4YSXA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with the specific inhibitor nn23
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 225
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ysxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ysxA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ysxA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ysxA04
4O5QA 1DOEA 4USRA 3VQRA 2GR3A 3K7QX 2APGA 2JKCA 4JN9A 2C67A 3RP7A 3BI2A 2OLOA 4JY2A 1XANA 1N4VA 3ICSA 2GMHA 4WCTA 4TM0A 2R9ZA 3NHOX 3P4SA 4CCQA 3K30A 4USQA 5L46A 4BK3A 4FX9A 1KSUA 1DJQA 4NTDA 1IUUA 2Q0KA 2XVEA 5M0ZA 4H4SA 2GQWA 2VVMA 4GRTA 3IF9A 2V3BA 5M10A 3UOZA 1IUWA 3IHGA 3SQPA 4YTMA 2WOIA 4MJWA 2GR0A 2CDUA 2GAHB 2BXSA 3L8KA 3UKFA 4GR1A 2FBWA 3GD3A 4BJYA 2YLRA 4GUVA 3AE1A 4Y4MA 2EQ7A 3ALLA 4Y4NA 2WOVA 1ZX9A 1S2QA 5FS8A 2C72A 4GF7A 4EMWA 4DSGA 1K0IA 3K7MX 1DODA 4NZHA 1RYIA 5U1OA 3BI5A 1HYUA 1GESA 1E6EA 4RG3A 5KOXA 2V60A 1D7LA 3GQKA 1O94A 4FK1A 1B8SA 1BGNA 3NK2X 4RG4A 1EBDA 1Z6LA 5IQ1A 5FS6A 1E1KA 1IUSA 3UTFA 3CPHG 3RNMA 4AP3A 1FOHA 3AE9A 3GYJA 4C77A 1ZP0A 3QFAA 2YVJA 4B69A 1NHPA 4EQRA 1FEBA 4K8DA 5EOWA 3FIMB 3BNMA 1B4VA 2B7SA 3FG2P 4U8PA 4U8LA 4U2SA 2XYOA 4C74A 4J2WA 4D04A 4Z24A 4A6NB 4H2QA 1CC6A 2VQBA 2BCGG 4ICYA 3UTHA 4B68A 2W0HA 4J31A 3JSKA 1D4CA 1GRGA 2ZBWA 3V3OA 2XLPA 3CNPA 5C2TA 1P2HA 1IUTA 1XDIA 4ECHA 5KVHA 1O5WA 2V5ZA 4JNQA 4LU6A 2ACZA 4B65A 2C65A 4AP1A 4AT2A 3ALMA 5KVIA 4Z2UA 3G5SA 1L9CA 4FK1C 3URHA 1E1LA 1H81A 3BHFA 4J57A 1BWCA 3DK8A 1M6IA 1TYTA 5KOWA 3AEFA 3C4NA 3Q6JA 1PN0A 1CHUA 1K4QA 4EMJA 3GSIA 3DK9A 1GRBA 3AE4A 3DH9A 2WQYA 1L9EA 4YKGA 3AE3A 1MXTA 4A9WA 2XVJA 4Z25A 1Y56A 1CJ4A 1XPQA 3NK0X 4Y4LA 2NPXA 1X31B 3DJGX 2BK3A 4YT0A 1PDHA 1PJ5A 2WP6A 3RP8A 1MO9A 1BZLA 4UDPA 1GNDA 3GQHA 1E1NA 2BS3A 2WOWA 4AOSA 3LZXA 2R4JA 4K5RA 1VG9A 1F8SA 2GEWA 3ZYXA 3AD8B 3GWFA 1KNRA 1TDFA 4C3XA 4DNAA 1JEHA 2PHHA 2QA2A 2ARDA 2YG5A 3PS9A 5HXIA 1NENA 3AB1A 1PBFA 4OVIA 2JB1A 2X8GA 5JCIA 1GTEA 1DNCA 2BC0A 3DGZA 3DA1A 4D03A 3EAOA 5J60A 3KKJA 2WP9A 4CRTA 2Q6UA 4XXGA 4ZCDA 2E5VA 1PBCA 1EL8A 1B37A 1GPEA 1YKJA 3AD7B 2OALA 3ATQA 5HY5A 1ZMDA 3FPZA 4YTPA 3UKLA 1GREA 3AEAA 2GH5A 2JB2A 3COXA 3M13A 3QSSA 4KPRA 3NYCA 3ITJA 2TMDA 2GMJA 3CN8A 1EL5A 3CGEA 3EF6A 2B9XA 4TM1A 1VRQB 4A65A 2QAEA 2R46A 5EB4A 3NNEA 3OC4A 4U8OA 2YLSA 2BA9A 1NHQA 3UKKA 2CFYA 2AR8A 3ICTA 2WDQA 3NT6A 3I6DA 4CCRA 1ZOYA 3NYEA 4NTCA 2XLTA 4YTNA 1QLBA 1Y0PA 2YWLA 3Q9TA 4CY6A 2C66A 2V6OA 4EQSA 3CGDA 3AECA 1JOAA 1PBBA 2YM2A 4GDEA 1E39A 2UZZA 3AXBA 1NHRA 2XFNA 1RP0A 3F8PA 3QSEA 2JB3A 3F8RA 2IVEA 2TPRA 3AE2A 5HYMA 1YQ3A 2A87A 2XFQA 1Q1RA 5C3JA 3I3LA 4IV9A 2H89A 3P4RA 4AT0A 1ZK7A 4A5LA 4KX6A 1NAAA 1F3PA 4H4XA 2WP5A 2FJDA 4B67A 2WU5A 1RSGA 3GRTA 1EL9A 3NH3X 4DSHA 5CQFA 5BRTA 4X9NA 4CY8A 3QFBA 2BABA 3ABVA 2XFUA 2X8CA 2Y6QA 2YR4A 3F8DA 3GDNA 4YWOA 4EIPA 4EM3A 2NVKX 2IVDA 2VRMA 2WDRA 2DKHA 4C3YA 2FJEA 2GV8A 1GEUA 2XDOA 1DOCA 2VOUA 3NYFA 1GV4A 1FL2A 1QJDA 4ZCCA 3SFEA 4BJZA 5LV9A 1LQTA 1FCDA 1JRXA 2XFPA 2GVCA 2GB0A 4HB9A 4REKA 4YKFA 4LIIA 3NN6X 2R0GA 3AEGA 3CNSA 3NRNA 3UP5A 1D4DA 5KXJA 1ONFA 3UKQA 4H7UA 2WPEA 3SUCA 2EQ8A 3KPFA 2V3AA 3LOVA 3SGLA 4ZN0A 1GRFA 1OJCA 2RGHA 5EB5A 4EM4A 2VRLA 3DJEA 3NKSA 5BUKA 3M12A 3VR8A 4H4PA 4C5OA 1GT8A 2WEUA 4U8MA 4EQWA 4IVMB 3NLCA 4P9SA 5DBJA 4YSZA 2BS4A 4J56A 3QVPA 4UDRA 2VVLG 1CJCA 4EQXA 1TRBA 1VG0A 4NEWA 1CBOA 2WS3A 1D7YA 2BACA 2VQ7A 2YR5A 2C64A 4OPDA 3AD9B 4U8IA 4B66A 1LVLA 2YLTA 1VQWA 1M64A 1B5QA 1SEZA 2JBVA 4O5UA 5HHFA 4CNKA 1DJNA 2B7RA 5IQ4A 4YSHA 3ALJA 1PS9A 1AOGA 4Z44A 1BKWA 5JCMA 3GD4A 2BXRA 1P2EA 3AWIA 3UP4A 3VRAA 3FMWA 1VDCA 1ZDLA 4OPTA 1E1MA 1KFYA 3ADAB 2AAQA 2RGOA 3CPIG 2YVGA 3REDA 3VR9A 1N4WA 2YR6A 3NK1X 4E0VA 4YXDA 1GETA 3EANA 2JAEA 2XVIA 1ZOVA 3NTDA 2YG3A 4H4YA 4YSXA 1NDAA 4B1BA 2OLNA 3V76A 3AE8A 1DXLA 3M0OA 4XWRA 2IIDA 2WESA 2C76A 5TR3A 1IJHA 2B9WA 1H7WA 2BK4A 3CGBA 5U63A 3C96A 4Z2TA 2QA1A 2FJBA 4H4UA 1Q1WA 1PXCA 4IA5A 3AYLA 1CF3A 4UP3A 2Q7VA 2JK6A 2YAUA 3G5QA 4OPUA 3VRDB 3P1WA 1ZKQA 1FECA 1K0LA 2WBAA 3QVRA 2WHDA 1LTXR 1GRTA 1JRZA 1NPXA 1YQ4A 1F8WA 1NHSA 2ZZCA 2Z5YA 3GRSA 4JDRA 4K22A 3UKAA 1F8RA 1GOSA 2E1MA 3LJPA 4BV6A 5GRTA 1JNZA 2YM1A 2CVJA 4U8KA 3LZWA 3DK4A 3AYJA 1H83A 1PJ6A 2PYXA 3KVEA 4B63A 3BI4A 2YVFA 2BK5A 2C7GA 3GWDA 3P9UA 5EBKA 3KLJA 3CNJA 1BGJA 1S3EA 2WETA 4U8NA 3CGCA 2YG4A 3IHMA 4H4QA 2X3NA 5FS7A 4NEVA 3BNUA 2WU2A 1OJTA 1OJDA 3PO7A 3H8LA 4UDQA 1COYA 4I58A 4IA6A 5ER0A 2X8HA 4B64A 2BYBA 3E1TA 5JCLA 2BC1A 2Z5XA 4GDPA 2H88A 3UOYA 2YG7A 2B76A 1GTHA 2HQMA 2GR2A 2XFOA 3H8IA 3T37A 1PXAA 3S5WA 4OPGA 1K0JA 2EQ9A 4Z2RA 1MOKA 3FBSA 4APNA 2C70A 4JNAA 1N4UA 3WE0A 4A79A 5IPYA 4TM4A 1EL7A 1S3BA 2XVHA 3GDPA 4FDCB 3LXDA 3IC9A 1KNPA 2C3CA 3CPJG 2GRTA 4U2TA 3D1CA 2O9ZA 4GCMA 1NG4A 4BK2A 1E7PA 3B6DA 4TM3A 5FS9A 3V3NA 5BULA 4OCGA 1PXBA 5BVAA 5U25A 1TDNA 1D4EA 1OJ9A 2R45A 2Q0LA 3UTEA 1JU2A 2OAMA 4OPLA 4U8JA 1IUXA 3SM8A 4K5SA 1H82A 1KF6A 1BF3A 3DMEA 4H4ZA 4X9MA 2XLRA 2OA1A 1S2YA 4H4TA 3NTAA 1N1PA 2ZZ0A 1Y56B 1GERA 3UOXA 2R0CA 1QO8A 3II4A 3DJDA 3D8XA 1L0VA 2YLWA 5KWFA 1H7XA 3KD9A 1TDKA 3UCLA 3L1RA 1CJ2A 4X4JA 3K7TA 1F6MA 3ISHA 4TLXA 4A99A 3BHKA 1L9DA 2R4EA 5JCNA 2C75A 3UKPA 4WX1A 1GRHA 3G5RA 2GF3A 2A8XA 1IUVA 3S61A 3AE7A 3B3RA 5JCKA 4K7ZA 2GAGB 4A7AA 2RABA 1CC2A 3RHAA 1GALA 1V59A 4H50A 3QJ4A 4OPIA 3AE6A 2XVFA 3IWAA 2AQJA 5J7XA 2J3NA 1H6VA 4H2PA 2C3DA 1TYPA 4U2LA 1H86A 3P4QA 2BS2A 4H2NA 3VRBA 1LJ1A 4N9XA 4CNJA 4PAAA 4YSYA 4H2RA 4LA1A 1JNRA 1LQUA 1KSSA 2GQFA 3QSMA 4J36A 1LPFA 2XLSA 2RGJA 4OPCA 3R9UA 1H84A 2C73A 3GMCA 1Q9IA 3NN0X 3DJJA 2ZZBA 5FMHA 4AOXA 5KRQA 2YLZA 3EPTA 2VZ2A 5CKUA 3GYXA 3AE5A 1D5TA 3AEDA 3ZDNA 1DOBA 1ZMCA 2A89A 1FEAA 2V61A 4EIQA 3GMBA 4HA6A 1GSNA 4IVOB 3P4PA 3KA7A 3LB8A 4M52A 2QCUA 2YLXA 4BK1A 4NTEA 1KDGA 3CIRA 3KU9A 4H4VA 2BCPA 2XCGA 2WDVA 3RP6A 3AEEA 1CC4A 4J34A 4EMIA 2LFCA 3SFDA 3LADA 2WPFA 2CULA 4RSLA 3H4KA 1PBDA 3AYIA 1TDOA 4Z43A 3NIXA 4A6NA 2YQUA 1OJAA 4I59A 2VVLA 4BURA 1W4XA 3O0HA 3PVCA 2EQ6A 2X99A 3AEBA 3UOVA 1TDEA 3UTGA 4Z26A 1O95A 4XWZA 1CL0A 1PHHA 1PBEA 3GYIA 4TLZA 3C4AA 4JY3A 3UKHA 1LV0A 3ICRA 3ATRA 2YG6A 3NG7X 2FJAA 1YQZA 1UKVG 2B9YA 2DKIA 2WPCA 2GR1A 3OZ2A 3CTYA 3HZLA 4ADWA 2I0ZA 3CNDA 4H4WA 2R0PA 1REOA 1YY5A 1GXFA 1PJ7A 4J33A 1GRAA 2X50A 2Y6RA 4JQ9A 2F5ZA 4PABA 1CJ3A 1NG3A 1ELIA 1JRYA 3DGHA 3NGCX 4CBQA 1XHCA 1ZY8A 2E4GA 4H4RA 5GSNA 2XLUA 3CNTA 4DGKA 1NEKA 4K2XA
chains in the Genus database with same CATH superfamily
2LT3A 1DOEA 5FP3A 4PJLA 4X1IE 4XBFB 4L9IA 3K3QC 2C67A 2OLOA 1N4VA 4U33A 2DWKA 4WCTA 3BQIA 4UELA 3PU3A 4TM0A 2FUPA 3D0TA 2D2SA 3PUQA 4CCQA 3O4XE 4RHV4 4UVAB 4EAHA 4HWFA 1WRDA 1IUUA 4NWZA 1ASJ4 4IE0A 1RHI4 4H4SA 2GQWA 3IF9A 1WR0A 2V3BA 3IHGA 4YTMA 2WCAA 3L8KA 3J7Yq 3UKFA 3LSVA 2FBWA 3GD3A 3UULA 3ALLA 2BVMA 4HE8A 3UU6A 2L8KA 5FS8A 4QKNA 4DR1T 1RUD4 1K0IA 3K7MX 1DODA 4PDWD 2VKOA 5KOXA 4GKKT 1B8SA 1BGNA 4RG4A 3TLSA 3UTFA 2A3DA 2DL1A 4AP3A 1ZP0A 3QFAA 4TNVA 3RHWA 4B69A 1RUJ4 4OYKA 1FEBA 1SA0E 2B7SA 5HWYA 4U2SA 4C74A 2W0GA 4J2WA 4Z24A 4A6NB 4H2QA 4H9NC 2VQBA 2DLRA 4IDPA 2BCGG 3H37A 4IT4A 1P2HA 3SZCA 5KVHA 2XQ3A 2ACZA 3NRXA 4AP1A 4AT2A 3VKHA 3ALMA 3TKLB 3L39A 3CWZB 4P09A 2K24A 1E1LA 3BHFA 4UIGA 1PN0A 5KNLA 1HG2A 3I9YA 3CPZA 4EMJA 3PUZF 3AE4A 4JEUB 2B1EA 5CA1E 4YKGA 2W62A 4NXMT 2XQ9A 2JIWA 2HPLA 1XMOT 4KUMB 2NPXA 1X31B 2BK3A 4JUYA 1MO9A 4UDPA 1GNDA 2VKDA 2WOWA 1AR94 4AOSA 1F8SA 3GWFA 3MXZA 1X9BA 4C3XA 3JC6D 4FI5A 4UR9A 3PS9A 5HXIA 2JRKA 1H8TD 2X51A 3ZJ1A 4OVIA 1LVKA 5JR9C 4F8HA 1VBB4 3N5LA 3T31A 3DGZA 5HWXA 4ERRA 3C4ZA 3L09A 5J60A 3KKJA 5GONE 2WP9A 2IC9A 1PBCA 1EL8A 2NTXA 2OALA 5HY5A 3R6NA 1D0ZA 4YTPA 2JB2A 2GH5A 1YW0A 4DV2T 3EF6A 1HRV4 4TM1A 3RIUA 5IUXA 2R46A 2PYLA 3NNEA 4U8OA 4KP3C 2LSKA 2CFYA 3T1YT 2X66A 3FXDB 3NYEA 4HWHA 1QLBA 1EAH4 2YWLA 5LOVE 4E7SA 3DTOA 2UZZA 2XFNA 4YLHA 4HFCA 5EK4A 3KV5A 4ZI7E 1MMDA 2IVEA 1FMVA 3V5SA 3UU8A 2E9XD 2ZM2A 1Q1RA 1XHZA 2V7LA 1BR4A 4IV9A 2BG9C 1HCIA 3P4RA 1NAAA 1F3PA 2WU5A 5L4EA 2WZHA 1EL9A 3NH3X 3U78A 5BRTA 1VBA4 3PUGA 3ABVA 2YR4A 2X8CA 3F8DA 2NVKX 2FJEA 3C50A 5FY1A 3NYFA 3SZWA 1GV4A 1FL2A 2F4VT 5LMUT 4BJZA 2UXDT 4HB9A 4YKFA 3QB5K 3NRNA 2YDQA 5KXJA 2WPEA 3SUCA 5KMSA 2EHOD 4ZN0A 3FXEB 4KMCA 2VRLA 3DJEA 3NKSA 4TV9E 3VR8A 1GT8A 2WEUA 4U8MA 3F57A 4MALA 4G6HA 2J1DG 2E9XA 3QVPA 2H7OA 1TRBA 1CBOA 5KMPA 1D7YA 2YR5A 1X79A 1YKHB 3AA6B 4L5GA 2YLTA 4MFRA 1M64A 1B5QA 2JBVA 1HF8A 4EZ4A 2B7RA 4EYUA 5HEUA 2VL0A 1HX1B 2ACXA 5LB7B 3I0OA 4Z44A 1BKWA 1N33T 1LKXA 2W00A 2RGOA 3ZCIA 2LSJA 4LMJA 5FYMA 3NK1X 3ZMVB 2MOZA 4G63A 2EHOA 5HXHA 2XVIA 5ABFA 3NZQA 3B5MA 4HGAA 2XM1A 2IIDA 2UUAT 2I0MA 5TR3A 1IJHA 4IGUA 3HL6A 5JVDE 1Q1WA 1PVC4 3AYLA 4UP3A 4Q4Y4 4OPUA 3VRDB 2CCQA 2LE8A 3P1WA 4LF7T 2WBAA 1AJ3A 1GRTA 1JRZA 3UT5E 5LJNA 1OXZA 1YKEB 1F8RA 2IIUA 3LJPA 5GRTA 3QUJA 2YM1A 2XAHB 1UK5A 2CVJA 4U8KA 4DR6T 3AYJA 4QWNB 5FMNA 3KVEA 4CQIA 2BK5A 1UX4A 3GWDA 4Q4X4 2WETA 4U8NA 3RGLA 1N32T 2CEAA 2YG4A 1D1CA 3J8F4 1IBKT 2X0HA 4H4QA 1YXRA 2V6YB 2XQ7A 4NEVA 2WU2A 4I50E 3SS1A 4I58A 2X8HA 3E1TA 5LHIB 2Z5XA 4GDPA 3UOYA 2YG7A 2HQMA 3TLUA 5IPYA 3S5WA 4WBNE 1K0JA 3EHZA 3C4WA 5JDLA 3WE0A 3C4XA 4IL4A 2HHHT 3CPJG 4U2TA 3IHRA 4BK2A 5BULA 4EGWA 5U25A 1TDNA 1D4EA 1FJGT 2R044 4HFIA 2G0UA 5DQWA 4DVDA 1IUXA 3HKEE 2QA7A 5LXTE 1Y56B 1GERA 3D8XA 1L0VA 2YLWA 5KWFA 1H7XA 2WY2A 4H9OC 5F8PA 5JDGA 3L1RA 3P50A 2LHRA 3BHKA 2Q9QB 2X9YA 5JCNA 4AKRB 1IZNB 3G5RA 4MBQA 1ZEEA 4K7ZA 2GAGB 2ZM6T 1GALA 4IIJE 2LSIA 5ABFB 5AQIB 3IWAA 4GYRA 2VL8A 2J3NA 1HR0T 1H6VA 2YU2A 5J7XA 2C3DA 4KHPT 4P0BA 2RS54 4TWDA 1LJ1A 3ZT6A 1VOMA 3RYCE 1Q9IA 3NN0X 3DJJA 4CXYA 4A5XA 2YLZA 3EPTA 1D4M4 3GYXA 5CKUA 2XQAA 3AE5A 1D5TA 3AEDA 1IBMT 5HXCA 1DOBA 1FEAA 4IVOB 3KA7A 3LB8A 4UF0B 5LGTB 5HXSA 3PE0A 1UCUA 4PK6A 1HX8A 5HEJA 1CUNA 2LJLA 3LADA 2OLTA 3V5UA 3H4KA 4Z43A 4PNIA 1WYCA 2ZM8A 2PTFA 4BURA 3N9LA 3O0HA 5HXRA 4M1PA 2R064 3AEBA 2RS14 4Z26A 4XWZA 5FXWA 1PHHA 1PBEA 3GYIA 4JY3A 3NG7X 1XNQT 4LMKA 1NA1D 3ZN0B 4ZEYA 2EX3A 1PJ7A 3T14A 2BRYA 3NGCX 4DR4T 3ZMZB 1ZY8A 2V7JA 4H4RA 4HKAA 4USRA 4LF6T 4EZHA 5KDMC 1VBD4 2APGA 1R084 5FL1A 3RP7A 3ZYKA 2WWUA 5FKYA 2C0SA 5CA0E 2GMHA 4CZZB 4II3A 2UUCT 3NKZA 3NHOX 2LEHA 3K30A 4USQA 2W4XA 5L46A 4FX9A 5AQPB 1DJQA 2XVEA 5FXVA 1HNXT 1IUWA 2J47A 1VRBA 3AVSA 1LRZA 1UUSA 1NAFA 2GR0A 2CDUA 2GAHB 4ZI3D 1MIYA 4O4IE 3AAIA 4BJYA 2YLRA 3RIUC 2EQ7A 4UV9B 4Y4MA 1W0BA 1ZX9A 1S2QA 4EMWA 4DNDA 3UU3A 5U1OA 3BI5A 5FXXA 3NVOA 4ILUA 1HYUA 4DV0T 2XAQB 1D7LA 3GQKA 1Z6LA 1E1KA 2W2UA 1IUSA 4KI0F 4JI7T 2CBIA 2E5LT 4AI6A 4BJMA 3FI7A 5EOWA 3RYHE 1B4VA 3BNMA 3FG2P 5LYJE 4A56A 2XYOA 2D0TA 4D04A 4ZHQE 5LG3A 3RKGA 2WBLA 1CC6A 3UTHA 4UVCB 4JV5T 1GRGA 4PJJA 1IUTA 4HFHA 1XDIA 1O5WA 2V5ZA 4ECHA 4LU6A 1XDOA 3L3PA 4B65A 2C65A 1OOPD 3SZ0A 4Z2UA 3ZEFB 4FK1C 3N9QA 1H81A 3PU8A 4J57A 3OPCA 3AEFA 5AQQB 3DH9A 3Q9DA 4H9QC 1MXTA 2BG9B 4EYYR 4A9WA 3IA3A 4Y4LA 5JRCA 1ZKEA 3DJGX 2PZSA 1PDHA 3UFEA 3RP8A 3HYVA 4TNWA 4EXTA 5HEHA 3GQHA 2BS3A 5IYZE 4O2AE 1H7CA 2R4JA 3FB2A 4G73A 3CK6A 4HFEA 4DBRA 1XHXA 1AL24 2RPAA 3PJAJ 2PHHA 2ARDA 3ZJ2A 3GN5A 4YJ2E 2X8GA 5JCIA 3F31A 2N9DA 1DNCA 1MNDA 3PUWF 2YN6A 1FMWA 2JMKA 5L3CB 2IUBA 3KFWX 4CRTA 2Q6UA 3LK3B 2C5KT 2E5VA 1YKJA 2KWHA 2LHNA 3PUSA 3AD7B 3EI0A 4YJ3E 3FZLB 1GREA 3QSSA 3COXA 4H9SE 2Q9QC 3M13A 3ITJA 3BK9A 4ISSA 4XZCA 1NWMX 3CN8A 3ETVA 4A65A 2QAEA 4K0UA 4JI3T 3OC4A 2AR8A 3N2OA 1WYBA 3NT6A 4AQFA 2XLTA 4HN9A 4DO0A 1HS7A 4GK0E 1Y0PA 3Q9TA 4CY6A 1PBBA 2KSRA 4U72A 2YM2A 3M65A 2XQ5A 3F8PA 3L8RA 3OVUA 3HKDE 2JB3A 4Z91A 5AFUL 4I43B 2E8IA 3X1DA 2XFQA 3KV4A 5C3JA 2H89A 4DR7T 3SWHA 2XSAA 4A5LA 4EV6A 1IBLT 2WZIA 4CN6A 2WP5A 4B67A 4JBWF 3MZKB 3NRYA 2CHOA 1FIOA 2XFUA 4DV4T 5A1LA 3M3ZB 2IVDA 1S94A 2MAWA 4C3YA 2GV8A 3IF8B 4U2YA 1DOCA 2CRBA 2PW9A 4WZXA 5JTGA 2V5CA 2XFPA 4REKA 4LIIA 4CXWA 3AEGA 2R0GA 3CNSA 2EQ8A 3SGLA 1OEDE 1OJCA 2A2FX 5BUKA 2XQ4A 3RKOA 4C5OA 4QHOA 4P9SA 3CQGB 2YU1A 2HWB4 4J56A 3IBPA 2XJ7A 3QNUA 3AA7B 1SEZA 1G8XA 1W09A 1U4QA 3ZMSB 1AOGA 3RYFE 5JCMA 3GD4A 1QSDA 2BXRA 5CFBA 4IE4A 5H6QB 2XSBA 2JQHA 4HWCA 3OTOT 4OPTA 4B3MT 1US7B 3CPIG 4OFZA 2K3WA 3CVRA 3MKDA 2YR6A 2CM0A 3MACA 4ZI2D 3FZKB 1XMQT 1GETA 3RIAA 5L3DB 5L3EB 4X1YE 3EANA 1ZOVA 3NTDA 3AE8A 3M0OA 4XWRA 2LOPA 4H63V 1DU2A 2WESA 4IREA 4H63H 4ADZA 1MIWA 2BK4A 5L3BB 3QK6A 4HWIB 4AQGA 2QA1A 3ZSTA 2FJBA 4H4UA 3KINB 4ILAA 2W67A 2Q7VA 1K0LA 2BKNA 2D5UA 4IL9A 1NPXA 3NBXX 1GOSA 2Y8DA 2R6GF 4B3TT 1OEDA 2DWGA 3DK4A 1RUI4 1PJ6A 3H3MA 4HWDA 3Q5XA 2CWYA 4JI5T 4L0RA 5ABEA 3CNJA 4O4JE 3CGCA 3O9XA 2R7FA 3BNUA 1OJTA 1OJDA 3PO7A 3EAMA 2NWBA 2RM24 2BYBA 2WSSV 4BAYB 1E1HB 2CBJA 4H9RC 2YINA 3T1HT 2B76A 2RR14 2XFOA 3T37A 1Z8UA 2XY8B 1PXAA 2EQ9A 4OPGA 1XNRT 1N4UA 1AR84 3HR0A 3B13A 4CI3B 4DR5T 3UTKA 4TM4A 1RUC4 1D1BA 2C3CA 2GRTA 4X1KE 3WAJA 4DV3T 1NG4A 5IWAT 1E7PA 3B6DA 4JI1T 2IDOB 4OCGA 3A7MA 1PXBA 1OJ9A 2X67A 4TV8E 5ABGA 3CMMA 3T0KA 4WW0A 1BF3A 2OA1A 1S2YA 2DCFA 2VWAA 3JADA 2ZZ0A 3DJDA 2DHRA 4JI2T 4DV7T 5FXZA 2YKSA 2ZM0A 4X4JA 4TLXA 2R4EA 2C75A 2C5IT 3UKPA 3A8YC 3PURA 3AE7A 3B3RA 4A7AA 3KBTA 1FEWA 2XASB 1CC2A 5JDFA 3HI2A 3QJ4A 2WWVA 3UU5A 3AE6A 3VKGA 3ZKRA 2ODVA 5L2LA 4AKHA 5C8YE 4J2CA 4H2PA 4U2LA 1H86A 3P4QA 4H2NA 3ANWA 2XQ6A 3UUNA 3SRZA 4YSYA 4U74A 4H2RA 4LA1A 1JNRA 4ILBA 2GQFA 3C64A 2PLV4 1Z0PA 2RGJA 1Z7S4 3AB3B 4EEBA 2XAJB 2C73A 3GMCA 5KRQA 3QC9A 4IHJE 4MHCA 2VZ2A 4U7IA 3GMBA 1GSNA 3ZC0A 2YLXA 4NTEA 3RP6A 3KU9A 2BCPA 2WDVA 3T2YA 1CC4A 3FHNA 2WPFA 4H9PC 2X0YA 4DV6T 1TDOA 2YDSA 5FL0A 4X62T 4I59A 4O8SA 5AQLB 2VVLA 2C5JA 3O1HA 4GK5E 3AA0B 3Q5DA 3NWIA 1J5WA 1POV0 3LDQB 5AQKB 4DMVA 3PVCA 2AXDS 3O1JA 2XPKA 2X99A 5ADXL 5JH7E 4P0AA 3UTGA 2KLQA 3MK7C 1J5ET 3C4AA 4YFSA 1LV0A 4G74A 1D0XA 4EEDA 2FJAA 3C51A 1YQZA 4TN7B 1UKVG 3U3IA 4X64T 3I9WA 4ADWA 2I6HA 3RPUA 1EZ3A 1HRI4 2DNXA 2YOEA 2X50A 2Y6RA 4JQ9A 4PABA 1ELIA 2HH7A 3Q5WA 1XHCA 1BEV4 2KZ7B 5GSNA 5LMNT 1NEKA 2LSYA 4K2XA 1J1JA 3K7QX 2Y48B 3RRWA 2JKCA 1AR74 4JN9A 3PUVF 5AQFB 5JQGE 1XANA 3ICSA 5LJMA 1UURA 2GK9A 1M7KA 2IMLA 5J1GA 4X66T 3P4SA 2Y6XA 5AQOB 4BK3A 4LF8T 4NTDA 2NR4A 1LVFA 5M0ZA 2R074 4B3RT 2VVMA 5M10A 3A5XA 5BR8T 4O4LE 2E9XB 3UQ7A 4MJWA 1ZV4X 4GOUA 5LA6E 2BXSA 3HKBE 4A98A 4GR1A 5LP6E 4GUVA 4CN1A 3ANWB 4Y4NA 4NIQA 2C72A 2A72A 4EB6E 4GF7A 2LRKA 4DSGA 4WNKA 4AQFC 1B7TA 3F2EA 4IDOA 2NTYA 1GESA 1E6EA 2QGSA 4HTEA 3P7IA 4DUYT 1O94A 1KNZA 1EBDA 5KMQA 5IQ1A 5FS6A 1MNEA 3CPHG 3MJXA 2HWC4 3RNMA 1FOHA 3GYJA 4C77A 2X0LB 1NHPA 5CJ5A 2EHOB 4U8PA 4GB34 2ODUA 4U8LA 3GWHA 1PO14 4DR3T 4B68A 2W0HA 4J31A 5HCMA 2ZBWA 2KT9A 3CNPA 4LMLA 5KVIA 3ZSSA 4CI2B 2L3LA 1M6IA 1TYTA 5KOWA 4Z8XA 3Q6JA 1CHUA 3KPKA 3GSIA 5M4YA 1GRBA 5JR9A 2WQYA 3AE3A 3PUAA 4Z25A 1CJ4A 2CXDA 3NK0X 2CE7A 2MBGA 1GQEA 5ABHA 1PJ5A 2X9HA 3WI3A 4K0KT 2WP6A 2Z6EA 2XHEB 2VKHA 1E1NA 3UUBA 3TLTA 3FZFB 2I59A 3ONJA 3LZXA 2LOSA 4K5RA 2VQFT 1KNRA 1T98A 1TDFA 3RX6A 3FZHB 1JEHA 2QA2A 3RQUA 3N2KE 2JB1A 2CHNA 3DA1A 4D03A 2XTLA 3ZT5A 2V1DB 3EAOA 2M67A 1GPEA 4LF5T 3ATQA 1XDPA 1ZMDA 3RIFA 2RA1A 4PK4A 3LJCA 3NYCA 2GMJA 4U31A 3Q5EA 3OJAA 2B9XA 2X9WA 1VRQB 5AQSB 4ASKA 2BA9A 1T8BA 3UKKA 4QXCB 2QYWA 2WDQA 2CXFA 3RYIE 2XAGB 3I6DA 4CCRA 3BQLA 4JI6T 5KX5E 4YTNA 2V6OA 4EQSA 3CGDA 3AAAB 1JOAA 4GDEA 3MA9A 5L3FB 1E39A 4UEMA 1NHRA 1RP0A 2JQ9A 2K9AA 2H3RA 1YD8G 3R84B 3AE2A 2NOXA 2A87A 3Q2MA 3I3LA 3UFGA 1WR6A 1OEDC 4EOZB 3PUXF 1Y64B 4H4XA 2FJDA 1D1AA 1RSGA 3GRTA 2BKPA 4DSHA 3SZFA 5CQFA 5AQNB 4X9NA 5AQMB 4CY8A 1PIV4 3QFBA 2BABA 2RS34 3GDNA 4YWOA 4EM3A 3JC6C 4QX8B 3E22E 2VRMA 1BR1A 4X20E 2DKHA 4PFOA 1UGOA 2XDOA 2VOUA 3CMLA 3N9MA 4ZCCA 1JRXA 3ZLIA 3GA8A 3NN6X 1D4DA 1ONFA 2PFVA 4H7UA 3J9X1 3UQ4A 4AIUA 5JREA 2V3AA 1GRFA 2RGHA 5EB5A 4EM4A 2K48A 4H4PA 4EQWA 4LF9T 4PW8A 2BS4A 1MQTD 2BZBA 2VVLG 3P8CD 2JPFA 5KMRA 1V9DA 2BACA 2C64A 3QOFA 4B66A 3AD9B 4PAGA 4U8IA 5LGNB 1LVLA 4ZXLA 1VQWA 5JDHA 4CNKA 2YK0A 5HEOA 3CX6B 5IQ4A 1UX5A 2WM9A 1EV14 1PS9A 4PJNA 1VCTA 3AWIA 4LFBT 3AVRA 4PFPA 4X5TA 2X68A 5HAXA 4EIWA 1E1MA 1KFYA 3REDA 3VR9A 2E9XC 3E0ZA 4IDQA 4E0VA 4YXDA 4AKGA 2JAEA 4P1NA 2NW8A 4DMWA 4YSXA 2WMNA 3ONLC 1NDAA 3RRCA 4B1BA 5AQUB 1DXLA 3LK2B 2C76A 2LRLA 3H3AA 4LF4T 2B9WA 2CMRA 3CGBA 2VASA 5AQGB 5LNKA 1CF3A 1SE7A 3G5QA 2JK6A 2YAUA 1IJ5A 1ZKQA 1FECA 5AQRB 3QVRA 2WHDA 5DBJA 4K22A 1YQ4A 2MPKA 2W66A 3ZPOA 1NHSA 2Z5YA 2PY5A 2KXPB 5J2UE 2RMU4 4IE6A 2EHOC 4E7ZA 4LFAT 3LZWA 3ETUA 3ZYMA 1OWAA 5AQJB 1M62A 3I1AA 2PYXA 3JAEA 2M6IA 3K3NA 2C7GA 3BI4A 1BGJA 4DIDB 2XAFB 3JCFA 5EK2A 3BQKA 2X3NA 2HPJA 4ZS2A 3SX6A 5ER0A 1COYA 4B64A 5JCLA 2BC1A 2H88A 4O2BE 2V7MA 4OX9T 1VRH4 4Z2RA 1MOKA 3FBSA 1SUMB 2HN1A 2XVHA 4FDCB 3LXDA 3IC9A 1KNPA 4ANJA 4GCMA 4A97A 4IE7A 5JDMA 1KK7A 2BKOA 4I0UA 3C98B 1JU2A 1IAPA 3CQCB 3G06A 3SM8A 4K5SA 1KF6A 3DMEA 2XLRA 5HCJA 1I6ZA 1RUE4 5DJQC 1N1PA 3PJAA 2R0CA 1QO8A 3II4A 1BR2A 5JRCB 3UUMA 1TDKA 3UCLA 3QB5A 2IAKA 1XWMA 4O4HE 4HFDA 1L9DA 4WX1A 4DV1T 2A8XA 3S61A 3K8PC 5JCKA 2C4CA 2RABA 3RHAA 3GN5B 1V59A 4OPIA 3N9PA 2XVFA 2AQJA 4GYSA 3ESLA 5J0ZA 3ZMTB 1TYPA 2UXCT 2BS2A 2JMHA 3VRBA 4TUYE 2ES0A 4N9XA 1HFAA 3T8OA 4PAAA 4J36A 1LPFA 3AA1B 3ZT7A 4OPCA 1H84A 3EABA 3KV9A 4NNJA 5FMHA 4AOXA 4B6XA 2X9XA 2UXXB 1HG5A 3JAFA 3O1IA 4KHZF 1ZMCA 2A89A 4WBOA 2V61A 4EIQA 4QXHB 4BK1A 1KDGA 4H4VA 2V7IA 1AR64 2YEVC 2XCGA 4EMIA 2LFCA 3SFDA 4PJMA 2CPTA 2V6XA 3DJBA 1D0YA 1KEYA 4PK5A 2JJ9A 1XZYA 2EQ6A 4QH4A 3OYXA 5EK3A 2JQQA 3UOVA 2LKGA 1TDEA 1O95A 1CL0A 2D0UA 3ATRA 2NP9A 2V5DA 4YY3T 2YG6A 2B9YA 2WPCA 2DKIA 4AXPA 3CX8B 3CTYA 5L47A 2H7VC 2PBIA 4DV5T 3CNDA 4Q4W4 2CA5A 2KWIB 4H4WA 4GAPA 2CLYC 1GRAA 5DABA 2F5ZA 3KVAA 3DGHA 1JRYA 1HNZT 2E4GA 4QX7B 3K1SA 4TX5A 4AISA 3SFEA 2VK9A 3CGEA 4O5QA 3VQRA 2GR3A 3ZC1A 3JD74 4NPPA 2OV9A 3BI2A 3OBVE 4JY2A 5FVKA 3VU7H 5JDQA 2R9ZA 4JEHB 1KSUA 4II2A 2IHR1 2Q0KA 4GIWA 4ZZCA 3HYWA 3SOLA 4GRTA 3UOZA 1COV4 3TLVA 3SQPA 2BBJA 2WOIA 3EDUA 5LG4A 4IDNA 1U5PA 3P4WA 4DBQA 2SPCA 3S4UA 2KINB 3AE1A 2N1GA 3EDVA 2W63A 2WOVA 2UU9T 2LM2A 3FZMB 4NZHA 1R094 1RYIA 4RG3A 2V60A 1NCQD 4FK1A 1VBE4 3NK2X 4IE5A 3TLWA 2HN2A 3AE9A 4V1Av 2V6YA 4ZZBA 2YVJA 4G9KA 1I94T 4EQRA 1T7SA 2Q9QD 4K8DA 3FIMB 5J2TE 1N36T 2VURA 2PJQA 3EVYA 4ICYA 3JSKA 1T72A 2OA5A 1D4CA 3KDSE 3V3OA 2XLPA 5C2TA 3LG7A 4JNQA 3T2ZA 5LBQB 3G5SA 1L9CA 3AAEB 3URHA 5HXEA 3N9OA 1BWCA 3DK8A 3C4NA 1K4QA 2J62A 2YDRA 1R8IA 3DK9A 2IC6A 2LLYA 1MMGA 1L9EA 3CQXC 1QUUA 1OEDB 2LSGA 4MLKA 2XVJA 4JYAT 3RI5A 1Y56A 4QH1A 5LBMA 1XPQA 1HXS4 5F5WA 4YT0A 4OHFA 1BZLA 4G2AA 3HYXA 4ZI3C 2XQYA 1K5MD 3RC8A 2Q9QA 5LHHB 5DQVA 1VG9A 2GEWA 3ZYXA 3AD8B 4DNAA 2YG5A 1NENA 3AB1A 3B57A 1PBFA 4BA9A 4B3ST 4Q25A 1GTEA 3RH3A 2BDEA 2BC0A 2V7KA 4C90A 4ZS3A 3PDYA 5TAOA 2VKJA 4XXGA 4ZCDA 2WMOA 3RF1A 1B37A 3LBXA 5FNVE 3KV6A 2VVNA 4HFBA 2MYSA 3FPZA 3UKLA 3AEAA 2V26A 4AKLA 4KPRA 4QXBB 2TMDA 1EL5A 4UF0A 5EB4A 2YLSA 1NHQA 3ICTA 5L4HA 4CXXA 1ZOYA 4U3CA 1RUF4 4NTCA 3SXIA 2CWOA 4GAVA 2MTQA 5EZYE 2C66A 3AECA 1O3XA 2E2AA 3PV0F 5F3JA 3AXBA 3QSEA 2X5ID 3F8RA 1RMU4 2TPRA 3CX7B 4I55E 5HYMA 1YQ3A 1RVF4 1WCRA 3KVBA 4AT0A 1ZK7A 5H6RB 4KX6A 2ZMAA 3OKQA 4UXNB 3ZMUB 2WAUA 1MMAA 2Y6QA 4EIPA 2RP4A 4COFA 2WDRA 3AXJA 4OYJA 5LCYA 1GEUA 4ILCA 1G73A 1QJDA 5LV9A 2VQET 1LQTA 1FCDA 2GVCA 2GB0A 3UP5A 1PO24 3FBZA 3UKQA 4NUUA 3KPFA 3LOVA 3OYZA 2UXNB 2BG9E 1VCSA 1W0AA 3M12A 2BRAA 3E08A 4IVMB 2NW9A 3NLCA 2DI4A 4CN4A 4YSZA 3I0QA 5FY7A 4UDRA 4BJNA 1CJCA 4EQXA 4NEWA 1VG0A 4G6GA 2WS3A 3GMIA 2VQ7A 4LFCT 1HTJF 4OPDA 5FY0A 4O5UA 2KMFA 5HHFA 3DP7A 1DJNA 3LBXB 4YSHA 3ALJA 1RUH4 2P9BA 3WAKA 1BR0A 1XI1A 1P2EA 3UP4A 5JDNA 4Q4V4 3VRAA 3FMWA 1VDCA 1ZDLA 3UU4A 2V8SV 3ADAB 2AAQA 3PUYF 1W9RA 2YVGA 1N4WA 2XQ8A 5CGMA 2AE9A 5AQVB 2VB6A 1WFDA 4NXNT 2YG3A 4H4YA 2PYJA 2OLNA 3V76A 4KBMB 5AQHB 4N78D 5LGUB 3SYIA 4Z2TA 1H7WA 5U63A 3C96A 4JI4T 3ONXA 3JBG4 2ZLYA 1PXCA 4IA5A 4YHJA 4GKJT 1WLXA 2N2NA 1LTXR 2ZZCA 4JDRA 1F8WA 2UUBT 3GRSA 2K5BB 3UKAA 5BMVE 2E1MA 4HFVA 5LHGB 4BV6A 1JNZA 4JLEA 3ZYLA 2WB5A 3FBLA 2BBHA 2BG9A 1H83A 4B63A 3VHLA 2YVFA 4DR2T 3P9UA 5EBKA 3KLJA 4U7YA 3AXJB 1S3EA 4YHHT 3IHMA 5FS7A 2A9UA 1HNWT 3H8LA 2XM2A 4UDQA 3ZN1B 4IA6A 5HEGA 1S35A 4FJOA 1GTHA 2GR2A 3H8IA 4APNA 3IEEA 2C70A 4JNAA 2D9DA 4A79A 1EL7A 1S3BA 3GDPA 1N34T 3D1CA 2KNDA 2O9ZA 4JI8T 4TM3A 3V3NA 5FS9A 4F6RC 3PTRB 3N9NA 3SY4A 5BVAA 3UTEA 2R45A 2Q0LA 2NW7A 2OAMA 4OPLA 4U8JA 4ZI2C 4XAXB 2QVAA 3LFMA 4TZ4C 1H82A 5JR9B 4X9MA 4H4ZA 4H4TA 3NTAA 2LM9A 3HA4A 1SHZC 3ZCJA 4CI1B 3UOXA 2CLYB 3T2KA 3KD9A 4QH5A 5HYAA 5IHYA 4UVBB 1CJ2A 2M6BA 4X65T 3K7TA 1F6MA 3ISHA 4A99A 3N2GE 4I4TE 1GRHA 2GF3A 1IUVA 2J4GA 5L3GB 1MMNA 2PG8A 4H50A 4AQYT 2QRXA 4ISTA 1MIVA 3K3OA 4CNJA 3LK42 1LQUA 1KSSA 2CXLA 3QSMA 4C91A 5FVLA 2XLSA 3R9UA 3HKCE 4IDZA 2ZZBA 3RQWA 2VVSA 3ZDNA 4HA6A 3KBUA 3P4PA 4M52A 2QCUA 1ZHCA 1Y01A 4WYVA 4Z90A 3CIRA 3AEEA 3UUXB 4J34A 2CULA 4RSLA 3CKDA 2BVLA 1PBDA 3AYIA 1E2AA 3NIXA 4A6NA 2YQUA 1OJAA 4OK0A 2UXBT 3RC3A 1W4XA 1IJ6A 2IW5B 2W61A 2LKHA 3NZPA 5CB4E 3UKHA 5KMGP 4TLZA 4AKIA 3ICRA 1VBC4 2XZEA 2L9QA 4TWHA 3W15B 4UV8B 2GR1A 3OZ2A 3HZLA 5ETWA 4DUZT 2JQKA 5AQTB 2I0ZA 4NUVA 2R0PA 4U2ZA 1REOA 1YY5A 1GXFA 4J33A 2XUEA 4ZOLE 4HEAA 1CJ3A 1NG3A 4CBQA 3EUHA 4JI0T 1RUG4 3RLFF 2XLUA 3CNTA 4DGKA 4TWFA 5E0OA
chains in the Genus database with same CATH topology
4O5QA 1DOEA 4USRA 3VQRA 2GR3A 3K7QX 2APGA 2JKCA 4JN9A 2C67A 3RP7A 3BI2A 2OLOA 4JY2A 1XANA 1N4VA 3ICSA 2GMHA 4II3A 4WCTA 4TM0A 2R9ZA 3NHOX 3P4SA 4CCQA 3K30A 4USQA 5L46A 4BK3A 4FX9A 1KSUA 1DJQA 4II2A 4NTDA 1IUUA 2Q0KA 4NWZA 2XVEA 5M0ZA 4H4SA 2GQWA 3HYWA 2VVMA 4GRTA 3IF9A 2V3BA 5M10A 3UOZA 1IUWA 3IHGA 3SQPA 4YTMA 2WOIA 4MJWA 2GR0A 2CDUA 2GAHB 2BXSA 3L8KA 3UKFA 4GR1A 2FBWA 3GD3A 4BJYA 2YLRA 4GUVA 3AE1A 4Y4MA 2EQ7A 3ALLA 4Y4NA 2WOVA 1ZX9A 1S2QA 5FS8A 2C72A 4GF7A 4EMWA 4DSGA 1K0IA 3K7MX 1DODA 4NZHA 1RYIA 5U1OA 3BI5A 1HYUA 1GESA 1E6EA 4RG3A 5KOXA 2V60A 1D7LA 3GQKA 1O94A 4FK1A 1B8SA 1BGNA 3NK2X 4RG4A 1EBDA 1Z6LA 5IQ1A 5FS6A 1E1KA 5KMQA 1IUSA 3UTFA 3CPHG 3RNMA 4AP3A 1FOHA 3AE9A 3GYJA 4C77A 1ZP0A 3QFAA 2YVJA 4B69A 4G9KA 1NHPA 4EQRA 1FEBA 4K8DA 5EOWA 3FIMB 3BNMA 1B4VA 2B7SA 3FG2P 4U8PA 4U8LA 4U2SA 2XYOA 4C74A 4J2WA 4D04A 4Z24A 4A6NB 4H2QA 1CC6A 2VQBA 2BCGG 4ICYA 3UTHA 4B68A 2W0HA 4J31A 3JSKA 1D4CA 1GRGA 2ZBWA 3V3OA 2XLPA 3CNPA 5C2TA 1P2HA 1IUTA 1XDIA 3SZCA 4ECHA 1O5WA 2V5ZA 5KVHA 4JNQA 4LU6A 2ACZA 4B65A 2C65A 4AP1A 3SZ0A 4AT2A 3T2ZA 3ALMA 5KVIA 4Z2UA 3G5SA 1L9CA 4FK1C 3URHA 1E1LA 1H81A 3BHFA 4J57A 1BWCA 3DK8A 1M6IA 1TYTA 5KOWA 3AEFA 3C4NA 3Q6JA 1PN0A 5KNLA 1CHUA 1K4QA 4EMJA 3KPKA 3GSIA 3DK9A 1GRBA 3AE4A 3DH9A 2WQYA 1L9EA 4YKGA 3AE3A 1MXTA 4A9WA 2XVJA 4Z25A 1Y56A 1CJ4A 1XPQA 3NK0X 4Y4LA 2NPXA 1X31B 3DJGX 2BK3A 4YT0A 1PDHA 1PJ5A 2WP6A 3RP8A 1MO9A 3HYVA 1BZLA 4UDPA 1GNDA 3GQHA 1E1NA 2BS3A 3HYXA 2WOWA 4AOSA 3LZXA 2R4JA 4G73A 4K5RA 1VG9A 1F8SA 2GEWA 3ZYXA 3AD8B 3GWFA 1KNRA 1TDFA 4C3XA 4DNAA 1JEHA 2PHHA 2QA2A 2ARDA 2YG5A 3PS9A 5HXIA 1NENA 3AB1A 1PBFA 4OVIA 2JB1A 2X8GA 5JCIA 1GTEA 1DNCA 3T31A 2BC0A 3DGZA 3DA1A 4D03A 3EAOA 5J60A 3KKJA 2WP9A 4CRTA 2Q6UA 4XXGA 4ZCDA 2E5VA 1PBCA 1EL8A 1B37A 1GPEA 1YKJA 3AD7B 2OALA 3ATQA 5HY5A 1ZMDA 3FPZA 4YTPA 3UKLA 1GREA 3AEAA 2GH5A 2JB2A 3COXA 3M13A 3QSSA 4KPRA 3NYCA 3ITJA 2TMDA 2GMJA 3CN8A 1EL5A 3CGEA 3EF6A 2B9XA 4TM1A 1VRQB 4A65A 2QAEA 2R46A 5EB4A 3NNEA 3OC4A 4U8OA 2YLSA 2BA9A 1NHQA 3UKKA 2CFYA 2AR8A 3ICTA 2WDQA 3NT6A 3I6DA 4CCRA 1ZOYA 3NYEA 4NTCA 2XLTA 3SXIA 4GAVA 4YTNA 1QLBA 1Y0PA 2YWLA 3Q9TA 4CY6A 2C66A 2V6OA 4EQSA 3CGDA 3AECA 1JOAA 1PBBA 2YM2A 4GDEA 1E39A 2UZZA 3AXBA 1NHRA 2XFNA 1RP0A 3F8PA 3QSEA 2JB3A 3F8RA 2IVEA 2TPRA 3AE2A 5HYMA 1YQ3A 2A87A 2XFQA 1Q1RA 5C3JA 3I3LA 4IV9A 2H89A 3P4RA 4AT0A 1ZK7A 4A5LA 4KX6A 1NAAA 1F3PA 4H4XA 2WP5A 2FJDA 4B67A 2WU5A 1RSGA 3GRTA 1EL9A 3NH3X 4DSHA 3SZFA 5CQFA 5BRTA 4X9NA 4CY8A 3QFBA 2BABA 3ABVA 2XFUA 2X8CA 2Y6QA 2YR4A 3F8DA 3GDNA 4YWOA 4EIPA 4EM3A 2NVKX 2IVDA 2VRMA 2WDRA 2DKHA 4C3YA 2FJEA 2GV8A 1GEUA 2XDOA 1DOCA 2VOUA 3NYFA 3SZWA 1GV4A 1FL2A 1QJDA 4ZCCA 3SFEA 4BJZA 5LV9A 1LQTA 1FCDA 1JRXA 2XFPA 2GVCA 2GB0A 4HB9A 4REKA 4YKFA 4LIIA 3NN6X 2R0GA 3AEGA 3CNSA 3NRNA 3UP5A 1D4DA 5KXJA 1ONFA 3UKQA 4H7UA 2WPEA 3SUCA 2EQ8A 5KMSA 3KPFA 2V3AA 3LOVA 3SGLA 4ZN0A 1GRFA 1OJCA 2RGHA 5EB5A 4EM4A 2VRLA 3DJEA 3NKSA 5BUKA 3M12A 3VR8A 2BRAA 4H4PA 4C5OA 1GT8A 2WEUA 4U8MA 4EQWA 4IVMB 3NLCA 4P9SA 5DBJA 4YSZA 4G6HA 2BS4A 4J56A 3QVPA 4UDRA 2VVLG 1CJCA 4EQXA 1TRBA 1VG0A 4NEWA 4G6GA 5KMRA 1CBOA 2WS3A 1D7YA 2BACA 5KMPA 2VQ7A 2YR5A 2C64A 4OPDA 3AD9B 4U8IA 4B66A 1LVLA 2YLTA 1VQWA 1M64A 1B5QA 1SEZA 2JBVA 4O5UA 5HHFA 4CNKA 1DJNA 2B7RA 5IQ4A 4YSHA 3ALJA 1PS9A 1AOGA 4Z44A 1BKWA 5JCMA 3GD4A 2BXRA 1P2EA 3AWIA 3UP4A 3VRAA 3FMWA 1VDCA 1ZDLA 4OPTA 1E1MA 1KFYA 3ADAB 2AAQA 2RGOA 3CPIG 2YVGA 3REDA 3VR9A 1N4WA 2YR6A 3NK1X 4E0VA 4YXDA 1GETA 3EANA 2JAEA 2XVIA 1ZOVA 3NTDA 2YG3A 4H4YA 4YSXA 1NDAA 4B1BA 2OLNA 3V76A 3AE8A 1DXLA 3M0OA 4XWRA 2IIDA 2WESA 2C76A 5TR3A 1IJHA 2B9WA 1H7WA 2BK4A 3CGBA 5U63A 3C96A 3SYIA 4Z2TA 2QA1A 2FJBA 4H4UA 1Q1WA 1PXCA 4IA5A 3AYLA 1CF3A 4UP3A 2Q7VA 2JK6A 2YAUA 3G5QA 4OPUA 3VRDB 3P1WA 1ZKQA 1FECA 1K0LA 2WBAA 3QVRA 2WHDA 1LTXR 1GRTA 1JRZA 1NPXA 1YQ4A 1F8WA 1NHSA 2ZZCA 2Z5YA 3GRSA 4JDRA 4K22A 3UKAA 1F8RA 1GOSA 2E1MA 3LJPA 4BV6A 5GRTA 1JNZA 2YM1A 2CVJA 4U8KA 3LZWA 3DK4A 3AYJA 1H83A 1PJ6A 2PYXA 3KVEA 4B63A 3BI4A 2YVFA 2BK5A 2C7GA 3GWDA 3P9UA 5EBKA 3KLJA 3CNJA 1BGJA 1S3EA 2WETA 4U8NA 3CGCA 2YG4A 3IHMA 4H4QA 2X3NA 5FS7A 4NEVA 3BNUA 2WU2A 3SX6A 1OJTA 1OJDA 3PO7A 3H8LA 4UDQA 1COYA 4I58A 4IA6A 5ER0A 2X8HA 4B64A 2BYBA 3E1TA 5JCLA 2BC1A 2Z5XA 4GDPA 2H88A 3UOYA 2YG7A 2B76A 1GTHA 2HQMA 2GR2A 2XFOA 3H8IA 3T37A 1PXAA 3S5WA 4OPGA 1K0JA 2EQ9A 4Z2RA 1MOKA 3FBSA 4APNA 2C70A 4JNAA 1N4UA 3WE0A 4A79A 5IPYA 4TM4A 1EL7A 1S3BA 2XVHA 3GDPA 4FDCB 3LXDA 3IC9A 1KNPA 2C3CA 3CPJG 2GRTA 4U2TA 3D1CA 2O9ZA 4GCMA 1NG4A 4BK2A 1E7PA 3B6DA 4TM3A 5FS9A 3V3NA 5BULA 4OCGA 3SY4A 1PXBA 5BVAA 5U25A 1TDNA 1D4EA 1OJ9A 2R45A 2Q0LA 3UTEA 1JU2A 2OAMA 4OPLA 4U8JA 3CMMA 3T0KA 1IUXA 3SM8A 4K5SA 1H82A 1KF6A 1BF3A 3DMEA 4H4ZA 4X9MA 2XLRA 2OA1A 1S2YA 4H4TA 3NTAA 1N1PA 2ZZ0A 1Y56B 1GERA 3UOXA 2R0CA 1QO8A 3II4A 3DJDA 3D8XA 1L0VA 2YLWA 5KWFA 3T2KA 1H7XA 3KD9A 1TDKA 3UCLA 3L1RA 1CJ2A 4X4JA 3K7TA 1F6MA 3ISHA 4TLXA 4A99A 3BHKA 1L9DA 2R4EA 5JCNA 2C75A 3UKPA 4WX1A 1GRHA 3G5RA 2GF3A 2A8XA 1IUVA 3S61A 3AE7A 3B3RA 5JCKA 4K7ZA 2GAGB 4A7AA 2C4CA 2RABA 1CC2A 3RHAA 1GALA 1V59A 4H50A 3QJ4A 4OPIA 3AE6A 2XVFA 3IWAA 2AQJA 5J7XA 2J3NA 1H6VA 4H2PA 2C3DA 1TYPA 4U2LA 1H86A 3P4QA 2BS2A 4H2NA 3VRBA 1LJ1A 4N9XA 4CNJA 4PAAA 4YSYA 4H2RA 4LA1A 1JNRA 1LQUA 1KSSA 2GQFA 3QSMA 4J36A 1LPFA 2XLSA 2RGJA 4OPCA 3R9UA 1H84A 2C73A 3GMCA 1Q9IA 3NN0X 3DJJA 2ZZBA 4NNJA 5FMHA 4AOXA 2YLZA 3EPTA 5KRQA 2VZ2A 3GYXA 5CKUA 3AE5A 1D5TA 3AEDA 3ZDNA 1DOBA 1ZMCA 2A89A 1FEAA 2V61A 4EIQA 3GMBA 4HA6A 1GSNA 4IVOB 3P4PA 3KA7A 3LB8A 4M52A 2QCUA 2YLXA 4BK1A 4NTEA 1KDGA 3CIRA 3KU9A 4H4VA 2BCPA 2XCGA 2WDVA 3RP6A 3AEEA 3T2YA 1CC4A 4J34A 4EMIA 2LFCA 3SFDA 3LADA 2WPFA 2CULA 4RSLA 3H4KA 1PBDA 3AYIA 1TDOA 4Z43A 3NIXA 4A6NA 2YQUA 1OJAA 4I59A 2VVLA 4BURA 1W4XA 3O0HA 3PVCA 2EQ6A 2X99A 3AEBA 3UOVA 1TDEA 3UTGA 4Z26A 1O95A 4XWZA 1CL0A 1PHHA 1PBEA 3GYIA 4TLZA 3C4AA 4JY3A 3UKHA 1LV0A 3ICRA 3ATRA 4G74A 2YG6A 3NG7X 2FJAA 1YQZA 1UKVG 2B9YA 2DKIA 2WPCA 2GR1A 3OZ2A 3CTYA 3HZLA 4ADWA 2I0ZA 3CNDA 4H4WA 2R0PA 1REOA 1YY5A 4GAPA 1GXFA 1PJ7A 4J33A 1GRAA 2X50A 2Y6RA 3T14A 4JQ9A 2F5ZA 2BRYA 4PABA 1CJ3A 1NG3A 1ELIA 1JRYA 3DGHA 3NGCX 4CBQA 1XHCA 1ZY8A 2E4GA 4H4RA 5GSNA 2XLUA 3CNTA 4DGKA 1NEKA 4K2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5Q A;  1DOE A;  4USR A;  3VQR A;  2GR3 A;  3K7Q X;  2APG A;  2JKC A;  4JN9 A;  2C67 A;  3RP7 A;  3BI2 A;  2OLO A;  4JY2 A;  1XAN A;  1N4V A;  3ICS A;  2GMH A;  4WCT A;  4TM0 A;  2R9Z A;  3NHO X;  3P4S A;  4CCQ A;  3K30 A;  4USQ A;  5L46 A;  4BK3 A;  4FX9 A;  1KSU A;  1DJQ A;  4NTD A;  1IUU A;  2Q0K A;  2XVE A;  5M0Z A;  4H4S A;  2GQW A;  2VVM A;  4GRT A;  3IF9 A;  2V3B A;  5M10 A;  3UOZ A;  1IUW A;  3IHG A;  3SQP A;  4YTM A;  2WOI A;  4MJW A;  2GR0 A;  2CDU A;  2GAH B;  2BXS A;  3L8K A;  3UKF A;  4GR1 A;  2FBW A;  3GD3 A;  4BJY A;  2YLR A;  4GUV A;  3AE1 A;  4Y4M A;  2EQ7 A;  3ALL A;  4Y4N A;  2WOV A;  1ZX9 A;  1S2Q A;  5FS8 A;  2C72 A;  4GF7 A;  4EMW A;  4DSG A;  1K0I A;  3K7M X;  1DOD A;  4NZH A;  1RYI A;  5U1O A;  3BI5 A;  1HYU A;  1GES A;  1E6E A;  4RG3 A;  5KOX A;  2V60 A;  1D7L A;  3GQK A;  1O94 A;  4FK1 A;  1B8S A;  1BGN A;  3NK2 X;  4RG4 A;  1EBD A;  1Z6L A;  5IQ1 A;  5FS6 A;  1E1K A;  1IUS A;  3UTF A;  3CPH G;  3RNM A;  4AP3 A;  1FOH A;  3AE9 A;  3GYJ A;  4C77 A;  1ZP0 A;  3QFA A;  2YVJ A;  4B69 A;  1NHP A;  4EQR A;  1FEB A;  4K8D A;  5EOW A;  3FIM B;  3BNM A;  1B4V A;  2B7S A;  3FG2 P;  4U8P A;  4U8L A;  4U2S A;  2XYO A;  4C74 A;  4J2W A;  4D04 A;  4Z24 A;  4A6N B;  4H2Q A;  1CC6 A;  2VQB A;  2BCG G;  4ICY A;  3UTH A;  4B68 A;  2W0H A;  4J31 A;  3JSK A;  1D4C A;  1GRG A;  2ZBW A;  3V3O A;  2XLP A;  3CNP A;  5C2T A;  1P2H A;  1IUT A;  1XDI A;  4ECH A;  5KVH A;  1O5W A;  2V5Z A;  4JNQ A;  4LU6 A;  2ACZ A;  4B65 A;  2C65 A;  4AP1 A;  4AT2 A;  3ALM A;  5KVI A;  4Z2U A;  3G5S A;  1L9C A;  4FK1 C;  3URH A;  1E1L A;  1H81 A;  3BHF A;  4J57 A;  1BWC A;  3DK8 A;  1M6I A;  1TYT A;  5KOW A;  3AEF A;  3C4N A;  3Q6J A;  1PN0 A;  1CHU A;  1K4Q A;  4EMJ A;  3GSI A;  3DK9 A;  1GRB A;  3AE4 A;  3DH9 A;  2WQY A;  1L9E A;  4YKG A;  3AE3 A;  1MXT A;  4A9W A;  2XVJ A;  4Z25 A;  1Y56 A;  1CJ4 A;  1XPQ A;  3NK0 X;  4Y4L A;  2NPX A;  1X31 B;  3DJG X;  2BK3 A;  4YT0 A;  1PDH A;  1PJ5 A;  2WP6 A;  3RP8 A;  1MO9 A;  1BZL A;  4UDP A;  1GND A;  3GQH A;  1E1N A;  2BS3 A;  2WOW A;  4AOS A;  3LZX A;  2R4J A;  4K5R A;  1VG9 A;  1F8S A;  2GEW A;  3ZYX A;  3AD8 B;  3GWF A;  1KNR A;  1TDF A;  4C3X A;  4DNA A;  1JEH A;  2PHH A;  2QA2 A;  2ARD A;  2YG5 A;  3PS9 A;  5HXI A;  1NEN A;  3AB1 A;  1PBF A;  4OVI A;  2JB1 A;  2X8G A;  5JCI A;  1GTE A;  1DNC A;  2BC0 A;  3DGZ A;  3DA1 A;  4D03 A;  3EAO A;  5J60 A;  3KKJ A;  2WP9 A;  4CRT A;  2Q6U A;  4XXG A;  4ZCD A;  2E5V A;  1PBC A;  1EL8 A;  1B37 A;  1GPE A;  1YKJ A;  3AD7 B;  2OAL A;  3ATQ A;  5HY5 A;  1ZMD A;  3FPZ A;  4YTP A;  3UKL A;  1GRE A;  3AEA A;  2GH5 A;  2JB2 A;  3COX A;  3M13 A;  3QSS A;  4KPR A;  3NYC A;  3ITJ A;  2TMD A;  2GMJ A;  3CN8 A;  1EL5 A;  3CGE A;  3EF6 A;  2B9X A;  4TM1 A;  1VRQ B;  4A65 A;  2QAE A;  2R46 A;  5EB4 A;  3NNE A;  3OC4 A;  4U8O A;  2YLS A;  2BA9 A;  1NHQ A;  3UKK A;  2CFY A;  2AR8 A;  3ICT A;  2WDQ A;  3NT6 A;  3I6D A;  4CCR A;  1ZOY A;  3NYE A;  4NTC A;  2XLT A;  4YTN A;  1QLB A;  1Y0P A;  2YWL A;  3Q9T A;  4CY6 A;  2C66 A;  2V6O A;  4EQS A;  3CGD A;  3AEC A;  1JOA A;  1PBB A;  2YM2 A;  4GDE A;  1E39 A;  2UZZ A;  3AXB A;  1NHR A;  2XFN A;  1RP0 A;  3F8P A;  3QSE A;  2JB3 A;  3F8R A;  2IVE A;  2TPR A;  3AE2 A;  5HYM A;  1YQ3 A;  2A87 A;  2XFQ A;  1Q1R A;  5C3J A;  3I3L A;  4IV9 A;  2H89 A;  3P4R A;  4AT0 A;  1ZK7 A;  4A5L A;  4KX6 A;  1NAA A;  1F3P A;  4H4X A;  2WP5 A;  2FJD A;  4B67 A;  2WU5 A;  1RSG A;  3GRT A;  1EL9 A;  3NH3 X;  4DSH A;  5CQF A;  5BRT A;  4X9N A;  4CY8 A;  3QFB A;  2BAB A;  3ABV A;  2XFU A;  2X8C A;  2Y6Q A;  2YR4 A;  3F8D A;  3GDN A;  4YWO A;  4EIP A;  4EM3 A;  2NVK X;  2IVD A;  2VRM A;  2WDR A;  2DKH A;  4C3Y A;  2FJE A;  2GV8 A;  1GEU A;  2XDO A;  1DOC A;  2VOU A;  3NYF A;  1GV4 A;  1FL2 A;  1QJD A;  4ZCC A;  3SFE A;  4BJZ A;  5LV9 A;  1LQT A;  1FCD A;  1JRX A;  2XFP A;  2GVC A;  2GB0 A;  4HB9 A;  4REK A;  4YKF A;  4LII A;  3NN6 X;  2R0G A;  3AEG A;  3CNS A;  3NRN A;  3UP5 A;  1D4D A;  5KXJ A;  1ONF A;  3UKQ A;  4H7U A;  2WPE A;  3SUC A;  2EQ8 A;  3KPF A;  2V3A A;  3LOV A;  3SGL A;  4ZN0 A;  1GRF A;  1OJC A;  2RGH A;  5EB5 A;  4EM4 A;  2VRL A;  3DJE A;  3NKS A;  5BUK A;  3M12 A;  3VR8 A;  4H4P A;  4C5O A;  1GT8 A;  2WEU A;  4U8M A;  4EQW A;  4IVM B;  3NLC A;  4P9S A;  5DBJ A;  4YSZ A;  2BS4 A;  4J56 A;  3QVP A;  4UDR A;  2VVL G;  1CJC A;  4EQX A;  1TRB A;  1VG0 A;  4NEW A;  1CBO A;  2WS3 A;  1D7Y A;  2BAC A;  2VQ7 A;  2YR5 A;  2C64 A;  4OPD A;  3AD9 B;  4U8I A;  4B66 A;  1LVL A;  2YLT A;  1VQW A;  1M64 A;  1B5Q A;  1SEZ A;  2JBV A;  4O5U A;  5HHF A;  4CNK A;  1DJN A;  2B7R A;  5IQ4 A;  4YSH A;  3ALJ A;  1PS9 A;  1AOG A;  4Z44 A;  1BKW A;  5JCM A;  3GD4 A;  2BXR A;  1P2E A;  3AWI A;  3UP4 A;  3VRA A;  3FMW A;  1VDC A;  1ZDL A;  4OPT A;  1E1M A;  1KFY A;  3ADA B;  2AAQ A;  2RGO A;  3CPI G;  2YVG A;  3RED A;  3VR9 A;  1N4W A;  2YR6 A;  3NK1 X;  4E0V A;  4YXD A;  1GET A;  3EAN A;  2JAE A;  2XVI A;  1ZOV A;  3NTD A;  2YG3 A;  4H4Y A;  4YSX A;  1NDA A;  4B1B A;  2OLN A;  3V76 A;  3AE8 A;  1DXL A;  3M0O A;  4XWR A;  2IID A;  2WES A;  2C76 A;  5TR3 A;  1IJH A;  2B9W A;  1H7W A;  2BK4 A;  3CGB A;  5U63 A;  3C96 A;  4Z2T A;  2QA1 A;  2FJB A;  4H4U A;  1Q1W A;  1PXC A;  4IA5 A;  3AYL A;  1CF3 A;  4UP3 A;  2Q7V A;  2JK6 A;  2YAU A;  3G5Q A;  4OPU A;  3VRD B;  3P1W A;  1ZKQ A;  1FEC A;  1K0L A;  2WBA A;  3QVR A;  2WHD A;  1LTX R;  1GRT A;  1JRZ A;  1NPX A;  1YQ4 A;  1F8W A;  1NHS A;  2ZZC A;  2Z5Y A;  3GRS A;  4JDR A;  4K22 A;  3UKA A;  1F8R A;  1GOS A;  2E1M A;  3LJP A;  4BV6 A;  5GRT A;  1JNZ A;  2YM1 A;  2CVJ A;  4U8K A;  3LZW A;  3DK4 A;  3AYJ A;  1H83 A;  1PJ6 A;  2PYX A;  3KVE A;  4B63 A;  3BI4 A;  2YVF A;  2BK5 A;  2C7G A;  3GWD A;  3P9U A;  5EBK A;  3KLJ A;  3CNJ A;  1BGJ A;  1S3E A;  2WET A;  4U8N A;  3CGC A;  2YG4 A;  3IHM A;  4H4Q A;  2X3N A;  5FS7 A;  4NEV A;  3BNU A;  2WU2 A;  1OJT A;  1OJD A;  3PO7 A;  3H8L A;  4UDQ A;  1COY A;  4I58 A;  4IA6 A;  5ER0 A;  2X8H A;  4B64 A;  2BYB A;  3E1T A;  5JCL A;  2BC1 A;  2Z5X A;  4GDP A;  2H88 A;  3UOY A;  2YG7 A;  2B76 A;  1GTH A;  2HQM A;  2GR2 A;  2XFO A;  3H8I A;  3T37 A;  1PXA A;  3S5W A;  4OPG A;  1K0J A;  2EQ9 A;  4Z2R A;  1MOK A;  3FBS A;  4APN A;  2C70 A;  4JNA A;  1N4U A;  3WE0 A;  4A79 A;  5IPY A;  4TM4 A;  1EL7 A;  1S3B A;  2XVH A;  3GDP A;  4FDC B;  3LXD A;  3IC9 A;  1KNP A;  2C3C A;  3CPJ G;  2GRT A;  4U2T A;  3D1C A;  2O9Z A;  4GCM A;  1NG4 A;  4BK2 A;  1E7P A;  3B6D A;  4TM3 A;  5FS9 A;  3V3N A;  5BUL A;  4OCG A;  1PXB A;  5BVA A;  5U25 A;  1TDN A;  1D4E A;  1OJ9 A;  2R45 A;  2Q0L A;  3UTE A;  1JU2 A;  2OAM A;  4OPL A;  4U8J A;  1IUX A;  3SM8 A;  4K5S A;  1H82 A;  1KF6 A;  1BF3 A;  3DME A;  4H4Z A;  4X9M A;  2XLR A;  2OA1 A;  1S2Y A;  4H4T A;  3NTA A;  1N1P A;  2ZZ0 A;  1Y56 B;  1GER A;  3UOX A;  2R0C A;  1QO8 A;  3II4 A;  3DJD A;  3D8X A;  1L0V A;  2YLW A;  5KWF A;  1H7X A;  3KD9 A;  1TDK A;  3UCL A;  3L1R A;  1CJ2 A;  4X4J A;  3K7T A;  1F6M A;  3ISH A;  4TLX A;  4A99 A;  3BHK A;  1L9D A;  2R4E A;  5JCN A;  2C75 A;  3UKP A;  4WX1 A;  1GRH A;  3G5R A;  2GF3 A;  2A8X A;  1IUV A;  3S61 A;  3AE7 A;  3B3R A;  5JCK A;  4K7Z A;  2GAG B;  4A7A A;  2RAB A;  1CC2 A;  3RHA A;  1GAL A;  1V59 A;  4H50 A;  3QJ4 A;  4OPI A;  3AE6 A;  2XVF A;  3IWA A;  2AQJ A;  5J7X A;  2J3N A;  1H6V A;  4H2P A;  2C3D A;  1TYP A;  4U2L A;  1H86 A;  3P4Q A;  2BS2 A;  4H2N A;  3VRB A;  1LJ1 A;  4N9X A;  4CNJ A;  4PAA A;  4YSY A;  4H2R A;  4LA1 A;  1JNR A;  1LQU A;  1KSS A;  2GQF A;  3QSM A;  4J36 A;  1LPF A;  2XLS A;  2RGJ A;  4OPC A;  3R9U A;  1H84 A;  2C73 A;  3GMC A;  1Q9I A;  3NN0 X;  3DJJ A;  2ZZB A;  5FMH A;  4AOX A;  5KRQ A;  2YLZ A;  3EPT A;  2VZ2 A;  5CKU A;  3GYX A;  3AE5 A;  1D5T A;  3AED A;  3ZDN A;  1DOB A;  1ZMC A;  2A89 A;  1FEA A;  2V61 A;  4EIQ A;  3GMB A;  4HA6 A;  1GSN A;  4IVO B;  3P4P A;  3KA7 A;  3LB8 A;  4M52 A;  2QCU A;  2YLX A;  4BK1 A;  4NTE A;  1KDG A;  3CIR A;  3KU9 A;  4H4V A;  2BCP A;  2XCG A;  2WDV A;  3RP6 A;  3AEE A;  1CC4 A;  4J34 A;  4EMI A;  2LFC A;  3SFD A;  3LAD A;  2WPF A;  2CUL A;  4RSL A;  3H4K A;  1PBD A;  3AYI A;  1TDO A;  4Z43 A;  3NIX A;  4A6N A;  2YQU A;  1OJA A;  4I59 A;  2VVL A;  4BUR A;  1W4X A;  3O0H A;  3PVC A;  2EQ6 A;  2X99 A;  3AEB A;  3UOV A;  1TDE A;  3UTG A;  4Z26 A;  1O95 A;  4XWZ A;  1CL0 A;  1PHH A;  1PBE A;  3GYI A;  4TLZ A;  3C4A A;  4JY3 A;  3UKH A;  1LV0 A;  3ICR A;  3ATR A;  2YG6 A;  3NG7 X;  2FJA A;  1YQZ A;  1UKV G;  2B9Y A;  2DKI A;  2WPC A;  2GR1 A;  3OZ2 A;  3CTY A;  3HZL A;  4ADW A;  2I0Z A;  3CND A;  4H4W A;  2R0P A;  1REO A;  1YY5 A;  1GXF A;  1PJ7 A;  4J33 A;  1GRA A;  2X50 A;  2Y6R A;  4JQ9 A;  2F5Z A;  4PAB A;  1CJ3 A;  1NG3 A;  1ELI A;  1JRY A;  3DGH A;  3NGC X;  4CBQ A;  1XHC A;  1ZY8 A;  2E4G A;  4H4R A;  5GSN A;  2XLU A;  3CNT A;  4DGK A;  1NEK A;  4K2X A; 
#chains in the Genus database with same CATH topology
 2LT3 A;  1DOE A;  5FP3 A;  4PJL A;  4X1I E;  4XBF B;  4L9I A;  3K3Q C;  2C67 A;  2OLO A;  1N4V A;  4U33 A;  2DWK A;  4WCT A;  3BQI A;  4UEL A;  3PU3 A;  4TM0 A;  2FUP A;  3D0T A;  2D2S A;  3PUQ A;  4CCQ A;  3O4X E;  4RHV 4;  4UVA B;  4EAH A;  4HWF A;  1WRD A;  1IUU A;  4NWZ A;  1ASJ 4;  4IE0 A;  1RHI 4;  4H4S A;  2GQW A;  3IF9 A;  1WR0 A;  2V3B A;  3IHG A;  4YTM A;  2WCA A;  3L8K A;  3J7Y q;  3UKF A;  3LSV A;  2FBW A;  3GD3 A;  3UUL A;  3ALL A;  2BVM A;  4HE8 A;  3UU6 A;  2L8K A;  5FS8 A;  4QKN A;  4DR1 T;  1RUD 4;  1K0I A;  3K7M X;  1DOD A;  4PDW D;  2VKO A;  5KOX A;  4GKK T;  1B8S A;  1BGN A;  4RG4 A;  3TLS A;  3UTF A;  2A3D A;  2DL1 A;  4AP3 A;  1ZP0 A;  3QFA A;  4TNV A;  3RHW A;  4B69 A;  1RUJ 4;  4OYK A;  1FEB A;  1SA0 E;  2B7S A;  5HWY A;  4U2S A;  4C74 A;  2W0G A;  4J2W A;  4Z24 A;  4A6N B;  4H2Q A;  4H9N C;  2VQB A;  2DLR A;  4IDP A;  2BCG G;  3H37 A;  4IT4 A;  1P2H A;  3SZC A;  5KVH A;  2XQ3 A;  2ACZ A;  3NRX A;  4AP1 A;  4AT2 A;  3VKH A;  3ALM A;  3TKL B;  3L39 A;  3CWZ B;  4P09 A;  2K24 A;  1E1L A;  3BHF A;  4UIG A;  1PN0 A;  5KNL A;  1HG2 A;  3I9Y A;  3CPZ A;  4EMJ A;  3PUZ F;  3AE4 A;  4JEU B;  2B1E A;  5CA1 E;  4YKG A;  2W62 A;  4NXM T;  2XQ9 A;  2JIW A;  2HPL A;  1XMO T;  4KUM B;  2NPX A;  1X31 B;  2BK3 A;  4JUY A;  1MO9 A;  4UDP A;  1GND A;  2VKD A;  2WOW A;  1AR9 4;  4AOS A;  1F8S A;  3GWF A;  3MXZ A;  1X9B A;  4C3X A;  3JC6 D;  4FI5 A;  4UR9 A;  3PS9 A;  5HXI A;  2JRK A;  1H8T D;  2X51 A;  3ZJ1 A;  4OVI A;  1LVK A;  5JR9 C;  4F8H A;  1VBB 4;  3N5L A;  3T31 A;  3DGZ A;  5HWX A;  4ERR A;  3C4Z A;  3L09 A;  5J60 A;  3KKJ A;  5GON E;  2WP9 A;  2IC9 A;  1PBC A;  1EL8 A;  2NTX A;  2OAL A;  5HY5 A;  3R6N A;  1D0Z A;  4YTP A;  2JB2 A;  2GH5 A;  1YW0 A;  4DV2 T;  3EF6 A;  1HRV 4;  4TM1 A;  3RIU A;  5IUX A;  2R46 A;  2PYL A;  3NNE A;  4U8O A;  4KP3 C;  2LSK A;  2CFY A;  3T1Y T;  2X66 A;  3FXD B;  3NYE A;  4HWH A;  1QLB A;  1EAH 4;  2YWL A;  5LOV E;  4E7S A;  3DTO A;  2UZZ A;  2XFN A;  4YLH A;  4HFC A;  5EK4 A;  3KV5 A;  4ZI7 E;  1MMD A;  2IVE A;  1FMV A;  3V5S A;  3UU8 A;  2E9X D;  2ZM2 A;  1Q1R A;  1XHZ A;  2V7L A;  1BR4 A;  4IV9 A;  2BG9 C;  1HCI A;  3P4R A;  1NAA A;  1F3P A;  2WU5 A;  5L4E A;  2WZH A;  1EL9 A;  3NH3 X;  3U78 A;  5BRT A;  1VBA 4;  3PUG A;  3ABV A;  2YR4 A;  2X8C A;  3F8D A;  2NVK X;  2FJE A;  3C50 A;  5FY1 A;  3NYF A;  3SZW A;  1GV4 A;  1FL2 A;  2F4V T;  5LMU T;  4BJZ A;  2UXD T;  4HB9 A;  4YKF A;  3QB5 K;  3NRN A;  2YDQ A;  5KXJ A;  2WPE A;  3SUC A;  5KMS A;  2EHO D;  4ZN0 A;  3FXE B;  4KMC A;  2VRL A;  3DJE A;  3NKS A;  4TV9 E;  3VR8 A;  1GT8 A;  2WEU A;  4U8M A;  3F57 A;  4MAL A;  4G6H A;  2J1D G;  2E9X A;  3QVP A;  2H7O A;  1TRB A;  1CBO A;  5KMP A;  1D7Y A;  2YR5 A;  1X79 A;  1YKH B;  3AA6 B;  4L5G A;  2YLT A;  4MFR A;  1M64 A;  1B5Q A;  2JBV A;  1HF8 A;  4EZ4 A;  2B7R A;  4EYU A;  5HEU A;  2VL0 A;  1HX1 B;  2ACX A;  5LB7 B;  3I0O A;  4Z44 A;  1BKW A;  1N33 T;  1LKX A;  2W00 A;  2RGO A;  3ZCI A;  2LSJ A;  4LMJ A;  5FYM A;  3NK1 X;  3ZMV B;  2MOZ A;  4G63 A;  2EHO A;  5HXH A;  2XVI A;  5ABF A;  3NZQ A;  3B5M A;  4HGA A;  2XM1 A;  2IID A;  2UUA T;  2I0M A;  5TR3 A;  1IJH A;  4IGU A;  3HL6 A;  5JVD E;  1Q1W A;  1PVC 4;  3AYL A;  4UP3 A;  4Q4Y 4;  4OPU A;  3VRD B;  2CCQ A;  2LE8 A;  3P1W A;  4LF7 T;  2WBA A;  1AJ3 A;  1GRT A;  1JRZ A;  3UT5 E;  5LJN A;  1OXZ A;  1YKE B;  1F8R A;  2IIU A;  3LJP A;  5GRT A;  3QUJ A;  2YM1 A;  2XAH B;  1UK5 A;  2CVJ A;  4U8K A;  4DR6 T;  3AYJ A;  4QWN B;  5FMN A;  3KVE A;  4CQI A;  2BK5 A;  1UX4 A;  3GWD A;  4Q4X 4;  2WET A;  4U8N A;  3RGL A;  1N32 T;  2CEA A;  2YG4 A;  1D1C A;  3J8F 4;  1IBK T;  2X0H A;  4H4Q A;  1YXR A;  2V6Y B;  2XQ7 A;  4NEV A;  2WU2 A;  4I50 E;  3SS1 A;  4I58 A;  2X8H A;  3E1T A;  5LHI B;  2Z5X A;  4GDP A;  3UOY A;  2YG7 A;  2HQM A;  3TLU A;  5IPY A;  3S5W A;  4WBN E;  1K0J A;  3EHZ A;  3C4W A;  5JDL A;  3WE0 A;  3C4X A;  4IL4 A;  2HHH T;  3CPJ G;  4U2T A;  3IHR A;  4BK2 A;  5BUL A;  4EGW A;  5U25 A;  1TDN A;  1D4E A;  1FJG T;  2R04 4;  4HFI A;  2G0U A;  5DQW A;  4DVD A;  1IUX A;  3HKE E;  2QA7 A;  5LXT E;  1Y56 B;  1GER A;  3D8X A;  1L0V A;  2YLW A;  5KWF A;  1H7X A;  2WY2 A;  4H9O C;  5F8P A;  5JDG A;  3L1R A;  3P50 A;  2LHR A;  3BHK A;  2Q9Q B;  2X9Y A;  5JCN A;  4AKR B;  1IZN B;  3G5R A;  4MBQ A;  1ZEE A;  4K7Z A;  2GAG B;  2ZM6 T;  1GAL A;  4IIJ E;  2LSI A;  5ABF B;  5AQI B;  3IWA A;  4GYR A;  2VL8 A;  2J3N A;  1HR0 T;  1H6V A;  2YU2 A;  5J7X A;  2C3D A;  4KHP T;  4P0B A;  2RS5 4;  4TWD A;  1LJ1 A;  3ZT6 A;  1VOM A;  3RYC E;  1Q9I A;  3NN0 X;  3DJJ A;  4CXY A;  4A5X A;  2YLZ A;  3EPT A;  1D4M 4;  3GYX A;  5CKU A;  2XQA A;  3AE5 A;  1D5T A;  3AED A;  1IBM T;  5HXC A;  1DOB A;  1FEA A;  4IVO B;  3KA7 A;  3LB8 A;  4UF0 B;  5LGT B;  5HXS A;  3PE0 A;  1UCU A;  4PK6 A;  1HX8 A;  5HEJ A;  1CUN A;  2LJL A;  3LAD A;  2OLT A;  3V5U A;  3H4K A;  4Z43 A;  4PNI A;  1WYC A;  2ZM8 A;  2PTF A;  4BUR A;  3N9L A;  3O0H A;  5HXR A;  4M1P A;  2R06 4;  3AEB A;  2RS1 4;  4Z26 A;  4XWZ A;  5FXW A;  1PHH A;  1PBE A;  3GYI A;  4JY3 A;  3NG7 X;  1XNQ T;  4LMK A;  1NA1 D;  3ZN0 B;  4ZEY A;  2EX3 A;  1PJ7 A;  3T14 A;  2BRY A;  3NGC X;  4DR4 T;  3ZMZ B;  1ZY8 A;  2V7J A;  4H4R A;  4HKA A;  4USR A;  4LF6 T;  4EZH A;  5KDM C;  1VBD 4;  2APG A;  1R08 4;  5FL1 A;  3RP7 A;  3ZYK A;  2WWU A;  5FKY A;  2C0S A;  5CA0 E;  2GMH A;  4CZZ B;  4II3 A;  2UUC T;  3NKZ A;  3NHO X;  2LEH A;  3K30 A;  4USQ A;  2W4X A;  5L46 A;  4FX9 A;  5AQP B;  1DJQ A;  2XVE A;  5FXV A;  1HNX T;  1IUW A;  2J47 A;  1VRB A;  3AVS A;  1LRZ A;  1UUS A;  1NAF A;  2GR0 A;  2CDU A;  2GAH B;  4ZI3 D;  1MIY A;  4O4I E;  3AAI A;  4BJY A;  2YLR A;  3RIU C;  2EQ7 A;  4UV9 B;  4Y4M A;  1W0B A;  1ZX9 A;  1S2Q A;  4EMW A;  4DND A;  3UU3 A;  5U1O A;  3BI5 A;  5FXX A;  3NVO A;  4ILU A;  1HYU A;  4DV0 T;  2XAQ B;  1D7L A;  3GQK A;  1Z6L A;  1E1K A;  2W2U A;  1IUS A;  4KI0 F;  4JI7 T;  2CBI A;  2E5L T;  4AI6 A;  4BJM A;  3FI7 A;  5EOW A;  3RYH E;  1B4V A;  3BNM A;  3FG2 P;  5LYJ E;  4A56 A;  2XYO A;  2D0T A;  4D04 A;  4ZHQ E;  5LG3 A;  3RKG A;  2WBL A;  1CC6 A;  3UTH A;  4UVC B;  4JV5 T;  1GRG A;  4PJJ A;  1IUT A;  4HFH A;  1XDI A;  1O5W A;  2V5Z A;  4ECH A;  4LU6 A;  1XDO A;  3L3P A;  4B65 A;  2C65 A;  1OOP D;  3SZ0 A;  4Z2U A;  3ZEF B;  4FK1 C;  3N9Q A;  1H81 A;  3PU8 A;  4J57 A;  3OPC A;  3AEF A;  5AQQ B;  3DH9 A;  3Q9D A;  4H9Q C;  1MXT A;  2BG9 B;  4EYY R;  4A9W A;  3IA3 A;  4Y4L A;  5JRC A;  1ZKE A;  3DJG X;  2PZS A;  1PDH A;  3UFE A;  3RP8 A;  3HYV A;  4TNW A;  4EXT A;  5HEH A;  3GQH A;  2BS3 A;  5IYZ E;  4O2A E;  1H7C A;  2R4J A;  3FB2 A;  4G73 A;  3CK6 A;  4HFE A;  4DBR A;  1XHX A;  1AL2 4;  2RPA A;  3PJA J;  2PHH A;  2ARD A;  3ZJ2 A;  3GN5 A;  4YJ2 E;  2X8G A;  5JCI A;  3F31 A;  2N9D A;  1DNC A;  1MND A;  3PUW F;  2YN6 A;  1FMW A;  2JMK A;  5L3C B;  2IUB A;  3KFW X;  4CRT A;  2Q6U A;  3LK3 B;  2C5K T;  2E5V A;  1YKJ A;  2KWH A;  2LHN A;  3PUS A;  3AD7 B;  3EI0 A;  4YJ3 E;  3FZL B;  1GRE A;  3QSS A;  3COX A;  4H9S E;  2Q9Q C;  3M13 A;  3ITJ A;  3BK9 A;  4ISS A;  4XZC A;  1NWM X;  3CN8 A;  3ETV A;  4A65 A;  2QAE A;  4K0U A;  4JI3 T;  3OC4 A;  2AR8 A;  3N2O A;  1WYB A;  3NT6 A;  4AQF A;  2XLT A;  4HN9 A;  4DO0 A;  1HS7 A;  4GK0 E;  1Y0P A;  3Q9T A;  4CY6 A;  1PBB A;  2KSR A;  4U72 A;  2YM2 A;  3M65 A;  2XQ5 A;  3F8P A;  3L8R A;  3OVU A;  3HKD E;  2JB3 A;  4Z91 A;  5AFU L;  4I43 B;  2E8I A;  3X1D A;  2XFQ A;  3KV4 A;  5C3J A;  2H89 A;  4DR7 T;  3SWH A;  2XSA A;  4A5L A;  4EV6 A;  1IBL T;  2WZI A;  4CN6 A;  2WP5 A;  4B67 A;  4JBW F;  3MZK B;  3NRY A;  2CHO A;  1FIO A;  2XFU A;  4DV4 T;  5A1L A;  3M3Z B;  2IVD A;  1S94 A;  2MAW A;  4C3Y A;  2GV8 A;  3IF8 B;  4U2Y A;  1DOC A;  2CRB A;  2PW9 A;  4WZX A;  5JTG A;  2V5C A;  2XFP A;  4REK A;  4LII A;  4CXW A;  3AEG A;  2R0G A;  3CNS A;  2EQ8 A;  3SGL A;  1OED E;  1OJC A;  2A2F X;  5BUK A;  2XQ4 A;  3RKO A;  4C5O A;  4QHO A;  4P9S A;  3CQG B;  2YU1 A;  2HWB 4;  4J56 A;  3IBP A;  2XJ7 A;  3QNU A;  3AA7 B;  1SEZ A;  1G8X A;  1W09 A;  1U4Q A;  3ZMS B;  1AOG A;  3RYF E;  5JCM A;  3GD4 A;  1QSD A;  2BXR A;  5CFB A;  4IE4 A;  5H6Q B;  2XSB A;  2JQH A;  4HWC A;  3OTO T;  4OPT A;  4B3M T;  1US7 B;  3CPI G;  4OFZ A;  2K3W A;  3CVR A;  3MKD A;  2YR6 A;  2CM0 A;  3MAC A;  4ZI2 D;  3FZK B;  1XMQ T;  1GET A;  3RIA A;  5L3D B;  5L3E B;  4X1Y E;  3EAN A;  1ZOV A;  3NTD A;  3AE8 A;  3M0O A;  4XWR A;  2LOP A;  4H63 V;  1DU2 A;  2WES A;  4IRE A;  4H63 H;  4ADZ A;  1MIW A;  2BK4 A;  5L3B B;  3QK6 A;  4HWI B;  4AQG A;  2QA1 A;  3ZST A;  2FJB A;  4H4U A;  3KIN B;  4ILA A;  2W67 A;  2Q7V A;  1K0L A;  2BKN A;  2D5U A;  4IL9 A;  1NPX A;  3NBX X;  1GOS A;  2Y8D A;  2R6G F;  4B3T T;  1OED A;  2DWG A;  3DK4 A;  1RUI 4;  1PJ6 A;  3H3M A;  4HWD A;  3Q5X A;  2CWY A;  4JI5 T;  4L0R A;  5ABE A;  3CNJ A;  4O4J E;  3CGC A;  3O9X A;  2R7F A;  3BNU A;  1OJT A;  1OJD A;  3PO7 A;  3EAM A;  2NWB A;  2RM2 4;  2BYB A;  2WSS V;  4BAY B;  1E1H B;  2CBJ A;  4H9R C;  2YIN A;  3T1H T;  2B76 A;  2RR1 4;  2XFO A;  3T37 A;  1Z8U A;  2XY8 B;  1PXA A;  2EQ9 A;  4OPG A;  1XNR T;  1N4U A;  1AR8 4;  3HR0 A;  3B13 A;  4CI3 B;  4DR5 T;  3UTK A;  4TM4 A;  1RUC 4;  1D1B A;  2C3C A;  2GRT A;  4X1K E;  3WAJ A;  4DV3 T;  1NG4 A;  5IWA T;  1E7P A;  3B6D A;  4JI1 T;  2IDO B;  4OCG A;  3A7M A;  1PXB A;  1OJ9 A;  2X67 A;  4TV8 E;  5ABG A;  3CMM A;  3T0K A;  4WW0 A;  1BF3 A;  2OA1 A;  1S2Y A;  2DCF A;  2VWA A;  3JAD A;  2ZZ0 A;  3DJD A;  2DHR A;  4JI2 T;  4DV7 T;  5FXZ A;  2YKS A;  2ZM0 A;  4X4J A;  4TLX A;  2R4E A;  2C75 A;  2C5I T;  3UKP A;  3A8Y C;  3PUR A;  3AE7 A;  3B3R A;  4A7A A;  3KBT A;  1FEW A;  2XAS B;  1CC2 A;  5JDF A;  3HI2 A;  3QJ4 A;  2WWV A;  3UU5 A;  3AE6 A;  3VKG A;  3ZKR A;  2ODV A;  5L2L A;  4AKH A;  5C8Y E;  4J2C A;  4H2P A;  4U2L A;  1H86 A;  3P4Q A;  4H2N A;  3ANW A;  2XQ6 A;  3UUN A;  3SRZ A;  4YSY A;  4U74 A;  4H2R A;  4LA1 A;  1JNR A;  4ILB A;  2GQF A;  3C64 A;  2PLV 4;  1Z0P A;  2RGJ A;  1Z7S 4;  3AB3 B;  4EEB A;  2XAJ B;  2C73 A;  3GMC A;  5KRQ A;  3QC9 A;  4IHJ E;  4MHC A;  2VZ2 A;  4U7I A;  3GMB A;  1GSN A;  3ZC0 A;  2YLX A;  4NTE A;  3RP6 A;  3KU9 A;  2BCP A;  2WDV A;  3T2Y A;  1CC4 A;  3FHN A;  2WPF A;  4H9P C;  2X0Y A;  4DV6 T;  1TDO A;  2YDS A;  5FL0 A;  4X62 T;  4I59 A;  4O8S A;  5AQL B;  2VVL A;  2C5J A;  3O1H A;  4GK5 E;  3AA0 B;  3Q5D A;  3NWI A;  1J5W A;  1POV 0;  3LDQ B;  5AQK B;  4DMV A;  3PVC A;  2AXD S;  3O1J A;  2XPK A;  2X99 A;  5ADX L;  5JH7 E;  4P0A A;  3UTG A;  2KLQ A;  3MK7 C;  1J5E T;  3C4A A;  4YFS A;  1LV0 A;  4G74 A;  1D0X A;  4EED A;  2FJA A;  3C51 A;  1YQZ A;  4TN7 B;  1UKV G;  3U3I A;  4X64 T;  3I9W A;  4ADW A;  2I6H A;  3RPU A;  1EZ3 A;  1HRI 4;  2DNX A;  2YOE A;  2X50 A;  2Y6R A;  4JQ9 A;  4PAB A;  1ELI A;  2HH7 A;  3Q5W A;  1XHC A;  1BEV 4;  2KZ7 B;  5GSN A;  5LMN T;  1NEK A;  2LSY A;  4K2X A;  1J1J A;  3K7Q X;  2Y48 B;  3RRW A;  2JKC A;  1AR7 4;  4JN9 A;  3PUV F;  5AQF B;  5JQG E;  1XAN A;  3ICS A;  5LJM A;  1UUR A;  2GK9 A;  1M7K A;  2IML A;  5J1G A;  4X66 T;  3P4S A;  2Y6X A;  5AQO B;  4BK3 A;  4LF8 T;  4NTD A;  2NR4 A;  1LVF A;  5M0Z A;  2R07 4;  4B3R T;  2VVM A;  5M10 A;  3A5X A;  5BR8 T;  4O4L E;  2E9X B;  3UQ7 A;  4MJW A;  1ZV4 X;  4GOU A;  5LA6 E;  2BXS A;  3HKB E;  4A98 A;  4GR1 A;  5LP6 E;  4GUV A;  4CN1 A;  3ANW B;  4Y4N A;  4NIQ A;  2C72 A;  2A72 A;  4EB6 E;  4GF7 A;  2LRK A;  4DSG A;  4WNK A;  4AQF C;  1B7T A;  3F2E A;  4IDO A;  2NTY A;  1GES A;  1E6E A;  2QGS A;  4HTE A;  3P7I A;  4DUY T;  1O94 A;  1KNZ A;  1EBD A;  5KMQ A;  5IQ1 A;  5FS6 A;  1MNE A;  3CPH G;  3MJX A;  2HWC 4;  3RNM A;  1FOH A;  3GYJ A;  4C77 A;  2X0L B;  1NHP A;  5CJ5 A;  2EHO B;  4U8P A;  4GB3 4;  2ODU A;  4U8L A;  3GWH A;  1PO1 4;  4DR3 T;  4B68 A;  2W0H A;  4J31 A;  5HCM A;  2ZBW A;  2KT9 A;  3CNP A;  4LML A;  5KVI A;  3ZSS A;  4CI2 B;  2L3L A;  1M6I A;  1TYT A;  5KOW A;  4Z8X A;  3Q6J A;  1CHU A;  3KPK A;  3GSI A;  5M4Y A;  1GRB A;  5JR9 A;  2WQY A;  3AE3 A;  3PUA A;  4Z25 A;  1CJ4 A;  2CXD A;  3NK0 X;  2CE7 A;  2MBG A;  1GQE A;  5ABH A;  1PJ5 A;  2X9H A;  3WI3 A;  4K0K T;  2WP6 A;  2Z6E A;  2XHE B;  2VKH A;  1E1N A;  3UUB A;  3TLT A;  3FZF B;  2I59 A;  3ONJ A;  3LZX A;  2LOS A;  4K5R A;  2VQF T;  1KNR A;  1T98 A;  1TDF A;  3RX6 A;  3FZH B;  1JEH A;  2QA2 A;  3RQU A;  3N2K E;  2JB1 A;  2CHN A;  3DA1 A;  4D03 A;  2XTL A;  3ZT5 A;  2V1D B;  3EAO A;  2M67 A;  1GPE A;  4LF5 T;  3ATQ A;  1XDP A;  1ZMD A;  3RIF A;  2RA1 A;  4PK4 A;  3LJC A;  3NYC A;  2GMJ A;  4U31 A;  3Q5E A;  3OJA A;  2B9X A;  2X9W A;  1VRQ B;  5AQS B;  4ASK A;  2BA9 A;  1T8B A;  3UKK A;  4QXC B;  2QYW A;  2WDQ A;  2CXF A;  3RYI E;  2XAG B;  3I6D A;  4CCR A;  3BQL A;  4JI6 T;  5KX5 E;  4YTN A;  2V6O A;  4EQS A;  3CGD A;  3AAA B;  1JOA A;  4GDE A;  3MA9 A;  5L3F B;  1E39 A;  4UEM A;  1NHR A;  1RP0 A;  2JQ9 A;  2K9A A;  2H3R A;  1YD8 G;  3R84 B;  3AE2 A;  2NOX A;  2A87 A;  3Q2M A;  3I3L A;  3UFG A;  1WR6 A;  1OED C;  4EOZ B;  3PUX F;  1Y64 B;  4H4X A;  2FJD A;  1D1A A;  1RSG A;  3GRT A;  2BKP A;  4DSH A;  3SZF A;  5CQF A;  5AQN B;  4X9N A;  5AQM B;  4CY8 A;  1PIV 4;  3QFB A;  2BAB A;  2RS3 4;  3GDN A;  4YWO A;  4EM3 A;  3JC6 C;  4QX8 B;  3E22 E;  2VRM A;  1BR1 A;  4X20 E;  2DKH A;  4PFO A;  1UGO A;  2XDO A;  2VOU A;  3CML A;  3N9M A;  4ZCC A;  1JRX A;  3ZLI A;  3GA8 A;  3NN6 X;  1D4D A;  1ONF A;  2PFV A;  4H7U A;  3J9X 1;  3UQ4 A;  4AIU A;  5JRE A;  2V3A A;  1GRF A;  2RGH A;  5EB5 A;  4EM4 A;  2K48 A;  4H4P A;  4EQW A;  4LF9 T;  4PW8 A;  2BS4 A;  1MQT D;  2BZB A;  2VVL G;  3P8C D;  2JPF A;  5KMR A;  1V9D A;  2BAC A;  2C64 A;  3QOF A;  4B66 A;  3AD9 B;  4PAG A;  4U8I A;  5LGN B;  1LVL A;  4ZXL A;  1VQW A;  5JDH A;  4CNK A;  2YK0 A;  5HEO A;  3CX6 B;  5IQ4 A;  1UX5 A;  2WM9 A;  1EV1 4;  1PS9 A;  4PJN A;  1VCT A;  3AWI A;  4LFB T;  3AVR A;  4PFP A;  4X5T A;  2X68 A;  5HAX A;  4EIW A;  1E1M A;  1KFY A;  3RED A;  3VR9 A;  2E9X C;  3E0Z A;  4IDQ A;  4E0V A;  4YXD A;  4AKG A;  2JAE A;  4P1N A;  2NW8 A;  4DMW A;  4YSX A;  2WMN A;  3ONL C;  1NDA A;  3RRC A;  4B1B A;  5AQU B;  1DXL A;  3LK2 B;  2C76 A;  2LRL A;  3H3A A;  4LF4 T;  2B9W A;  2CMR A;  3CGB A;  2VAS A;  5AQG B;  5LNK A;  1CF3 A;  1SE7 A;  3G5Q A;  2JK6 A;  2YAU A;  1IJ5 A;  1ZKQ A;  1FEC A;  5AQR B;  3QVR A;  2WHD A;  5DBJ A;  4K22 A;  1YQ4 A;  2MPK A;  2W66 A;  3ZPO A;  1NHS A;  2Z5Y A;  2PY5 A;  2KXP B;  5J2U E;  2RMU 4;  4IE6 A;  2EHO C;  4E7Z A;  4LFA T;  3LZW A;  3ETU A;  3ZYM A;  1OWA A;  5AQJ B;  1M62 A;  3I1A A;  2PYX A;  3JAE A;  2M6I A;  3K3N A;  2C7G A;  3BI4 A;  1BGJ A;  4DID B;  2XAF B;  3JCF A;  5EK2 A;  3BQK A;  2X3N A;  2HPJ A;  4ZS2 A;  3SX6 A;  5ER0 A;  1COY A;  4B64 A;  5JCL A;  2BC1 A;  2H88 A;  4O2B E;  2V7M A;  4OX9 T;  1VRH 4;  4Z2R A;  1MOK A;  3FBS A;  1SUM B;  2HN1 A;  2XVH A;  4FDC B;  3LXD A;  3IC9 A;  1KNP A;  4ANJ A;  4GCM A;  4A97 A;  4IE7 A;  5JDM A;  1KK7 A;  2BKO A;  4I0U A;  3C98 B;  1JU2 A;  1IAP A;  3CQC B;  3G06 A;  3SM8 A;  4K5S A;  1KF6 A;  3DME A;  2XLR A;  5HCJ A;  1I6Z A;  1RUE 4;  5DJQ C;  1N1P A;  3PJA A;  2R0C A;  1QO8 A;  3II4 A;  1BR2 A;  5JRC B;  3UUM A;  1TDK A;  3UCL A;  3QB5 A;  2IAK A;  1XWM A;  4O4H E;  4HFD A;  1L9D A;  4WX1 A;  4DV1 T;  2A8X A;  3S61 A;  3K8P C;  5JCK A;  2C4C A;  2RAB A;  3RHA A;  3GN5 B;  1V59 A;  4OPI A;  3N9P A;  2XVF A;  2AQJ A;  4GYS A;  3ESL A;  5J0Z A;  3ZMT B;  1TYP A;  2UXC T;  2BS2 A;  2JMH A;  3VRB A;  4TUY E;  2ES0 A;  4N9X A;  1HFA A;  3T8O A;  4PAA A;  4J36 A;  1LPF A;  3AA1 B;  3ZT7 A;  4OPC A;  1H84 A;  3EAB A;  3KV9 A;  4NNJ A;  5FMH A;  4AOX A;  4B6X A;  2X9X A;  2UXX B;  1HG5 A;  3JAF A;  3O1I A;  4KHZ F;  1ZMC A;  2A89 A;  4WBO A;  2V61 A;  4EIQ A;  4QXH B;  4BK1 A;  1KDG A;  4H4V A;  2V7I A;  1AR6 4;  2YEV C;  2XCG A;  4EMI A;  2LFC A;  3SFD A;  4PJM A;  2CPT A;  2V6X A;  3DJB A;  1D0Y A;  1KEY A;  4PK5 A;  2JJ9 A;  1XZY A;  2EQ6 A;  4QH4 A;  3OYX A;  5EK3 A;  2JQQ A;  3UOV A;  2LKG A;  1TDE A;  1O95 A;  1CL0 A;  2D0U A;  3ATR A;  2NP9 A;  2V5D A;  4YY3 T;  2YG6 A;  2B9Y A;  2WPC A;  2DKI A;  4AXP A;  3CX8 B;  3CTY A;  5L47 A;  2H7V C;  2PBI A;  4DV5 T;  3CND A;  4Q4W 4;  2CA5 A;  2KWI B;  4H4W A;  4GAP A;  2CLY C;  1GRA A;  5DAB A;  2F5Z A;  3KVA A;  3DGH A;  1JRY A;  1HNZ T;  2E4G A;  4QX7 B;  3K1S A;  4TX5 A;  4AIS A;  3SFE A;  2VK9 A;  3CGE A;  4O5Q A;  3VQR A;  2GR3 A;  3ZC1 A;  3JD7 4;  4NPP A;  2OV9 A;  3BI2 A;  3OBV E;  4JY2 A;  5FVK A;  3VU7 H;  5JDQ A;  2R9Z A;  4JEH B;  1KSU A;  4II2 A;  2IHR 1;  2Q0K A;  4GIW A;  4ZZC A;  3HYW A;  3SOL A;  4GRT A;  3UOZ A;  1COV 4;  3TLV A;  3SQP A;  2BBJ A;  2WOI A;  3EDU A;  5LG4 A;  4IDN A;  1U5P A;  3P4W A;  4DBQ A;  2SPC A;  3S4U A;  2KIN B;  3AE1 A;  2N1G A;  3EDV A;  2W63 A;  2WOV A;  2UU9 T;  2LM2 A;  3FZM B;  4NZH A;  1R09 4;  1RYI A;  4RG3 A;  2V60 A;  1NCQ D;  4FK1 A;  1VBE 4;  3NK2 X;  4IE5 A;  3TLW A;  2HN2 A;  3AE9 A;  4V1A v;  2V6Y A;  4ZZB A;  2YVJ A;  4G9K A;  1I94 T;  4EQR A;  1T7S A;  2Q9Q D;  4K8D A;  3FIM B;  5J2T E;  1N36 T;  2VUR A;  2PJQ A;  3EVY A;  4ICY A;  3JSK A;  1T72 A;  2OA5 A;  1D4C A;  3KDS E;  3V3O A;  2XLP A;  5C2T A;  3LG7 A;  4JNQ A;  3T2Z A;  5LBQ B;  3G5S A;  1L9C A;  3AAE B;  3URH A;  5HXE A;  3N9O A;  1BWC A;  3DK8 A;  3C4N A;  1K4Q A;  2J62 A;  2YDR A;  1R8I A;  3DK9 A;  2IC6 A;  2LLY A;  1MMG A;  1L9E A;  3CQX C;  1QUU A;  1OED B;  2LSG A;  4MLK A;  2XVJ A;  4JYA T;  3RI5 A;  1Y56 A;  4QH1 A;  5LBM A;  1XPQ A;  1HXS 4;  5F5W A;  4YT0 A;  4OHF A;  1BZL A;  4G2A A;  3HYX A;  4ZI3 C;  2XQY A;  1K5M D;  3RC8 A;  2Q9Q A;  5LHH B;  5DQV A;  1VG9 A;  2GEW A;  3ZYX A;  3AD8 B;  4DNA A;  2YG5 A;  1NEN A;  3AB1 A;  3B57 A;  1PBF A;  4BA9 A;  4B3S T;  4Q25 A;  1GTE A;  3RH3 A;  2BDE A;  2BC0 A;  2V7K A;  4C90 A;  4ZS3 A;  3PDY A;  5TAO A;  2VKJ A;  4XXG A;  4ZCD A;  2WMO A;  3RF1 A;  1B37 A;  3LBX A;  5FNV E;  3KV6 A;  2VVN A;  4HFB A;  2MYS A;  3FPZ A;  3UKL A;  3AEA A;  2V26 A;  4AKL A;  4KPR A;  4QXB B;  2TMD A;  1EL5 A;  4UF0 A;  5EB4 A;  2YLS A;  1NHQ A;  3ICT A;  5L4H A;  4CXX A;  1ZOY A;  4U3C A;  1RUF 4;  4NTC A;  3SXI A;  2CWO A;  4GAV A;  2MTQ A;  5EZY E;  2C66 A;  3AEC A;  1O3X A;  2E2A A;  3PV0 F;  5F3J A;  3AXB A;  3QSE A;  2X5I D;  3F8R A;  1RMU 4;  2TPR A;  3CX7 B;  4I55 E;  5HYM A;  1YQ3 A;  1RVF 4;  1WCR A;  3KVB A;  4AT0 A;  1ZK7 A;  5H6R B;  4KX6 A;  2ZMA A;  3OKQ A;  4UXN B;  3ZMU B;  2WAU A;  1MMA A;  2Y6Q A;  4EIP A;  2RP4 A;  4COF A;  2WDR A;  3AXJ A;  4OYJ A;  5LCY A;  1GEU A;  4ILC A;  1G73 A;  1QJD A;  5LV9 A;  2VQE T;  1LQT A;  1FCD A;  2GVC A;  2GB0 A;  3UP5 A;  1PO2 4;  3FBZ A;  3UKQ A;  4NUU A;  3KPF A;  3LOV A;  3OYZ A;  2UXN B;  2BG9 E;  1VCS A;  1W0A A;  3M12 A;  2BRA A;  3E08 A;  4IVM B;  2NW9 A;  3NLC A;  2DI4 A;  4CN4 A;  4YSZ A;  3I0Q A;  5FY7 A;  4UDR A;  4BJN A;  1CJC A;  4EQX A;  4NEW A;  1VG0 A;  4G6G A;  2WS3 A;  3GMI A;  2VQ7 A;  4LFC T;  1HTJ F;  4OPD A;  5FY0 A;  4O5U A;  2KMF A;  5HHF A;  3DP7 A;  1DJN A;  3LBX B;  4YSH A;  3ALJ A;  1RUH 4;  2P9B A;  3WAK A;  1BR0 A;  1XI1 A;  1P2E A;  3UP4 A;  5JDN A;  4Q4V 4;  3VRA A;  3FMW A;  1VDC A;  1ZDL A;  3UU4 A;  2V8S V;  3ADA B;  2AAQ A;  3PUY F;  1W9R A;  2YVG A;  1N4W A;  2XQ8 A;  5CGM A;  2AE9 A;  5AQV B;  2VB6 A;  1WFD A;  4NXN T;  2YG3 A;  4H4Y A;  2PYJ A;  2OLN A;  3V76 A;  4KBM B;  5AQH B;  4N78 D;  5LGU B;  3SYI A;  4Z2T A;  1H7W A;  5U63 A;  3C96 A;  4JI4 T;  3ONX A;  3JBG 4;  2ZLY A;  1PXC A;  4IA5 A;  4YHJ A;  4GKJ T;  1WLX A;  2N2N A;  1LTX R;  2ZZC A;  4JDR A;  1F8W A;  2UUB T;  3GRS A;  2K5B B;  3UKA A;  5BMV E;  2E1M A;  4HFV A;  5LHG B;  4BV6 A;  1JNZ A;  4JLE A;  3ZYL A;  2WB5 A;  3FBL A;  2BBH A;  2BG9 A;  1H83 A;  4B63 A;  3VHL A;  2YVF A;  4DR2 T;  3P9U A;  5EBK A;  3KLJ A;  4U7Y A;  3AXJ B;  1S3E A;  4YHH T;  3IHM A;  5FS7 A;  2A9U A;  1HNW T;  3H8L A;  2XM2 A;  4UDQ A;  3ZN1 B;  4IA6 A;  5HEG A;  1S35 A;  4FJO A;  1GTH A;  2GR2 A;  3H8I A;  4APN A;  3IEE A;  2C70 A;  4JNA A;  2D9D A;  4A79 A;  1EL7 A;  1S3B A;  3GDP A;  1N34 T;  3D1C A;  2KND A;  2O9Z A;  4JI8 T;  4TM3 A;  3V3N A;  5FS9 A;  4F6R C;  3PTR B;  3N9N A;  3SY4 A;  5BVA A;  3UTE A;  2R45 A;  2Q0L A;  2NW7 A;  2OAM A;  4OPL A;  4U8J A;  4ZI2 C;  4XAX B;  2QVA A;  3LFM A;  4TZ4 C;  1H82 A;  5JR9 B;  4X9M A;  4H4Z A;  4H4T A;  3NTA A;  2LM9 A;  3HA4 A;  1SHZ C;  3ZCJ A;  4CI1 B;  3UOX A;  2CLY B;  3T2K A;  3KD9 A;  4QH5 A;  5HYA A;  5IHY A;  4UVB B;  1CJ2 A;  2M6B A;  4X65 T;  3K7T A;  1F6M A;  3ISH A;  4A99 A;  3N2G E;  4I4T E;  1GRH A;  2GF3 A;  1IUV A;  2J4G A;  5L3G B;  1MMN A;  2PG8 A;  4H50 A;  4AQY T;  2QRX A;  4IST A;  1MIV A;  3K3O A;  4CNJ A;  3LK4 2;  1LQU A;  1KSS A;  2CXL A;  3QSM A;  4C91 A;  5FVL A;  2XLS A;  3R9U A;  3HKC E;  4IDZ A;  2ZZB A;  3RQW A;  2VVS A;  3ZDN A;  4HA6 A;  3KBU A;  3P4P A;  4M52 A;  2QCU A;  1ZHC A;  1Y01 A;  4WYV A;  4Z90 A;  3CIR A;  3AEE A;  3UUX B;  4J34 A;  2CUL A;  4RSL A;  3CKD A;  2BVL A;  1PBD A;  3AYI A;  1E2A A;  3NIX A;  4A6N A;  2YQU A;  1OJA A;  4OK0 A;  2UXB T;  3RC3 A;  1W4X A;  1IJ6 A;  2IW5 B;  2W61 A;  2LKH A;  3NZP A;  5CB4 E;  3UKH A;  5KMG P;  4TLZ A;  4AKI A;  3ICR A;  1VBC 4;  2XZE A;  2L9Q A;  4TWH A;  3W15 B;  4UV8 B;  2GR1 A;  3OZ2 A;  3HZL A;  5ETW A;  4DUZ T;  2JQK A;  5AQT B;  2I0Z A;  4NUV A;  2R0P A;  4U2Z A;  1REO A;  1YY5 A;  1GXF A;  4J33 A;  2XUE A;  4ZOL E;  4HEA A;  1CJ3 A;  1NG3 A;  4CBQ A;  3EUH A;  4JI0 T;  1RUG 4;  3RLF F;  2XLU A;  3CNT A;  4DGK A;  4TWF A;  5E0O A; 
#chains in the Genus database with same CATH homology
 4O5Q A;  1DOE A;  4USR A;  3VQR A;  2GR3 A;  3K7Q X;  2APG A;  2JKC A;  4JN9 A;  2C67 A;  3RP7 A;  3BI2 A;  2OLO A;  4JY2 A;  1XAN A;  1N4V A;  3ICS A;  2GMH A;  4II3 A;  4WCT A;  4TM0 A;  2R9Z A;  3NHO X;  3P4S A;  4CCQ A;  3K30 A;  4USQ A;  5L46 A;  4BK3 A;  4FX9 A;  1KSU A;  1DJQ A;  4II2 A;  4NTD A;  1IUU A;  2Q0K A;  4NWZ A;  2XVE A;  5M0Z A;  4H4S A;  2GQW A;  3HYW A;  2VVM A;  4GRT A;  3IF9 A;  2V3B A;  5M10 A;  3UOZ A;  1IUW A;  3IHG A;  3SQP A;  4YTM A;  2WOI A;  4MJW A;  2GR0 A;  2CDU A;  2GAH B;  2BXS A;  3L8K A;  3UKF A;  4GR1 A;  2FBW A;  3GD3 A;  4BJY A;  2YLR A;  4GUV A;  3AE1 A;  4Y4M A;  2EQ7 A;  3ALL A;  4Y4N A;  2WOV A;  1ZX9 A;  1S2Q A;  5FS8 A;  2C72 A;  4GF7 A;  4EMW A;  4DSG A;  1K0I A;  3K7M X;  1DOD A;  4NZH A;  1RYI A;  5U1O A;  3BI5 A;  1HYU A;  1GES A;  1E6E A;  4RG3 A;  5KOX A;  2V60 A;  1D7L A;  3GQK A;  1O94 A;  4FK1 A;  1B8S A;  1BGN A;  3NK2 X;  4RG4 A;  1EBD A;  1Z6L A;  5IQ1 A;  5FS6 A;  1E1K A;  5KMQ A;  1IUS A;  3UTF A;  3CPH G;  3RNM A;  4AP3 A;  1FOH A;  3AE9 A;  3GYJ A;  4C77 A;  1ZP0 A;  3QFA A;  2YVJ A;  4B69 A;  4G9K A;  1NHP A;  4EQR A;  1FEB A;  4K8D A;  5EOW A;  3FIM B;  3BNM A;  1B4V A;  2B7S A;  3FG2 P;  4U8P A;  4U8L A;  4U2S A;  2XYO A;  4C74 A;  4J2W A;  4D04 A;  4Z24 A;  4A6N B;  4H2Q A;  1CC6 A;  2VQB A;  2BCG G;  4ICY A;  3UTH A;  4B68 A;  2W0H A;  4J31 A;  3JSK A;  1D4C A;  1GRG A;  2ZBW A;  3V3O A;  2XLP A;  3CNP A;  5C2T A;  1P2H A;  1IUT A;  1XDI A;  3SZC A;  4ECH A;  1O5W A;  2V5Z A;  5KVH A;  4JNQ A;  4LU6 A;  2ACZ A;  4B65 A;  2C65 A;  4AP1 A;  3SZ0 A;  4AT2 A;  3T2Z A;  3ALM A;  5KVI A;  4Z2U A;  3G5S A;  1L9C A;  4FK1 C;  3URH A;  1E1L A;  1H81 A;  3BHF A;  4J57 A;  1BWC A;  3DK8 A;  1M6I A;  1TYT A;  5KOW A;  3AEF A;  3C4N A;  3Q6J A;  1PN0 A;  5KNL A;  1CHU A;  1K4Q A;  4EMJ A;  3KPK A;  3GSI A;  3DK9 A;  1GRB A;  3AE4 A;  3DH9 A;  2WQY A;  1L9E A;  4YKG A;  3AE3 A;  1MXT A;  4A9W A;  2XVJ A;  4Z25 A;  1Y56 A;  1CJ4 A;  1XPQ A;  3NK0 X;  4Y4L A;  2NPX A;  1X31 B;  3DJG X;  2BK3 A;  4YT0 A;  1PDH A;  1PJ5 A;  2WP6 A;  3RP8 A;  1MO9 A;  3HYV A;  1BZL A;  4UDP A;  1GND A;  3GQH A;  1E1N A;  2BS3 A;  3HYX A;  2WOW A;  4AOS A;  3LZX A;  2R4J A;  4G73 A;  4K5R A;  1VG9 A;  1F8S A;  2GEW A;  3ZYX A;  3AD8 B;  3GWF A;  1KNR A;  1TDF A;  4C3X A;  4DNA A;  1JEH A;  2PHH A;  2QA2 A;  2ARD A;  2YG5 A;  3PS9 A;  5HXI A;  1NEN A;  3AB1 A;  1PBF A;  4OVI A;  2JB1 A;  2X8G A;  5JCI A;  1GTE A;  1DNC A;  3T31 A;  2BC0 A;  3DGZ A;  3DA1 A;  4D03 A;  3EAO A;  5J60 A;  3KKJ A;  2WP9 A;  4CRT A;  2Q6U A;  4XXG A;  4ZCD A;  2E5V A;  1PBC A;  1EL8 A;  1B37 A;  1GPE A;  1YKJ A;  3AD7 B;  2OAL A;  3ATQ A;  5HY5 A;  1ZMD A;  3FPZ A;  4YTP A;  3UKL A;  1GRE A;  3AEA A;  2GH5 A;  2JB2 A;  3COX A;  3M13 A;  3QSS A;  4KPR A;  3NYC A;  3ITJ A;  2TMD A;  2GMJ A;  3CN8 A;  1EL5 A;  3CGE A;  3EF6 A;  2B9X A;  4TM1 A;  1VRQ B;  4A65 A;  2QAE A;  2R46 A;  5EB4 A;  3NNE A;  3OC4 A;  4U8O A;  2YLS A;  2BA9 A;  1NHQ A;  3UKK A;  2CFY A;  2AR8 A;  3ICT A;  2WDQ A;  3NT6 A;  3I6D A;  4CCR A;  1ZOY A;  3NYE A;  4NTC A;  2XLT A;  3SXI A;  4GAV A;  4YTN A;  1QLB A;  1Y0P A;  2YWL A;  3Q9T A;  4CY6 A;  2C66 A;  2V6O A;  4EQS A;  3CGD A;  3AEC A;  1JOA A;  1PBB A;  2YM2 A;  4GDE A;  1E39 A;  2UZZ A;  3AXB A;  1NHR A;  2XFN A;  1RP0 A;  3F8P A;  3QSE A;  2JB3 A;  3F8R A;  2IVE A;  2TPR A;  3AE2 A;  5HYM A;  1YQ3 A;  2A87 A;  2XFQ A;  1Q1R A;  5C3J A;  3I3L A;  4IV9 A;  2H89 A;  3P4R A;  4AT0 A;  1ZK7 A;  4A5L A;  4KX6 A;  1NAA A;  1F3P A;  4H4X A;  2WP5 A;  2FJD A;  4B67 A;  2WU5 A;  1RSG A;  3GRT A;  1EL9 A;  3NH3 X;  4DSH A;  3SZF A;  5CQF A;  5BRT A;  4X9N A;  4CY8 A;  3QFB A;  2BAB A;  3ABV A;  2XFU A;  2X8C A;  2Y6Q A;  2YR4 A;  3F8D A;  3GDN A;  4YWO A;  4EIP A;  4EM3 A;  2NVK X;  2IVD A;  2VRM A;  2WDR A;  2DKH A;  4C3Y A;  2FJE A;  2GV8 A;  1GEU A;  2XDO A;  1DOC A;  2VOU A;  3NYF A;  3SZW A;  1GV4 A;  1FL2 A;  1QJD A;  4ZCC A;  3SFE A;  4BJZ A;  5LV9 A;  1LQT A;  1FCD A;  1JRX A;  2XFP A;  2GVC A;  2GB0 A;  4HB9 A;  4REK A;  4YKF A;  4LII A;  3NN6 X;  2R0G A;  3AEG A;  3CNS A;  3NRN A;  3UP5 A;  1D4D A;  5KXJ A;  1ONF A;  3UKQ A;  4H7U A;  2WPE A;  3SUC A;  2EQ8 A;  5KMS A;  3KPF A;  2V3A A;  3LOV A;  3SGL A;  4ZN0 A;  1GRF A;  1OJC A;  2RGH A;  5EB5 A;  4EM4 A;  2VRL A;  3DJE A;  3NKS A;  5BUK A;  3M12 A;  3VR8 A;  2BRA A;  4H4P A;  4C5O A;  1GT8 A;  2WEU A;  4U8M A;  4EQW A;  4IVM B;  3NLC A;  4P9S A;  5DBJ A;  4YSZ A;  4G6H A;  2BS4 A;  4J56 A;  3QVP A;  4UDR A;  2VVL G;  1CJC A;  4EQX A;  1TRB A;  1VG0 A;  4NEW A;  4G6G A;  5KMR A;  1CBO A;  2WS3 A;  1D7Y A;  2BAC A;  5KMP A;  2VQ7 A;  2YR5 A;  2C64 A;  4OPD A;  3AD9 B;  4U8I A;  4B66 A;  1LVL A;  2YLT A;  1VQW A;  1M64 A;  1B5Q A;  1SEZ A;  2JBV A;  4O5U A;  5HHF A;  4CNK A;  1DJN A;  2B7R A;  5IQ4 A;  4YSH A;  3ALJ A;  1PS9 A;  1AOG A;  4Z44 A;  1BKW A;  5JCM A;  3GD4 A;  2BXR A;  1P2E A;  3AWI A;  3UP4 A;  3VRA A;  3FMW A;  1VDC A;  1ZDL A;  4OPT A;  1E1M A;  1KFY A;  3ADA B;  2AAQ A;  2RGO A;  3CPI G;  2YVG A;  3RED A;  3VR9 A;  1N4W A;  2YR6 A;  3NK1 X;  4E0V A;  4YXD A;  1GET A;  3EAN A;  2JAE A;  2XVI A;  1ZOV A;  3NTD A;  2YG3 A;  4H4Y A;  4YSX A;  1NDA A;  4B1B A;  2OLN A;  3V76 A;  3AE8 A;  1DXL A;  3M0O A;  4XWR A;  2IID A;  2WES A;  2C76 A;  5TR3 A;  1IJH A;  2B9W A;  1H7W A;  2BK4 A;  3CGB A;  5U63 A;  3C96 A;  3SYI A;  4Z2T A;  2QA1 A;  2FJB A;  4H4U A;  1Q1W A;  1PXC A;  4IA5 A;  3AYL A;  1CF3 A;  4UP3 A;  2Q7V A;  2JK6 A;  2YAU A;  3G5Q A;  4OPU A;  3VRD B;  3P1W A;  1ZKQ A;  1FEC A;  1K0L A;  2WBA A;  3QVR A;  2WHD A;  1LTX R;  1GRT A;  1JRZ A;  1NPX A;  1YQ4 A;  1F8W A;  1NHS A;  2ZZC A;  2Z5Y A;  3GRS A;  4JDR A;  4K22 A;  3UKA A;  1F8R A;  1GOS A;  2E1M A;  3LJP A;  4BV6 A;  5GRT A;  1JNZ A;  2YM1 A;  2CVJ A;  4U8K A;  3LZW A;  3DK4 A;  3AYJ A;  1H83 A;  1PJ6 A;  2PYX A;  3KVE A;  4B63 A;  3BI4 A;  2YVF A;  2BK5 A;  2C7G A;  3GWD A;  3P9U A;  5EBK A;  3KLJ A;  3CNJ A;  1BGJ A;  1S3E A;  2WET A;  4U8N A;  3CGC A;  2YG4 A;  3IHM A;  4H4Q A;  2X3N A;  5FS7 A;  4NEV A;  3BNU A;  2WU2 A;  3SX6 A;  1OJT A;  1OJD A;  3PO7 A;  3H8L A;  4UDQ A;  1COY A;  4I58 A;  4IA6 A;  5ER0 A;  2X8H A;  4B64 A;  2BYB A;  3E1T A;  5JCL A;  2BC1 A;  2Z5X A;  4GDP A;  2H88 A;  3UOY A;  2YG7 A;  2B76 A;  1GTH A;  2HQM A;  2GR2 A;  2XFO A;  3H8I A;  3T37 A;  1PXA A;  3S5W A;  4OPG A;  1K0J A;  2EQ9 A;  4Z2R A;  1MOK A;  3FBS A;  4APN A;  2C70 A;  4JNA A;  1N4U A;  3WE0 A;  4A79 A;  5IPY A;  4TM4 A;  1EL7 A;  1S3B A;  2XVH A;  3GDP A;  4FDC B;  3LXD A;  3IC9 A;  1KNP A;  2C3C A;  3CPJ G;  2GRT A;  4U2T A;  3D1C A;  2O9Z A;  4GCM A;  1NG4 A;  4BK2 A;  1E7P A;  3B6D A;  4TM3 A;  5FS9 A;  3V3N A;  5BUL A;  4OCG A;  3SY4 A;  1PXB A;  5BVA A;  5U25 A;  1TDN A;  1D4E A;  1OJ9 A;  2R45 A;  2Q0L A;  3UTE A;  1JU2 A;  2OAM A;  4OPL A;  4U8J A;  3CMM A;  3T0K A;  1IUX A;  3SM8 A;  4K5S A;  1H82 A;  1KF6 A;  1BF3 A;  3DME A;  4H4Z A;  4X9M A;  2XLR A;  2OA1 A;  1S2Y A;  4H4T A;  3NTA A;  1N1P A;  2ZZ0 A;  1Y56 B;  1GER A;  3UOX A;  2R0C A;  1QO8 A;  3II4 A;  3DJD A;  3D8X A;  1L0V A;  2YLW A;  5KWF A;  3T2K A;  1H7X A;  3KD9 A;  1TDK A;  3UCL A;  3L1R A;  1CJ2 A;  4X4J A;  3K7T A;  1F6M A;  3ISH A;  4TLX A;  4A99 A;  3BHK A;  1L9D A;  2R4E A;  5JCN A;  2C75 A;  3UKP A;  4WX1 A;  1GRH A;  3G5R A;  2GF3 A;  2A8X A;  1IUV A;  3S61 A;  3AE7 A;  3B3R A;  5JCK A;  4K7Z A;  2GAG B;  4A7A A;  2C4C A;  2RAB A;  1CC2 A;  3RHA A;  1GAL A;  1V59 A;  4H50 A;  3QJ4 A;  4OPI A;  3AE6 A;  2XVF A;  3IWA A;  2AQJ A;  5J7X A;  2J3N A;  1H6V A;  4H2P A;  2C3D A;  1TYP A;  4U2L A;  1H86 A;  3P4Q A;  2BS2 A;  4H2N A;  3VRB A;  1LJ1 A;  4N9X A;  4CNJ A;  4PAA A;  4YSY A;  4H2R A;  4LA1 A;  1JNR A;  1LQU A;  1KSS A;  2GQF A;  3QSM A;  4J36 A;  1LPF A;  2XLS A;  2RGJ A;  4OPC A;  3R9U A;  1H84 A;  2C73 A;  3GMC A;  1Q9I A;  3NN0 X;  3DJJ A;  2ZZB A;  4NNJ A;  5FMH A;  4AOX A;  2YLZ A;  3EPT A;  5KRQ A;  2VZ2 A;  3GYX A;  5CKU A;  3AE5 A;  1D5T A;  3AED A;  3ZDN A;  1DOB A;  1ZMC A;  2A89 A;  1FEA A;  2V61 A;  4EIQ A;  3GMB A;  4HA6 A;  1GSN A;  4IVO B;  3P4P A;  3KA7 A;  3LB8 A;  4M52 A;  2QCU A;  2YLX A;  4BK1 A;  4NTE A;  1KDG A;  3CIR A;  3KU9 A;  4H4V A;  2BCP A;  2XCG A;  2WDV A;  3RP6 A;  3AEE A;  3T2Y A;  1CC4 A;  4J34 A;  4EMI A;  2LFC A;  3SFD A;  3LAD A;  2WPF A;  2CUL A;  4RSL A;  3H4K A;  1PBD A;  3AYI A;  1TDO A;  4Z43 A;  3NIX A;  4A6N A;  2YQU A;  1OJA A;  4I59 A;  2VVL A;  4BUR A;  1W4X A;  3O0H A;  3PVC A;  2EQ6 A;  2X99 A;  3AEB A;  3UOV A;  1TDE A;  3UTG A;  4Z26 A;  1O95 A;  4XWZ A;  1CL0 A;  1PHH A;  1PBE A;  3GYI A;  4TLZ A;  3C4A A;  4JY3 A;  3UKH A;  1LV0 A;  3ICR A;  3ATR A;  4G74 A;  2YG6 A;  3NG7 X;  2FJA A;  1YQZ A;  1UKV G;  2B9Y A;  2DKI A;  2WPC A;  2GR1 A;  3OZ2 A;  3CTY A;  3HZL A;  4ADW A;  2I0Z A;  3CND A;  4H4W A;  2R0P A;  1REO A;  1YY5 A;  4GAP A;  1GXF A;  1PJ7 A;  4J33 A;  1GRA A;  2X50 A;  2Y6R A;  3T14 A;  4JQ9 A;  2F5Z A;  2BRY A;  4PAB A;  1CJ3 A;  1NG3 A;  1ELI A;  1JRY A;  3DGH A;  3NGC X;  4CBQ A;  1XHC A;  1ZY8 A;  2E4G A;  4H4R A;  5GSN A;  2XLU A;  3CNT A;  4DGK A;  1NEK A;  4K2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...