KA 1ZY9A 4PEEA 3DX6A 3T0EE 4H1LH 4FZ8L 3HG1D 2C3GA 3EW3B 1MCEA 2RD0A 1MAJA 3KPSE 3NEEA 5E5RB 2UXTA 2W88A 4HUVB 1TITA 4JZJB 4X7FC 4FLQA 5B3JF 4P0DA 1QLFB 5E6IB 5AAWC 4RBPH 3FU7A 1FYTA 1KC5H 1WCQA 4IJ3C 3RY5A 2PTTA 3SOBL 3FTWA 3F12B 4P5MA 4GIPD 1INQB 1MI5A 1TQWA 4X8CA 3RP1A 2AQPA 4AGMA 4K5LA 5ECJE 4B9ZA 4WGWB 1M7IA 5DJDA 3V5KB 3BW9B 4NI3A 1XGZA 4ZW3A 2CDGB 5KVMC 3B9VA 4N1CA 1PJWA 5GRVL 1J8SA 3IU3A 1KCWA 5A6IA 3ZE0E 4U1LB 3LZLA 3WDHA 1IC7H 2EDTA 1EZVX 2R69A 2Y24A 1A7QL 3KWTA 1FQ9C 3QNYB 3TO4D 3WUWG 4QAWA 4BWWA 2X7LB 5I1LB 1L9QA 4XPHL 2I5YL 4Z78A 5DZNA 4ABUA 1CG9B 2HN7B 3N43F 5EO9B 1DSFL 3OM3B 5ETUA 5LWYH 4I13B 3FRUA 4F2MA 3APNA 2VQUA 1A1OB 5KZCB 1P4LB 3RHWK 1R34A 2WCSA 1T7XA 1WWBX 3BWAA 1MJ8L 3CZNA 2ADJB 4OD2A 3APFA 3DVIA 4ZW7A 5DUBA 5TF1H 2GSIA 3FF8A 1Q0XH 3ZTCC 3UG3A 4Y19E 5E2UL 5EG6C 2A1WL 2NUTB 4E9LA 5ADOH 1S8DA 3Q5YA 3QUZB 4GT0A 4L2LA 4AEIL 2MCAA 4DUXA 2OTUA 4N2LA 3UDWA 2FATL 4KVNL 5IFHL 3BD5A 3FB5B 3LEXA 2L8AA 5FF6A 5ENWA 3VYOA 1MPAH 2WYHA 3JTTB 1UZ8A 4X6DF 1E6OL 2XXFA 1PL3A 5IEHB 1BP3B 1H8LA 3LN5B 4WHDA 2NQCA 4JCWA 4Y5XB 2FJFB 2DBLH 5CZXC 1CLOH 5HGAA 4F58H 3Q1SH 1WE5A 2HKHL 3V9CA 4FRWA 1FZJB 3VRJA 2ZSWB 4G83A 4IRSD 3QDGA 1DBBL 4TQ8A 3BDBA 4K71C 3MOAH 3TZVA 3EOBA 4YDVB 4L18A 3EYSH 1T4KA 1VACB 2H2PD 2CG9X 2J72A 3FQ1A 3MJ7A 5GGSY 4BK4A 2HLEB 1U33A 1XZWA 4Q74A 4ZMVA 2GTZB 1AXIB 3RU8H 1WK0A 2GK2A 4P2QB 2VDQL 1I8UA 1XCTA 2VDQB 3STZB 3WKML 1M2VA 4IOFC 4YFEA 3ARZA 1E6JH 4B53A 1V5JA 3MCKA 3QEQD 1CGSH 5FECB 3BVUA 2C1PA 2DQEL 5HDBE 5J12B 1PAZA 3RL2B 3QUXA 2TSAA 3PLYA 1OALA 1F56A 4KRPD 4KMLB 2BRRH 1CGTA 2BC4B 2B15A 1VEPA 1OHQA 5IB3B 1M6OA 2VM9A 3BGAA 3L3HA 5F2FA 5I18H 3DPDA 1HHKA 2C7FA 3IDYB 1QPXA 4HPYL 1DEEA 4NYLB 1CDJA 4OW6A 3FB6A 3DARA 4KXBA 2Z93A 3FU6A 4MB5A 5L6YL 2DEYX 2YRPA 4QKXB 4MCNA 4PD4K 1BOYA 4NCDA 3L7EB 4LVNC 1UG9A 3UG5A 3UJJH 2XTSA 5IW6B 2Q7NA 1RZ7H 4NJAL 1B0RA 2MFNA 2D3LA 2KKQA 4HJ0D 3IS1X 1AHMA 1EJOH 1AKJA 1CK0L 4LKCB 3S9DB 4YNYB 3O6KH 1TVBA 4K15A 1OT1A 4JPSA 2WXHA 4KK6C 4MXQC 3VX1A 1RD6A 2ATPB 2GITA 1EEQA 1Z9MA 3D7PA 2NYKA 4CSTA 5IG7A 2VXQA 1RK1B 1CDUA 4URTB 1RJLB 4BA8A 1RV6X 2LVCA 3F2LA 1UQSB 2X42A 1SQ2N 1W91A 2DLIA 2JKXA 3H53A 1KXTB 3OPZL 2RBLA 4BRJA 1PX4A 3AT8A 3I9IA 4GBXB 1IAMA 2UZPA 1JZ3A 5D1XA 3ABLB 4Y4HD 3KYKH 4RZCA 1GGBL 2CK2A 1D2OA 1QFWM 1XO8A 2XG5B 5GJTL 3MACH 1FUNA 4NGHH 5C0ND 3UYOD 1FCCA 2HH0H 5TQ2H 3EZJB 5TJWK 3HE6B 1KSRA 2BZ7A 3MBEC 5HD8C 2ODIA 1QRNA 4OCSH 1XVSA 3A4EA 4XN9A 2ZOLB 5CU5A 2VW6A 4BWUA 1CBVL 3NJJA 3PDDA 3L3KB 1T0NA 3CFQA 2XT1B 4H5SA 4XXDA 1DBMH 4Y4KA 3F7PC 3EDKA 1XFPA 2VDKL 3A0OA 4P57A 3S8FB 3H8NA 4UTAH 4Z8FL 2H8PB 3BP6B 5GHWH 1M9SA 4G43A 2C7UB 2EJ1A 1L6XA 3E6FB 3ZQWA 5HDQL 4RFOH 1RPUA 5B38G 1ZSHA 3DVGA 4DWHA 3QIUD 4Q14A 1FHNA 1SF3A 3UMTA 1GGYA 1O9VA 2P9RA 2WIIA 3CZFA 3IMRA 1I9IH 2BOLA 2G9HB 5HI3D 3NCJL 1ZTXH 4RMSA 4QHKJ 12E8H 4LASL 3WCYA 5FHBL 4HC1A 1TZGL 5ACLA 4KROD 4YE4H 2E7LC 3JXAA 4D94A 2WQXA 5T5NG 4GEJA 4PJ7B 1T83A 2NY2B 1OCRB 3ARDA 4P4RA 4XMKL 1WUZA 2VDPH 2HPTA 2ZUTA 2BVUA 3BD4A 4CC1A 2QGCA 3T3PB 1NBZA 5F7NC 5BV7L 3MLWL 3OD3A 4BQCA 1M1SA 2X88A 3BZ5A 1LO4L 3DJZA 5ICUA 5SWQA 4YDJA 3MV11 3ZLQC 1KIRA 1LMKA 4FTDA 2DQCL 3JZ7A 3IWUA 1YN7A 4AJ0A 4WW2B 4TOYH 5T1LA 5IJVB 2C9RA 3CVHA 2A6IB 3ARFC 3NESA 1LO3H 2ZUVA 4U7SA 1KJVA 5DJAA 2AJXH 1OZTG 1S9YA 3D9AL 4JM4L 3RB5A 5FO9B 4MA3A 3VRLF 5IV2A 1JPSH 4Z0BL 2H3NB 4E42B 2R29H 4ZX4A 3OX8A 4D2NA 4J3VA 4PS4L 3ESNA 3JYBA 1GL4B 2NW2B 4KVPA 3SE9L 4IGBB 3MRBA 4KRMB 1E3XA 4EZKA 5ANME 2Y2TA 2OTWA 3HG1A 2J2ZA 3VI3F 3IJYB 2O5ZH 4XC3H 2DKSA 3EXLA 3SY6A 4WEBH 1P1ZB 1XH2A 1ZSDB 3Q48A 3LZFH 3DK2A 4FMKA 4F57L 1K9TA 5T5FA 2PPDA 3SOTA 5MENE 1EEYA 1KTBA 4U6XA 4CDGC 2DW5A 5CZVH 3SKJH 1GTFA 4LPTA 3T3MF 5HYJB 3SE6A 2JQZA 3G6JA 2HAZA 4M5YL 4R7LA 3TNMA 2R0WL 4UUJB 2DZEA 3ZN6A 2F2HA 4N8VA 2XVLA 5DZJA 4XPGH 3EDDA 1SN5A 1AS6A 4TYUA 5BS0D 4PGDB 1ZLUH 3LZNA 1V7NH 2JCCB 4HUXB 4FXKC 5TH2B 2MIZA 2OCCB 3JWNH 5A2JH 2IDCA 5EIQA 4WF7A 3TBWB 3HS0B 2E0PA 1U21A 2P5EB 3VD9A 4CMMA 3SQRA 4RDQF 1AVAA 2G2PA 2QDVA 4IJTA 1DQKA 1V3KA 1NBYA 4LFHD 4NQED 5DJ0A 1P53A 5EN2B 2Y7QA 2AK4E 3S3DB 4U1GC 4G1EA 5CFAA 3TM6A 2H2SC 4IU3A 4NENA 5AAMC 4KJPC 4K3HA 3HR5A 2DJSA 3MRQB 1MRFH 2IAMB 4FXLA 4FG2A 2AXFA 1DLFL 2CUMA 4XVJL 5GXBB 3DV4A 2RIKA 3UAJA 3HS9A 2DLFL 3QI9B 2F54B 3OKDA 1ACZA 1MWAA 3WE6B 5IMMA 1PNCA 1E67A 4FFYL 5HYSA 3HNTH 3CDZA 1SYVA 3GSNA 3C8DA 2GB2A 1NMBH 3NDZE 3NIFE 2D2OA 4Z23A 1M1XA 1P0SE 2KC0A 4UM9D 1J5OL 4OCXH 2YOCA 1P7QD 4ZS6C 1WWWX 2CMRH 5B3NA 1T5XA 4FQJH 4CSSA 1JPFA 4IRSA 5F7EH 3B8SA 1JS4A 1UJ3A 3DROA 2PLTA 3AREC 1RUAH 1YQ2A 3F00A 3QRBA 4P5TC 5IM7A 3U7YL 1T22B 3C60B 2JQMA 4KH9A 8PAZA 1J5CA 3TV3L 3HB3B 5I17A 3B7RL 3CVIL 2BNQD 1L7IH 2QMKA 3VI3A 4ICXA 1KLUB 2ARJQ 3KJ6H 1A1NB 4OZIE 1TQCB 1AJ7H 4U1KA 4X7CC 4ZO8A 4UQ2B 4BELD 4CSZA 1ZLVK 5JHMA 3BI9X 4N3TA 2Z35A 3PWVB 5EFIA 3IGLA 2Y1YA 3WN5C 3AVEA 4JE0A 1WTGT 4X4YB 3O2DL 4GI9A 2WXGA 5CINH 4OIIH 2EE9A 2ZCKL 3WHXB 4KRNA 3RWHA 2H6PB 4Q0XL 4U1IB 1OANA 1DCEA 1RUQH 4WDIA 2OAAA 4DVBA 2WXKA 5HI5C 5J56B 1A8ZA 1EO7A 1OW0A 1SNRA 2NYYC 2ICCA 1NGQH 4XMPH 1RHHA 3SGKC 1ROWA 1JUFB 1YN6B 3MLYH 1UJTA 1MQKL 2NZ9C 4RMRA 4X6DB 4HK3N 5E0QA 2DH2A 4MLIA 1LLAA 1UFGA 3K1DA 4ANXA 3ZDYB 3MMEB 5LNGA 1H9DA 4HS8H 2NNRA 3PWJB 5J6GA 5JHBA 1FV1B 4IBQA 2WBJD 2JKWA 1ILUA 5E5MA 4ERSH 5DYFA 5ADPL 1FL6A 2DLGA 1TZAA 4FFVC 4CN4A 4RSYA 4UOQA 3FNKA 1BD2E 1CD0A 4XMLH 4JG1H 3GPEA 4I48A 4JN2B 2ZOUA 5CAYB 4PREA 4A7VA 3GSWB 3L3DA 5DJYB 3KS0J 4ZRGA 3MC0A 3S3SA 4EVNA 2VWEC 1T1XB 2GUOA 3RTQD 1ADQA 2DQIH 2FHFA 3VFOB 3NUKA 2O5YH 4Y4HA 5BZXA 5IW1A 4ABQA 2VN5A 1LO5A 2FNWA 3DX1A 4NC1E 4TM9A 4UMSA 1ET5A 5GS0L 4W9CC 3TCTA 5JW4N 3DI3B 1A4KB 1J9SA 4XOBA 4LLDB 4ZQTA 3ZMRA 3KNBA 4HS6B 5FM5M 1MCWW 3ORJA 5HHME 4B5EA 1NMAH 1IARB 2AVFA 5JOFB 4OKVB 1IQWH 5IQMA 4OQTL 2VRQA 3DX9A 3GI8H 4YK4C 4YZFF 3ZR5A 2P8LA 3BLKA 3ARBB 1JVLA 5F7YC 3FTXA 4F93B 3CN3A 4AVHA 3L4CA 4JW3A 5EEWA 1RJYA 5E9AA 3D4GA 4C4KT 3MLPA 1NC2D 1KV7A 1QYGH 1XF4B 3L1GA 1H6TA 3FFCE 4QCIA 4KZEH 1IQDA 4AQ8C 2H4EA 4X9GA 4LL4A 3HC3L 3LB6C 4QRUA 2YPLD 1A7PL 2EABA 3ZX1A 1EBPA 1DYZA 6FABL 5DRXB 5EU5B 4NHUB 3IEAA 3QIUA 4QI3A 1LILA 3QZLA 4FN0A 1C1EH 1U8CA 1QLEB 1E4XI 1KFAL 1WFIA 2WMPA 5D7IE 5I0ZA 4V33A 3NJMA 4LSPL 4HMCA 4ZSOA 5C0CD 3N42F 3P40A 2QQLH 3MV9D 2WO3B 2OMUA 3U2SB 1L0PA 4NQQA 1J0IA 5DEGB 2E7DA 1MJUH 4OCRH 5EOTB 5BO1H 2UZIH 4LHJB 1M4KA 4F8LA 4QD2E 1MZZA 3FOMB 4D0DA 1XB6A 3BZFB 3TO2A 4ANVA 2NY1C 1GSMA 4HV8B 4LSVH 1QFPA 1EV2E 2IDFA 4DESA 1G7JA 2LFGA 5JHDD 2E9BA 5I82A 3B3IB 1F3RB 4ZFFA 1VGKA 2H47C 3QJHA 1WHOA 4QGTA 3LS4H 4RGOL 4QRSA 3KVDD 5KVGE 1PEWA 4IHOA 3NTCL 4OCWH 1FNAA 1BBDL 2I25N 4OV6F 2BHFA 5I6XB 4H40A 3NEXA 3ILPB 3ZO9A 2BY0A 4CGUB 2X4RB 5F7MC 1G9NL 2Y1VA 3QFDA 3SDXB 1NEUA 1RK0B 4PMFA 3FO0L 1JF1B 1RZFL 4B9JA 4F5CE 2AGJH 1A9BA 2RCSH 3HAEH 3BWZA 4GKLA 2WLIB 1RZIB 5DJXB 3S0PA 3UYRL 5FKAA 1V7ML 3RVUC 4PPTA 4Z6AT 3Q6FA 1X4YA 1JI1A 4JKNA 4L0YA 4G8IB 1ZT4A 3D12B 2J73A 5AVUB 3T2PA 5KSBB 2OMZA 3KPOB 1SPDA 3BSZA 4JG0L 4OD3L 4XB3A 3QXTA 2J25A 3HPLA 4NRXB 2OZ4H 5TK2A 2V8MA 2AABH 2YSTA 4ZK8A 3TBTB 5D5ME 3U4AA 3L5XH 3OHXA 2GY7B 3SGEH 2EIBA 4WV1B 1EHAA 4P5RA 2IADB 5I16A 1AHKA 1IT9L 5G4OA 4AT6A 4NWTH 1HCFX 1G7HB 2HLFD 4GAAA 5BOZG 3HI6H 3N85L 3OAUH 4CVZB 3B43A 3QUMA 5BS0A 4J3WA 1JI2A 1OD7A 2DTSA 5IROD 2B14A 2ROYA 5DZOA 4BD4A 4JDZA 2XVKA 5BVJB 2AJUL 1JHKH 2L0DA 5I8EA 1TQUA 4PG2A 1MJ7H 3II1A 1LO2H 5GISH 4NRYB 1ZT7B 5T3ZD 2C9QA 3LKPA 4QRRB 5DMIL 5MI0B 4OU3A 5B7EA 3AU0A 4XOAA 3VTAA 1SHWA 4CVXA 4N68A 5E99L 3CCHB 3ISRA 5ISZD 4MTMA 4RGNE 5D1QC 1H3WM 4JHUA 3WEBA 3OTTA 3WJMA 2FNBA 1KB5H 2NY0C 3DECA 3EFOA 5F7DB 4PVBA 2IG2H 5AB1A 1MRDL 32C2A 5E1HB 4DW2L 4F7PB 2R0ZH 3G6AB 3BP5A 3WELA 5B1AB 2KI6A 1DVUA 4UTBH 8FABB 3OVUB 5HPMA 5E6RB 2K3TA 3E0GA 5DD5H 4L3CB 4NDMA 2XACC 5PCYA 3VYPA 4H88L 1TQBC 3VH8B 3PXLA 1OGAB 3NFSH 4N5EC 3B2PA 1P5VA 1SEBB 4UM9A 1AS7A 5I9QC 4FQLH 1P7QA 3QIWC 3HG4A 3HMXA 3CZEA 2CD0A 2JXMB 3K6SB 1AG6A 1NANI 5DLLA 4O02H 1XF2B 3ZPDA 2BNQA 5I8OH 3WAJA 2FR4A 3V95A 2AEWA 5KBPA 1ZT1A 2OQJB 2ZWNA 3G5ZB 4OUOA 4RMUA 4WFED 2EUXA 1L0QA 5JPNA 2HUHA 3KHQA 3ULUL 4A38A 1BVNT 5F1NB 1LEKA 4YVUA 3MREB 2AV1B 3T65B 4G80B 5F71A 1KTJA 2I24N 2VUOA 2Z1KA 3NJKA 4N9GA 1XB3A 4W6WB 4N24A 3VX0A 3HI1B 4N2HA 1WICA 4I8DA 3H4FA 1AIFB 3ULVD 5C0RL 4H20L 4R4BB 1G6RB 1NSNL 4U2ZA 2HVKB 5EEUA 5FGBA 2ITEA 3QNXA 5JHLH 2W81C 1KTDB 4KFMA 4NOBA 2QSTA 4HG4K 3GKWL 4DN3H 3AROA 3NCYP 3R06B 3QUYD 3CSYA 3KS0H 3U36A 4B6ZA 4DKEH 4YHNB 1BM7A 4Y89A 1U8IB 2CRIA 4PB9L 1TCRB 2VN3A 4P2OB 4E9XA 2OMWB 3ARPA 2ZXDA 1T5WB 1FNEA 4W9KC 2K78A 4Y16D 4TUJB 4G2AA 4F3FA 5TDNB 2XIDA 2VDRH 2P3YA 2VCOA 3B1UA 4PGEB 1MHHB 4U33A 5CEYB 3T3PE 3WS6C 2BSRA 2AXHA 5K5YA 2VOTA 3CH1A 4IKKA 5DWUL 4DCQB 4F9PC 3PGCB 2APVA 1U3HB 4ZO9A 2BSTA 5DMGC 1QTSA 2HLAA 4OGAD 4TMPA 5BZDB 2NW3A 3N0AA 2OKMA 2R15A 3IJEB 5CEZL 3RTQA 4ZBJA 1FYTE 1N8OE 1A14H 4ZAKB 2P44B 2NPLX 3I84A 3WMSA 4XOCA 4NKDB 2GIMA 1JWMA 2LR4A 1XCQA 3BH9A 3BSHA 4NC0B 1FFTB 4GP4B 2WKGA 2DQMA 3TIDA 1KJ2B 1V3LA 4QRTA 3C2AL 2JIXB 2MMXA 1YAIA 2I9TA 1KT2A 4JRYD 3GQFA 2VZOA 3WTUA 2BVYA 5CUSH 1OM9A 3VFRB 2J1WA 4TSCL 4HHAB 2YJQA 3DO7B 4M43L 1SY6L 2Z3FA 3FZUD 2V5MA 4FCAA 3VA6A 1CLZL 3GSVB 5F6HJ 4OGXL 1NC2A 1I8AA 2KYIA 1DJYA 5F1OB 4OZHA 1MFBH 2R4RH 2ZOKB 2EDKA 1T21B 4IRJC 3W39A 5KZCD 2VE6A 3RI5F 3MR9B 3BKMH 5JHAA 1JGEA 3BT0A 4R7VA 3P3RA 1IIIA 4QO1B 3VFSA 4YPGA 4Y2OB 3UFIA 3NRQA 1OLZA 4JQXA 2PMZA 2YPLA 2UZYB 3ASWA 3DHJA 5HYJE 1ZLVH 5CD5C 3G5YA 1MHPH 4XZ4A 4NZ8A 5CLXA 4U1JA 1QSFD 4I5BB 4E41D 4UB0L 2W9EH 1MCHA 3FT4B 2QQNL 5C0CA 5KYYB 1NGWB 1JHTA 3MV9A 5IBUB 3TH3T 2B2XL 1FGNL 2Z31C 3CFNA 3US9A 1IGCL 3KR3H 5IGXL 3RUGB 4CW1B 4QY8A 4I4WB 1JGVH 3L4XA 3HI5L 2Q6WA 4FABL 4DP7X 5E94A 1HU8A 4WAFA 1A7RH 3NPZB 2YUZA 2DQHH 4X8XA 4F33B 3MQIA 1MCLA 2OYMA 1NGZA 5DVPA 3BDYH 4CMHB 2NMSA 3GMNB 3P69A 1EAQA 3MUJA 5C8JB 3WHE0 1UASA 5JHDA 3IDMB 1A8JH 1TQVA 1OAUL 3P73A 4ZUUB 3S2CA 1R5IA 2XN2A 4V2BA 4GRWB 4TS6A 3BD3A 3RNKA 2XIIA 2OJ1A 1WDAA 4Q6YA 4OCYH 1A3LL 1AXSA 1MY5A 3REWA 3RPIB 1IE5A 5IKCB 3VGBA 5J13B 5B3JE 2QSCL 2AQ3A 2DKMA 2F54E 4AY0A 4NM8H 4HG4J 3H0TB 4IRZL 4JM2B 5CXPA 1N3NA 1YEDB 3TCLA 4LSSL 4KZDL 3NJVA 1E90A 4QMEA 3RWEA 4JZNB 4HK3J 3D50A 2EIEA 4G7YL 2X70A 4PUBH 5DK0B 1H3UA 2DL9A 3AXHA 4P3CL 2VC2L 3WUWA 5BW7C 2WTRA 1D6VH 4M7ZC 5I28A 5GSVB 2R2EB 5DO8A 5IBTH 5JIIA 1G84A 5EEVA 1I3VA 1MLBB 3ECVA 5C0GB 4JLRA 2BOCB 1IGYB 4GOSA 3QHZL 4AC4A 5CSZA 5TDOB 3FHQA 1W16A 5EHFA 2H41A 2QR0B 3DTUB 4XT1C 1ORQB 4N1HB 4NKMA 3VWKC 2N7AA 1H3PH 5T1MB 3ARSA 3VFGL 5GGQH 2YD4A 5LJYH 4JFYB 4TULL 3TA3A 2CKBH 2IH9A 1AZCA 1D9KC 4O51B 4KV5F 2WTOA 2VR9A 5IMKA 4XNQB 4XNMA 1LE5A 1QVOB 4JJHA 1KFGA 4S1DD 1WSST 2B3RA 1O0VA 1HHIB 3DXAD 5C0FA 5T3XH 4ZO7A 1BQKA 2KPNA 3ZHNA 3GHBL 5IOKA 1ZVSA 1AACA 2JFCA 2YIHA 3DOSA 5ISZA 1I1YB 1BQUA 3U4EA 1BQLH 4NOFA 3U7WL 5D1XE 1YEFL 3GLDA 4X6DE 2VXVL 4KNUA 1IGIL 1QSVA 3B7UX 4G8GB 1IM3B 3RDTB 2J8HA 4L29B 1KY7A 3QDHA 1TPXC 3JV5A 3TVMB 3U83A 2VUYA 3VGAB 5K9OB 4P5SA 1GZHA 1MFCL 3CZUB 3F6IA 1BGXH 4JJOA 2XWRA 3VUAA 1UFUA 1II4E 2X3CA 5DFAA 1FFOA 4GRLD 3UIYA 3HZKB 3F7YA 1Z7JA 1I9JH 5CJQH 1I7ZB 1PDKB 5HHVH 3I9AA 2QMJA 2VERA 3I75A 3L4ZA 3PV7A 3QQXA 5FW8A 2EO7A 2N7SA 4RRPA 1KG0B 2AP2A 3WTTA 1KTKE 4OI8A 3PABA 4JPKL 4K5OA 1FVEB 1M71B 4UT9L 4LLYB 4WO4B 5EZLB 1JXJA 3EOTL 3UX9B 4JRFA 1ZS8A 3RNQB 2FUTA 5KOMC 1ES0B 1O6SB 2ZXCA 3ULSA 3VD2A 3ESUF 1U91B 1JE6A 1MCSA 2JE8A 1URIA 3L5JA 1NJ9A 1BWWA 3Q0HA 4FQ1L 5HHXL 1DQDL 3PAYA 2VIRB 1LD9A 4WW1A 2WJ5A 4HGWB 5IHUH 4ZPVB 2BIOA 5DFWH 5HP5A 4FHKA 3GZKA 4HHGA 5DI8A 3N44F 2L7EA