4YSUA

Structure of copper nitrite reductase from geobacillus thermodenitrificans - 25.0 mgy
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
295
structure length
295
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled structural changes in nitrite reductase revealed by serial femtosecond and microfocus crystallography
pubmed doi rcsb
source organism Geobacillus thermodenitrificans (strain ng80-2)
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 97
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ysuA00
2J5WA 1MZYA 2PLTA 1W8EA 4QLWA 4YVUA 3QJVB 1IKOP 4FAAB 1NIBA 4G7RB 4A2GA 4AKQA 1ASQA 5I6MA 3NJLA 4AKPA 3AG3B 2B08A 2I7OA 1WAEA 4KO9A 2YARA 2FQDA 2DWTA 2FNWA 1OCOB 2J56A 3X1BA 4E9XA 2OJ1A 1JZJA 2UXFA 2UXVA 3JT2A 5TK4A 5B7EA 5PAZA 1PNDA 5AFAA 1RCYA 1AOZA 1AANA 3PAZA 3S3BB 1PZCA 1W6LA 2XYBA 1E67A 3NSFA 3FPYA 4DPAX 2EIMB 2BP0A 5I6KA 3S3DB 3FSVA 3UACA 1IC0A 2WSDA 2FT8A 3L45A 2XV2A 3OM3B 1M57B 1J9RA 4JHUA 2BP8A 5B1JA 4KNTA 1ASOA 3UGEA 1L9QA 2I85A 4YSQA 1WA2X 4L0PB 4JKNA 1MDAA 1DZ0A 2Q5BA 1AG0A 3NJGA 1TEFA 2MTAA 3WI9A 1BQKA 3FU8A 1N70A 2ZOOA 4G70B 3PPSA 1EHKB 5I28A 3NSCA 4AZUA 3AW5A 2IWEA 1M56B 3D12B 2DV6A 2GHZA 2DYSB 2HX8A 1PLCA 1J5CA 6PCYA 4BWWA 2IH8A 1NWOA 4HALA 1NPNA 2RACA 3SQRA 1NIAA 2BHFA 2HZHA 1URIA 4HZ1A 3UAEA 2XXFA 4YSOA 1JZFA 3UADA 2NRDA 1AR1B 3ABLB 3CVDA 3C75A 4DPCX 3QQXA 1PLAA 4DP9X 4GXFA 3GDCA 4EF3A 3QJSB 1A3ZA 3CZUB 3IN0A 3UABA 3S8FB 1NWPA 3NJNA 3NP4A 4G7QB 1GS6X 2FJSA 4BDVA 5I6LA 1MZZA 2N0MA 5B7FA 5TK2A 1OE2A 4DP5X 1L9RA 4F7KA 4RH4A 3EHBB 2PCYA 2EINB 2P80A 4TXVB 4E9WA 2R7EB 3QJUB 3CG8A 2XVBA 4QKTA 5B1AB 4DP1X 1BQ5A 1BXAA 4A2DA 3V9CA 1GS8A 3FYIB 2B3IA 4HIPA 4A66A 1CURA 5B1BB 2YAOA 3NJFA 2GC7C 5F7AA 1AG6A 1E30A 3ABKB 3CVBA 1PZAA 3IEAA 2XX0A 4F2EA 3QJTB 2QT6A 3SBRA 1ZDSA 2AVFA 3TA4D 1OCZB 1R1CA 4E9VA 1JXFA 1KCWA 5ANHA 1PMYA 2QPDB 1ZDQA 1E5YA 3PAVA 1TEGA 3WKPA 4AX3A 4DP4X 2BW5A 4E9YA 2PP9A 3N2JA 1BAWA 4NB7A 1FFTB 1XMEB 1HAWA 3NSDA 3TASA 3MX0B 2CBPA 2CCWA 4Q8BA 2W8CA 1VLXA 1QLEB 4GP8B 2VMJA 1HAUA 3T6ZA 3DIVA 1I53A 1OOWA 1HFUA 2IH9A 4HCGA 3FPXA 4CSZA 2MRYA 3OMNB 2W88A 3OMIB 3AG4B 1L9OA 3NYKA 4BWTA 1BYOA 2YQBA 4YSSA 4Q89A 1AS8A 1AZNA 4HCFA 2GSMB 2HRHA 3BVDB 3ZBMA 2HX7A 2VM3A 2XUWA 1GSKA 1A8ZA 1JXGA 5I6OA 3H4FA 2QDWA 1AZCA 2VW4A 3T6WA 2XX1A 3QPKA 1J9SA 3OMAB 2YAMA 2XV3A 3ABMB 1RZPA 2CALA 1OCRB 1ZPUA 3HB3B 5B7MA 2VN3A 3WIAA 3FQYA 1L9TA 2AZAA 1NTDA 3ZDWA 3CDZA 1JOIA 1JXDA 2QDVA 2JXMA 4DP0X 2DWSA 4E9QA 8PAZA 3ASOB 2FQGA 3EH4B 3ABGA 4PCYA 1BEXA 5B1KA 1AAJA 3EH5B 2GI0A 4YSUA 2IDQA 1OCCB 4HHWA 1SHXA 2UX7A 1IBYA 3G5WA 4G7SB 3QJQB 4GP5B 4KNUA 4BWUA 3N55A 4GYBA 2BZCA 5LDUA 2E86A 1WS7A 3AG2B 1L9SA 4P5RA 2XLLA 4PAZA 4W9ZA 5D4IA 1OF0A 3WNIA 4W1TA 2PPCA 3NJKA 3PXLA 1AZBA 1A65A 2CAKA 1KDJA 1AACA 1YLBB 3H4HA 2FWLB 1QNIA 1SFHA 1GS7A 4BXVA 1ZV2A 2JKWA 2YAPA 4K9JA 1F56A 1E5ZA 4A2EA 3CVCA 2HRGA 4YSDA 1OV8A 1SNRA 4YVNA 4F2FA 2VSMB 1JVLA 3NJIA 2EIKB 1GW0A 1M9WA 2XXGA 4BDVB 5EHFA 1J9TA 3S8GB 2OV0A 2BP0B 1ET8A 1CYXA 2J55A 4GP4B 4YSRA 2BW4A 7PAZA 1B3IA 1WS8A 4DP6X 3AG1B 5I26A 4YSEA 2IDTA 2R7EA 3DTUB 2PCFA 2PPDA 4HAKA 4N8UA 2XU9A 3EH3B 3T6VA 5A7EA 1XB8A 1X9RA 4UF7C 4ZK8A 3ERXA 2FQEA 1MG3C 2PPEA 2YAHA 3X1NA 3FSZA 1AS7A 2ZONA 1GY1A 1BXVA 2JFCA 2QPEB 1KCBA 5IY5B 2BWIA 4KO7A 4KOCA 5I5IA 2CJ3A 1A4CA 1RZQA 1QHQA 4E9RA 4DPBX 3NJMA 4M3HA 3NJHA 3NSYA 1PZBA 5D4HA 5FC9A 1RKRA 2I7SA 3FU7B 5B3SB 3NT0A 4CSPA 1SDDA 3T9WA 1AZUA 2BP8B 4UANA 4DP8X 2UXTA 3TU6A 1JZGA 1NIDA 2YAEA 3ZIYA 4KO5A 4AI7A 1KBWA 3T6XA 4G72B 1IUZA 1JZEA 3X2QB 1TU2A 1L9PA 1AZRA 1XB3A 1A4BA 2AFNA 5D4JA 1ZIAA 3TBCA 2EILB 5I5JA 4A2FA 1NICA 5E9NA 1KYAA 2WO3B 2BZ7A 2H47C 1OE1A 2VM4A 4AKOA 3KW8A 3FS9A 2HLEB 2PPFA 4ENZA 2H5UA 1WA0X 1JVOA 1NDTA 3GXUB 2IAAC 2GB2A 3FQ1A 2IDSA 4KNSA 1ILSA 3X1FA 1JZHA 2H3XC 4JHVA 2X88A 2TSBA 3GYRA 4HHGA 4WKXA 3FT0A 1SHWA 4A68A 1BQRA 1W6WA 6PAZA 4KOBA 2Y1AA 3IE9A 1CC3A 2LLNA 2IWKA 1ASPA 3AZUA 2X87A 4MFHA 1T5KA 4BXSV 1AS6A 4NERA 2OCCB 3NJJA 3S3CB 1GR7A 2A3TA 1GYCA 1BXUA 3PAUA 5AKRA 3PLYA 3SBPA 3U25A 2FT6A 2BWDA 4A2HA 1FWXA 1PAZA 1SFDA 4NAJA 1PCSA 3UAAA 2BO0A 1SF5A 1UATA 3DKHA 1PNCA 2DYRB 1OE3A 4P5SA 4YSCA 1IBZA 2GC4C 1XB6A 2IDFA 4YSPA 3WKQA 3MBWB 2UXGA 4DP7X 4X4KA 4G71B 2J57A 2PPAA 1X9UA 3FYEB 1V54B 1ET5A 1DYZA 3FSAA 3FSWA 1KBVA 2FQFA 3JTBA 1GY2A 1FA4A 2IWFA 5B1JC 5I5MA 1NPJA 1PLBA 3TBBA 1ZIBA 1V10A 2XWZA 1ETJA 3ASNB 4N4YB 1SF3A 2YXVA 3IN2A 1SJMA 1TKWA 4E9TA 3OQRA 2Y69B 2FTAA 1NIFA 2AANA 4YSTA 2TSAA 3FQ2A 5I6NA 5F7BA 7PCYA 1A4AA 1J5DA 5PCYA 3X1GA 1KGYE 2YAQA 4YSAA 4HCIA 2HXAA 3ZX1A 2GIMA 1JZIA 1KDIA 3IBOA 5AZUA 4KO6A 1ID2A 5I6PA 4DP2X 2UX6A 1MG2C 1ILUA 2AZUA 1CUOA 3V9EA 1ADWA 3WNJA 3X1EA 2Q9OA 1V55B 4M4RB 3KW7A 2P80D 1NIEA 4A67A 4WTQA 2GBAA 1KV7A 3SBQA 3FU9A 2PP8A 1JERA 1PF3A 2ZWNA 1BYPA 2VSKB 1CYWA 2ZXWB 4FA7B 3FU7A 3HEIB 1PY0A 1SDDB 4BK5C 2YXWA 3AY2A 1N68A 2HX9A 2EIJB 2XV0A 3NP3A 3RYMA 1E65A 2VW7A 2CUAA 2PP7A 1EZLA 2FT7A 3CDZB 1AQ8A 1WA1X 2VW6A 3EF4A 2DY2A 1J9QA 3WG7B 1AIZA 9PCYA 1NINA 4GY4A 1ET7A 4YL4A 4UAHA 3H56A 3OD3A 4E9SA 1NZRA 3BQVA 3T71A 3PCYA 3QJRB 2WO2B 2YAFA 2IDUA
chains in the Genus database with same CATH superfamily
3O3DA 3VD5A 4IKLA 5ADPL 3LPOA 1CICB 5EU7E 4OD3H 2CIKB 3RWGA 2WTRA 4PJBB 3RL2A 4EN3B 4PG2A 1FZJB 4K8RH 4FI7A 3V52H 4OVUA 2XFXB 4I1RA 3UGXA 3X1BA 4X9BA 1A1OB 4FLSA 3SDDA 3MJWA 1O6TA 5DJ2A 3F04A 4YPGA 4WU7B 4JREC 4IBUA 4ISVA 3VU1A 2EIMB 4JZNA 5ITFA 4J6IA 4AGMA 1B9ZA 5C9KA 4LSQL 1UH2A 2YR3A 2OMYA 4C47A 5DUBA 1M1XB 4IEFB 1J9RA 1RHHB 2NOYA 4OY9A 3QA3B 5DQ9B 1X5ZA 2QV2A 3PWNB 4QRSA 4GKOA 3U4EB 4F8PA 4E41D 1WA2X 4L0PB 5F6HJ 3MV7A 1Z9PA 4LSSH 3UBFA 3QBTB 4M6MH 2IEPA 3ARSA 2NUTB 2X4QA 4RAUA 5E7BA 2ZOOA 4JQIH 4XPBL 4N26A 4ZSOE 3K2MC 5CU9A 1A9VA 4GFXA 1XSJA 3H6AA 5EBMA 1LE9A 2AABL 5B4MC 3GSWB 2IBGA 4W9GC 1GC1L 5IFHL 3MRDA 1NOLA 3ECUA 4JM2D 3IMUA 4IHOA 1QPPA 4PJ9C 3DX7A 3BFQG 3IE4A 4YSOA 3E9TA 5JDJA 1UB5B 3GC3A 3WKML 5DHVH 4GW4A 2X5PA 4MNGE 3VRJB 3BAXA 4DAGL 2JQMA 5TE4H 3JZYA 2ADGB 1H8LA 3QEQA 2XIIA 3KWWB 4PREA 2ZKYA 2R0KL 3CFEB 4PWHA 5EO9B 5F1IB 2O4EA 1Q94A 4OZFB 4PMFA 3V95A 5FECB 1UM5L 2D0GA 1UJ3A 5HGDA 4FXKC 3L1EA 1KBGH 1B0IA 5DYFA 2EQDA 2QTVA 2VB5A 2WWKO 4DTGH 3TV8A 1KCUL 5B7FA 4P23A 5A2JH 4IU2B 1MWAL 1MEXH 2WQRA 1IAKA 1L9RA 2M2DA 5DWUH 3WTVA 3AITA 3WUWB 1ES0B 3P2DA 2AITA 4QAWA 5HHOA 4HUMB 4NQCA 3M6DA 1UOVA 3I50L 4OGZA 3ZYIA 4R7DB 1KGCE 4QRUB 3V9CA 1TFPA 4OH2A 3V4PB 1YDPB 5KVDE 1IO4C 1CURA 2AJXH 2IFGA 1II4E 4Y4FD 3CVBA 1PZAA 32C2B 2DJSA 4E0RB 4MNGB 5A40E 4UDUA 2QT6A 4BK5A 2OJZL 1LP9B 1TJHL 3ARUA 3QDGD 1I8KB 3NFSL 1NCOA 3TESA 2BW5A 3PDOB 2PP9A 4XNAA 3ZYOA 4WFGD 3CVIL 1IX2A 4QRBA 4JFHE 1NLDH 5F6HI 3OKNB 4IKIA 1R46A 4TUOA 2A4ZA 5HDLA 2XTJE 3HS0B 5D9SB 4UILH 3L08A 5E9DD 4KK9C 2YD8A 3KYNB 1HKLH 5G55A 5I75B 1N6VA 1NQBA 2Y4SA 3KPSE 5IVOA 3IJHA 2RMNA 1NBYA 3CXDH 1X44A 2ZCZA 4ANWA 3I6GB 3SPVA 2B3RA 3SKMB 3GTNA 4ZFGH 2XBDA 3L3DB 1MCKA 3GLAA 4HUUA 4RWYH 1O5DT 1T0MA 2HFTA 2YC1B 3SGDI 1B0GA 1MFBH 1DDHA 1JUFA 1HSBB 4WU7A 2XN9D 2F8XC 2DKSA 3GMOA 3MV8A 1JPFA 3MRIB 4IBYA 4H8WC 4RA3A 2P8MA 2P5EB 1WBZB 4Z7VE 2DIEA 5F89A 3H2QA 3LS4L 2WN2A 3QZMA 5DJDB 4LCYA 3VFPB 5IKCA 3RWDB 4UT7H 2C4FU 4FJ6A 5LCVL 4YXKH 1ZLEA 3HG3A 5F0PB 3S48A 3IS0X 3MV7B 4X5WA 3SDAA 4BCYA 4N90E 4DP0X 4R0LC 4UQ3B 1OT4A 1G0DA 4JPVH 3S35X 2FBJL 5GGUA 3TA3C 1FYTE 4XP9L 4DKAA 2WD0A 1IGTA 4Z7QB 5AYUH 4NO2A 2GI0A 4MD4A 4V2CB 2YPLE 1IBYA 3SCMD 1FYHB 1SEBA 3G6AA 5HPOA 5AZ2L 3STLB 4N2HA 3FT4B 3GXIA 3E2HC 3LXAA 4P07A 4O2CB 5H37A 1R5IB 1GYAA 3T2OA 5BUGA 1AH1A 5ISZA 4I3GA 4U6YB 1CI3M 1HOCB 2P8LB 1AQKL 4G8AC 3S9DB 3U1QA 4ZAKB 4EN3A 4ODXA 1D7BA 4PW4A 2WZ5A 1MFEL 3AADB 1A65A 5D7LE 4YBLB 4JR9H 4GQPH 1EZVY 1T7WA 1F56A 1C08B 3PWJA 4HJSA 4PREB 1TTFA 1SNRA 3ZZ1A 4F2FA 1R0AH 5HBBA 1TSRA 4NUJA 3MRQB 3N1PC 3SDDD 2YRPA 3S8GB 5F9DC 3SOTA 2OXGA 5CP7B 3RFZA 3TCLB 4X6DB 5K33A 1HEZA 4GRMB 2XG4B 1E4WL 5DHMC 3QIBD 2HFGL 2OKMA 2DRUA 4MWFA 4Z7NE 4RETB 3EG9B 3F2LA 3WUWA 1EEZB 5DEGB 1P9MC 4FNPA 4JQXA 5F7EH 2PPDA 3N1FC 1V5JA 4PB9L 3W1ZA 4U1JA 2ZP0T 2G0LA 2Y2WA 5JHDA 1AQDA 2BC4B 4HKBA 5AVTB 1OTTC 1FN4A 4JG9A 3C08L 1FFOA 5FYKD 3ALWA 1E6OH 2X4QB 4S11A 2NUTA 4ZTOH 2X4NB 3HE6C 2A1WH 2CDGB 2Y7MA 4JVPA 2V9UA 1FDLL 2PXYC 2X70B 2VKWA 3F12B 1U92A 3DK2A 1J0ZA 2WANA 3II3A 3MRBA 4J8QA 4M3HA 3NJHA 1BOYA 4XVOA 4H20L 3BPOB 4X6FB 5B3SB 5K9OB 4XN2A 1N2RB 1EJFA 4U6HA 2QQNH 1HNYA 2BP8B 4JZOB 4YO0B 1FGNL 4S1SL 2ZXDA 4KRPB 3BO8A 4HH9A 4TUKH 5AVVB 4TVPH 2Y3NA 1DBAL 4EMZA 1TU2A 1V7NL 2WQAA 1WHOA 1J5OH 2GFBB 3T4AB 1P7BA 3WEBA 1OB0A 2IAMC 3R0MA 3SQBA 3WXVL 3ZMRA 5L88L 1CDUA 1XIWB 4UT6L 4C57C 4N2BA 4NZDA 3EYUL 4AEHH 2ZP8A 3K1DA 1NCJA 3O2DL 2ZUXA 3V0WH 3LNIA 3DA0A 3D18B 3NG5A 3QIBC 3TCXA 3A67H 1WO2A 4ZUTA 4L3AA 1B6UA 5EUKA 1WBZA 2CBTA 1KTKE 3QNFA 1G0YR 2R15A 4GS7B 5FUZH 3ZYJA 4QRUA 4G8GE 4MAUL 2XTJD 4N0RA 3THML 1U3HA 1G7MB 1DBBL 3RB5A 5KYUB 1KJ3H 1U3YA 5DRNB 1M6OB 3BWZA 2O6PA 3CE1A 2DEYX 3EFFA 4PU2A 4DHLA 2LLNA 1ASPA 3LKNB 5FGCB 2ZUUA 4M43L 2VLME 3V55A 4QXTA 1X5IA 1YQ2A 4PGBA 3HC0B 5J11C 4LVHC 5FFLA 5CEZL 1P84K 2BWQA 5TFSH 2ZKHH 1PAZA 2HN7A 5BZWB 2WINA 4I0PC 4QOKD 5H94B 4APQA 2NMSA 4ZQTA 3US1A 3OKNA 3S5YA 2KDYA 2B77A 3UAAA 2E8ZA 2F19L 3DV6B 4LOUD 3FU6A 2MWCA 5IIEA 4K5LA 2FB4H 1BVOA 4K9EC 4RMWA 1I8UA 3MBEB 4ZJ9A 1UEYA 4BQCA 4Y5VC 3LNFA 2P8LA 4DVBB 4YSPA 4ZMVA 4AMWA 1I7UA 1Q8MA 1U2YA 3ZGHA 3F7YB 3VRIB 3K72A 5D1QD 1MW1A 2ILLA 3RJDA 4HUUB 2C4FT 2V5RA 3FSAA 4IGBD 4J23A 4FA8A 4LGPB 1OT2A 2FQFA 1ADQH 1M2OA 1GY2A 3QO1B 2LQRA 4E41E 1F3JA 3TPUA 2L8AA 4D2NA 1U3HC 2BIQA 4LEXL 2IOOA 3KWVA 4NC1E 3U1PA 4PRIA 5INDA 4U1GC 2XG4A 5FA3A 4HK0A 1K5NA 2NY4D 1NIFA 4PP1D 2WQXA 3HN5A 3UIZA 4ZW5A 1U95B 5KOVC 4WDIB 4IOFC 2EEXA 4EEEA 2MQ0A 4YK4B 2YAQA 4POUB 1A6UL 4FNLL 4PVNA 1OAXL 3MA9L 1BD2B 3EW3B 1DJSA 5FYLE 4KO6A 1L6PA 3V6OC 3HHSB 5C2BH 4UQ3A 5T3XD 1CUOA 5E5MA 5EEZA 2VQTA 2R2BB 2Q9OA 1MHPL 1CXFA 2P80D 3RG1C 4PBWD 4RAHA 2BH0A 1P5UC 1U36A 4XNQA 5GJTH 3WIFB 4YDLB 2IMNA 1E4WH 3BAWA 2OMUB 4OB5L 3F01A 1I7TB 2WXGA 1LDSA 3L3IA 3PQYE 2CHXA 4HIEB 3UDWA 2J7LA 1QFWM 1JF6A 1ZT1A 3RNQA 2G9HA 4R96A 1QFHA 5E08H 4JFOB 2EIJB 3AABA 4IMLB 2GVYA 3LEXB 4LP4A 4R7NB 1NUDA 1U3JA 1TU2B 5AAWA 3OBAA 3OAZK 5MEOA 4M1DL 5FGSA 1LK3L 3MJ6A 4IRZA 1P7KB 2QSVA 3JTSA 3SEPA 4UB0L 4AYBA 5CJXC 4KXZH 3AT8A 3KGRA 3POHA 2P48B 3S96A 3TO2A 2PO6C 1SDYA 3HS0A 4M4PA 3ULVH 2XVKA 4WI0A 3DURB 1AIFA 5KVGH 4A7UA 4Z8FH 4OW6A 1XF3A 5I6MA 2Y2TA 2K0RA 4NP9A 5EF0A 4DPRA 2XQ0A 4XPGH 4LLYB 5D1XE 4OGAD 2ADFH 1QKZH 2H1PL 3L3DA 4URTB 4YGVA 1T83A 4MNQA 4PJDB 4ADIA 5GS0L 5IB1B 1JE6A 3QUYC 2H32A 3VI3B 2KZKA 1Q1JH 2LU7A 3JT2A 3VDBA 2ITCA 1RCYA 1AANA 3I3EA 2ZSWB 3S3BB 4CVUA 4UTAH 5EU6A 1S8DB 3RY6C 4P46C 2QEJA 3TO4B 4LEOA 1ZHKB 4JY5H 3GSXA 3HFML 2D4DA 2CLRB 1UUSA 1IV8A 3C8HA 4OZFH 4WFFE 1UYWL 3QEUB 4U6HB 3U0TB 3KYMA 3MTRA 4D8PB 3BT0A 3EYOA 1T20A 4CL7A 5DHEA 3MV9D 4ERSL 3QNZB 5EDSA 3L1FA 3O8XB 2NNAB 5I71B 1X5YA 1D7CA 3GPSA 4TTDC 3IFNH 4OM1H 3VFRA 2HRLA 3BH8B 3IDIA 5DF0A 5KUKA 1REIA 2YOCA 3TBTB 4LRIC 2VXTL 1IARB 3QQ3A 4FZEL 4G70B 2VRQA 3FOMA 3KYKH 4L8DB 4M8RA 5LN4A 3KL5A 1CR9H 5DRXA 3A0OA 2KPNA 4JFSA 2VCOA 4MA7L 4NENA 5IBTL 4YIQA 2F61A 2V2XA 2YBRB 4Q97A 1BGXL 2F1EA 2ARJB 3MJ9A 4D9LL 2DQIL 3VXNB 2J4WL 5BRZB 1CYGA 2P5WD 4FTVA 4P23D 4UBDC 2ADIA 3IJ9A 4PPTA 1A47A 3P69A 1KGCD 2VDPB 1WFIA 4PRAB 1DJIA 2ZCLH 4WDIA 3EO9L 3FTGB 3F6JA 4ZOEA 1ACYL 4B96A 1D9KB 4KVCL 1WD9A 4LLAA 2C3HA 3HJEA 1S7SB 1MQKL 4LEBA 1A7PL 4KVPA 3GDCA 5C0AD 3AS1A 3APCA 4FNRA 3HZ3A 2QGDA 3NJNA 4B9JA 3LD8C 2W60A 2DQFB 2FJSA 3MRQA 4F7TB 3MRHA 4H5SA 2LOEA 3A24A 3CSTA 4P59H 3HR5B 3PP3H 3FB7B 2HN7B 4HMDA 1FVDA 5HJDA 3TCTA 3HCVA 4R2GD 1FP5A 1JK9A 5JO5B 3U2SB 3S8WA 4NC0B 4J3WA 4ANXA 3QEHB 1WC7A 2XVBA 4IOSA 4PW9A 2QTEA 2QQKL 5FDWB 3DTXA 4GH7B 4ZFQA 1GS8A 2YGQA 3ORJA 3L5HA 1PZ5B 1U8QB 3GMPA 4HUWB 4K5PA 5DVOA 1CFSA 4UWQB 5FGBC 4Y9GA 5B1BB 3V5HA 1CQYA 3BP6B 3GBLA 1I7UB 4HISA 3O3AB 2V7HB 4GUPB 3EJPA 1N6UA 4OZIA 1QEWA 2O5NA 4UQCA 3SIKA 2AVFA 4KQ4L 4AQZA 3TEUA 4HKXB 1KCWA 2VJXA 3WN5C 3BN3B 1PMYA 1DJGA 5GRXG 3KPTA 3NSJA 4GKZB 3BD5A 4X9GA 2BY2A 1LEIB 4KRLB 2VTFA 4NB7A 3WOVA 2VXVH 2BSED 4HWEH 4X6FA 4FDWA 4HJJL 5IF0B 3T65A 4IBTA 2ZXQA 1EDQA 3CFDB 1ZJAA 4PV9A 3D85D 5KYXA 4L8SA 4HBQA 4WW1B 4KX8A 3JWNC 1ZS8B 2Y5EA 4FZ8L 3BAEH 2B39A 4FYRA 4R4FH 3OMIB 4NQDA 4HBCH 4YSSA 5ILTL 5DSCB 4LPWA 3GMNB 4HCFA 3L3JA 4M4RA 5E2WL 1YEHH 1WIOA 3B9DA 2H6UA 4M6ML 1G0XA 3H9SA 1B0WA 5JDSA 3VQ1C 1ED3A 4QRPE 1HKFA 1HIMH 3DXAA 4HH8A 1MCSA 3PNWB 4RLDA 3TO4A 4O51A 5HJBA 1QTPA 2BSEA 1IGFL 1OAQH 4QHKI 1DQDL 1FRGL 5C07B 1ZT7B 1ZVSB 3GZOA 4OZ4B 4JE0A 3VGAC 4W6WB 3TYFA 4R96B 1A1MA 2VISA 3JSSA 1G6RL 2D31B 5E2VL 2NSXA 3N85H 3FT1A 1O0VA 3JV6A 1ZPUA 5IMLA 5DHYB 3O9WA 3B1TA 5D7HA 1B3JA 3MJ7B 4FQXD 3S0PA 2X4UA 2DDQH 1JXDA 3KPOA 3DVFA 3NSXA 1C1EH 4APQC 4NN6C 1QG3A 4C4UA 2JLLA 2FSEB 1KPVA 5C86A 4U7SA 5B1KA 4AV0A 6TAAA 2HJFA 4PJXF 1JWUA 3LDBB 2XPZA 1OK8A 4QI3A 1CFTA 2BIHA 1JHKL 3ISWA 4HPYL 4OGXH 3N55A 3RL1A 2WUBL 3ESOA 4GRLD 2VR4A 5EIIB 1Z1WA 2HAZA 3AG2B 3BLKA 5JR1L 3DSNB 5KZCD 1YEGH 1BMWA 2OMTB 3LB6D 3RAJL 3G5VB 3WKNA 1WVZA 1BVLA 3M1OA 3P9WB 4LVOC 3RTLA 1IGFH 1OAQL 2C3VA 2XOTA 1HXYA 2E46A 3DYOA 1HINL 2XFXA 2XTJC 2QZQA 4KUCD 5EU3B 1I3VA 3OR7A 1E5ZA 5GGSY 2VSDA 4NLHA 2A7BA 4TS6A 3VI3A 4Z7NF 2XNAB 2ZKMX 3A4DA 1ORQB 4FQQA 2OJEB 2H41A 5A6IA 5E6IB 1M7IA 3MRHB 4ISVB 4QRTA 4NQDD 1ET8A 4WTWA 4FFVD 2BRRL 4P04A 4TRPH 1B3IA 4YXKL 2JIXD 3DJ9A 4GW1B 1BZ7B 2APSA 4JREB 2ZOUA 1ZLDA 4L3EA 4MB3A 4WV1A 4DVRH 3NZHH 4JM2F 3QNZA 5IREA 2R39A 2ZX5A 5C0CA 1GAFL 4JRYE 1T2QL 4PWFA 2D2OA 4UF7C 5FYJL 2FL5B 1ITBB 1ZXQA 2NY5C 3KDPB 4JLRB 4BFFA 4W81A 2YAHA 3L17A 3QC5X 5GS3A 1W72A 3Q9QA 4YFLF 1Z0MA 1X4XA 4JQVA 1JZ2A 2CJ3A 3T8VA 5T33L 2Q2LA 4HXBH 4CN1A 2IVFC 1CDGA 1EEYA 5E4AA 4AQAA 2HKHH 4HHAA 5TE6H 1NDMB 5KSAA 5IQMA 2VLRE 2ZWSA 2N1TE 2P43B 1CG9B 3FK3A 4ODWB 4UANA 1BJ8A 4I2XB 2OMZA 5D1XA 3VXUD 5CEZH 3UP6A 3OLGA 4K3DL 3VXRE 1C8PA 2UUDH 3FTYA 1KGWA 2DTML 3SDCB 2PO6A 5JQHC 4WHYH 3VGDA 4EQ3A 2AFNA 2ENSA 2IF7A 3DO3A 4X7CC 5IQLA 3HS0C 1KTCA 2EILB 3LKQA 1FH5L 4GS7C 3RZCA 3MGTB 5FYJH 4FQ1H 1OY3B 5FB8B 1HE7A 3BP5A 2H47C 3S37X 3D39E 4PJFE 2YJQA 1T1ZA 4J2QA 4KK6D 4Y1AA 1IAKB 5D5MF 3O2DA 1SYVA 2CHZA 2IAMA 3D30A 1A9BA 4MAYD 2UY6A 1OP3K 4MB5A 1NGPH 4X6BB 3WN6A 1C5DB 5TE7H 4FG2A 2YKLL 3O2VH 1RZ8B 3DTXB 4N8VB 3ZOAA 4LLYA 2TSBA 4FF9A 3W81A 5AG9A 3KS0J 3V5HB 5HYSA 3HI5H 1HQ4B 4HD5A 1OHZA 1V3MA 2Z92A 2NW3A 3L2NA 3Q6FA 3OKOB 2WQSA 2IMMA 4ESKA 1LO0H 5ERWB 1BIIB 2KUTA 4XCCL 4AL8L 2AJZB 2BP5M 3ZE2F 2EEAA 2E5EA 2HJFB 1BAGA 4S1SH 1N10A 3RDTC 1KLGB 3V4VH 4OCWH 3IWUA 3KXFD 2NXZB 3PXHA 5I8OH 1TQBC 4LSTH 4TKWA 4NYLB 2VXQH 1BVZA 4C8XA 5D72L 4XXDB 3U0TA 4XC3H 3KYNA 3DKHA 4XO3A 1R75A 4EI5B 3CV5A 2A38A 4L8SB 3IXTB 2DW5A 5E00A 2D9CA 4DP7X 3KGSA 2XVGA 1YEIL 2DMGA 2PF6A 4N2GA 2L7JA 4N2MA 2CBOA 1F4XH 4D3CH 4DQOL 4F8QA 4C56B 4Z7IA 4RX4A 1KCUH 4BIKA 2BVOA 4TLSA 2IWFA 3NQIA 3JV5A 5CD5D 3AT9A 2IALB 2AQNA 3G5XB 4NQVA 5IFAH 3S88L 1PZUB 3T4YB 5KYWA 1FLRL 3N43F 3IN2A 4FTVB 4IBZA 3MRIA 4HWBL 1AR2A 2J71A 4AWJC 3KE0A 2DLHA 3P3UA 2GAZA 2DKMA 4OLYH 4B60A 7PCYA 1EV2E 2XWJA 1HU8A 1UYWH 5AEAA 4W4NA 1F58L 3SJVB 4LSTL 3PE9A 3GI9H 4PJFF 2YGPA 5GGVL 2IAMD 4LHUG 2G3XA 1ZEAH 2PYFA 2X4UB 1UC6A 3OV6A 3WNJA 3D39D 4GO6B 1TQWA 4CSSA 4M7JH 4LDLB 4TQEL 1O9VA 4L4TE 4RGMB 5LHDA 5E94B 5SWQB 2WZ0A 2YQ3A 2VDKB 3ILQC 1INDH 1SLUA 5HHME 3U7WH 4LDCA 2PP8A 2WXPA 3F62A 1CL7H 4X7DC 1K85A 1T66C 2ZWNA 5D71H 5D1QA 1CYWA 4FTDA 3ZDXB 1XDTT 1G1OA 1U6AL 5EBLB 4BK5C 4N5EC 5DHVA 1EERB 2XSKA 1KTLB 4KMQA 3MNMA 1TMQA 3SDAD 2FWOA 3UOAB 2BVUA 2NY3C 3SO5A 4LF3A 1FBIL 1PD0A 2PO6B 4JAMA 5FS5A 3VFGH 5HI3C 5EIQA 3B3IB 4ICXA 5HPMB 2R1XB 2WXRA 4EKXA 2ZF8A 3QEQE 2XNAA 4IDJL 3LAFA 3V0DA 1XR9B 4NQSB 1AZZC 3W9DB 1JAEA 5FB8A 1EPFA 5T1JA 1K5WA 3REWB 3QUZA 1HZLA 2BNRD 5ADOL 3UC0H 3V0HA 3BQUB 2OSLA 3S4SG 2XWEA 4JRYD 1EEZA 3S36X 1BBDH 4MA3A 2WLYA 3IJ8A 3WIIH 1YUHB 2XKNB 1QZNA 3ILEA 1JTPA 4XN4A 3OJ2C 3IDJB 4L5FE 4TTGA 3VX1A 3GI8H 3P77B 4XO4A 2I7OA 2HYMA 4QWWC 1KZYA 4XCYB 2EIDA 1OCOB 2Z92B 5TF1L 4JLRA 3JVFC 1O7SA 5LGHH 4E9XA 4AUJA 1FFOB 1JYXA 1TZGL 1BZQK 3V6ZA 3DUSA 3NSFA 2VXSH 4KH2A 1D5XA 3GXNA 4C83A 4JGJA 1O7VA 1CJYA 2DM4A 3DIFA 3S3DB 4ZQKA 4GRWH 5GRVL 3NK4A 1A6TA 3P4LA 4X8JA 1M7XA 2A73B 4X4XB 2BIMA 4HAGA 2BCKB 4APXA 4FEMA 4X6CA 1A7QH 1XCXA 2D3LA 3D2UD 5SX4H 3TYFB 3VSVA 4Q0XL 5G2NA 2VDKH 1THCA 3TIEA 4YSQA 1MDTA 3EFOB 5AKTA 2DQJL 4FLRA 2MCG1 2KQMA 3OX8A 4UB0H 3EOTL 1BG1A 3TZVB 4UQEA 4ENEC 1AXSA 1Z0NA 2AXHA 1H3VA 2NY1B 3NJGA 1G7PB 3CFKA 4YHOH 4AXWB 2WPGA 4WWKD 4M5YL 1BWMA 2DQHH 2KHAA 3FQUB 2DLEA 4NQEE 2JJUA 4Z8FL 3GNML 4UAOC 5KJ4A 4UQAA 3NCYP 4KXBA 4LIQL 3MRMA 3MZTA 3M8OH 3U4BH 2A2QT 4FNSA 2EDKA 1EO5A 3PHSA 2UZYA 3G08A 1KJ2A 1T1ZB 3N41B 3O11B 3KPPB 3W0WE 4LHUA 1J5CA 6PCYA 2VR5A 5DMKA 5IROA 3UYRL 5EOCH 2D7QA 3QRLA 4Y16D 4F91B 3UBXG 5GGRA 1UB6A 1C5DA 3CZGA 3AUWB 4HZ1A 4LFHD 5JW4N 5G4OA 3VA2C 2N3JA 1YYML 4U1IB 5DQJA 4MD5A 1QNZH 3CLFL 2D2CC 4MA1C 1G7LB 1HQ4A 4ANUA 1WZKA 2CH8A 1A3RL 3ZVVA 4EF3A 1E8ZA 1IC5L 3S2AA 4ZBJA 1CICC 1JHTB 2RCSH 3F58L 4LLQA 4N0FB 1TETL 4CC4C 3DX9B 3HRZB 3MCG1 1BOGB 5JIPA 1I8IB 4FQQB 2IWGA 1VESA 4G7YH 3VG0H 2YEQA 1NSNH 4OLEA 2PO6D 2V3FA 1NEZB 4WV1C 3T3PB 5CIPA 3L1OL 1JK8A 4OCYH 2QQLL 4PJIA 2MCPH 1YNKL 4R0LA 3C6EA 1FJ1A 3W5MA 1L3NA 5EWIL 3WXWH 4Z9KB 4D8OA 4E42B 1V8HA 3GGWA 4I0KA 4GRWB 3DECA 2YAOA 2Y7LA 2AEOA 5KSBB 3F64A 5CSZA 3ABKB 3DVNA 4YX2L 43C9A 3IEAA 5IESH 3FCGA 3MSPA 4L4VE 1PDKA 2W9DH 5AAMC 3K4ZA 1YY9D 5FYJD 4E9VA 2P26A 1V7MH 5D1ZC 3S36L 3PNRB 2XJKA 3QIUC 2MJWA 2XZQL 3ARGC 1G87A 1BAWA 2IGTA 3PGFL 3VH8B 1QBMH 2BJML 3REWA 1HHGB 3PIQB 5JORA 4L2YA 1F90H 4UDTB 3WUZA 5KVEH 2W8CA 3IMBA 2YGVA 4UAOB 4I2XA 3L4XA 2JI2A 2JIXA 4MJ6B 3CGTA 3NRFA 4DUXA 1JPTL 1RUQL 2MOQA 3T6ZA 3DVGB 3L5XH 4LHUD 2IH9A 4R3SA 2F8VA 2JWYA 3NUKA 4HCGA 5I1LB 5SV4A 4J1UA 4G1EB 3HHSA 5KJRH 1UD5A 5B38B 2ESVB 4PJ9B 2CA4A 3TONA 1AO7B 2SEBA 3D6GA 4Y9EA 4M8QA 4JFQA 1MHEB 1HSAB 3MLYH 4XHJD 3FFCA 3EAKA 4K3EH 2F19H 2BVEA 5DMJB 1GW6A 3H4FA 3WE6B 3L3IB 1KXTA 1OP5H 5IV2B 1ZTMA 3WIIL 4F9LA 4JCMA 1XBDA 2A4EA 1N59B 2XHNA 3OLIA 5E70A 2A73A 1IC1A 3JWNH 3PGDA 1XGRA 3U30C 4N1HB 3WGVB 2AV7B 2R23A 1YQVL 1P4IH 1G6RA 1MFCH 1KYOJ 5EN3A 3HB3B 3O2WL 1KFAL 1XR8B 2YMTA 4L37A 2JCCE 1GMIA 4U1SB 5JHDE 1ADQL 1RLBA 3Q6FB 5JZ7D 4KMTH 5KBPA 4JNXA 4ZX4A 1YEJH 2JXMA 2E47A 4KKCC 4HWEL 1XCTB 2AMUA 3KXFA 3RILA 5I5RA 5IOKA 3ABGA 3JTTA 1JVKA 2XWTB 5IOPA 1AAJA 5B39A 2I60H 2C7UB 2B15A 1DJYA 3G5YA 3HS9A 3O9WD 3F83A 1NGWA 4I87A 1ZS2A 4HUCA 4JPVL 3VFVA 4L1TA 4AVIA 1QR1B 1KIPA 3QWOB 1KIUA 2HFEB 3QJQB 1T0NA 4FXGC 4OJYA 3RJOA 1FE8L 5LDUA 2O61A 3CIQA 4IGBB 5I18L 5DD1H 4W9ZA 1L9SA 3ARGB 4O2FB 4H1LA 4RGOL 3NTCH 1M3JA 2VO5A 4XPHH 4KWUA 2PPCA 5IVXB 2NY0B 2AAVA 4NNXB 4IDLA 5D7IB 3VFUA 7CGTA 3V7MA 5DK2A 2IPTH 1RZKH 3RPIA 5DWUL 5DJZB 3BVNB 3CVCA 2HRGA 1R34A 3GF8A 4CVXA 1K2DB 2GKIA 3T0AA 3FHEA 2UYLB 4GKNA 2VDRB 1W15A 1ZK9A 3LN4B 2I32A 1I7ZA 1J0IA 1VGEL 4OCWL 4PJHA 3PS6A 2AXFA 4UUJA 3GUTB 4U3SB 2GUOB 3FRPG 3KBEA 4KX9A 4PVLA 5LB1A 1S9YA 2O30A 4YSEA 1CGUA 2E59A 4R0LB 1BX2A 3HE6A 3WKMH 2EDBA 4FQHA 3SPIA 5F9JB 5EN2A 4NKDA 2G2PA 2G4GA 3CC5B 1DLFH 3GIVA 3TIEB 4AYMC 4PJ9D 1QVOA 4NUQA 4JDEA 5D7JA 1Z9LA 1RPUA 4OFPA 2X41A 1IGJA 3O2VL 2GJRA 5D1QC 4PD4J 3MJ8A 3D4ZA 1OGAE 5FDYA 4ZMWA 2QPEB 5DRXB 2ENPA 1T03H 1QFOA 4FFWC 1W2KT 5J4MA 5ITFB 3DETC 2YBRA 5CFAA 3I6KB 3F7RA 2QQLH 4MQTB 4ZUSA 4PBDA 3NJMA 2DLFH 1ZHBB 5I6XB 5J06A 4K4KA 5AALA 3TT1H 4LHUB 1M1XA 1RKRA 4YHKH 2LGNA 3HR6A 1UXWA 3G04B 4YZFE 4M7LT 1I8LC 3N1QC 2W81C 3QR1A 4UIMA 4YX2H 3RWIA 4F33A 4YAQB 2OPCA 2MKWA 2YZ8A 3ECWA 2LAAA 4PJEB 4KTGA 5HPMA 3OC8A 4OBRA 2WO4A 1T0MB 1ZIAA 3VE0B 5CEXB 3AVEA 5BZDA 1CO1A 4B6ZA 4FFYL 3L5WA 4JFXA 4N8PA 3DVIA 3HFMH 4XPAH 2JK5A 4ETYA 2AK4E 3QXDB 5IB2A 2ADJA 1ODAA 3DHPA 5JIIA 5KJ7E 3ULAB 4P3DB 4R5XA 5KANG 3A6BH 1WA0X 2J6EH 5TJWK 4FG6C 4R90H 4OQTH 3U36B 3BE1H 1WC7B 4ZW6A 1OPOA 3VXTA 2KMWA 3L5XL 1TYJA 5EEVA 2H3XC 2AV7A 2R23B 3UX9B 3D3VB 5BV7C 1OAUL 3BDXA 5DLLA 4ONFL 1SHWA 5CWSB 4BUGA 1MWAA 4F7EA 5JIMA 2F5AL 3LZRA 1JMXA 3O0RL 3NN8B 3VFGL 3EBAA 3IE9A 4AGNA 3RUGA 4MCZA 2GBUA 3BW9A 5GS1C 4PY7B 5TDNB 1UJ3B 2ICWJ 3V6ZB 4IU3A 3T8MA 3PQYA 1GYCA 3LKOA 1ZEAL 3FO1B 4Z5RB 3VFSB 4A2HA 4NN7B 1N12A 2CIIA 3D2UA 2ZCLL 2ATKA 3HG5A 3MVSA 4YBLC 3WHXB 1JFHA 2YMXL 2XQBL 2CJTA 3COOA 5DMGD 5HDBF 3GJFA 2NXZD 1A6ZA 3EJRA 1U41A 1KG0A 3V0AC 4H1LB 3BFWA 4NM8L 2E7CA 3GHBL 2IDFA 2YSSB 4WW1A 1SOSA 2IQAB 3FHAA 1HHIB 1PU0A 2EUXA 3OJVC 4MMZB 1KXQE 3KS0H 2VABA 3PY9A 1BYNA 4FP8L 3DOHA 4KZDH 3RU8L 4N2IA 1HSAA 1ZIBA 5DYOA 5L2JA 2F5BH 3K0YA 3H2WA 3ARTA 3K0WA 1E3FA 3LPFA 4ELMA 2NY2C 5GS2D 2VITA 1DQIA 1QSVA 3RGVC 1UKSA 1E8XA 3V6OA 3RZCC 3PP4H 2TSAA 4P9MH 4RGOH 1CLZL 5IZ7A 1J5DA 5JA9A 3CZEA 1PZSA 1FNLA 3D69A 2GBVA 3V8OA 2FJUB 1UM4H 2BNUB 2GIMA 4M8VA 4XMPH 4DO6A 1XL4A 4DUWA 4AVKA 2VMCA 1N5AA 1I1FB 2BC4A 3DJTA 4JQXC 4M6OL 5C0BD 4WTZA 3CUPA 5KSAC 4KKBD 1A6UH 4FNLH 3BPOC 4ZS7L 2VWEE 1BD2D 2PWFA 3ARDA 5E6SB 4L4VA 3ZJAA 1IFGA 3RWCA 3KBHE 1IC4H 4YNYB 3UFIA 4NKOA 4BUHA 5FF6A 3GSOB 3LS5L 3MRFA 4DFIA 4Z7UE 5BV7L 5LVEA 1JGDA 3B7RL 1CE1L 2VM9A 1OF2A 3PFUA 1KYFA 5C3IA 4O9HH 3HI1A 3D50A 3I9PA 3AY2A 2AJSH 3ARGA 1QQDA 1S46A 3RWDA 2A9DA 1B4JH 3BMVA 2PNDA 4MMXB 2NXYB 4LVHB 2NY7L 3FDWA 1HL8A 3MUGB 4F3FA 3LRGA 4MRCA 1OGTB 2WLZA 3CPLA 3EDKA 3L2LA 4JS7A 4J3SA 1N6QH 3LRSB 4PLJD 3SE3C 5KVFL 3VB8A 1MRDH 3BP7A 1MCBA 1HI6B 1YEDB 2OTUB 1NINA 3SQBB 2YD0A 3OAUL 5HGBA 4NO2B 1SVCP 1XIWA 1MFDH 1SMOA 4KMLB 1ETZB 3BFOA 1P5VA 1WBXB 2Y24A 1OP5K 1E2ZA 2J5WA 1MZYA 4UUJB 1UKTA 4FG4A 5K9QG 1XF4A 2V37A 3WY4A 5L4JA 3JV4B 2GTQA 3DOIA 4G7RB 5F21B 2P46B 4P5TD 3EJTA 2Y1ZA 4OGYH 1UXMA 5IHBA 4LU5H 2XN2A 1TZOA 5EIIG 4HJ1A 1U3HB 5I19H 2XY1A 5GRUL 1UWGL 3BP4B 2DWTA 5CWSA 4X4YA 4U1KA 5DRNA 4F7CB 4FADA 1BG9A 4KC3B 5IESL 5KVDL 2I9LB 3C6LB 3L95A 1OD9A 4KKBC 4NGHL 5I74B 3IGAA 4LPUA 2AQ1A 5AD0A 4Q14A 5CHNB 1QFUL 4DO5A 4BYHA 1S7QA 5HDQH 4NO3A 2ZF9A 3B7SA 4K55A 5BZWA 1QFPA 2FT8A 1MCOH 1RVFH 3C5SA 5FKPB 3VXQA 3GZKA 4AYSA 1SYSB 3QGVA 4R26L 1WBYB 1GGTA 1W0VB 3CZKA 1J48A 3BUIA 2K70A 3JWOH 4QCIA 1NJ9B 2QVTA 4XVSH 2Y72A 1JD9A 2OCJA 4P5MB 4MYPA 4Y4FC 4WHTB 5BS0E 1DZ0A 4X6EA 2Q5BA 5BS0B 4BJLA 4JGNA 4UNIA 2MTAA 3WI9A 4OCXH 1N64L 5D8JL 1N70A 3JTTB 1I8LA 4HIIA 4G9DB 3FZUD 5JYMA 5BZDB 4O5LL 4R4BB 3QULB 3G5YB 4WHCA 4FMFA 4TSAL 2YA2A 5FO9A 5C0BE 1Z5LB 1VPOH 5DJAB 2ZXEB 2WZPA 2HFFB 2DV6A 3ROLB 5D7KD 3AXLB 2BLFA 1BECA 4HALA 2UWEB 4HT1H 3MNZA 5JXAH 3BSHA 1CFVL 3D05A 1JZ5A 2ZXGA 3C9NB 3MKKA 3OC5A 1M4KA 4XBPA 3KR3H 5BO1L 5T5FA 3VYPA 4TV3A 2PYEE 3ABLB 3D51A 4JM2C 4QRRB 2GFBA 3T4AA 1UXSA 43CAA 1E4KC 1I1FA 4DNLA 4G6JH 5EBGA 1BFOA 2K6ZA 4UM9B 5KSUA 4HFUH 5ERWA 3IU3B 4MCZB 1K2DA 3FRUA 1S7RB 3QH3A 4OCSH 3SPGA 4EDWH 1B4RA 5JNYB 4IU3B 3BWUF 4JPIA 5DT1L 5TE6L 1YC8A 3WIFA 2GTWA 2A6JB 2OULB 3MLWH 2R2EB 3O9WC 2VLKB 2K6WA 2BINA 2NYYD 2QSQA 1LP9F 1T6WA 3D0AA 3GMMB 4GW5A 4NYLA 1T4WA 3DJRA 2J2ZA 1LQBC 3CG8A 4DETA 1BX2B 3HHRB 3U0WL 3QYNA 1BQ5A 4MA8L 5LBSH 1UM4L 4JFDB 4X4ZA 4NC1C 4G6KL 4ZMQA 2VZOA 1YNLL 3KGUA 5JOFB 4KNQA 3WNOA 3RVTD 3T0BA 3MUGA 3D08A 3MGOA 1HS6A 2E0PA 1AHWA 4AEIL 4UU9B 2D7TH 1VEPA 5F6IC 3GI8L 2Z8WC 5D2NB 2ITDA 3MLZH 1S7TA 2X3BA 4WFHD 1ZDQA 2QGCA 5FYKL 4UT6A 3MCYA 2Y3AA 2AXWA 3PAYA 3IFPA 3ZMEA 1JGVH 3KLQA 1BJMA 1OL0A 1RFDH 2C3XA 3KPSB 4MKTA 1LE5B 3DO7A 3HAEA 2JV6A 5K9JL 3KNBB 4GMTH 2RR3A 3OMNB 4XMXA 4YGVB 4UV7H 4J6RH 1BYOA 5IW1B 2V7NA 4XB7A 3L95B 4P2QA 5C0RH 1MCHA 1F3JB 3JYBA 4QRPB 5DMGC 1S3KH 3QHFL 5HVFB 1MAJA 4OF3A 3TJEH 5F0LB 5FAAA 2WXKA 4LOVA 4L0YA 4WUKL 2AVGA 3ECBB 2VDOH 1A8ZA 1JXGA 2LTQB 3CJJA 3T1FB 1AZCA 4PRIE 1T04B 3CDGA 4TUKL 3AXIA 1ZV9A 4GG8A 5T3ZL 2NY0D 2P5WB 4X0KA 4Z7QF 2GEQA 4Y1SA 4AC4A 3QRGH 3RVUC 5IVXE 4QCIB 3QK0A 3UH8A 4JQVC 4FD0A 2H6PB 2BIIA 4HPHA 3BX7C 2NR6D 3OAYH 3RVTC 4MXQD 4W68A 1HEHC 1ADQA 1HT6A 3KPNB 4I4WB 2CBQA 2DWSA 2P24B 4CAGA 3ZLQC 1NCCL 5LJYH 4XCFH 4RA0C 5E1AA 3EH4B 1WD8A 1G4RA 3HE6D 3O41B 1Y1DA 2HJKA 2Q20A 4XNBA 4YSUA 3LKOB 1YCSA 5FO9B 1SHXA 4MRBA 2F08A 2OMUA 3ZPDA 1RULH 4G7SB 2J6WA 3FTWA 1ZT4B 4PRDB 5AZEL 1F58H 4AC2A 4MZRA 2E86A 2MQ3A 1Q9WB 5FKAA 5C0CE 3GKWH 5I73B 1JZ3A 2QL1A 2XLLA 3BKCH 4IS6B 3BE1L 4MJJA 5EU5A 1LO2H 2X4SB 3AQDA 4FG6D 2VL4A 5DUML 1AE6L 5T3ZH 3EZ8A 5HYJA 4B5EA 1QNIA 5K9KA 4EDXB 3HKFA 4NQEB 1A1NB 4WSKA 5DD3L 1UFUA 5SWSB 2YAPA 3SD5A 4K9JA 2APXA 4L8BA 4ODSL 4TQ8A 4H8QA 3IMTA 4S1RL 4DESA 3IXAA 4FYQA 3U7WL 4UNUA 2WWKT 2EO9A 2XXGA 3B2PA 4H4NA 4NC2B 4GXUN 2I07B 1NUFA 4NO3B 1RI8A 4Y9BA 2IGFL 2VLJB 2FHCA 2IDTA 3QEHA 3NCFB 3V79C 3KR3L 3SDDC 4U4BA 4Y7MA 2J8UB 1CLVA 3ARDC 4KZEL 4I77L 4G11A 3VFNB 5AWNL 3RQ3A 5F2FA 4O02L 1T3FA 3BUDA 2VXUH 2WKOF 1QPKA 5BW7A 1BJ1H 1FLTX 1F5WA 3RIFK 3VAEA 5FV2A 3LQMA 4PLKC 1ACXA 4RDBA 4OV6F 1EHAA 1I8KA 3ARVA 3EYVA 1AQMA 4JRWA 2E4FA 4GMSH 5DFTA 3GM0A 5F96L 1S8DA 4C58B 3QDGB 5FW7A 2WQVA 4Q6YA 2F5AH 5D7EA 5BNXD 5M95B 3F7VB 2HFFA 4I0PD 3MRJB 1UCBL 3G08B 1O9ZA 1XO8A 2NY5L 5H35B 4K94H 3E8UH 4OJFH 1JPGA 3FU7B 2UWEA 2YK1L 4PH8A 4IOIB 1AZUA 3N40F 5IG7A 5GGRB 1T7YA 5I23A 4YHYC 3QZBA 4Z76B 4ONHB 1FZOB 1LVEA 5AOJA 1R3HB 3QNYB 3O6LL 3NESA 2OSWA 4D0DA 1FHGA 4KJPC 1XB3A 3CMOH 1AZRA 4MAZA 1UXSB 1BLIA 1QO3A 3Q01A 4BHUI 3MACH 3QIBA 1KELH 1H6FA 5I5JA 4A2FA 3DX9A 5HHXL 3IJ7A 3HE7A 3VGAB 4NENB 2X7LA 2XY2A 4JO5A 3TL5A 1KWKA 3ZHKA 4Y19B 2DQTH 3HLKA 3VXNA 3X3FL 5IROD 2CO4A 2UZIH 5F88A 3LS5H 5JIDA 2B2XH 4PP1C 5ALBL 2R9HC 1UACL 3GXUB 4QXVA 4WY7L 3WCYA 1MCWW 4JFVA 4G8FB 4DN3L 5HHOB 5AW8B 2Z64C 4DK5A 2WTRB 4PJBA 1TQTA 5E8PA 4PUBL 3L6FA 4QRQB 1A4KB 1LO4L 4L9LC 3V5DA 4DAGH 1FZJA 2C9UA 4POYA 1NEPA 3FF7A 4HHGA 3ZRCC 1E9PA 3FT0A 4QTIH 2G5RA 3ZE0E 1LYQA 3CZSA 4M1CC 5H2BB 3GSNL 1U58B 1P7QB 5FGCE 3KPRE 4UQ2A 4UINL 4MX7B 3ZQ9A 1OQOA 4RFOH 4RMVA 4IQHA 5ICZB 2O5XL 1S7TB 2A3TA 3CHQA 3MLSL 1K72A 3PLYA 3PWUA 1GGYA 3SPCA 2X4PA 3IAPA 5FFOA 4N22A 4NAJA 4X5LA 1FG2B 2FHFA 3QZPA 3IPFA 4NUGH 4X7EC 1HJCA 1T89C 3OAWA 3IGFA 2F54D 3I2CH 3B2UD 1Z9MA 2DWDB 5E2VH 4N0YL 1ZHLB 5SWSD 4A7VA 3WIHH 1PZ5A 1U8QA 4YSCA 4NCC2 5ALBH 3KZ8A 2WSPA 4XR8C 3L4YA 4CGTA 1J9CT 3FONA 1IMHC 1NCUA 4AM0B 3MJGX 3OB0H 1MAKA 5MP6H 1IQWH 3OR7B 2FATH 4X50A 1OXYA 5L8JB 5EU4A 4FQCL 1S9WA 4DGIH 4GKZA 1X7QA 4X6CF 1Z5LA 1RIUL 4JY5L 5EO1A 3DX4A 25C8L 3NMEA 2ATAA 4R8WL 3EJCA 2OXGB 5CP7A 4UTBL 3CN3A 4EVNA 1ORSB 1KPUA 1OTSC 1LXMA 3EZJB 1G9MC 2AQSA 3ZDYF 3LRLA 5HD8C 3TEYA 4GG8B 4KTEL 2X6CA 2FLRT 1A4AA 4HAFA 5E4EC 5DRWA 2CMRH 4NBXB 3ZUNC 2G75A 3TJHD 3TYGH 4HV8A 4AVJA 3UTPD 4MXWH 1LEKA 1F2QA 5MENB 2J8UA 4NUGL 4HS3A 4AW4A 3F7LA 4I0PA 5G5DA 1FIGL 4NUMA 3SKJL 4I48B 4CMMA 3SY0A 1T3FB 1PJ9A 2C3GA 2ITFA 1D5RA 1MIMH 4RCAA 5LBVA 5I1AA 2XZQH 1TQBB 2WXQA 1RIVH 3LN9A 2Z1PA 4K7PL 3WFDL 2GUYA 1INEH 1U8CA 2I69A 3WHE0 2NDGA 4KK9D 1YPZE 2A6JA 1GPOL 1LO5B 4B97A 1SEBB 4LLWA 2ZXBA 4PRBA 4BK4A 1BYPA 4AQ8A 1M7UA 3L9EA 3Q43A 5K9OA 3TBYB 2O61B 4KY1H 2L7EA 1DN0A 1KB9J 2YXWA 3QP3A 3DBSA 5D2LB 5DK3A 3UBGA 1C9SA 3D07A 4HXAH 2ZCHL 1CLOH 2ZAGA 3LKPA 1RZJH 3MO1B 1XX9C 4NJ9H 1MCOL 5IVXA 4F92B 3PL6A 4RIRB 4W9EC 2VW6A 2NXYD 4NQEA 4UOJA 4LVEA 4PIBA 1JZ7A 1C5CH 4HGWB 4GQRA 4D0CA 4RISH 2BNQE 1AKJA 2ZWLT 4E9SA 1NCBL 4Y2OA 5L4FA 3DRQA 1JGEA 1KWGA 3B7TA 5DT1H 4ZDHA 1U30A 1U8PB 4Y1AB 1QR4A 4LK4A 3WS6C 4EJ1C 1FFQA 3Q5OA 5TDPA 3EG9A 2AXGB 5KWYC 3K2UL 5MEPB 2ZUYA 2OR9H 1W9XA 4OUOA 4WFHE 3RFRA 3KPSA 4LL9A 4WI6A 3U9PL 1LE5A 2PR9A 1MJJB 1SM3L 5FYLL 1JDDA 3JT0A 1WZ1L 2F6AA 3KPLB 1LNUA 5IQ7L 3QIWB 5DURD 1DSFH 2JJTC 5EUOB 5HHQA 1H15B 2QKSA 2RHEA 3RUGE 4WFED 3IF1B 3TFBA 3DX8A 2C9XA 4HW6A 2H7WA 2BP0A 5I6KA 4PBXA 2QGBA 1T80A 3F12A 4PIRF 3MRPB 3PL6C 2W9EL 5I0WA 3QHZH 2FD6L 1R5VA 1K8IB 5F89B 4XP4H 2APBA 1JGLH 4WCYH 1W72L 4Z7VA 2VN7A 1MLCA 1FYTD 1AP2A 1JV5A 1MRFH 4P05A 2I85A 3HMWL 2BDNH 4S1DC 3WFBH 5IHHA 5CD3B 3MBED 2IPUK 5KSAD 2FX9H 4BELD 1FL6A 3F7YA 1RU9H 2UZXA 3U1SH 4Q0XH 3H3PL 1RK0B 3MNVB 5D93C 1KFGA 1I9JL 2YJLA 4H13C 5DZPA 4XMPL 5TGBA 4RMTA 2DB8A 2AHIA 1OAJA 1H8NA 5DUPH 5A2CA 1M56B 1RMFL 2VLKE 4PI2A 1HNFA 2DYSB 5E99H 1VSCA 4Z0BH 5JMRA 4B0MM 4E9LA 3VD9A 1FGNH 4AY0A 1HC1A 4TVSa 1IU1A 1NWOA 2YUZA 2A99A 4G8GD 4HK0B 5EZJB 3KVQA 4XNYL 4F27A 1NIAA 1JNLL 3TWCH 1FV1A 4HU8A 1AY1L 5DK0A 2IADA 4FFZL 2ZX6A 1QEXA 4Z7NB 4GKSA 2Q10A 3MBXL 4PLJC 1AR1B 3IVKB 2ZCKL 1BIHA 5GXBB 5K9KB 4OI9A 3CHXA 4DP9X 9CGTA 3OR6B 5H2BA 3FOLB 5DC9B 4ZFOL 1A3ZA 3WLWD 1D5ZA 4PV8A 5DA0B 3SKNB 1IIKA 2FIRT 3MGTA 2ID5A 1ONQA 2CR6A 2ODHA 3WY3A 3P4NA 3FB8A 4UQBA 3V0WL 3VXMB 3A22A 3SE8H 1LO5A 4PJFA 2WN3A 1OEZW 2J1ZA 3KPQA 3GSNB 5L2KD 4Z3JA 2R0LL 3N5AA 3KGTA 4KQ3L 4E9WA 4JFFA 3QJUB 2EYRB 3WJMA 4J2XA 5ANME 1BXAA 4NNPH 4BINA 1G4MA 2B3IA 2VR7A 2A6DB 3C60B 4JX0A 4HDIB 4LHQB 3N06B 1JBJA 1E50A 4AYEC 4M02A 2DDQL 4ODUA 5HSFA 4F8TA 1UENA 1I1AD 1WZLA 2DQMA 1HILA 4PB9H 1GKEA 1SMDA 3TEWA 1HXMA 4FQPA 1DFBL 4KHXH 2WB1A 1YMMA 4MAYC 3VD2A 4XZUB 4JY4A 1GC1C 2DPKA 1AJ7H 4OCMC 4RMUA 2DIJA 3MX0B 1PTZA 1U6AH 4I88A 4WWPA 2P5WE 1AHMA 2CCWA 2JKJA 1K8DA 5JHLH 1V7ML 1TJIH 5AOMA 3DURA 5TDPB 2EE2A 2OXHA 4LL1A 4PGEB 1T1YB 1XF3B 5KW9H 4WU5A 1A3QA 5MENE 3Q05A 1I53A 3RWEA 3HRZC 3K2IA 1UA6L 1K4DA 4EAEA 4X8XA 3VWJC 4NO5B 3P77A 3FUFA 4KJWC 3B5HA 3ULUH 1FZMA 1N5AB 5CM1A 1FFRA 2YKKA 3AG4B 3QUZC 3TBSA 4AJWA 3CUPB 3C5JB 3ZXAC 2PWGA 4GIOA 1H15A 4L4VB 1WTGT 4Z7WE 2P1YA 4NSKA 3BVDB 1EAJA 4OIAA 4P4KD 5EORL 1N64H 1BM7A 5K9QI 2L3BA 2MNUA 5J1AA 5E2UH 3O6KH 2E9IA 4XN7A 1DE4A 1WCBA 5I0DA 5DQDH 5LUMA 2XX1A 2R1YA 3V0IA 1J9SA 2YK1H 2VMEA 5CLZA 2VLRD 2VZ1A 3QORA 3MROA 2BZDA 3DRTB 3KDMB 3EFOA 1JGUL 1COBA 5TF1H 1KNOA 4HUKB 2CK2A 2FHBA 2AZAA 2OS7A 2VERN 4FQ1L 1ACYH 3OJDA 5DC2A 3UZEC 3WTTA 3NFPA 3CFKB 1DQLL 2FECI 5SX5H 2X0VA 5LBSA 4J8RB 5TGBB 1EGJA 3O2WH 1KJVB 2K4WA 4A55A 4I18C 4HHWA 4L4TA 5CZRA 5AENA 1OAYH 1M05B 2CO2A 2CO6B 3K1KC 5IR1A 4J3XA 1I3RA 4BA0A 1YN7B 2CLVB 3VTMA 4KNUA 1FFNA 4XOBA 4XP4L 3OAYK 4DEWA 4YWGL 3BVXA 1CFQB 1UADC 2Y22A 3NQKA 1C12B 4HIJB 4MAYB 3HMWH 4KXZI 5EOCJ 1JL8A 5FYJE 3CSBA 5LQBH 4WWID 4Z7UF 4LVNC 3L4CA 1AACA 3TVMC 4ZS7H 4B7IA 1V27A 2FWLB 3BVUA 5CJXA 2R69L 2YPVL 2ZWKA 3Q2CA 2J72A 5DVNA 4G6KH 5DVKA 3MQIA 3M86A 2MKLC 3HFFA 4PV8B 4YSDA 4F5CA 5EUOA 4QYAA 1NC2D 3NCJH 1AOHA 5CHNA 3QXWA 4NN5B 4KPHH 5A2BA 1O7DE 3I9GL 2AXJA 2GW5A 1ZA6A 4NKMA 5D72H 5IJVA 2BW4A 4HZLA 3FB7A 4XCNB 3SDAC 2VDNH 5FYLD 1VFMA 4EKJA 3FTXA 4XB3A 5IHLB 1P1VA 5LDSA 3KWXA 1OALA 4J7RA 2Y6TE 4YDVB 1PJWA 4XMLH 1L0YA 3SO3C 1VGEH 5LG1A 5J11B 2Z93A 3KYOA 1XSOA 1RUAH 3S36H 3VG9B 5JIHA 1X9RA 3QJHB 3BVVA 1XAKA 5HYQB 43C9B 4FTVD 3AMLA 5JMOC 1KJ2H 3EXJA 1VFBA 3VI3E 3H42H 3CN2A 5MP6L 1H6TA 3OKLB 5E8DH 4ZSOB 3QDGE 3ZT5A 5L0QB 4LGSB 2LABA 5CMAA 1HH9A 4X5RA 1VZIA 1WLHA 2YRLA 4UZUA 1CU4L 4LLWB 3QXVA 4PJEF 1GCFA 4C55A 2DJUA 4R83A 4L3EE 2VZUA 4MTMA 5D4HA 2I7SA 4DTGL 3CFBB 5EZJA 3BPLB 1KY7A 4QWWD 1ZT1B 3RNQB 5BOZG 2KZ1B 3PG2A 3MNZB 3RA7L 4CADA 3LPPA 1PEWA 2OLDA 3DVGA 2V17L 4HSAC 1JDCA 4ZT1A 3OX8B 4HUXA 4R4ND 3C09B 1D9KD 1S7SA 3MXWH 2W0FA 3ZE1F 1VACB 1HYSC 4G1EA 3EYFA 2C9RA 2NZ1A 5L2KB 5FUCC 3QEGL 3TBCA 1S5HA 2ZG1A 3LZOA 1F4YH 4NDMB 4YK4C 1AKJB 4M7ZC 4G7VH 4BFIA 3QDJE 3P4NB 3MRMB 3FFOA 4OIFA 1ED3B 4B9KC 3S5LA 1UZ6E 3FQNA 3HR5A 4DN4L 1DL7L 3GXPA 3RZCD 4ENZA 3L5JA 5ABZA 1JPTH 1RUQH 5I0XA 3A67L 2WP3T 2GJZB 1OHQA 4GI9A 4JHWL 1W8NA 3GKZA 4NN5C 4R8WH 3UBXI 4JHVA 5FUZL 3GZQA 5DQJB 1MJJA 1XZWA 2EEBA 1PY9A 1TCRA 1BQHA 3X14B 1DSWA 1J0KA 1W6WA 4C56E 3QXTA 2ZE0A 4ZO7A 1JPSL 4X7FC 4UU9A 3M88A 3NFPB 4XNXH 3PJNA 2C1OA 1HINH 2OL3B 2FSEA 4J8RA 2OCCB 2MPVA 1OSPH 2XVLA 4YLQT 3PAUA 3SKJH 5DMIL 3SBPA 4JY4B 3HUJB 5EG6C 5GZND 1KV3A 4KKLD 1MRCL 4HS6B 2IG2H 3SE3A 5IF0A 1LHZA 2JI3A 4AOFA 5I1DA 4HF5L 5KUMA 3QQ9D 3SE6A 5FR3A 4TYUA 3FQWA 4WTXA 4RFEA 5SWZE 4ZNCD 1NMCC 2ENYA 1UOLA 1XF5A 2GSGA 2L04A 2OW7A 4N2LA 35C8L 3P0VL 4L3ED 3WYRA 3QPQC 2UXGA 4HFUL 4A1RA 1HYRC 3RIKA 1X9UA 2UZIL 3BDYH 3AS2A 2QLYA 1V54B 4AMXA 4PS8A 1T2QH 3TOPA 3CN4A 4QF1B 5GS0D 4X9IA 3C8KA 3VTTA 4G1MA 4C59B 4HFWA 4PUBH 3PNWA 2FSDA 3DGDA 5CSBA 1FVCA 1JRHI 3KPMB 4I9XA 2GUOA 4YSTA 5CNHA 5EO0B 3BKJH 3Q8EA 1LM8V 4PJDF 4ZUUA 4ZO6A 4ZOCA 4MXVF 3P9LA 2J20A 4LLMA 2IADB 5DJDA 1KGYE 3GSUB 4MLSA 4CN4A 5HVHB 3I74A 5IKCB 4AQ1B 4NKDB 3BAEL 3CFCL 4R4FL 5GHWH 5T5NF 2HXAA 4AEIH 5CJ5A 1JZIA 1BZEA 4XB8A 3IVKA 4M5YH 1XT5A 4P49A 1C7SA 2ICEB 4YJZL 3OR6A 2MMXA 4X5WB 5I6PA 5HYQA 3ZDXF 4LDOB 1MG2C 4N1EA 2GSIA 4KFZC 4LO9A 4D9RD 35C8H 1N8ZA 5MEQB 3T0EB 5CN1A 5HI4D 2MHAB 5IVZA 3FH5A 1OP3H 5DI8A 5J8OA 3M17A 3PWPA 3TT3H 2DTSA 3V8CA 4JKKA 4BZ2H 2VDNL 4OKVA 5HI5D 3KPQB 3ZT7A 2GJPA 1J8HA 1RZFL 1RJLA 1FFNB 3WFEH 1LD9A 1Q9OB 2QADD 3FUDA 3LEVL 3MUHL 5IMKB 3LIZH 2YQ2A 1GOHA 2HFGH 2EXYD 2FATL 4QAMB 4G8GA 3MOQA 3NP3A 4HUWA 4M6NL 5LGYA 3C60A 1P4BH 3O3AA 1DFXA 2JCCB 1QTYT 4HIHB 4HUNB 1NFDB 3IDYB 1VFOA 3ET9F 1TVBA 4OZIE 1S7XA 2CWRA 5FO7B 5GHWL 9PCYA 1WICA 4HKXA 1TZ8A 4YL4A 3WEMA 3BJLA 4UAHA 1D5MA 4NZRH 2AV1A 5MHSD 1QSZA 4LKCB 3BPNB 5MHSE 4U6TA 4Z7WA 5E6IA 3T71A 2CHWA 4G8IA 1JNJA 4W93A 1AXTL 3FQNB 4MS6A 2EAEA 2WO2B 4HZLB 1K8DB 3UPCA 1W8EA 1YEGL 2OYMA 4QLWA 1VZGA 1RUPH 2ZICA 3VM7A 3CFDA 2B1AH 4NQUA 3LD8B 4NFBA 4KXCA 4OLVL 3KEHA 3FUIA 3RWEB 1UJ3C 1H5BC 3WFEL 4AKPA 3AG3B 2Z93B 3SCMA 1FUNA 1HHJA 2VXVL 2XKUA 1M7DA 5E5LA 4POZC 1MCQA 2XYCA 3CHSA 5CP3H 1G5GA 2B0SL 5FCSH 1EGJH 2EE6A 4XVTH 3UAFA 2HRPL 2H8PB 2BFGA 3BW9B 1MH5B 4BM7A 5CCGE 4MS8C 2VDQH 3OZ9H 4UTAL 3CLWA 4M9PA 4YDMA 3KLHD 5IJKC 1DUZA 5E9AA 5F0MB 3FSVA 5AW5B 1IGIL 3HBZA 4NO0D 4DGIL 3SZKC 3OM3B 1XH3B 1JCVA 1YEHL 1JN6B 1MHHA 4NZTL 1E4XL 2G5BA 4PRPB 3ZKMC 4U1MA 1EANA 1KCVL 2APWA 1ETB1 1MDAA 2YSSA 2BSBA 4JHBA 4WNQA 4LAJH 1D3CA 1QSEB 1AFVL 2Y7SA 2YN3A 2O5YL 3RVXD 3X13B 3DHMA 4YFEA 3KM2A 3BH9B 2VIRB 4ZS6C 4YDKH 2DYPD 3S34H 1URZA 5E7FA 4NXKA 5T3XE 2IWEA 1Q0XL 2A9ML 1JFQL 2VR8A 4HGMA 3TN0C 3X3GL 4XVTL 1SXAA 1IGYA 5DD6A 3INUH 4CKVX 1CGVA 3B3BA 3GRWH 1TKWB 5FYLH 3VI3F 5BRZE 2G2RB 3FO9A 1A9BB 2VLRB 1EJ6A 2UUDK 3WKYA 2HZHA 3D2TA 4LQFL 3TN0D 4U49A 1IM3B 4HX1B 5KYUA 2JTYA 1PLAA 1P9MA 4PW3A 3G9VA 1N19A 4KITB 3FUKA 3ARFA 1DJWA 4H88H 3RU8H 2IFFL 2W95A 4XMKL 3UABA 5CEXA 1L4IA 4GG6B 3QB7C 2OL3A 1GS6X 4NAMA 2K1MA 4KHTL 1HZHH 4N87A 1MCWM 4H8WH 2O5YH 2Q86B 4PP2A 3UJJH 3LKSB 5IB2B 3ME0A 5KSVB 2WP3O 2Y1VA 3MOAH 1AC0A 4BKLB 2OMXB 4JHAL 2G30A 1FG2A 2WXIA 1WZAA 4D7PA 3MZGB 1CK0H 5HJ3B 4BFEA 5BW7C 3KMDA 3VDCA 2K8QA 4EN3D 2QADB 5LG6A 5J89A 5EEXA 4A66A 1RZKL 5CXPA 2FL5A 5HHXH 1LP9E 1W0WB 4WRLA 1CD1B 3TA3D 1ID5I 2OYPA 5I2IA 4Z7UB 5TDNA 2PUQT 3P2TA 3B34A 3QO1A 2HWZH 3SE9H 1JNLH 3BZEA 1IT9L 3U7YL 2AJVH 4AX3A 1PCXA 3SQOH 4A39A 3WFCH 1FFTB 3C5ZB 3OAZH 4Y4HD 3D2UB 4X80H 2HTKD 2H6OA 5GGSA 1NC2B 4H8PA 1N0XL 1L9MA 1I4FA 2IH3B 3I9AA 4Y16C 5B22A 4MJIE 5DRWB 3H9ZA 4QD2E 1HAUA 4ALAH 1NCIA 5C0GA 1JJUA 3NDZE 4WLCA 5BQDA 1KGUA 1EH9A 3IDJA 4WWKB 3WFHB 6FABH 2GT9B 2Z91A 4UM8B 3LH2H 4JRYA 2W0FB 1WTLA 2NY6B 1KCLA 4RBPK 4HWUA 4ZXBD 5ACZB 1TUPA 2YQBA 4C4KO 2GSIB 1E27B 1GOGA 2FYYB 2JVUA 4M3KB 1F1AA 5GRJH 5T1MB 2YPLD 3NPSC 5EU6E 3IKCB 2FR4B 3VWJD 4TNGA 1LK3H 3STZB 3S3PA 3IM1A 1UD3A 3GBML 2ATPB 4Q74A 2R8SH 4ELMB 4TSCL 3ZKNC 2MQGA 4JM2B 5D7SL 5DJYA 3MRKA 4JO2H 4PRBB 1F11A 2C9VA 1TTCA 2OMYB 5IMKA 2G3MA 3WL9B 4LZKA 4NWTH 2B5IB 3NZ8A 2H0FA 4EZJA 5BOJA 3DGGA 4TSAH 5E8EB 1DVQA 1I8MA 4OB5H 2XWRA 5KBKA 1L9TA 3GJFK 2HKAA 3BHBA 1AXSB 2F68X 5I17A 1RK1B 2XWCA 4FFZH 4J3VA 4EQ2A 4I8DA 3WHE1 1HXKA 4FABH 2CGRH 5AOKA 3BH9A 4IIQC 4G9DA 5DJXA 1F42A 2XTSA 1E6JL 3CU7A 1FYTB 4L1SA 4QR7A 4CUCA 5GS0H 2A74B 1IC5H 1O6VA 3GSOA 3MRFB 3A6BL 2UX7A 4R2GC 2V3DA 5C0JB 3G5WA 4G8IB 2OTWA 1MVFA 1F45A 2WXOA 3C08H 1KJ2B 1KACB 3FTZA 3MJ9H 4GP5B 5GGTH 4WF7A 3VD7A 4A6YB 5HGHB 1KCKA 1PG7L 5I1DB 2EVJA 1K4CA 1QQDB 3NA9L 3BAIA 2AJYH 2Y36L 4N5UA 5E00B 5DCCA 3FFCD 4XPFL 1N0LB 4FHBD 5C9JB 3BCFA 5D7LA 4GT0A 4K5MA 3FC8A 1Q90A 3R06B 1NCGA 2XRAL 3VRJA 4K7PH 2JKWA 3U4KA 4ERSH 1KN2L 3CX5K 1QBAA 4NWUH 2GY5A 4XVUC 2J44A 2OZ4A 4Y1AD 1N9PA 3QQDB 1OV8A 3HRZA 5E95B 2Z35A 4P2OB 5CLWA 1TZAA 2Y7NA 1J9TA 3LHPL 4K23L 2K8MA 3IGLA 5E9DA 4LAQL 4RQQB 3DIFB 1WS8A 4MJ2A 4F37K 4WI3A 1G9ML 1QSED 4FC3E 1T1WB 4GW5B 1BMGA 3ATFA 1QBML 2BJMH 4FFZA 3QEUA 4HF5H 3HUJF 3HC4L 4CVZB 2PR4H 4DVRL 4L1DA 3EUDA 4PRPD 3ZE2B 3P1VA 5IW6B 2YWYA 3LTVA 4L1LA 4O2EB 2FQEA 2DH3A 3QS3A 4P3CH 1CD1A 3DX2A 3NCXA 3CPUA 4PJIF 1PDKB 3QQ3B 5I1IL 4QRPD 4PCSA 4OZFG 1YC7A 4NZUL 5IWLC 1BZ9B 2VC2H 1CE6A 4N8CH 3GBNL 5I73C 1KCBA 3OB8A 4HJIA 2YUWA 1SY6A 1AHWC 2ARJA 2OFQA 3B2MA 4P5KB 4Y7OC 2EDLA 3FH7A 3IDXL 1JI1A 2P5ED 1S7VA 1T0OA 4H8HA 5FC9A 3QUMH 1H6EA 2ZSVB 3VNZA 1SYSA 4CSPA 3LXBA 2EDQA 3MYJB 3MRLB 3TU6A 2H2SC 3CXHK 5SWZD 4LL4A 4BH8A 4Z7WF 3UJIH 3IJHB 4XH2A 4PFEA 3ZQWA 5TQ0L 3EBGA 1SXBA 1EEUA 2HVKB 3B6SB 5T3ZE 3TH2T 2QLVB 4TOYL 3BI9X 2FO1A 2Q8AH 1HCZA 2QELA 5B38A 1UH4A 2F53B 4IJTA 1NICA 1BQUA 1BQLL 4NHUB 2IPKA 4QRPA 3D34A 5DJAA 3R18A 3VWKD 4BSVA 1LK2A 2CRYA 3DHUA 4BZ2L 3PUUA 4PJFB 1CF8L 2DQUH 1JPFB 2PPFA 4WEBL 1XL6A 1XTMA 2H5UA 3K7UA 3UYPB 1JVOA 3ULUC 2P8MB 1IILE 5EBWB 4BSWA 2B4CL 1YYMH 3UTTB 3ZQXA 3LKRB 2W07B 2CJUH 2R0WH 5E56A 4Y0GA 3QE5A 4XTRC 5GZOA 3H3PH 1I9IL 4B5ZA 4MB1A 4HG4J 3UJTL 3TM6A 1CU4H 3DVNB 1X9QA 1RK1A 1A0QH 2Y1AA 4NM4H 4XO8A 3W9EA 4OFDA 3JVGC 4H25A 1HILB 1NMCB 4PHXA 4YS4A 4LKXA 4AL8H 4XTRD 1DTUA 2CLZB 3PU7A 5CGMA 4I85A 4RMRA 4PJ7B 3RWHA 4U1HA 1XBRA 3EJZD 1A7BA 3I85A 1NMAL 5KS9B 4LBEB 1DLHB 4J28A 1MOEA 1IM9D 3UZVB 1HIML 1T5XB 4K7FA 5GGSB 3C12A 3ZTJG 4FL4C 2VN6A 2B59A 3R7QA 3WDJA 2WNXA 5CZVH 3NVQA 1TTUA 3BSGA 5EU5B 3WFHA 5JOFA 3AU1B 3BQUD 4YBHA 1XGQA 3P3RA 4N9OB 4YFDB 3QUXD 3VNYA 3VO0A 5CBEB 3BUQA 3D3VE 3N42B 1G6RH 3L7FA 2GPZA 3IPEA 4FABL 4JO1H 1WK0A 4X7SH 3WIHL 2Z4TA 3TIDA 2XCMC 5DJZA 1AO7A 4N8VG 3DNKA 4JANA 4YLCA 4E36A 1P7QD 5H37G 1SN5A 5IB4B 1V10A 2XWZA 4GKNB 2E4TA 4KZEH 1XCQB 1CXHA 3PWPD 3DC0A 3IFPB 3O11A 2ZWZA 4ZFGL 4RQQA 1WCBB 4NNPL 2V3EA 2WYTA 2KDGA 3NCBB 2R1YB 1MUJB 4MVBD 4DCQA 3ARXA 2JJTA 1YPZF 3EJSA 4HCIA 4W9CC 1KOAA 3CC5A 3GIVB 3IDNA 1GVIA 4FZEH 4K7PX 3GK8L 5I19L 4WEEA 4P4RA 4NWUL 3GPEA 4L1HA 1MCDA 2FEDC 4JJHA 3QG6B 1EHXA 2CZNA 5C7XH 3X11B 3VFOA 4R5VA 5KVDH 1Y18A 5FO8B 1DDHB 1JUFB 1IEAA 2I5YH 1NANI 3D4YA 3HPJB 3NIGB 3UAJA 3VJ6B 2F15A 5D7JD 4H7VA 4PP2B 2AJUL 5K93A 1U8KA 1SY6L 1PF3A 4NFCA 5JHBA 4X8GA 4OM0H 4ZX5A 4M62H 2D0HA 4HPOL 4NN6B 2C26A 2WNGA 3QDMB 1PY0A 3HC4H 3FQRB 3TF7C 1U8OB 1Y0LB 3GWJA 3ULVC 3GRGA 4HMEA 1PZ2A 1EZLA 1NBZA 1N18A 3CDZB 1XV8A 4ZZFA 4X9FA 1WJ3A 1GJWA 3CQQA 1ROCA 1K6QL 1AIZA 4Y9FA 1F3DH 2F53A 1E5CA 3VXPA 1AKPA 4NRXB 4UQDA 1KT2B 3CSYA 4L9LB 2D7PA 2Z31A 1PQZA 3NFNA 1MFEH 3TC9A 2NQDA 4NX0A 2QQKH 1OGSA 3LN4A 3SBWC 2BVQB 4YDKL 2GJJA 3UEQA 1RPQA 4WFFD 2ICES 4U3SA 3GSRA 4KI5F 5FOBA 1R5IA 3RI5F 3IJEA 5EF1A 3CSFA 3UAJC 4QHUA 3NJLA 5IB5A 5E6IC 1QA9A 1N5YH 4GI6A 1JXKA 1XXFC 2DM2A 3IK2A 4J3UA 1WAEA 2K9UA 4TF4A 1Z5YD 4Y2DB 1IFRA 2WGXA 3GLDA 1RPKA 5C0ND 5TK4A 1G1CA 5E4EB 5HHVH 4HEPA 4L29B 2Z4QB 4QRFA 5B8CB 1W6LA 1CE6B 2X42A 4G9FE 1ZTXE 1YY9C 1HH9B 3FPYA 4LPYA 5L6YL 1KGIA 5FK9A 2X10A 3TCLA 4JFPA 2YBGA 4TL5A 1E90A 5H94A 4X5XB 4O02A 3UPAA 3GXFA 3OKDB 4TTDD 4X80L 1XZ0B 5INCA 1ERNA 2YN5A 5AG8A 1IM3D 2FRGP 4XWOD 3GB7A 1CG9A 5GRWA 5D1ZB 2VDML 2XFGB 1A5FH 5ESAB 3QFDB 1ZLVH 4JKNA 4DVBA 3G6JA 2FD6H 4NFDA 1IGMH 1PEZA 5C0AE 3BOVA 3FONB 1MHCA 4RMQA 4KFMA 1TEFA 5LLIC 3BWUC 4JFED 5ABAA 3UXFA 2ED8A 4UOZA 5GGVY 3BN9C 1EHKB 5EU4B 4NHUA 5GRJL 2EDXA 1NMAH 5E6UB 4JFYA 1VGKA 1IFHL 3EO0A 4IK6A 3S35H 2HX8A 3DYMA 1PLCA 3TVMA 5FA3B 1UKQA 3QYCA 3V0VA 4UIKL 1EK3A 1K4CB 4PWIA 3U48A 3AWGA 5F3FA 4KH9A 2GJZA 5L8KB 3K71B 2HUHA 3LKRA 2UWEE 4BFJA 2NT0A 4Z76A 2BSCA 1ECZA 2WSKA 1RZ8A 2YMOA 4LT7A 1U8MB 2AQPA 3KJ4C 4PS4L 4ELKB 2X6VA 1XH2A 4NNXA 3HVDA 4M1DH 3UTOA 5DVPA 1SBBA 1FLRH 1HL9A 1NKOA 1IRAY 1R3KA 3DOSA 1Z9OA 2PXYD 4PJEE 4UV7L 2ZG2A 1MJ8H 3S8FB 3U9WA 1RH8A 1BEYL 2CGRL 4KK5C 4OAWA 2VLMD 4HIXL 5C0BA 3MRRB 3UYOD 3EJQA 5F9OL 1FL5B 3F6IA 2FJGA 4QGYA 2CRIA 1I7TA 1ZV5A 5KVGL 2CMRL 2X4TB 5EC2A 4OTXH 2R7EB 4H0IA 2H0PA 5ANMB 2X53A 1YYLH 4XP5H 3CN0A 4G9FD 5B1AB 1MF2H 1AXTH 4L0ZA 1FDLH 3V5KA 3FQXA 1T7VA 5I1JL 1XGUB 1F4WL 3RDTB 4BZ1H 3AU1A 2Z31D 2GC7C 2NW2A 3NJXA 5I8OL 1C7TA 5MEOB 1YEEL 1DO5A 5T1DL 4UTCA 4G7VL 3GI9L 5HY9A 4NBZB 3QCTL 4NT6B 2ZX9A 5GRUH 1MFAL 1OCZB 3EF7A 5HHMB 4GUQA 4AQ8C 2C7FA 2V6HA 2QPDB 4ZX6A 1FG9C 2WAHA 3OKMB 1MY7A 2P5EE 4LCUA 3UO1L 3OSKA 4MJIB 4XNZC 3ZKMD 3FNKA 1UXWB 3G04A 3IU4H 3UMTA 5E4IA 2VMJA 4DCQB 1T66D 5DZ9A 2VAAA 2HKFL 2Y25A 4MQ7B 5FHAL 3WJLA 4OTXL 3NEOA 4JRFA 1INQA 4F5CE 4ZS6D 2HVBA 3ZO0A 2ZPKH 3RFZC 4U1KB 2YD6A 3NYKA 4NPKA 1SMAA 4LASL 4P3CL 4NP4H 4WIQA 4MA7H 1DVFD 4XXWC 2QSTA 1IEAB 4HKZB 3K5SA 5H4YA 2DIBA 1X5XA 1DBBH 3MA9H 4P06A 4WI2A 5DVLA 4OD1L 2Z0BA 3WJJA 4PRIB 5INDB 1DQTA 4P3DA 2QQQA 1J8HB 3PQYD 1RJLB 5DO2C 2EKSA 1L0XA 5DUBB 4MMYB 5D93B 1PX4A 5CCHE 4NCDA 1MHPH 3FCSB 1F6LL 1WITA 2CHNA 2EDMA 3E3QC 3U4EA 3N6YA 1T20B 3ZW3A 3ESMA 3ABMB 1NFKA 1RZPA 4HT1L 5E0FA 3VGGA 4S2SA 4DW2L 4X6EB 1NTDA 5J9PB 1JOIA 1OT1A 4ACPA 1UUNA 3W9EB 3ASOB 2K9FB 3B3IA 1S7XB 2YOAA 4KUZH 1FORH 2R4SH 2VH5H 3FTSA 4WEUD 4F80A 1FI8C 4ZNEE 1GOFA