4YSXA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with the specific inhibitor nn23
Total Genus 225
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
225
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 225
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ysxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ysxA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ysxA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ysxA04
1PJ5A 1YKJA 4TLXA 4X9MA 2BK3A 3VQRA 1MO9A 1OJAA 1PJ6A 4IVOB 1O5WA 2YR6A 3DMEA 1VQWA 5JCKA 4FDCB 1BGJA 1H82A 3RHAA 1FCDA 1EL7A 2IVEA 1JRYA 2C75A 1DXLA 2AR8A 3IHGA 1EL8A 1AOGA 2YG4A 2BXRA 1GRBA 3UKLA 1NEKA 4KX6A 4N9XA 1MOKA 1H6VA 3HZLA 2ARDA 5EB5A 2YQUA 3OC4A 4J33A 3K7TA 1NHRA 1CF3A 1H83A 2BK4A 4B69A 2W0HA 2YLZA 1Q1WA 1Y0PA 4GDPA 4ADWA 1TDEA 4C5OA 3LB8A 3NIXA 1KSSA 4IA6A 1PN0A 3CNJA 5GSNA 2RABA 4I59A 2BXSA 1S3EA 1CC4A 3FMWA 2WP6A 3NH3X 3OZ2A 4K22A 1W4XA 3DK8A 1KFYA 1CJ4A 3UKPA 2OLOA 2XFQA 4CNKA 4RSLA 4CCRA 5KVHA 1GT8A 2GH5A 3AD8B 1O95A 1EL9A 2C76A 1GRAA 4A65A 2Q6UA 4BJZA 2FJAA 3GYIA 5KVIA 3UOYA 2IIDA 1L0VA 2YLWA 4PABA 2XLRA 3NGCX 1V59A 3PO7A 1GSNA 4YSHA 2XVHA 2R46A 4XWZA 4AT0A 2WPCA 4B65A 3CPJG 3BHFA 1H86A 3NYFA 4EQSA 1K4QA 1PBBA 2O9ZA 3B6DA 2YAUA 5EBKA 3QFBA 2JKCA 4K5SA 1COYA 3E1TA 1JRZA 3NK2X 3L8KA 4U2SA 3R9UA 2V61A 3NTAA 4Y4LA 3V3NA 2VOUA 4BJYA 3GMCA 3M13A 4OCGA 1PJ7A 1JNZA 1GTEA 4OPUA 1TRBA 1MXTA 3CGEA 4B68A 4OPLA 3EPTA 2WDQA 3II4A 4O5QA 2BS2A 1BWCA 1DJQA 1F6MA 1ZDLA 2WPFA 4NTDA 4OPCA 3FBSA 1H84A 4XWRA 3K7QX 4H4XA 4CRTA 1PDHA 1IJHA 1BKWA 5HXIA 3NN6X 4HB9A 4U8OA 3ADAB 5EOWA 1NDAA 4AOXA 2BK5A 4ECHA 2VZ2A 2V3BA 3PVCA 2I0ZA 4H4WA 2E4GA 1F3PA 3VRAA 3DJGX 4BURA 2XFUA 4YXDA 1CJCA 1XPQA 3ALJA 4WX1A 3AE5A 4EM3A 3AXBA 4GUVA 1K0IA 3CIRA 2R0GA 2EQ6A 3D8XA 1LJ1A 2GMHA 3GWDA 4B63A 1E1NA 2GAGB 5FS7A 4BK1A 2R45A 4HA6A 1GERA 4KPRA 2BA9A 2V5ZA 1ELIA 3AWIA 4U8KA 1PHHA 2GRTA 4FK1C 2GV8A 3UP4A 3BNUA 2YWLA 4ZCCA 1RSGA 4RG3A 4X9NA 1YY5A 4B1BA 4Y4NA 3GQHA 1FL2A 1S3BA 2BACA 3ZYXA 1PBEA 4H4VA 3UCLA 2XLSA 2WDVA 5C2TA 3G5RA 4USRA 5M10A 3RP8A 1NENA 2YVFA 1YQ4A 3KD9A 1TYPA 1KNRA 2C70A 3G5SA 3GDNA 3NLCA 1QLBA 1XHCA 4EM4A 5CQFA 4H4YA 5JCLA 3GMBA 2WP5A 2B9WA 3ISHA 4ZCDA 2GAHB 4NTCA 4MJWA 2WDRA 4YWOA 4J57A 1N4UA 2YG6A 3NG7X 1LV0A 2WP9A 2V6OA 1P2EA 1YQ3A 3FIMB 2GQWA 3AE9A 4OPTA 4EMWA 1NHPA 2BC1A 4K8DA 2C66A 1ZY8A 5IQ4A 1D4DA 1D7YA 1K0JA 2XLUA 3CGDA 3M0OA 2WBAA 4NEWA 2YG5A 4YTPA 4K7ZA 1GV4A 3AE7A 4TLZA 4LIIA 1JU2A 1RYIA 4TM4A 4WCTA 3P1WA 3AE2A 3P9UA 4J31A 4C3XA 1IUWA 3EANA 2XVEA 1BGNA 3T37A 4H2RA 4NEVA 4YKFA 3CGCA 2WOVA 2QCUA 2CDUA 2BCPA 3M12A 1BF3A 1D5TA 2C72A 2XFNA 2ZBWA 4Z43A 4Z2TA 1QO8A 5KOXA 1OJCA 3UOZA 3CPHG 2V60A 4AP3A 3QJ4A 4X4JA 3DK9A 5FS8A 4EQWA 3AEFA 2YLSA 5LV9A 2RGJA 1H7XA 3SGLA 2GR1A 3Q9TA 2TMDA 2WESA 3BNMA 3UKHA 2X8HA 4ICYA 4EMIA 3F8PA 3LZWA 4H2PA 4YTNA 4NTEA 4Z2UA 1LTXR 4C77A 1KF6A 3QSEA 2EQ9A 3CNTA 4A99A 2R0PA 3G5QA 1JOAA 3LZXA 1H7WA 2QA1A 5FMHA 1E1KA 3ICTA 3QVPA 2RGHA 2B7RA 2XVFA 1GALA 2J3NA 4U8PA 1XANA 3UOXA 1CL0A 3GD4A 4C74A 4H50A 5BULA 3AE4A 5IPYA 5CKUA 4GR1A 3RNMA 4B66A 1M6IA 3ATQA 1K0LA 2APGA 2YLRA 2IVDA 4U8IA 1XDIA 3QFAA 4TM1A 4OPGA 3AEEA 2BYBA 5GRTA 3DGHA 3SUCA 1TDNA 2FJEA 3UTHA 4U8JA 3AD9B 1GNDA 2YG7A 2YVJA 3H8IA 3AYIA 4Z2RA 1F8RA 2OA1A 1DJNA 2R9ZA 4OPIA 2Y6RA 4J56A 4A6NB 5DBJA 2QAEA 3FPZA 3AE8A 3DH9A 3NK0X 4GF7A 3UOVA 3AE1A 1GRGA 1TDKA 2A87A 2VVLA 2XLPA 3B3RA 2TPRA 2WQYA 2Q0KA 3FG2P 3VR9A 3LOVA 4DSGA 2ACZA 1OJTA 2B9YA 1BZLA 2Q7VA 4H4ZA 5U25A 1GETA 4I58A 2H89A 2PHHA 2GQFA 2XVJA 1FEAA 3DGZA 1S2YA 3NNEA 5FS6A 4EQXA 1FOHA 1GESA 2B9XA 4OPDA 3AEAA 1GRHA 3SQPA 3C4NA 1TYTA 2X8CA 4H4UA 1Y56A 3K30A 1F8SA 3I6DA 3P4SA 1PBFA 4EIPA 1B37A 3AEDA 3UKQA 1P2HA 3SFEA 1IUXA 4BV6A 3P4PA 1OJ9A 3GYJA 2X3NA 1OJDA 3NHOX 3GYXA 4GDEA 4OVIA 4E0VA 1JNRA 3AE6A 3KPFA 4ZN0A 3GQKA 1LQUA 2C65A 4A9WA 5JCMA 1L9DA 1ZX9A 4IVMB 3AEGA 2JAEA 3EAOA 3QSMA 2FJDA 2GR0A 4AT2A 3IHMA 3QVRA 1DNCA 1REOA 1S2QA 3LJPA 4JY3A 4TM3A 1H81A 4PAAA 4APNA 3GRSA 2Y6QA 3GD3A 3BI2A 3KKJA 2ZZCA 3CN8A 4D03A 1F8WA 3D1CA 3GDPA 1E7PA 3REDA 1E1MA 5M0ZA 4YSZA 3K7MX 1O94A 1N4VA 1ONFA 3AYLA 1DODA 1JRXA 1KSUA 1L9CA 2C7GA 3ITJA 3L1RA 3DK4A 1IUTA 2NVKX 3H4KA 4A79A 3GSIA 1FEBA 2GEWA 2YLXA 2A8XA 2XFPA 2FJBA 3ALMA 2WU5A 1TDFA 2WEUA 3CNSA 4USQA 4XXGA 2UZZA 1HYUA 3UTGA 3BI4A 2R4EA 1NPXA 2CFYA 3UP5A 1B8SA 3IWAA 2BABA 4RG4A 3LXDA 2XDOA 4IV9A 4A5LA 2B7SA 4UP3A 5U63A 4YSYA 1PBDA 4AP1A 3NYEA 1NG4A 2WETA 2ZZ0A 2H88A 1JEHA 2GF3A 4U8LA 2BCGG 4JN9A 3ABVA 2WPEA 2E5VA 1PS9A 1EBDA 2CVJA 3S61A 2WS3A 5KWFA 2A89A 2QA2A 2JBVA 3Q6JA 4BK2A 1D4CA 4LA1A 1KDGA 3C4AA 4BK3A 1PBCA 3DA1A 4CCQA 1GOSA 2FBWA 3KVEA 4JDRA 1LQTA 5FS9A 4REKA 5HY5A 2DKHA 1X31B 2F5ZA 4TM0A 2C64A 1M64A 4B64A 1GXFA 2Z5XA 2YM2A 1CJ2A 3UKAA 2C67A 4YTMA 3I3LA 5BUKA 2NPXA 2B76A 3GRTA 2Z5YA 1ZOYA 2GVCA 4IA5A 1DOCA 2RGOA 2E1MA 2WOIA 4U2TA 1RP0A 4DNAA 1CC2A 2OALA 2V3AA 4YSXA 1GTHA 2GR3A 1ZMDA 5J7XA 3V76A 3UTFA 2XLTA 4EMJA 3ICSA 3F8RA 2XVIA 4DSHA 3IC9A 1CC6A 2PYXA 1DOBA 1N4WA 2X50A 1Z6LA 3IF9A 4GCMA 2YR4A 3P4RA 2VQBA 3P4QA 2R0CA 2JB3A 2XYOA 1GEUA 4UDPA 2JB2A 3AB1A 3CPIG 3NN0X 4H4SA 5BRTA 5J60A 4K2XA 1NHQA 2CULA 4U2LA 2LFCA 5L46A 3VRDB 2OLNA 2EQ7A 1ZP0A 1VDCA 3UKFA 4A6NA 3ICRA 5HYMA 2WU2A 5EB4A 4J34A 5HHFA 3KLJA 3CTYA 3AD7B 4H4TA 4JNAA 4Z25A 1VRQB 4H2NA 2DKIA 3NYCA 2GB0A 2C73A 4H4PA 1GRFA 2EQ8A 1IUSA 3NK1X 1GRTA 1PXAA 2Q0LA 1YQZA 3PS9A 1DOEA 1TDOA 3DJJA 1VG0A 3WE0A 3AE3A 1N1PA 1B5QA 2C3DA 3EF6A 4YT0A 5KRQA 2YVGA 3O0HA 3RP7A 2AAQA 2VVLG 1QJDA 4JQ9A 3H8LA 3JSKA 1NG3A 1ZMCA 3AECA 1LVLA 4AOSA 4J36A 2BS3A 3NKSA 1CHUA 4A7AA 1ZKQA 1IUVA 4O5UA 4Z44A 3UTEA 2VVMA 3S5WA 1PXBA 2GR2A 2WHDA 4CBQA 1PXCA 3DJDA 3V3OA 1GPEA 4H4RA 4FK1A 3URHA 2VRMA 3NT6A 3AEBA 4J2WA 4D04A 2YLTA 4UDRA 4Y4MA 5BVAA 1UKVG 3CGBA 3CNPA 4M52A 4Z24A 4B67A 1GREA 3GWFA 4YKGA 2BS4A 1D7LA 3DJEA 1VG9A 1ZK7A 2OAMA 1Q1RA 5JCIA 2YR5A 2VQ7A 2XCGA 4NZHA 5ER0A 2AQJA 1E39A 1IUUA 5KOWA 2R4JA 3QSSA 2YM1A 4UDQA 1SEZA 3ALLA 5TR3A 4EQRA 4LU6A 1CJ3A 2XFOA 3KA7A 4FX9A 4JNQA 4JY2A 4U8MA 1NHSA 1EL5A 2YG3A 4C3YA 3VRBA 4CY6A 1E6EA 3F8DA 4U8NA 2ZZBA 3C96A 2C3CA 2BC0A 3VR8A 4CY8A 2VRLA 5U1OA 2JK6A 1L9EA 4H2QA 2GMJA 3UKKA 3BI5A 3SFDA 4H7UA 2WOWA 3ZDNA 5C3JA 5KXJA 4K5RA 3NTDA 4Z26A 2X8GA 1CBOA 1D4EA 1KNPA 1FECA 3LADA 3BHKA 1B4VA 3RP6A 3SM8A 3CNDA 4EIQA 1Q9IA 1NAAA 3ATRA 2JB1A 5JCNA 4P9SA 3NRNA 1LPFA 1ZOVA 3KU9A 4H4QA 4DGKA 4GRTA 2HQMA 1E1LA 1Y56B 3COXA 3AYJA 5IQ1A 4CNJA 2X99A
chains in the Genus database with same CATH superfamily
1YKJA 3VQRA 4TLXA 3AA6B 3TLTA 2YR6A 2CA5A 4CN1A 3LBXA 1H82A 1HR0T 4HFVA 2IVEA 1EL7A 5DABA 1R094 2VWAA 1EL8A 1PIV4 5LCYA 1GRBA 2PG8A 1IBMT 5AQNB 1US7B 2WM9A 4U72A 4X1YE 5EB5A 5JDHA 2NW9A 2YQUA 3K7TA 5JDMA 2L3LA 5LG3A 4JI7T 1Y0PA 4GDPA 4ADWA 3EABA 1SA0E 1Y64B 1KSSA 4QH5A 2VK9A 4X65T 2HHHT 4TV8E 3CQXC 1CC4A 3OYZA 4CNKA 2XFQA 1E2AA 3W15B 4RSLA 2DLRA 5CA0E 4L0RA 1O95A 1RUE4 1GRAA 4X64T 5L3EB 3PUVF 5KVIA 3UOYA 2JQKA 2IIDA 5LMUT 2BRAA 2F4VT 4O8SA 1CUNA 4A98A 3PO7A 4AQFA 1ZHCA 2XVHA 4XWZA 3CPJG 3BHFA 2YAUA 3QFBA 2XQYA 1COYA 3E1TA 2KMFA 5EZYE 4GAVA 1GTEA 4NUUA 4X20E 4O4IE 5JR9C 2Q9QC 2MYSA 3CGEA 2JMHA 2WDQA 4O5QA 1DJQA 2WPFA 1ZDLA 4NTDA 4OPCA 4CXWA 2IW5B 1H84A 3K7QX 4XWRA 4OX9T 1PDHA 1IJHA 4L5GA 2VKOA 1W9RA 4DO0A 4N78D 5AQHB 2L9QA 2V3BA 3PVCA 5A1LA 2I0ZA 4H63H 3DJGX 2JJ9A 3UU5A 3QC9A 5HEGA 4WX1A 4EM3A 3K8PC 3AXBA 4GUVA 3ZYKA 2R0GA 2XQ6A 1E1NA 3UUNA 4HN9A 2M6IA 2ZM8A 3AVRA 4TWFA 2BA9A 3LFMA 1ELIA 1PHHA 2GRTA 4HFBA 1M62A 3UP4A 2XQ4A 3BNUA 3QOFA 4X9NA 1YY5A 3ZMUB 5J2UE 2J62A 1FL2A 1S3BA 2BACA 1PBEA 4KHPT 5C2TA 4USRA 2XSAA 3O9XA 1NENA 2YVFA 2LOSA 1YQ4A 2XPKA 1KNRA 2C70A 4ERRA 3DP7A 2VB6A 1XHCA 1OEDB 2BKOA 2B9WA 3ISHA 2GAHB 3NG7X 3NKZA 2WP9A 2V6OA 5JREA 4OPTA 3AE9A 4WW0A 3SXIA 4EMWA 1NHPA 2MOZA 2BC1A 1XI1A 5IUXA 3T31A 3RC3A 4DR5T 4II3A 2WBAA 3QUJA 2YG5A 2XAFB 1GV4A 4TLZA 1JU2A 5ABEA 4HFHA 3P1WA 3P9UA 4J31A 1IAPA 4EXTA 4ZEYA 1HNXT 2WWVA 1BGNA 1RUJ4 2RMU4 5LB7B 2WCAA 4NEVA 3KV6A 2BCPA 3T8OA 1HS7A 1BF3A 3M12A 4Z2TA 1MIVA 3MACA 1OJCA 3CK6A 3LDQB 3GWHA 4X62T 3O1JA 5FS8A 2YLSA 4DV1T 5LJNA 2TMDA 4ICYA 2QGSA 4EZHA 2KT9A 4H2PA 4NTEA 2AXDS 4IDZA 5KMSA 4I55E 2EQ9A 2EHOC 2CHNA 5FMHA 4QXHB 4IDQA 3QVPA 3SX6A 2XVFA 1GALA 4U8PA 2XM1A 5BULA 3AE4A 4GR1A 2WMOA 3RNMA 2A3DA 3LJCA 4QKNA 4TM1A 2BYBA 5GRTA 3UTHA 1IZNB 4U8JA 3E08A 2YVJA 3AYIA 4IE6A 4OPIA 1NWMX 2V7LA 2BRYA 4GF7A 4H9RC 2EHOA 3UOVA 3AE1A 1TDKA 3B3RA 5LHGB 2WQYA 2TPRA 1FJGT 1RUI4 4KP3C 3LOVA 4DSGA 1XNQT 2B9YA 2Q7VA 3ZCJA 2JQ9A 3CQCB 2XVJA 1FEAA 1B7TA 1YXRA 1FOHA 1GESA 1TYTA 3SWHA 4G74A 3K30A 2IHR1 3F57A 4EIPA 1MNEA 3KFWX 3EUHA 3ZC1A 1T8BA 2YK0A 3RGLA 5LJMA 1OJ9A 3NHOX 1OJDA 4GDEA 2IMLA 3AE6A 2G0UA 3AA7B 2M67A 4JI0T 3RKOA 1L9DA 3KDSE 3WAKA 3SZCA 2QVAA 4QH4A 2GR0A 4IL4A 4AT2A 3IHMA 1DNCA 2YINA 3Q9DA 1REOA 3JCFA 4GKJT 5JDQA 1S2QA 3LJPA 4TM3A 2ODVA 4APNA 3BK9A 3GD3A 2BVLA 2C0SA 2OLTA 4EIWA 3KKJA 1R084 3SZ0A 3F31A 4D03A 3RYCE 3D1CA 3M3ZB 4J2CA 5M0ZA 4YSZA 2HWB4 1N4VA 2CE7A 3I9WA 5AQRB 1KSUA 2C7GA 1EV14 4K0UA 4DBRA 3DK4A 4A79A 3T2YA 3GSIA 4HWIB 3ETUA 1FEBA 2XFPA 4V1Av 1TDFA 4P1NA 4NPPA 4USQA 2WB5A 3L8RA 2ZLYA 2N1GA 5U63A 4AQFC 2WETA 1JEHA 4U8LA 2BCGG 3FHNA 2WPEA 1PS9A 4A97A 3S61A 5KWFA 4LA1A 1H7CA 2WMNA 1LQTA 3N9PA 3RYHE 5FS9A 4IE0A 3NRXA 3AAAB 4TM0A 4UF0A 1J5WA 1M64A 2X9WA 1GXFA 1IBKT 1AR74 2YM2A 1CJ2A 2C67A 4YTMA 1YKEB 3GRTA 2LLYA 4OK0A 1D4M4 1XMOT 4U2TA 2E1MA 1RP0A 1CC2A 2HH7A 3EI0A 4HWCA 2V3AA 3ONJA 5ABFB 5JDNA 3V76A 3UTFA 3ICSA 2PYXA 2X50A 1Z6LA 1RMU4 2VQBA 2R0CA 2KWHA 1N34T 1GEUA 2JB2A 3CPIG 4K2XA 2CULA 2LFCA 4EZ4A 2OLNA 2JIWA 3ICRA 4A6NA 5HYMA 5KMRA 3SOLA 4G73A 3AD7B 4Z25A 3ZPOA 2WZHA 2CRBA 2C73A 2KZ7B 4H4PA 1GRFA 3R6NA 1IUSA 5L4HA 2KWIB 1YQZA 5HCJA 3PTRB 1N1PA 3LG7A 5F5WA 2LSKA 2C3DA 3EF6A 4LMLA 4U2ZA 4YT0A 3O0HA 2IAKA 1OWAA 3JSKA 3KPKA 1CHUA 5JR9A 4CBQA 4IE4A 5LOVE 3V3OA 3V5UA 1GPEA 4DNDA 5LGNB 2V7IA 3K3NA 2LSGA 3T1HT 4J2WA 4D04A 1VCTA 5BVAA 3ZMZB 5FVLA 1GREA 4GK0E 2BS4A 2NP9A 3KV9A 1VG9A 5HXRA 5JCIA 4NZHA 4AIUA 5J2TE 1E39A 2DI4A 2R4JA 3QSSA 3CMLA 3Q5XA 1CJ3A 3ZMSB 3RYFE 3KA7A 4U8MA 2HN2A 4C3YA 3VRBA 4PNIA 5HXSA 3VR8A 5U1OA 1RUD4 3AVSA 2JK6A 4H2QA 4DMWA 2GMJA 3UKKA 5LP6E 3KVAA 5IYZE 3Q5DA 4H7UA 3ZDNA 4DIDB 3NTDA 4KBMB 1CBOA 1BR0A 1D4EA 1ZV4X 1FECA 3LADA 1B4VA 3CNDA 1Q9IA 2JB1A 5JCNA 3NRNA 1LPFA 1ZOVA 2HQMA 1E1LA 4TUYE 2E9XD 2YDSA 1MMDA 5FVKA 5AQVB 1PJ5A 2UUAT 3RRCA 4CZZB 5L3CB 5C8YE 4DV6T 1O5WA 2LRKA 3DMEA 4NWZA 2D5UA 1DXLA 2AR8A 2IUBA 2RR14 2V6XA 4ANJA 3UKLA 3A8YC 3HZLA 4H63V 4B6XA 3FBLA 4J33A 5DJQC 5LA6E 3RQWA 1LVFA 2BG9E 1M7KA 1Q1WA 2I6HA 3C4ZA 1TDEA 4C5OA 5AQFB 5HAXA 3RHWA 3M65A 4IA6A 3CNJA 4DR4T 4X1KE 4GAPA 4Q25A 4UF0B 3NH3X 3AAIA 3OZ2A 3DK8A 1KFYA 1CJ4A 3UKPA 3N9LA 5KVHA 2V8SV 1GT8A 2GH5A 3KVBA 2W2UA 4A65A 4YJ3E 3RKGA 1VRBA 2YLWA 2WSSV 3ANWA 3RI5A 5AQSB 4JI5T 3SRZA 4AT0A 4B65A 5L4EA 2NOXA 4AQYT 2XASB 1FIOA 2O9ZA 5EBKA 5IHYA 3D0TA 1JRZA 2V61A 3NTAA 3V3NA 1VBB4 2VOUA 4BJYA 3GMCA 3ANWB 1TRBA 5ABGA 2LJLA 3FBSA 4H4XA 2PBIA 3K3QC 5EK3A 4JI4T 2CXDA 4X66T 5HXIA 4U8OA 4AOXA 1NDAA 4ECHA 1VBC4 4P0BA 3X1DA 4JV5T 4NNJA 4H4WA 2E4GA 4H9PC 4BURA 4Z90A 4HWDA 4QH1A 4YXDA 1R8IA 3AE5A 3B57A 3CIRA 2EQ6A 3D8XA 1LJ1A 2GMHA 5AQPB 1EZ3A 4ILBA 4U31A 5HCMA 4PJNA 2D9DA 2XQ3A 4BK1A 4WYVA 2JQQA 5FP3A 4A5XA 2L8KA 2V5ZA 4U8KA 2VASA 4FK1C 4UIGA 5HXEA 2W63A 4GKKT 1W09A 4LF8T 4HFCA 3TLUA 4RG3A 2VKJA 4B1BA 4Y4NA 2WAUA 3GQHA 5JVDE 2XLSA 3G5RA 5M10A 1OEDC 2VVNA 5FNVE 4O2AE 3KD9A 4OYKA 1TYPA 3G5SA 1UGOA 2Y6XA 3LSVA 4H4YA 4F6RC 4NTCA 2WDRA 2BZBA 4UV8B 2YG6A 3PURA 4II2A 1P2EA 1YQ3A 3FIMB 2LHRA 2R064 2CPTA 3RIUC 3FZMB 5HYAA 5FL0A 4ZI7E 1ZY8A 2XLUA 4LMKA 4NIQA 3SS1A 2X9XA 4K7ZA 4RHV4 1RYIA 2B1EA 1IUWA 4DV7T 5AQQB 4IDNA 2E9XB 2CDUA 4UXNB 5HEUA 2C72A 2XFNA 2A72A 3OYXA 3UOZA 4O2BE 4AP3A 1S94A 2OV9A 3S4UA 3QJ4A 4X4JA 4EQWA 2UUBT 3ZMTB 4KUMB 2CMRA 1MQTD 3Q9TA 3BNMA 3P8CD 5JDFA 2X8HA 4EMIA 4ILUA 2BBHA 4Z2UA 3AA1B 3PU3A 3VKHA 1LTXR 4C77A 1HRV4 3QSEA 2W0GA 4A99A 3G5QA 3LZXA 1H7WA 2QA1A 1VCSA 1E1KA 3ICTA 2RGHA 4IDPA 3PUAA 2J3NA 5LYJE 3GD4A 5IPYA 3ZT5A 4ADZA 4B66A 2K3WA 1M6IA 2IVDA 2WZIA 2C4CA 3AEEA 5JRCA 4ILAA 1W0AA 3AD9B 1GNDA 5HXHA 2OA1A 2R9ZA 4UR9A 2Y6RA 4A6NB 3FPZA 3AE8A 1GRGA 2A87A 2VVLA 3T2KA 3FG2P 2KLQA 3VR9A 5LBQB 2PHHA 2GQFA 3OTOT 4XZCA 3CX8B 4EQXA 2B9XA 3OPCA 3SQPA 4M1PA 5KNLA 4H4UA 1ZEEA 1Y56A 2UU9T 4ZI2D 1PBFA 4TZ4C 1XNRT 3FZLB 3JC6C 1X79A 3CPZA 3GYJA 2X3NA 4OVIA 4E0VA 4CN6A 2HN1A 4ZN0A 5CB4E 5L47A 1AJ3A 3OVUA 3AA0B 1AL24 5FY0A 1EAH4 1VBE4 5KDMC 4DUZT 3RC8A 1ZX9A 4P0AA 1UX4A 4IHJE 4YHHT 1H81A 1T7SA 4HWFA 3PJAJ 5J0ZA 2AE9A 3GDPA 5HWYA 3REDA 4H9NC 1UX5A 2XJ7A 4TWHA 1O94A 4TNVA 1ONFA 3AYLA 1JRXA 3ONXA 4ZZBA 4ZOLE 2A8XA 2CEAA 4B3MT 2WU5A 3CNSA 2UZZA 1HYUA 2R4EA 2CBJA 1NPXA 2CFYA 3IWAA 2RPAA 4AP1A 2UXNB 3E22E 2CCQA 2B7SA 2QYWA 4GB34 1VRH4 2GF3A 4XAXB 3FXDB 2CVJA 3T14A 4HFEA 2WS3A 2CWOA 4JBWF 2A89A 2JBVA 2QA2A 3IBPA 4ZZCA 2DWKA 4BK2A 5CFBA 3C4AA 1PBCA 3BQIA 3CVRA 2FBWA 2X0YA 4DUYT 3KVEA 2DKHA 1X31B 4QWNB 4YFSA 3K1SA 4PJLA 3J9X1 3GN5A 2Z5XA 4UEMA 5L3DB 3I3LA 5FMNA 2NPXA 2B76A 2W4XA 3AXJA 3Q5EA 2GVCA 4IA5A 4AKHA 1GQEA 1N36T 4DBQA 2OALA 2N9DA 1D0ZA 1RHI4 4EMJA 4GK5E 3T2ZA 4DSHA 3CMMA 1N4WA 3BQLA 2VQFT 2YR4A 3P4RA 3P4QA 4EEDA 2CXFA 4UDPA 1K5MD 4HGAA 4DV2T 1NHQA 2LM9A 4U2LA 2PYJA 5CA1E 4NUVA 1VDCA 1DU2A 2WU2A 4HKAA 4J34A 4WBNE 2Y8DA 3KLJA 3H37A 4H2NA 3NYCA 3HKCE 2V1DB 1PVC4 4OFZA 4ZI3D 3OKQA 1UURA 3VKGA 4LF4T 1TDOA 3DJJA 3WE0A 1XDOA 5KRQA 1POV0 4JQ9A 1ZMCA 3IEEA 2J4GA 4J36A 4E7ZA 3UU3A 1IUVA 4Z44A 3S5WA 2GR2A 3GMIA 3N2OA 4FK1A 3UU6A 2IDOB 2K24A 3URHA 2Q9QA 3NT6A 3AEBA 4UDRA 4M52A 2MTQA 2R074 3GWFA 2KNDA 4IE5A 3RQUA 3NZQA 2VURA 2OAMA 2XTLA 4MBQA 2XCGA 2I0MA 4C91A 4YJ2E 2XQ5A 3N9QA 2AQJA 1HNWT 4P09A 5LXTE 2VL0A 3FZFB 4LF5T 4EQRA 4YHJA 2R044 4LU6A 3HA4A 4IGUA 2ZMAA 2XFOA 1VBD4 3QB5A 4CY6A 4LF9T 4U8NA 2ZZBA 3C96A 2C3CA 1BEV4 2VRLA 4AKGA 4PJJA 3BI5A 2A2FX 4K0KT 4Z26A 1HF8A 3RP6A 3SM8A 3BHKA 3G06A 2VQET 4G6HA 2M6BA 4EIQA 1T98A 4LF7T 1NAAA 3ATRA 4Q4W4 4P9SA 3KU9A 4H4QA 5F3JA 4GRTA 2LOPA 3A7MA 4A56A 5IQ1A 2X99A 4FJOA 4X9MA 2IC9A 2R6GF 2BK3A 5EK2A 1MO9A 1OJAA 1PJ6A 2LEHA 5JCKA 1VQWA 1XDPA 3FBZA 1MIWA 4FDCB 1U5PA 1BGJA 1NAFA 4MALA 2EX3A 1FCDA 3C64A 3NWIA 4PK4A 2C75A 2Q9QB 5JR9B 2UXXB 4KX6A 4N9XA 4LMJA 4WZXA 4EV6A 2XY8B 1MOKA 1H6VA 3TKLB 3OC4A 1NHRA 3N5LA 1CF3A 1H83A 2BK4A 4B69A 2XHEB 2YLZA 3F2EA 4IDOA 4JI8T 1MMAA 3C51A 2BXSA 2J1DG 2HPJA 3FMWA 2FUPA 2C5JA 4G63A 1W4XA 5BR8T 5KMPA 2N2NA 3AD8B 1EL9A 3RRWA 2FJAA 1OEDA 1YD8G 3WAJA 2XLRA 3P50A 1V59A 1GSNA 4YSHA 1Z8UA 4DV5T 3KV5A 2R46A 4ISTA 2WPCA 1J1JA 5LG4A 4EQSA 2LSJA 3MKDA 1HG2A 2IIUA 3R84B 3DJBA 1RUC4 2JKCA 4K5SA 5FKYA 4U2SA 4Y4LA 2PTFA 5HEHA 4OCGA 4LFCT 4XBFB 1PJ7A 1JNZA 1V9DA 2C5IT 2PZSA 1VBA4 4B68A 3HR0A 2JPFA 4DR6T 1F6MA 2V7JA 1QSDA 2LHNA 3NN6X 4HB9A 4TV9E 3ADAB 2BK5A 3VRAA 2VL8A 3HKEE 5LNKA 3KBTA 3AB3B 1CJCA 5FY1A 1FMWA 4PK6A 4B63A 3ZN0B 5HEOA 2R45A 4HA6A 1XHXA 3LBXB 4KPRA 4EYUA 3AWIA 3LK42 1W0BA 2YWLA 4ZCCA 4DR2T 1RSGA 5DQWA 2MAWA 3UCLA 2WDVA 2XAGB 3RP8A 5FXZA 3RIAA 1PO24 3NLCA 1QLBA 4EM4A 4DR1T 4YY3T 5AFUL 1KEYA 4ZCDA 4MJWA 1N4UA 3CWZB 5AQOB 1HG5A 2GQWA 3SZFA 2V7MA 3EVYA 2HPLA 2D0UA 4IT4A 3CQGB 2C66A 3MZKB 5IQ4A 1K0JA 3CGDA 4TNWA 3M0OA 4NEWA 2BKNA 1Z7S4 4LIIA 4TM4A 3AE2A 4C3XA 5FYMA 3EANA 2XVEA 3T37A 2V26A 3EHZA 4H2RA 3CGCA 2WOVA 2QCUA 1QO8A 2E9XC 5KOXA 3PUZF 3CPHG 2V60A 5LBMA 4WBOA 3AEFA 5L3BB 2RGJA 3ZMVB 1H7XA 1HX1B 1SUMB 2GR1A 1XHZA 2HWC4 1O3XA 3LZWA 4WNKA 1KF6A 5FY7A 3RIFA 2X68A 1LKXA 1JOAA 1N33T 4NXNT 3SYIA 3UOXA 3B5MA 1CL0A 5L3GB 5JQGE 4C74A 2PYLA 4H50A 5CKUA 5ABFA 1D0YA 4GYRA 3UFEA 3ATQA 1K0LA 4U8IA 3QFAA 1RUH4 4OPGA 3SUCA 1TDNA 3H8IA 1F8RA 1OEDE 2QAEA 3DH9A 2XAHB 3NK0X 2XLPA 2ZM0A 3C4XA 2H7OA 4UVBB 3RYIE 2ACZA 5EK4A 2CBIA 1BZLA 4H4ZA 1GETA 4I58A 2H89A 1AR84 1E1HB 3NNEA 5FS6A 1GRHA 3C4NA 2X9HA 4OHFA 5F8PA 1F8SA 3I6DA 3P4SA 4HFDA 5AQUB 1P2HA 2W66A 3QK6A 4U33A 1YW0A 4L9IA 4DV3T 5LGUB 3PV0F 3GQKA 4HTEA 4NXMT 2A9UA 3RF1A 4EYYR 4IVMB 1WR6A 2JAEA 3QSMA 2V5DA 2FJDA 3U3IA 4CQIA 4PDWD 5HEJA 4PAAA 4ZI3C 1AR94 4BJNA 2X9YA 5JH7E 1E7PA 3OJAA 4PJMA 1E1MA 4JEHB 3SY4A 4PK5A 3L1RA 1L9CA 3UULA 1IUTA 3AAEB 2NVKX 5AQTB 5KMQA 4LF6T 2GEWA 2YLXA 2BG9C 3RH3A 3PU8A 3UQ4A 2FJBA 3ALMA 2X0HA 1HRI4 4XXGA 4AISA 4AQGA 3ESLA 3BI4A 4UELA 3UP5A 5HXCA 3LXDA 3MJXA 4YSYA 1NG4A 2H88A 4JN9A 3NRYA 2E5VA 2RS54 4JI1T 5FL1A 3NZPA 4UVAB 3Q6JA 1D4CA 1KDGA 4BK3A 4ISSA 4DR3T 4DR7T 3L09A 1NA1D 2PJQA 4REKA 5HY5A 3V5SA 2EHOB 2F5ZA 2C64A 3ZKRA 4AXPA 4DV0T 2UUCT 5BUKA 2YDRA 2UXCT 5IWAT 2C5KT 2R7FA 2Z5YA 1ZOYA 4ZHQE 3OBVE 3E0ZA 4Z91A 1GTHA 1ZMDA 5AQGB 1UUSA 3F8RA 2XVIA 2OA5A 2E9XA 4JI2T 4PFOA 1DOBA 3IF9A 3O1IA 2CLYC 2PW9A 2KINB 5L2LA 1BR1A 5BRTA 3FZKB 4I43B 1COV4 2NW8A 3VRDB 1LVKA 4YLHA 2EQ7A 4DVDA 1OOPD 4HEAA 2JRKA 5HHFA 1WCRA 3FB2A 3CTYA 1VRQB 3UUMA 2GB0A 2EQ8A 2DWGA 4O4LE 2LSYA 1GRTA 1PXAA 5HWXA 4ILCA 4EEBA 2Q0LA 3JD74 4CI3B 3PS9A 3ZT7A 4CXXA 2XQ7A 1VG0A 3AE3A 3H3AA 3ZN1B 4Q4X4 3PUXF 4GYSA 1LVLA 3NKSA 4A7AA 1U4QA 3UTEA 2VVMA 5KMGP 1PXBA 1PXCA 3MA9A 1LRZA 3P4WA 3LK2B 2VRMA 2YLTA 4Y4MA 3CGBA 2Y48B 4Z24A 3ETVA 4YKGA 1D7LA 3ZEFB 1ZK7A 1WR0A 2YR5A 2VQ7A 3KBUA 3QNUA 5ER0A 1FEWA 2XQAA 3CX6B 1HCIA 2H3RA 2W61A 4UDQA 1SEZA 3EDUA 3ZCIA 4JY2A 1NHSA 1EL5A 4U2YA 1YKHB 2BG9B 3F8DA 5GONE 1HXS4 4DV4T 2XAQB 3HYVA 5KXJA 4K5RA 2ES0A 2XUEA 1RUF4 2DHRA 1FMVA 3VU7H 3CKDA 4DGKA 2YOEA 4C90A 2V6YA 2W67A 3COXA 4KMCA 4U7IA 3AYJA 4F8HA 4CXYA 2DL1A 4BAYB 4IVOB 4OYJA 1WYCA 4I4TE 3RHAA 2ODUA 1XWMA 2LT3A 3IHGA 5LHHB 5BMVE 5FXWA 1JRYA 3JAEA 1AOGA 2YG4A 2BXRA 1NEKA 5AQLB 3RLFF 2ARDA 3PUSA 1D0XA 2W0HA 3EAMA 4ZS2A 1OXZA 2H7VC 3LB8A 3NIXA 4MHCA 1PN0A 2ACXA 5GSNA 3C98B 2RABA 4I59A 1S3EA 1AR64 2WP6A 4K22A 2YEVC 2OLOA 4JUYA 4HFIA 4I50E 3L39A 2PY5A 4GIWA 4CCRA 4LFAT 2C76A 4TX5A 2Q6UA 4BJZA 3PJAA 3GYIA 2E5LT 1L0VA 4PABA 2BDEA 2PFVA 3NGCX 4EOZB 4QXBB 1J5ET 4O4HE 3HI2A 1H86A 3NYFA 2WY2A 1K4QA 1PBBA 3B6DA 3J8F4 2XQ8A 3SZWA 2YKSA 3CX7B 4ZI2C 3NK2X 3L8KA 3R9UA 3JC6D 4JYAT 3M13A 4OPUA 4CI1B 2K48A 1KK7A 1MXTA 1SHZC 4OPLA 3UT5E 3EPTA 3II4A 2KXPB 2BS2A 2LRLA 1BWCA 2LSIA 4O4JE 1MMGA 3ZSTA 2D2SA 4CRTA 1BKWA 1D1AA 3IA3A 2LE8A 5EOWA 2DCFA 5E0OA 2VZ2A 2X0LB 4EGWA 1UCUA 1F3PA 2V6YB 2XFUA 4IREA 3PUQA 3KV4A 1XPQA 3ZJ1A 4B3RT 3ALJA 1K0IA 2NTYA 5LHIB 3GWDA 2GAGB 5FS7A 2X51A 1GERA 3A5XA 2KSRA 4JI3T 2GV8A 3WI3A 2BKPA 3ZYXA 3PUYF 3TLWA 2BBJA 4H4VA 2UXDT 2BVMA 3ZYLA 1ASJ4 3GDNA 1RUG4 5CQFA 5JCLA 3N9OA 3GMBA 2WP5A 2WWUA 4ASKA 3VHLA 3FI7A 4YWOA 4U3CA 5AQIB 4J57A 1LV0A 3PDYA 2CM0A 3IF8B 1I6ZA 4K8DA 1HTJF 4EAHA 4H9QC 1D4DA 1D7YA 5AQKB 3RX6A 4YTPA 3AE7A 3UTKA 3I0OA 4WCTA 3HKDE 2RM24 4KI0F 4YKFA 1D5TA 2ZBWA 3K3OA 4Z43A 2LM2A 4TN7B 4JLEA 4JEUB 3DK9A 5LV9A 1HFAA 3O4XE 3RIUA 1ZKEA 3JADA 3SGLA 2WESA 3UKHA 2QRXA 1WLXA 4BA9A 2UXBT 4AKLA 4YTNA 4B3TT 3F8PA 5CGMA 3UU4A 4CI2B 2X66A 3CNTA 4UV9B 2R0PA 4FI5A 1KNZA 1G73A 2K9AA 2CLYB 2B7RA 5KX5E 1XANA 5TAOA 3C4WA 1QUUA 3BQKA 1D1CA 1Z0PA 4HE8A 5DQVA 2APGA 2YLRA 3N2GE 1XDIA 5LMNT 2J47A 3DGHA 2FJEA 4IIJE 2YG7A 4Z2RA 1DJNA 3ONLC 4J56A 5DBJA 2LKGA 3ZSSA 2NW7A 3KINB 2IC6A 2NWBA 5JDLA 2Q0KA 2YU1A 3PE0A 1OJTA 3T0KA 5U25A 4G6GA 1IJ6A 2CXLA 3NBXX 2MPKA 3Q5WA 3Q2MA 3DGZA 1S2YA 1Y01A 1SE7A 4OPDA 3AEAA 2X8CA 4QX8B 3N2KE 3L3PA 4Q4Y4 2VVSA 3I0QA 4U7YA 1B37A 3AEDA 4Z8XA 3QB5K 3UKQA 5J1GA 3C50A 5H6RB 3U78A 3SFEA 1IUXA 4BV6A 3P4PA 3HYWA 3AXJB 3GYXA 3I9YA 2ZM6T 1JNRA 3EDVA 3KPFA 2SPCA 5ETWA 4MFRA 1LQUA 2C65A 4JI6T 2YDQA 2WBLA 4QXCB 4A9WA 5JCMA 3AEGA 3EAOA 2RS34 2BG9A 3QVRA 4JY3A 2X67A 2W00A 4PW8A 1IBLT 3GRSA 5CJ5A 2Y6QA 4IE7A 1UK5A 3BI2A 5ADXL 2ZZCA 3CN8A 2X5ID 1F8WA 4LFBT 2VKHA 3K7MX 4AKIA 3ZYMA 1DODA 3ITJA 4BJMA 4QX7B 4TWDA 3H4KA 2E2AA 2ZM2A 1D1BA 2LKHA 3FZHB 5ABHA 1WRDA 2WEUA 5JTGA 1XZYA 4GOUA 3UTGA 3I1AA 1B8SA 2PLV4 2BABA 4RG4A 2XDOA 4IV9A 2XSBA 4UP3A 4A5LA 1PBDA 3NYEA 4U74A 4B3ST 2ZZ0A 2RS14 1WYBA 5FXVA 4E7SA 3ABVA 3HYXA 2E8IA 3MXZA 1EBDA 3N9MA 4H9OC 4ZS3A 3UFGA 1VOMA 2RA1A 3DTOA 4CCQA 3DA1A 4Q4V4 1BR4A 1GOSA 4JDRA 1MMNA 1X9BA 3UUXB 4UVCB 2YN6A 4B64A 2DNXA 2XM2A 3UKAA 2NTXA 3H3MA 2P9BA 2V5CA 4HWHA 5FXXA 4H9SE 1DOCA 2RGOA 2WOIA 4DNAA 2W62A 4YSXA 3UQ7A 2GR3A 3UU8A 5J7XA 2XLTA 2NR4A 4DMVA 1PO14 1MNDA 3IHRA 3IC9A 1CC6A 2K5BB 2JQHA 4GCMA 1BR2A 3T1YT 4AI6A 2JB3A 2XYOA 3N9NA 4PAGA 3AB1A 4H4SA 3NN0X 5J60A 5L3FB 3NVOA 1I94T 4QHOA 2Q9QD 5L46A 3JAFA 1ZP0A 3UKFA 3RPUA 2JMKA 3ZC0A 5EB4A 5JDGA 2EHOD 1IJ5A 4H4TA 4JNAA 1G8XA 3B13A 2DKIA 5JRCB 2D0TA 2RP4A 1MIYA 3NK1X 3J7Yq 4I0UA 3O1HA 2Z6EA 1DOEA 1XMQT 1T72A 2XQ9A 3HL6A 1B5QA 4KHZF 2I59A 5M4YA 2YVGA 3RP7A 2AAQA 2VVLG 1QJDA 3H8LA 1NG3A 4AOSA 3AECA 2BS3A 1ZKQA 2CWYA 4O5UA 1HNZT 2WHDA 2CHOA 4AKRB 3DJDA 4X1IE 4H4RA 1HX8A 3MK7C 2XAJB 3HKBE 4EB6E 2V7KA 4IL9A 3P7IA 1UKVG 3CNPA 3TLSA 3FXEB 4B67A 2VKDA 3DJEA 1H8TD 1RVF4 3PUGA 1NCQD 3TLVA 1Q1RA 3ZLIA 3ZJ2A 1WFDA 1IUUA 5KOWA 2YM1A 2XZEA 4PFPA 3ALLA 3PUWF 5TR3A 3JBG4 2YU2A 4CN4A 4FX9A 4JNQA 2YG3A 3GA8A 1E6EA 2BC0A 4CY8A 3GN5B 5AQJB 1L9EA 5H6QB 4ZXLA 3SFDA 2WOWA 5C3JA 4G2AA 4G9KA 2X8GA 3UUBA 1KNPA 2GK9A 2MBGA 3LK3B 4X5TA 5AQMB 1N32T 3ZT6A 2QA7A 5LGTB 1Y56B 4COFA 1S35A 4MLKA 4CNJA
chains in the Genus database with same CATH topology
1PJ5A 1YKJA 4TLXA 4X9MA 2BK3A 3VQRA 1MO9A 1OJAA 1PJ6A 4IVOB 1O5WA 2YR6A 3DMEA 1VQWA 5JCKA 4NWZA 4FDCB 1BGJA 1H82A 3RHAA 1FCDA 1EL7A 2IVEA 1JRYA 2C75A 1DXLA 2AR8A 3IHGA 1EL8A 1AOGA 2YG4A 2BXRA 1GRBA 3UKLA 1NEKA 4KX6A 4N9XA 1MOKA 1H6VA 3HZLA 2ARDA 5EB5A 2YQUA 3OC4A 4J33A 3K7TA 1NHRA 1CF3A 1H83A 2BK4A 4B69A 2W0HA 2YLZA 1Q1WA 1Y0PA 4GDPA 4ADWA 1TDEA 4C5OA 3LB8A 3NIXA 1KSSA 4IA6A 1PN0A 3CNJA 5GSNA 2RABA 4I59A 2BXSA 1S3EA 1CC4A 4GAPA 3FMWA 2WP6A 3NH3X 3OZ2A 4K22A 1W4XA 3DK8A 1KFYA 1CJ4A 3UKPA 2OLOA 2XFQA 4CNKA 4RSLA 5KMPA 4CCRA 5KVHA 1GT8A 2GH5A 3AD8B 1O95A 1EL9A 2C76A 1GRAA 4A65A 2Q6UA 4BJZA 2FJAA 3GYIA 5KVIA 3UOYA 2IIDA 1L0VA 2BRAA 2YLWA 4PABA 2XLRA 3NGCX 1V59A 3PO7A 1GSNA 4YSHA 2XVHA 2R46A 4XWZA 4AT0A 2WPCA 4B65A 3CPJG 3BHFA 1H86A 3NYFA 4EQSA 1K4QA 1PBBA 2O9ZA 3B6DA 2YAUA 5EBKA 3QFBA 2JKCA 4K5SA 1COYA 3SZWA 3E1TA 1JRZA 3NK2X 3L8KA 4U2SA 3R9UA 2V61A 3NTAA 4Y4LA 3V3NA 2VOUA 4BJYA 3GMCA 3M13A 4GAVA 1PJ7A 1JNZA 1GTEA 4OCGA 4OPUA 1TRBA 1MXTA 3CGEA 4B68A 4OPLA 3EPTA 2WDQA 3II4A 4O5QA 2BS2A 1BWCA 1DJQA 1F6MA 1ZDLA 2WPFA 4NTDA 4OPCA 3FBSA 1H84A 4XWRA 3K7QX 4H4XA 4CRTA 1PDHA 1IJHA 1BKWA 5HXIA 3NN6X 4HB9A 4U8OA 3ADAB 5EOWA 1NDAA 4AOXA 2BK5A 4ECHA 2VZ2A 4NNJA 2V3BA 3PVCA 2I0ZA 4H4WA 2E4GA 1F3PA 3VRAA 3DJGX 4BURA 2XFUA 4YXDA 1CJCA 1XPQA 3ALJA 4WX1A 3AE5A 4EM3A 3AXBA 4GUVA 1K0IA 3CIRA 2R0GA 2EQ6A 3D8XA 1LJ1A 2GMHA 3GWDA 4B63A 1E1NA 2GAGB 5FS7A 4BK1A 2R45A 4HA6A 1GERA 4KPRA 2BA9A 2V5ZA 1ELIA 3AWIA 4U8KA 1PHHA 2GRTA 4FK1C 2GV8A 3UP4A 3BNUA 2YWLA 4ZCCA 1RSGA 4RG3A 4X9NA 1YY5A 4B1BA 4Y4NA 3GQHA 1FL2A 1S3BA 2BACA 3ZYXA 1PBEA 4H4VA 3UCLA 2XLSA 2WDVA 5C2TA 3G5RA 4USRA 5M10A 3RP8A 1NENA 2YVFA 1YQ4A 3KD9A 1TYPA 1KNRA 2C70A 3G5SA 3GDNA 3NLCA 1QLBA 1XHCA 4EM4A 5CQFA 4H4YA 5JCLA 3GMBA 2WP5A 2B9WA 3ISHA 4ZCDA 2GAHB 4NTCA 4MJWA 2WDRA 4YWOA 4J57A 1N4UA 2YG6A 3NG7X 4II2A 1LV0A 2WP9A 2V6OA 1P2EA 1YQ3A 3FIMB 2GQWA 3AE9A 4OPTA 3SXIA 3SZFA 4EMWA 1NHPA 2BC1A 4K8DA 2C66A 3T31A 1ZY8A 5IQ4A 1D4DA 1D7YA 1K0JA 2XLUA 3CGDA 3M0OA 4II3A 2WBAA 4NEWA 2YG5A 4YTPA 4K7ZA 1GV4A 3AE7A 4TLZA 4LIIA 1JU2A 1RYIA 4TM4A 4WCTA 3P1WA 3AE2A 3P9UA 4J31A 4C3XA 1IUWA 3EANA 2XVEA 1BGNA 3T37A 4H2RA 4NEVA 4YKFA 3CGCA 2WOVA 2QCUA 2CDUA 2BCPA 3M12A 1BF3A 1D5TA 2C72A 2XFNA 2ZBWA 4Z43A 4Z2TA 1QO8A 5KOXA 1OJCA 3UOZA 3CPHG 2V60A 4AP3A 3QJ4A 4X4JA 3DK9A 5FS8A 4EQWA 3AEFA 2YLSA 5LV9A 2RGJA 1H7XA 3SGLA 2GR1A 3Q9TA 2TMDA 2WESA 3BNMA 3UKHA 2X8HA 4ICYA 4EMIA 3F8PA 3LZWA 4H2PA 4YTNA 4NTEA 5KMSA 4Z2UA 1LTXR 4C77A 1KF6A 3QSEA 2EQ9A 3CNTA 4A99A 2R0PA 3G5QA 1JOAA 3LZXA 1H7WA 2QA1A 5FMHA 1E1KA 3SX6A 3ICTA 3QVPA 2RGHA 2B7RA 2XVFA 1GALA 2J3NA 4U8PA 1XANA 3SYIA 3UOXA 1CL0A 3GD4A 4C74A 4H50A 5BULA 3AE4A 5IPYA 5CKUA 4GR1A 3RNMA 4B66A 1M6IA 3ATQA 1K0LA 2APGA 2YLRA 2IVDA 4U8IA 1XDIA 3QFAA 2C4CA 4TM1A 4OPGA 3AEEA 2BYBA 5GRTA 3DGHA 3SUCA 1TDNA 2FJEA 3UTHA 4U8JA 3AD9B 1GNDA 2YG7A 2YVJA 3H8IA 3AYIA 4Z2RA 1F8RA 2OA1A 1DJNA 2R9ZA 4OPIA 2Y6RA 4J56A 4A6NB 2BRYA 2QAEA 3FPZA 3AE8A 3DH9A 3NK0X 5DBJA 4GF7A 3UOVA 3AE1A 1GRGA 1TDKA 2A87A 2VVLA 2XLPA 3B3RA 2TPRA 2WQYA 2Q0KA 3T2KA 3FG2P 3VR9A 3LOVA 4DSGA 2ACZA 1OJTA 2B9YA 1BZLA 2Q7VA 4H4ZA 4G6GA 5U25A 1GETA 4I58A 3T0KA 2H89A 2PHHA 2GQFA 2XVJA 1FEAA 3DGZA 1S2YA 3NNEA 5FS6A 4EQXA 1FOHA 1GESA 2B9XA 4OPDA 3AEAA 1GRHA 3SQPA 3C4NA 1TYTA 5KNLA 4G74A 2X8CA 4H4UA 1Y56A 3K30A 1F8SA 3I6DA 3P4SA 1PBFA 4EIPA 1B37A 3AEDA 3UKQA 1P2HA 3SFEA 1IUXA 4BV6A 3P4PA 3HYWA 1OJ9A 3GYJA 2X3NA 1OJDA 3GYXA 3NHOX 4GDEA 4OVIA 4E0VA 1JNRA 3AE6A 3KPFA 4ZN0A 3GQKA 1LQUA 2C65A 4A9WA 5JCMA 1L9DA 1ZX9A 3SZCA 4IVMB 3AEGA 2JAEA 3EAOA 3QSMA 2FJDA 2GR0A 4AT2A 3IHMA 3QVRA 1DNCA 1REOA 1S2QA 3LJPA 4JY3A 4TM3A 1H81A 4PAAA 4APNA 3GRSA 2Y6QA 3GD3A 3BI2A 3KKJA 2ZZCA 3CN8A 3SZ0A 4D03A 1F8WA 3D1CA 3GDPA 1E7PA 3REDA 1E1MA 5M0ZA 4YSZA 3K7MX 3SY4A 1O94A 1N4VA 1ONFA 3AYLA 1DODA 1JRXA 1KSUA 1L9CA 2C7GA 3ITJA 3L1RA 3DK4A 1IUTA 2NVKX 3H4KA 3T2YA 4A79A 3GSIA 5KMQA 1FEBA 2GEWA 2YLXA 2A8XA 2XFPA 2FJBA 3ALMA 2WU5A 1TDFA 2WEUA 3CNSA 4USQA 4XXGA 2UZZA 1HYUA 3UTGA 3BI4A 2R4EA 1NPXA 2CFYA 3UP5A 1B8SA 3IWAA 2BABA 4RG4A 3LXDA 2XDOA 4IV9A 4A5LA 2B7SA 4UP3A 5U63A 4YSYA 1PBDA 4AP1A 3NYEA 1NG4A 2WETA 2ZZ0A 2H88A 1JEHA 2GF3A 4U8LA 2BCGG 4JN9A 3ABVA 2WPEA 3HYXA 2E5VA 1PS9A 1EBDA 2CVJA 3T14A 3S61A 2WS3A 5KWFA 2A89A 2QA2A 2JBVA 3Q6JA 4BK2A 1D4CA 4LA1A 1KDGA 3C4AA 4BK3A 1PBCA 3DA1A 4CCQA 1GOSA 2FBWA 3KVEA 4JDRA 1LQTA 5FS9A 4REKA 5HY5A 2DKHA 1X31B 2F5ZA 4TM0A 2C64A 1M64A 4B64A 1GXFA 2Z5XA 2YM2A 1CJ2A 3UKAA 2C67A 4YTMA 3I3LA 5BUKA 2NPXA 2B76A 3GRTA 2Z5YA 1ZOYA 2GVCA 4IA5A 1DOCA 2RGOA 2E1MA 2WOIA 4U2TA 1RP0A 4DNAA 1CC2A 2OALA 2V3AA 4YSXA 1GTHA 2GR3A 1ZMDA 5J7XA 3V76A 3UTFA 2XLTA 4EMJA 3ICSA 3F8RA 2XVIA 3T2ZA 4DSHA 3CMMA 1CC6A 2PYXA 3IC9A 1DOBA 1N4WA 2X50A 1Z6LA 3IF9A 4GCMA 2YR4A 3P4RA 2VQBA 3P4QA 2R0CA 2JB3A 2XYOA 1GEUA 4UDPA 2JB2A 3AB1A 3CPIG 3NN0X 4H4SA 5BRTA 5J60A 4K2XA 1NHQA 2CULA 4U2LA 2LFCA 5L46A 3VRDB 2OLNA 2EQ7A 1ZP0A 1VDCA 3UKFA 4A6NA 3ICRA 5HYMA 2WU2A 5EB4A 4J34A 5KMRA 5HHFA 3KLJA 3CTYA 4G73A 3AD7B 4H4TA 4JNAA 4Z25A 1VRQB 4H2NA 2DKIA 3NYCA 2GB0A 2C73A 4H4PA 1GRFA 2EQ8A 1IUSA 3NK1X 1GRTA 1PXAA 2Q0LA 1YQZA 3PS9A 1DOEA 1TDOA 3DJJA 1VG0A 3WE0A 3AE3A 1N1PA 1B5QA 2C3DA 3EF6A 4YT0A 5KRQA 2YVGA 3O0HA 3RP7A 2AAQA 2VVLG 1QJDA 4JQ9A 3H8LA 3JSKA 1NG3A 1ZMCA 3AECA 1LVLA 3KPKA 4J36A 4AOSA 2BS3A 3NKSA 1CHUA 4A7AA 1ZKQA 1IUVA 4O5UA 4Z44A 3UTEA 2VVMA 3S5WA 1PXBA 2GR2A 2WHDA 4CBQA 1PXCA 3DJDA 3V3OA 1GPEA 4H4RA 4FK1A 3URHA 2VRMA 3NT6A 3AEBA 4J2WA 4D04A 2YLTA 4UDRA 4Y4MA 5BVAA 1UKVG 3CGBA 3CNPA 4M52A 4Z24A 4B67A 1GREA 3GWFA 4YKGA 2BS4A 1D7LA 3DJEA 1VG9A 1ZK7A 2OAMA 1Q1RA 5JCIA 2YR5A 2VQ7A 2XCGA 4NZHA 5ER0A 2AQJA 1E39A 1IUUA 5KOWA 2R4JA 3QSSA 2YM1A 4UDQA 1SEZA 3ALLA 5TR3A 4EQRA 4LU6A 1CJ3A 2XFOA 3KA7A 4FX9A 4JNQA 4JY2A 4U8MA 1NHSA 1EL5A 2YG3A 4C3YA 3VRBA 4CY6A 1E6EA 3F8DA 4U8NA 2ZZBA 3C96A 2C3CA 2BC0A 3VR8A 4CY8A 2VRLA 5U1OA 2JK6A 1L9EA 4H2QA 2GMJA 3HYVA 3UKKA 3BI5A 3SFDA 4H7UA 2WOWA 3ZDNA 5C3JA 5KXJA 4K5RA 3NTDA 4G9KA 4Z26A 2X8GA 1CBOA 1D4EA 1KNPA 1FECA 3LADA 3BHKA 1B4VA 3RP6A 3SM8A 3CNDA 4G6HA 4EIQA 1Q9IA 1NAAA 3ATRA 2JB1A 5JCNA 4P9SA 3NRNA 1LPFA 1ZOVA 3KU9A 4H4QA 4DGKA 4GRTA 2HQMA 1E1LA 1Y56B 3COXA 3AYJA 5IQ1A 4CNJA 2X99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJ5 A;  1YKJ A;  4TLX A;  4X9M A;  2BK3 A;  3VQR A;  1MO9 A;  1OJA A;  1PJ6 A;  4IVO B;  1O5W A;  2YR6 A;  3DME A;  1VQW A;  5JCK A;  4FDC B;  1BGJ A;  1H82 A;  3RHA A;  1FCD A;  1EL7 A;  2IVE A;  1JRY A;  2C75 A;  1DXL A;  2AR8 A;  3IHG A;  1EL8 A;  1AOG A;  2YG4 A;  2BXR A;  1GRB A;  3UKL A;  1NEK A;  4KX6 A;  4N9X A;  1MOK A;  1H6V A;  3HZL A;  2ARD A;  5EB5 A;  2YQU A;  3OC4 A;  4J33 A;  3K7T A;  1NHR A;  1CF3 A;  1H83 A;  2BK4 A;  4B69 A;  2W0H A;  2YLZ A;  1Q1W A;  1Y0P A;  4GDP A;  4ADW A;  1TDE A;  4C5O A;  3LB8 A;  3NIX A;  1KSS A;  4IA6 A;  1PN0 A;  3CNJ A;  5GSN A;  2RAB A;  4I59 A;  2BXS A;  1S3E A;  1CC4 A;  3FMW A;  2WP6 A;  3NH3 X;  3OZ2 A;  4K22 A;  1W4X A;  3DK8 A;  1KFY A;  1CJ4 A;  3UKP A;  2OLO A;  2XFQ A;  4CNK A;  4RSL A;  4CCR A;  5KVH A;  1GT8 A;  2GH5 A;  3AD8 B;  1O95 A;  1EL9 A;  2C76 A;  1GRA A;  4A65 A;  2Q6U A;  4BJZ A;  2FJA A;  3GYI A;  5KVI A;  3UOY A;  2IID A;  1L0V A;  2YLW A;  4PAB A;  2XLR A;  3NGC X;  1V59 A;  3PO7 A;  1GSN A;  4YSH A;  2XVH A;  2R46 A;  4XWZ A;  4AT0 A;  2WPC A;  4B65 A;  3CPJ G;  3BHF A;  1H86 A;  3NYF A;  4EQS A;  1K4Q A;  1PBB A;  2O9Z A;  3B6D A;  2YAU A;  5EBK A;  3QFB A;  2JKC A;  4K5S A;  1COY A;  3E1T A;  1JRZ A;  3NK2 X;  3L8K A;  4U2S A;  3R9U A;  2V61 A;  3NTA A;  4Y4L A;  3V3N A;  2VOU A;  4BJY A;  3GMC A;  3M13 A;  4OCG A;  1PJ7 A;  1JNZ A;  1GTE A;  4OPU A;  1TRB A;  1MXT A;  3CGE A;  4B68 A;  4OPL A;  3EPT A;  2WDQ A;  3II4 A;  4O5Q A;  2BS2 A;  1BWC A;  1DJQ A;  1F6M A;  1ZDL A;  2WPF A;  4NTD A;  4OPC A;  3FBS A;  1H84 A;  4XWR A;  3K7Q X;  4H4X A;  4CRT A;  1PDH A;  1IJH A;  1BKW A;  5HXI A;  3NN6 X;  4HB9 A;  4U8O A;  3ADA B;  5EOW A;  1NDA A;  4AOX A;  2BK5 A;  4ECH A;  2VZ2 A;  2V3B A;  3PVC A;  2I0Z A;  4H4W A;  2E4G A;  1F3P A;  3VRA A;  3DJG X;  4BUR A;  2XFU A;  4YXD A;  1CJC A;  1XPQ A;  3ALJ A;  4WX1 A;  3AE5 A;  4EM3 A;  3AXB A;  4GUV A;  1K0I A;  3CIR A;  2R0G A;  2EQ6 A;  3D8X A;  1LJ1 A;  2GMH A;  3GWD A;  4B63 A;  1E1N A;  2GAG B;  5FS7 A;  4BK1 A;  2R45 A;  4HA6 A;  1GER A;  4KPR A;  2BA9 A;  2V5Z A;  1ELI A;  3AWI A;  4U8K A;  1PHH A;  2GRT A;  4FK1 C;  2GV8 A;  3UP4 A;  3BNU A;  2YWL A;  4ZCC A;  1RSG A;  4RG3 A;  4X9N A;  1YY5 A;  4B1B A;  4Y4N A;  3GQH A;  1FL2 A;  1S3B A;  2BAC A;  3ZYX A;  1PBE A;  4H4V A;  3UCL A;  2XLS A;  2WDV A;  5C2T A;  3G5R A;  4USR A;  5M10 A;  3RP8 A;  1NEN A;  2YVF A;  1YQ4 A;  3KD9 A;  1TYP A;  1KNR A;  2C70 A;  3G5S A;  3GDN A;  3NLC A;  1QLB A;  1XHC A;  4EM4 A;  5CQF A;  4H4Y A;  5JCL A;  3GMB A;  2WP5 A;  2B9W A;  3ISH A;  4ZCD A;  2GAH B;  4NTC A;  4MJW A;  2WDR A;  4YWO A;  4J57 A;  1N4U A;  2YG6 A;  3NG7 X;  1LV0 A;  2WP9 A;  2V6O A;  1P2E A;  1YQ3 A;  3FIM B;  2GQW A;  3AE9 A;  4OPT A;  4EMW A;  1NHP A;  2BC1 A;  4K8D A;  2C66 A;  1ZY8 A;  5IQ4 A;  1D4D A;  1D7Y A;  1K0J A;  2XLU A;  3CGD A;  3M0O A;  2WBA A;  4NEW A;  2YG5 A;  4YTP A;  4K7Z A;  1GV4 A;  3AE7 A;  4TLZ A;  4LII A;  1JU2 A;  1RYI A;  4TM4 A;  4WCT A;  3P1W A;  3AE2 A;  3P9U A;  4J31 A;  4C3X A;  1IUW A;  3EAN A;  2XVE A;  1BGN A;  3T37 A;  4H2R A;  4NEV A;  4YKF A;  3CGC A;  2WOV A;  2QCU A;  2CDU A;  2BCP A;  3M12 A;  1BF3 A;  1D5T A;  2C72 A;  2XFN A;  2ZBW A;  4Z43 A;  4Z2T A;  1QO8 A;  5KOX A;  1OJC A;  3UOZ A;  3CPH G;  2V60 A;  4AP3 A;  3QJ4 A;  4X4J A;  3DK9 A;  5FS8 A;  4EQW A;  3AEF A;  2YLS A;  5LV9 A;  2RGJ A;  1H7X A;  3SGL A;  2GR1 A;  3Q9T A;  2TMD A;  2WES A;  3BNM A;  3UKH A;  2X8H A;  4ICY A;  4EMI A;  3F8P A;  3LZW A;  4H2P A;  4YTN A;  4NTE A;  4Z2U A;  1LTX R;  4C77 A;  1KF6 A;  3QSE A;  2EQ9 A;  3CNT A;  4A99 A;  2R0P A;  3G5Q A;  1JOA A;  3LZX A;  1H7W A;  2QA1 A;  5FMH A;  1E1K A;  3ICT A;  3QVP A;  2RGH A;  2B7R A;  2XVF A;  1GAL A;  2J3N A;  4U8P A;  1XAN A;  3UOX A;  1CL0 A;  3GD4 A;  4C74 A;  4H50 A;  5BUL A;  3AE4 A;  5IPY A;  5CKU A;  4GR1 A;  3RNM A;  4B66 A;  1M6I A;  3ATQ A;  1K0L A;  2APG A;  2YLR A;  2IVD A;  4U8I A;  1XDI A;  3QFA A;  4TM1 A;  4OPG A;  3AEE A;  2BYB A;  5GRT A;  3DGH A;  3SUC A;  1TDN A;  2FJE A;  3UTH A;  4U8J A;  3AD9 B;  1GND A;  2YG7 A;  2YVJ A;  3H8I A;  3AYI A;  4Z2R A;  1F8R A;  2OA1 A;  1DJN A;  2R9Z A;  4OPI A;  2Y6R A;  4J56 A;  4A6N B;  5DBJ A;  2QAE A;  3FPZ A;  3AE8 A;  3DH9 A;  3NK0 X;  4GF7 A;  3UOV A;  3AE1 A;  1GRG A;  1TDK A;  2A87 A;  2VVL A;  2XLP A;  3B3R A;  2TPR A;  2WQY A;  2Q0K A;  3FG2 P;  3VR9 A;  3LOV A;  4DSG A;  2ACZ A;  1OJT A;  2B9Y A;  1BZL A;  2Q7V A;  4H4Z A;  5U25 A;  1GET A;  4I58 A;  2H89 A;  2PHH A;  2GQF A;  2XVJ A;  1FEA A;  3DGZ A;  1S2Y A;  3NNE A;  5FS6 A;  4EQX A;  1FOH A;  1GES A;  2B9X A;  4OPD A;  3AEA A;  1GRH A;  3SQP A;  3C4N A;  1TYT A;  2X8C A;  4H4U A;  1Y56 A;  3K30 A;  1F8S A;  3I6D A;  3P4S A;  1PBF A;  4EIP A;  1B37 A;  3AED A;  3UKQ A;  1P2H A;  3SFE A;  1IUX A;  4BV6 A;  3P4P A;  1OJ9 A;  3GYJ A;  2X3N A;  1OJD A;  3NHO X;  3GYX A;  4GDE A;  4OVI A;  4E0V A;  1JNR A;  3AE6 A;  3KPF A;  4ZN0 A;  3GQK A;  1LQU A;  2C65 A;  4A9W A;  5JCM A;  1L9D A;  1ZX9 A;  4IVM B;  3AEG A;  2JAE A;  3EAO A;  3QSM A;  2FJD A;  2GR0 A;  4AT2 A;  3IHM A;  3QVR A;  1DNC A;  1REO A;  1S2Q A;  3LJP A;  4JY3 A;  4TM3 A;  1H81 A;  4PAA A;  4APN A;  3GRS A;  2Y6Q A;  3GD3 A;  3BI2 A;  3KKJ A;  2ZZC A;  3CN8 A;  4D03 A;  1F8W A;  3D1C A;  3GDP A;  1E7P A;  3RED A;  1E1M A;  5M0Z A;  4YSZ A;  3K7M X;  1O94 A;  1N4V A;  1ONF A;  3AYL A;  1DOD A;  1JRX A;  1KSU A;  1L9C A;  2C7G A;  3ITJ A;  3L1R A;  3DK4 A;  1IUT A;  2NVK X;  3H4K A;  4A79 A;  3GSI A;  1FEB A;  2GEW A;  2YLX A;  2A8X A;  2XFP A;  2FJB A;  3ALM A;  2WU5 A;  1TDF A;  2WEU A;  3CNS A;  4USQ A;  4XXG A;  2UZZ A;  1HYU A;  3UTG A;  3BI4 A;  2R4E A;  1NPX A;  2CFY A;  3UP5 A;  1B8S A;  3IWA A;  2BAB A;  4RG4 A;  3LXD A;  2XDO A;  4IV9 A;  4A5L A;  2B7S A;  4UP3 A;  5U63 A;  4YSY A;  1PBD A;  4AP1 A;  3NYE A;  1NG4 A;  2WET A;  2ZZ0 A;  2H88 A;  1JEH A;  2GF3 A;  4U8L A;  2BCG G;  4JN9 A;  3ABV A;  2WPE A;  2E5V A;  1PS9 A;  1EBD A;  2CVJ A;  3S61 A;  2WS3 A;  5KWF A;  2A89 A;  2QA2 A;  2JBV A;  3Q6J A;  4BK2 A;  1D4C A;  4LA1 A;  1KDG A;  3C4A A;  4BK3 A;  1PBC A;  3DA1 A;  4CCQ A;  1GOS A;  2FBW A;  3KVE A;  4JDR A;  1LQT A;  5FS9 A;  4REK A;  5HY5 A;  2DKH A;  1X31 B;  2F5Z A;  4TM0 A;  2C64 A;  1M64 A;  4B64 A;  1GXF A;  2Z5X A;  2YM2 A;  1CJ2 A;  3UKA A;  2C67 A;  4YTM A;  3I3L A;  5BUK A;  2NPX A;  2B76 A;  3GRT A;  2Z5Y A;  1ZOY A;  2GVC A;  4IA5 A;  1DOC A;  2RGO A;  2E1M A;  2WOI A;  4U2T A;  1RP0 A;  4DNA A;  1CC2 A;  2OAL A;  2V3A A;  4YSX A;  1GTH A;  2GR3 A;  1ZMD A;  5J7X A;  3V76 A;  3UTF A;  2XLT A;  4EMJ A;  3ICS A;  3F8R A;  2XVI A;  4DSH A;  3IC9 A;  1CC6 A;  2PYX A;  1DOB A;  1N4W A;  2X50 A;  1Z6L A;  3IF9 A;  4GCM A;  2YR4 A;  3P4R A;  2VQB A;  3P4Q A;  2R0C A;  2JB3 A;  2XYO A;  1GEU A;  4UDP A;  2JB2 A;  3AB1 A;  3CPI G;  3NN0 X;  4H4S A;  5BRT A;  5J60 A;  4K2X A;  1NHQ A;  2CUL A;  4U2L A;  2LFC A;  5L46 A;  3VRD B;  2OLN A;  2EQ7 A;  1ZP0 A;  1VDC A;  3UKF A;  4A6N A;  3ICR A;  5HYM A;  2WU2 A;  5EB4 A;  4J34 A;  5HHF A;  3KLJ A;  3CTY A;  3AD7 B;  4H4T A;  4JNA A;  4Z25 A;  1VRQ B;  4H2N A;  2DKI A;  3NYC A;  2GB0 A;  2C73 A;  4H4P A;  1GRF A;  2EQ8 A;  1IUS A;  3NK1 X;  1GRT A;  1PXA A;  2Q0L A;  1YQZ A;  3PS9 A;  1DOE A;  1TDO A;  3DJJ A;  1VG0 A;  3WE0 A;  3AE3 A;  1N1P A;  1B5Q A;  2C3D A;  3EF6 A;  4YT0 A;  5KRQ A;  2YVG A;  3O0H A;  3RP7 A;  2AAQ A;  2VVL G;  1QJD A;  4JQ9 A;  3H8L A;  3JSK A;  1NG3 A;  1ZMC A;  3AEC A;  1LVL A;  4AOS A;  4J36 A;  2BS3 A;  3NKS A;  1CHU A;  4A7A A;  1ZKQ A;  1IUV A;  4O5U A;  4Z44 A;  3UTE A;  2VVM A;  3S5W A;  1PXB A;  2GR2 A;  2WHD A;  4CBQ A;  1PXC A;  3DJD A;  3V3O A;  1GPE A;  4H4R A;  4FK1 A;  3URH A;  2VRM A;  3NT6 A;  3AEB A;  4J2W A;  4D04 A;  2YLT A;  4UDR A;  4Y4M A;  5BVA A;  1UKV G;  3CGB A;  3CNP A;  4M52 A;  4Z24 A;  4B67 A;  1GRE A;  3GWF A;  4YKG A;  2BS4 A;  1D7L A;  3DJE A;  1VG9 A;  1ZK7 A;  2OAM A;  1Q1R A;  5JCI A;  2YR5 A;  2VQ7 A;  2XCG A;  4NZH A;  5ER0 A;  2AQJ A;  1E39 A;  1IUU A;  5KOW A;  2R4J A;  3QSS A;  2YM1 A;  4UDQ A;  1SEZ A;  3ALL A;  5TR3 A;  4EQR A;  4LU6 A;  1CJ3 A;  2XFO A;  3KA7 A;  4FX9 A;  4JNQ A;  4JY2 A;  4U8M A;  1NHS A;  1EL5 A;  2YG3 A;  4C3Y A;  3VRB A;  4CY6 A;  1E6E A;  3F8D A;  4U8N A;  2ZZB A;  3C96 A;  2C3C A;  2BC0 A;  3VR8 A;  4CY8 A;  2VRL A;  5U1O A;  2JK6 A;  1L9E A;  4H2Q A;  2GMJ A;  3UKK A;  3BI5 A;  3SFD A;  4H7U A;  2WOW A;  3ZDN A;  5C3J A;  5KXJ A;  4K5R A;  3NTD A;  4Z26 A;  2X8G A;  1CBO A;  1D4E A;  1KNP A;  1FEC A;  3LAD A;  3BHK A;  1B4V A;  3RP6 A;  3SM8 A;  3CND A;  4EIQ A;  1Q9I A;  1NAA A;  3ATR A;  2JB1 A;  5JCN A;  4P9S A;  3NRN A;  1LPF A;  1ZOV A;  3KU9 A;  4H4Q A;  4DGK A;  4GRT A;  2HQM A;  1E1L A;  1Y56 B;  3COX A;  3AYJ A;  5IQ1 A;  4CNJ A;  2X99 A; 
#chains in the Genus database with same CATH topology
 1YKJ A;  3VQR A;  4TLX A;  3AA6 B;  3TLT A;  2YR6 A;  2CA5 A;  4CN1 A;  3LBX A;  1H82 A;  1HR0 T;  4HFV A;  2IVE A;  1EL7 A;  5DAB A;  1R09 4;  2VWA A;  1EL8 A;  1PIV 4;  5LCY A;  1GRB A;  2PG8 A;  1IBM T;  5AQN B;  1US7 B;  2WM9 A;  4U72 A;  4X1Y E;  5EB5 A;  5JDH A;  2NW9 A;  2YQU A;  3K7T A;  5JDM A;  2L3L A;  5LG3 A;  4JI7 T;  1Y0P A;  4GDP A;  4ADW A;  3EAB A;  1SA0 E;  1Y64 B;  1KSS A;  4QH5 A;  2VK9 A;  4X65 T;  2HHH T;  4TV8 E;  3CQX C;  1CC4 A;  3OYZ A;  4CNK A;  2XFQ A;  1E2A A;  3W15 B;  4RSL A;  2DLR A;  5CA0 E;  4L0R A;  1O95 A;  1RUE 4;  1GRA A;  4X64 T;  5L3E B;  3PUV F;  5KVI A;  3UOY A;  2JQK A;  2IID A;  5LMU T;  2BRA A;  2F4V T;  4O8S A;  1CUN A;  4A98 A;  3PO7 A;  4AQF A;  1ZHC A;  2XVH A;  4XWZ A;  3CPJ G;  3BHF A;  2YAU A;  3QFB A;  2XQY A;  1COY A;  3E1T A;  2KMF A;  5EZY E;  4GAV A;  1GTE A;  4NUU A;  4X20 E;  4O4I E;  5JR9 C;  2Q9Q C;  2MYS A;  3CGE A;  2JMH A;  2WDQ A;  4O5Q A;  1DJQ A;  2WPF A;  1ZDL A;  4NTD A;  4OPC A;  4CXW A;  2IW5 B;  1H84 A;  3K7Q X;  4XWR A;  4OX9 T;  1PDH A;  1IJH A;  4L5G A;  2VKO A;  1W9R A;  4DO0 A;  4N78 D;  5AQH B;  2L9Q A;  2V3B A;  3PVC A;  5A1L A;  2I0Z A;  4H63 H;  3DJG X;  2JJ9 A;  3UU5 A;  3QC9 A;  5HEG A;  4WX1 A;  4EM3 A;  3K8P C;  3AXB A;  4GUV A;  3ZYK A;  2R0G A;  2XQ6 A;  1E1N A;  3UUN A;  4HN9 A;  2M6I A;  2ZM8 A;  3AVR A;  4TWF A;  2BA9 A;  3LFM A;  1ELI A;  1PHH A;  2GRT A;  4HFB A;  1M62 A;  3UP4 A;  2XQ4 A;  3BNU A;  3QOF A;  4X9N A;  1YY5 A;  3ZMU B;  5J2U E;  2J62 A;  1FL2 A;  1S3B A;  2BAC A;  1PBE A;  4KHP T;  5C2T A;  4USR A;  2XSA A;  3O9X A;  1NEN A;  2YVF A;  2LOS A;  1YQ4 A;  2XPK A;  1KNR A;  2C70 A;  4ERR A;  3DP7 A;  2VB6 A;  1XHC A;  1OED B;  2BKO A;  2B9W A;  3ISH A;  2GAH B;  3NG7 X;  3NKZ A;  2WP9 A;  2V6O A;  5JRE A;  4OPT A;  3AE9 A;  4WW0 A;  3SXI A;  4EMW A;  1NHP A;  2MOZ A;  2BC1 A;  1XI1 A;  5IUX A;  3T31 A;  3RC3 A;  4DR5 T;  4II3 A;  2WBA A;  3QUJ A;  2YG5 A;  2XAF B;  1GV4 A;  4TLZ A;  1JU2 A;  5ABE A;  4HFH A;  3P1W A;  3P9U A;  4J31 A;  1IAP A;  4EXT A;  4ZEY A;  1HNX T;  2WWV A;  1BGN A;  1RUJ 4;  2RMU 4;  5LB7 B;  2WCA A;  4NEV A;  3KV6 A;  2BCP A;  3T8O A;  1HS7 A;  1BF3 A;  3M12 A;  4Z2T A;  1MIV A;  3MAC A;  1OJC A;  3CK6 A;  3LDQ B;  3GWH A;  4X62 T;  3O1J A;  5FS8 A;  2YLS A;  4DV1 T;  5LJN A;  2TMD A;  4ICY A;  2QGS A;  4EZH A;  2KT9 A;  4H2P A;  4NTE A;  2AXD S;  4IDZ A;  5KMS A;  4I55 E;  2EQ9 A;  2EHO C;  2CHN A;  5FMH A;  4QXH B;  4IDQ A;  3QVP A;  3SX6 A;  2XVF A;  1GAL A;  4U8P A;  2XM1 A;  5BUL A;  3AE4 A;  4GR1 A;  2WMO A;  3RNM A;  2A3D A;  3LJC A;  4QKN A;  4TM1 A;  2BYB A;  5GRT A;  3UTH A;  1IZN B;  4U8J A;  3E08 A;  2YVJ A;  3AYI A;  4IE6 A;  4OPI A;  1NWM X;  2V7L A;  2BRY A;  4GF7 A;  4H9R C;  2EHO A;  3UOV A;  3AE1 A;  1TDK A;  3B3R A;  5LHG B;  2WQY A;  2TPR A;  1FJG T;  1RUI 4;  4KP3 C;  3LOV A;  4DSG A;  1XNQ T;  2B9Y A;  2Q7V A;  3ZCJ A;  2JQ9 A;  3CQC B;  2XVJ A;  1FEA A;  1B7T A;  1YXR A;  1FOH A;  1GES A;  1TYT A;  3SWH A;  4G74 A;  3K30 A;  2IHR 1;  3F57 A;  4EIP A;  1MNE A;  3KFW X;  3EUH A;  3ZC1 A;  1T8B A;  2YK0 A;  3RGL A;  5LJM A;  1OJ9 A;  3NHO X;  1OJD A;  4GDE A;  2IML A;  3AE6 A;  2G0U A;  3AA7 B;  2M67 A;  4JI0 T;  3RKO A;  1L9D A;  3KDS E;  3WAK A;  3SZC A;  2QVA A;  4QH4 A;  2GR0 A;  4IL4 A;  4AT2 A;  3IHM A;  1DNC A;  2YIN A;  3Q9D A;  1REO A;  3JCF A;  4GKJ T;  5JDQ A;  1S2Q A;  3LJP A;  4TM3 A;  2ODV A;  4APN A;  3BK9 A;  3GD3 A;  2BVL A;  2C0S A;  2OLT A;  4EIW A;  3KKJ A;  1R08 4;  3SZ0 A;  3F31 A;  4D03 A;  3RYC E;  3D1C A;  3M3Z B;  4J2C A;  5M0Z A;  4YSZ A;  2HWB 4;  1N4V A;  2CE7 A;  3I9W A;  5AQR B;  1KSU A;  2C7G A;  1EV1 4;  4K0U A;  4DBR A;  3DK4 A;  4A79 A;  3T2Y A;  3GSI A;  4HWI B;  3ETU A;  1FEB A;  2XFP A;  4V1A v;  1TDF A;  4P1N A;  4NPP A;  4USQ A;  2WB5 A;  3L8R A;  2ZLY A;  2N1G A;  5U63 A;  4AQF C;  2WET A;  1JEH A;  4U8L A;  2BCG G;  3FHN A;  2WPE A;  1PS9 A;  4A97 A;  3S61 A;  5KWF A;  4LA1 A;  1H7C A;  2WMN A;  1LQT A;  3N9P A;  3RYH E;  5FS9 A;  4IE0 A;  3NRX A;  3AAA B;  4TM0 A;  4UF0 A;  1J5W A;  1M64 A;  2X9W A;  1GXF A;  1IBK T;  1AR7 4;  2YM2 A;  1CJ2 A;  2C67 A;  4YTM A;  1YKE B;  3GRT A;  2LLY A;  4OK0 A;  1D4M 4;  1XMO T;  4U2T A;  2E1M A;  1RP0 A;  1CC2 A;  2HH7 A;  3EI0 A;  4HWC A;  2V3A A;  3ONJ A;  5ABF B;  5JDN A;  3V76 A;  3UTF A;  3ICS A;  2PYX A;  2X50 A;  1Z6L A;  1RMU 4;  2VQB A;  2R0C A;  2KWH A;  1N34 T;  1GEU A;  2JB2 A;  3CPI G;  4K2X A;  2CUL A;  2LFC A;  4EZ4 A;  2OLN A;  2JIW A;  3ICR A;  4A6N A;  5HYM A;  5KMR A;  3SOL A;  4G73 A;  3AD7 B;  4Z25 A;  3ZPO A;  2WZH A;  2CRB A;  2C73 A;  2KZ7 B;  4H4P A;  1GRF A;  3R6N A;  1IUS A;  5L4H A;  2KWI B;  1YQZ A;  5HCJ A;  3PTR B;  1N1P A;  3LG7 A;  5F5W A;  2LSK A;  2C3D A;  3EF6 A;  4LML A;  4U2Z A;  4YT0 A;  3O0H A;  2IAK A;  1OWA A;  3JSK A;  3KPK A;  1CHU A;  5JR9 A;  4CBQ A;  4IE4 A;  5LOV E;  3V3O A;  3V5U A;  1GPE A;  4DND A;  5LGN B;  2V7I A;  3K3N A;  2LSG A;  3T1H T;  4J2W A;  4D04 A;  1VCT A;  5BVA A;  3ZMZ B;  5FVL A;  1GRE A;  4GK0 E;  2BS4 A;  2NP9 A;  3KV9 A;  1VG9 A;  5HXR A;  5JCI A;  4NZH A;  4AIU A;  5J2T E;  1E39 A;  2DI4 A;  2R4J A;  3QSS A;  3CML A;  3Q5X A;  1CJ3 A;  3ZMS B;  3RYF E;  3KA7 A;  4U8M A;  2HN2 A;  4C3Y A;  3VRB A;  4PNI A;  5HXS A;  3VR8 A;  5U1O A;  1RUD 4;  3AVS A;  2JK6 A;  4H2Q A;  4DMW A;  2GMJ A;  3UKK A;  5LP6 E;  3KVA A;  5IYZ E;  3Q5D A;  4H7U A;  3ZDN A;  4DID B;  3NTD A;  4KBM B;  1CBO A;  1BR0 A;  1D4E A;  1ZV4 X;  1FEC A;  3LAD A;  1B4V A;  3CND A;  1Q9I A;  2JB1 A;  5JCN A;  3NRN A;  1LPF A;  1ZOV A;  2HQM A;  1E1L A;  4TUY E;  2E9X D;  2YDS A;  1MMD A;  5FVK A;  5AQV B;  1PJ5 A;  2UUA T;  3RRC A;  4CZZ B;  5L3C B;  5C8Y E;  4DV6 T;  1O5W A;  2LRK A;  3DME A;  4NWZ A;  2D5U A;  1DXL A;  2AR8 A;  2IUB A;  2RR1 4;  2V6X A;  4ANJ A;  3UKL A;  3A8Y C;  3HZL A;  4H63 V;  4B6X A;  3FBL A;  4J33 A;  5DJQ C;  5LA6 E;  3RQW A;  1LVF A;  2BG9 E;  1M7K A;  1Q1W A;  2I6H A;  3C4Z A;  1TDE A;  4C5O A;  5AQF B;  5HAX A;  3RHW A;  3M65 A;  4IA6 A;  3CNJ A;  4DR4 T;  4X1K E;  4GAP A;  4Q25 A;  4UF0 B;  3NH3 X;  3AAI A;  3OZ2 A;  3DK8 A;  1KFY A;  1CJ4 A;  3UKP A;  3N9L A;  5KVH A;  2V8S V;  1GT8 A;  2GH5 A;  3KVB A;  2W2U A;  4A65 A;  4YJ3 E;  3RKG A;  1VRB A;  2YLW A;  2WSS V;  3ANW A;  3RI5 A;  5AQS B;  4JI5 T;  3SRZ A;  4AT0 A;  4B65 A;  5L4E A;  2NOX A;  4AQY T;  2XAS B;  1FIO A;  2O9Z A;  5EBK A;  5IHY A;  3D0T A;  1JRZ A;  2V61 A;  3NTA A;  3V3N A;  1VBB 4;  2VOU A;  4BJY A;  3GMC A;  3ANW B;  1TRB A;  5ABG A;  2LJL A;  3FBS A;  4H4X A;  2PBI A;  3K3Q C;  5EK3 A;  4JI4 T;  2CXD A;  4X66 T;  5HXI A;  4U8O A;  4AOX A;  1NDA A;  4ECH A;  1VBC 4;  4P0B A;  3X1D A;  4JV5 T;  4NNJ A;  4H4W A;  2E4G A;  4H9P C;  4BUR A;  4Z90 A;  4HWD A;  4QH1 A;  4YXD A;  1R8I A;  3AE5 A;  3B57 A;  3CIR A;  2EQ6 A;  3D8X A;  1LJ1 A;  2GMH A;  5AQP B;  1EZ3 A;  4ILB A;  4U31 A;  5HCM A;  4PJN A;  2D9D A;  2XQ3 A;  4BK1 A;  4WYV A;  2JQQ A;  5FP3 A;  4A5X A;  2L8K A;  2V5Z A;  4U8K A;  2VAS A;  4FK1 C;  4UIG A;  5HXE A;  2W63 A;  4GKK T;  1W09 A;  4LF8 T;  4HFC A;  3TLU A;  4RG3 A;  2VKJ A;  4B1B A;  4Y4N A;  2WAU A;  3GQH A;  5JVD E;  2XLS A;  3G5R A;  5M10 A;  1OED C;  2VVN A;  5FNV E;  4O2A E;  3KD9 A;  4OYK A;  1TYP A;  3G5S A;  1UGO A;  2Y6X A;  3LSV A;  4H4Y A;  4F6R C;  4NTC A;  2WDR A;  2BZB A;  4UV8 B;  2YG6 A;  3PUR A;  4II2 A;  1P2E A;  1YQ3 A;  3FIM B;  2LHR A;  2R06 4;  2CPT A;  3RIU C;  3FZM B;  5HYA A;  5FL0 A;  4ZI7 E;  1ZY8 A;  2XLU A;  4LMK A;  4NIQ A;  3SS1 A;  2X9X A;  4K7Z A;  4RHV 4;  1RYI A;  2B1E A;  1IUW A;  4DV7 T;  5AQQ B;  4IDN A;  2E9X B;  2CDU A;  4UXN B;  5HEU A;  2C72 A;  2XFN A;  2A72 A;  3OYX A;  3UOZ A;  4O2B E;  4AP3 A;  1S94 A;  2OV9 A;  3S4U A;  3QJ4 A;  4X4J A;  4EQW A;  2UUB T;  3ZMT B;  4KUM B;  2CMR A;  1MQT D;  3Q9T A;  3BNM A;  3P8C D;  5JDF A;  2X8H A;  4EMI A;  4ILU A;  2BBH A;  4Z2U A;  3AA1 B;  3PU3 A;  3VKH A;  1LTX R;  4C77 A;  1HRV 4;  3QSE A;  2W0G A;  4A99 A;  3G5Q A;  3LZX A;  1H7W A;  2QA1 A;  1VCS A;  1E1K A;  3ICT A;  2RGH A;  4IDP A;  3PUA A;  2J3N A;  5LYJ E;  3GD4 A;  5IPY A;  3ZT5 A;  4ADZ A;  4B66 A;  2K3W A;  1M6I A;  2IVD A;  2WZI A;  2C4C A;  3AEE A;  5JRC A;  4ILA A;  1W0A A;  3AD9 B;  1GND A;  5HXH A;  2OA1 A;  2R9Z A;  4UR9 A;  2Y6R A;  4A6N B;  3FPZ A;  3AE8 A;  1GRG A;  2A87 A;  2VVL A;  3T2K A;  3FG2 P;  2KLQ A;  3VR9 A;  5LBQ B;  2PHH A;  2GQF A;  3OTO T;  4XZC A;  3CX8 B;  4EQX A;  2B9X A;  3OPC A;  3SQP A;  4M1P A;  5KNL A;  4H4U A;  1ZEE A;  1Y56 A;  2UU9 T;  4ZI2 D;  1PBF A;  4TZ4 C;  1XNR T;  3FZL B;  3JC6 C;  1X79 A;  3CPZ A;  3GYJ A;  2X3N A;  4OVI A;  4E0V A;  4CN6 A;  2HN1 A;  4ZN0 A;  5CB4 E;  5L47 A;  1AJ3 A;  3OVU A;  3AA0 B;  1AL2 4;  5FY0 A;  1EAH 4;  1VBE 4;  5KDM C;  4DUZ T;  3RC8 A;  1ZX9 A;  4P0A A;  1UX4 A;  4IHJ E;  4YHH T;  1H81 A;  1T7S A;  4HWF A;  3PJA J;  5J0Z A;  2AE9 A;  3GDP A;  5HWY A;  3RED A;  4H9N C;  1UX5 A;  2XJ7 A;  4TWH A;  1O94 A;  4TNV A;  1ONF A;  3AYL A;  1JRX A;  3ONX A;  4ZZB A;  4ZOL E;  2A8X A;  2CEA A;  4B3M T;  2WU5 A;  3CNS A;  2UZZ A;  1HYU A;  2R4E A;  2CBJ A;  1NPX A;  2CFY A;  3IWA A;  2RPA A;  4AP1 A;  2UXN B;  3E22 E;  2CCQ A;  2B7S A;  2QYW A;  4GB3 4;  1VRH 4;  2GF3 A;  4XAX B;  3FXD B;  2CVJ A;  3T14 A;  4HFE A;  2WS3 A;  2CWO A;  4JBW F;  2A89 A;  2JBV A;  2QA2 A;  3IBP A;  4ZZC A;  2DWK A;  4BK2 A;  5CFB A;  3C4A A;  1PBC A;  3BQI A;  3CVR A;  2FBW A;  2X0Y A;  4DUY T;  3KVE A;  2DKH A;  1X31 B;  4QWN B;  4YFS A;  3K1S A;  4PJL A;  3J9X 1;  3GN5 A;  2Z5X A;  4UEM A;  5L3D B;  3I3L A;  5FMN A;  2NPX A;  2B76 A;  2W4X A;  3AXJ A;  3Q5E A;  2GVC A;  4IA5 A;  4AKH A;  1GQE A;  1N36 T;  4DBQ A;  2OAL A;  2N9D A;  1D0Z A;  1RHI 4;  4EMJ A;  4GK5 E;  3T2Z A;  4DSH A;  3CMM A;  1N4W A;  3BQL A;  2VQF T;  2YR4 A;  3P4R A;  3P4Q A;  4EED A;  2CXF A;  4UDP A;  1K5M D;  4HGA A;  4DV2 T;  1NHQ A;  2LM9 A;  4U2L A;  2PYJ A;  5CA1 E;  4NUV A;  1VDC A;  1DU2 A;  2WU2 A;  4HKA A;  4J34 A;  4WBN E;  2Y8D A;  3KLJ A;  3H37 A;  4H2N A;  3NYC A;  3HKC E;  2V1D B;  1PVC 4;  4OFZ A;  4ZI3 D;  3OKQ A;  1UUR A;  3VKG A;  4LF4 T;  1TDO A;  3DJJ A;  3WE0 A;  1XDO A;  5KRQ A;  1POV 0;  4JQ9 A;  1ZMC A;  3IEE A;  2J4G A;  4J36 A;  4E7Z A;  3UU3 A;  1IUV A;  4Z44 A;  3S5W A;  2GR2 A;  3GMI A;  3N2O A;  4FK1 A;  3UU6 A;  2IDO B;  2K24 A;  3URH A;  2Q9Q A;  3NT6 A;  3AEB A;  4UDR A;  4M52 A;  2MTQ A;  2R07 4;  3GWF A;  2KND A;  4IE5 A;  3RQU A;  3NZQ A;  2VUR A;  2OAM A;  2XTL A;  4MBQ A;  2XCG A;  2I0M A;  4C91 A;  4YJ2 E;  2XQ5 A;  3N9Q A;  2AQJ A;  1HNW T;  4P09 A;  5LXT E;  2VL0 A;  3FZF B;  4LF5 T;  4EQR A;  4YHJ A;  2R04 4;  4LU6 A;  3HA4 A;  4IGU A;  2ZMA A;  2XFO A;  1VBD 4;  3QB5 A;  4CY6 A;  4LF9 T;  4U8N A;  2ZZB A;  3C96 A;  2C3C A;  1BEV 4;  2VRL A;  4AKG A;  4PJJ A;  3BI5 A;  2A2F X;  4K0K T;  4Z26 A;  1HF8 A;  3RP6 A;  3SM8 A;  3BHK A;  3G06 A;  2VQE T;  4G6H A;  2M6B A;  4EIQ A;  1T98 A;  4LF7 T;  1NAA A;  3ATR A;  4Q4W 4;  4P9S A;  3KU9 A;  4H4Q A;  5F3J A;  4GRT A;  2LOP A;  3A7M A;  4A56 A;  5IQ1 A;  2X99 A;  4FJO A;  4X9M A;  2IC9 A;  2R6G F;  2BK3 A;  5EK2 A;  1MO9 A;  1OJA A;  1PJ6 A;  2LEH A;  5JCK A;  1VQW A;  1XDP A;  3FBZ A;  1MIW A;  4FDC B;  1U5P A;  1BGJ A;  1NAF A;  4MAL A;  2EX3 A;  1FCD A;  3C64 A;  3NWI A;  4PK4 A;  2C75 A;  2Q9Q B;  5JR9 B;  2UXX B;  4KX6 A;  4N9X A;  4LMJ A;  4WZX A;  4EV6 A;  2XY8 B;  1MOK A;  1H6V A;  3TKL B;  3OC4 A;  1NHR A;  3N5L A;  1CF3 A;  1H83 A;  2BK4 A;  4B69 A;  2XHE B;  2YLZ A;  3F2E A;  4IDO A;  4JI8 T;  1MMA A;  3C51 A;  2BXS A;  2J1D G;  2HPJ A;  3FMW A;  2FUP A;  2C5J A;  4G63 A;  1W4X A;  5BR8 T;  5KMP A;  2N2N A;  3AD8 B;  1EL9 A;  3RRW A;  2FJA A;  1OED A;  1YD8 G;  3WAJ A;  2XLR A;  3P50 A;  1V59 A;  1GSN A;  4YSH A;  1Z8U A;  4DV5 T;  3KV5 A;  2R46 A;  4IST A;  2WPC A;  1J1J A;  5LG4 A;  4EQS A;  2LSJ A;  3MKD A;  1HG2 A;  2IIU A;  3R84 B;  3DJB A;  1RUC 4;  2JKC A;  4K5S A;  5FKY A;  4U2S A;  4Y4L A;  2PTF A;  5HEH A;  4OCG A;  4LFC T;  4XBF B;  1PJ7 A;  1JNZ A;  1V9D A;  2C5I T;  2PZS A;  1VBA 4;  4B68 A;  3HR0 A;  2JPF A;  4DR6 T;  1F6M A;  2V7J A;  1QSD A;  2LHN A;  3NN6 X;  4HB9 A;  4TV9 E;  3ADA B;  2BK5 A;  3VRA A;  2VL8 A;  3HKE E;  5LNK A;  3KBT A;  3AB3 B;  1CJC A;  5FY1 A;  1FMW A;  4PK6 A;  4B63 A;  3ZN0 B;  5HEO A;  2R45 A;  4HA6 A;  1XHX A;  3LBX B;  4KPR A;  4EYU A;  3AWI A;  3LK4 2;  1W0B A;  2YWL A;  4ZCC A;  4DR2 T;  1RSG A;  5DQW A;  2MAW A;  3UCL A;  2WDV A;  2XAG B;  3RP8 A;  5FXZ A;  3RIA A;  1PO2 4;  3NLC A;  1QLB A;  4EM4 A;  4DR1 T;  4YY3 T;  5AFU L;  1KEY A;  4ZCD A;  4MJW A;  1N4U A;  3CWZ B;  5AQO B;  1HG5 A;  2GQW A;  3SZF A;  2V7M A;  3EVY A;  2HPL A;  2D0U A;  4IT4 A;  3CQG B;  2C66 A;  3MZK B;  5IQ4 A;  1K0J A;  3CGD A;  4TNW A;  3M0O A;  4NEW A;  2BKN A;  1Z7S 4;  4LII A;  4TM4 A;  3AE2 A;  4C3X A;  5FYM A;  3EAN A;  2XVE A;  3T37 A;  2V26 A;  3EHZ A;  4H2R A;  3CGC A;  2WOV A;  2QCU A;  1QO8 A;  2E9X C;  5KOX A;  3PUZ F;  3CPH G;  2V60 A;  5LBM A;  4WBO A;  3AEF A;  5L3B B;  2RGJ A;  3ZMV B;  1H7X A;  1HX1 B;  1SUM B;  2GR1 A;  1XHZ A;  2HWC 4;  1O3X A;  3LZW A;  4WNK A;  1KF6 A;  5FY7 A;  3RIF A;  2X68 A;  1LKX A;  1JOA A;  1N33 T;  4NXN T;  3SYI A;  3UOX A;  3B5M A;  1CL0 A;  5L3G B;  5JQG E;  4C74 A;  2PYL A;  4H50 A;  5CKU A;  5ABF A;  1D0Y A;  4GYR A;  3UFE A;  3ATQ A;  1K0L A;  4U8I A;  3QFA A;  1RUH 4;  4OPG A;  3SUC A;  1TDN A;  3H8I A;  1F8R A;  1OED E;  2QAE A;  3DH9 A;  2XAH B;  3NK0 X;  2XLP A;  2ZM0 A;  3C4X A;  2H7O A;  4UVB B;  3RYI E;  2ACZ A;  5EK4 A;  2CBI A;  1BZL A;  4H4Z A;  1GET A;  4I58 A;  2H89 A;  1AR8 4;  1E1H B;  3NNE A;  5FS6 A;  1GRH A;  3C4N A;  2X9H A;  4OHF A;  5F8P A;  1F8S A;  3I6D A;  3P4S A;  4HFD A;  5AQU B;  1P2H A;  2W66 A;  3QK6 A;  4U33 A;  1YW0 A;  4L9I A;  4DV3 T;  5LGU B;  3PV0 F;  3GQK A;  4HTE A;  4NXM T;  2A9U A;  3RF1 A;  4EYY R;  4IVM B;  1WR6 A;  2JAE A;  3QSM A;  2V5D A;  2FJD A;  3U3I A;  4CQI A;  4PDW D;  5HEJ A;  4PAA A;  4ZI3 C;  1AR9 4;  4BJN A;  2X9Y A;  5JH7 E;  1E7P A;  3OJA A;  4PJM A;  1E1M A;  4JEH B;  3SY4 A;  4PK5 A;  3L1R A;  1L9C A;  3UUL A;  1IUT A;  3AAE B;  2NVK X;  5AQT B;  5KMQ A;  4LF6 T;  2GEW A;  2YLX A;  2BG9 C;  3RH3 A;  3PU8 A;  3UQ4 A;  2FJB A;  3ALM A;  2X0H A;  1HRI 4;  4XXG A;  4AIS A;  4AQG A;  3ESL A;  3BI4 A;  4UEL A;  3UP5 A;  5HXC A;  3LXD A;  3MJX A;  4YSY A;  1NG4 A;  2H88 A;  4JN9 A;  3NRY A;  2E5V A;  2RS5 4;  4JI1 T;  5FL1 A;  3NZP A;  4UVA B;  3Q6J A;  1D4C A;  1KDG A;  4BK3 A;  4ISS A;  4DR3 T;  4DR7 T;  3L09 A;  1NA1 D;  2PJQ A;  4REK A;  5HY5 A;  3V5S A;  2EHO B;  2F5Z A;  2C64 A;  3ZKR A;  4AXP A;  4DV0 T;  2UUC T;  5BUK A;  2YDR A;  2UXC T;  5IWA T;  2C5K T;  2R7F A;  2Z5Y A;  1ZOY A;  4ZHQ E;  3OBV E;  3E0Z A;  4Z91 A;  1GTH A;  1ZMD A;  5AQG B;  1UUS A;  3F8R A;  2XVI A;  2OA5 A;  2E9X A;  4JI2 T;  4PFO A;  1DOB A;  3IF9 A;  3O1I A;  2CLY C;  2PW9 A;  2KIN B;  5L2L A;  1BR1 A;  5BRT A;  3FZK B;  4I43 B;  1COV 4;  2NW8 A;  3VRD B;  1LVK A;  4YLH A;  2EQ7 A;  4DVD A;  1OOP D;  4HEA A;  2JRK A;  5HHF A;  1WCR A;  3FB2 A;  3CTY A;  1VRQ B;  3UUM A;  2GB0 A;  2EQ8 A;  2DWG A;  4O4L E;  2LSY A;  1GRT A;  1PXA A;  5HWX A;  4ILC A;  4EEB A;  2Q0L A;  3JD7 4;  4CI3 B;  3PS9 A;  3ZT7 A;  4CXX A;  2XQ7 A;  1VG0 A;  3AE3 A;  3H3A A;  3ZN1 B;  4Q4X 4;  3PUX F;  4GYS A;  1LVL A;  3NKS A;  4A7A A;  1U4Q A;  3UTE A;  2VVM A;  5KMG P;  1PXB A;  1PXC A;  3MA9 A;  1LRZ A;  3P4W A;  3LK2 B;  2VRM A;  2YLT A;  4Y4M A;  3CGB A;  2Y48 B;  4Z24 A;  3ETV A;  4YKG A;  1D7L A;  3ZEF B;  1ZK7 A;  1WR0 A;  2YR5 A;  2VQ7 A;  3KBU A;  3QNU A;  5ER0 A;  1FEW A;  2XQA A;  3CX6 B;  1HCI A;  2H3R A;  2W61 A;  4UDQ A;  1SEZ A;  3EDU A;  3ZCI A;  4JY2 A;  1NHS A;  1EL5 A;  4U2Y A;  1YKH B;  2BG9 B;  3F8D A;  5GON E;  1HXS 4;  4DV4 T;  2XAQ B;  3HYV A;  5KXJ A;  4K5R A;  2ES0 A;  2XUE A;  1RUF 4;  2DHR A;  1FMV A;  3VU7 H;  3CKD A;  4DGK A;  2YOE A;  4C90 A;  2V6Y A;  2W67 A;  3COX A;  4KMC A;  4U7I A;  3AYJ A;  4F8H A;  4CXY A;  2DL1 A;  4BAY B;  4IVO B;  4OYJ A;  1WYC A;  4I4T E;  3RHA A;  2ODU A;  1XWM A;  2LT3 A;  3IHG A;  5LHH B;  5BMV E;  5FXW A;  1JRY A;  3JAE A;  1AOG A;  2YG4 A;  2BXR A;  1NEK A;  5AQL B;  3RLF F;  2ARD A;  3PUS A;  1D0X A;  2W0H A;  3EAM A;  4ZS2 A;  1OXZ A;  2H7V C;  3LB8 A;  3NIX A;  4MHC A;  1PN0 A;  2ACX A;  5GSN A;  3C98 B;  2RAB A;  4I59 A;  1S3E A;  1AR6 4;  2WP6 A;  4K22 A;  2YEV C;  2OLO A;  4JUY A;  4HFI A;  4I50 E;  3L39 A;  2PY5 A;  4GIW A;  4CCR A;  4LFA T;  2C76 A;  4TX5 A;  2Q6U A;  4BJZ A;  3PJA A;  3GYI A;  2E5L T;  1L0V A;  4PAB A;  2BDE A;  2PFV A;  3NGC X;  4EOZ B;  4QXB B;  1J5E T;  4O4H E;  3HI2 A;  1H86 A;  3NYF A;  2WY2 A;  1K4Q A;  1PBB A;  3B6D A;  3J8F 4;  2XQ8 A;  3SZW A;  2YKS A;  3CX7 B;  4ZI2 C;  3NK2 X;  3L8K A;  3R9U A;  3JC6 D;  4JYA T;  3M13 A;  4OPU A;  4CI1 B;  2K48 A;  1KK7 A;  1MXT A;  1SHZ C;  4OPL A;  3UT5 E;  3EPT A;  3II4 A;  2KXP B;  2BS2 A;  2LRL A;  1BWC A;  2LSI A;  4O4J E;  1MMG A;  3ZST A;  2D2S A;  4CRT A;  1BKW A;  1D1A A;  3IA3 A;  2LE8 A;  5EOW A;  2DCF A;  5E0O A;  2VZ2 A;  2X0L B;  4EGW A;  1UCU A;  1F3P A;  2V6Y B;  2XFU A;  4IRE A;  3PUQ A;  3KV4 A;  1XPQ A;  3ZJ1 A;  4B3R T;  3ALJ A;  1K0I A;  2NTY A;  5LHI B;  3GWD A;  2GAG B;  5FS7 A;  2X51 A;  1GER A;  3A5X A;  2KSR A;  4JI3 T;  2GV8 A;  3WI3 A;  2BKP A;  3ZYX A;  3PUY F;  3TLW A;  2BBJ A;  4H4V A;  2UXD T;  2BVM A;  3ZYL A;  1ASJ 4;  3GDN A;  1RUG 4;  5CQF A;  5JCL A;  3N9O A;  3GMB A;  2WP5 A;  2WWU A;  4ASK A;  3VHL A;  3FI7 A;  4YWO A;  4U3C A;  5AQI B;  4J57 A;  1LV0 A;  3PDY A;  2CM0 A;  3IF8 B;  1I6Z A;  4K8D A;  1HTJ F;  4EAH A;  4H9Q C;  1D4D A;  1D7Y A;  5AQK B;  3RX6 A;  4YTP A;  3AE7 A;  3UTK A;  3I0O A;  4WCT A;  3HKD E;  2RM2 4;  4KI0 F;  4YKF A;  1D5T A;  2ZBW A;  3K3O A;  4Z43 A;  2LM2 A;  4TN7 B;  4JLE A;  4JEU B;  3DK9 A;  5LV9 A;  1HFA A;  3O4X E;  3RIU A;  1ZKE A;  3JAD A;  3SGL A;  2WES A;  3UKH A;  2QRX A;  1WLX A;  4BA9 A;  2UXB T;  4AKL A;  4YTN A;  4B3T T;  3F8P A;  5CGM A;  3UU4 A;  4CI2 B;  2X66 A;  3CNT A;  4UV9 B;  2R0P A;  4FI5 A;  1KNZ A;  1G73 A;  2K9A A;  2CLY B;  2B7R A;  5KX5 E;  1XAN A;  5TAO A;  3C4W A;  1QUU A;  3BQK A;  1D1C A;  1Z0P A;  4HE8 A;  5DQV A;  2APG A;  2YLR A;  3N2G E;  1XDI A;  5LMN T;  2J47 A;  3DGH A;  2FJE A;  4IIJ E;  2YG7 A;  4Z2R A;  1DJN A;  3ONL C;  4J56 A;  5DBJ A;  2LKG A;  3ZSS A;  2NW7 A;  3KIN B;  2IC6 A;  2NWB A;  5JDL A;  2Q0K A;  2YU1 A;  3PE0 A;  1OJT A;  3T0K A;  5U25 A;  4G6G A;  1IJ6 A;  2CXL A;  3NBX X;  2MPK A;  3Q5W A;  3Q2M A;  3DGZ A;  1S2Y A;  1Y01 A;  1SE7 A;  4OPD A;  3AEA A;  2X8C A;  4QX8 B;  3N2K E;  3L3P A;  4Q4Y 4;  2VVS A;  3I0Q A;  4U7Y A;  1B37 A;  3AED A;  4Z8X A;  3QB5 K;  3UKQ A;  5J1G A;  3C50 A;  5H6R B;  3U78 A;  3SFE A;  1IUX A;  4BV6 A;  3P4P A;  3HYW A;  3AXJ B;  3GYX A;  3I9Y A;  2ZM6 T;  1JNR A;  3EDV A;  3KPF A;  2SPC A;  5ETW A;  4MFR A;  1LQU A;  2C65 A;  4JI6 T;  2YDQ A;  2WBL A;  4QXC B;  4A9W A;  5JCM A;  3AEG A;  3EAO A;  2RS3 4;  2BG9 A;  3QVR A;  4JY3 A;  2X67 A;  2W00 A;  4PW8 A;  1IBL T;  3GRS A;  5CJ5 A;  2Y6Q A;  4IE7 A;  1UK5 A;  3BI2 A;  5ADX L;  2ZZC A;  3CN8 A;  2X5I D;  1F8W A;  4LFB T;  2VKH A;  3K7M X;  4AKI A;  3ZYM A;  1DOD A;  3ITJ A;  4BJM A;  4QX7 B;  4TWD A;  3H4K A;  2E2A A;  2ZM2 A;  1D1B A;  2LKH A;  3FZH B;  5ABH A;  1WRD A;  2WEU A;  5JTG A;  1XZY A;  4GOU A;  3UTG A;  3I1A A;  1B8S A;  2PLV 4;  2BAB A;  4RG4 A;  2XDO A;  4IV9 A;  2XSB A;  4UP3 A;  4A5L A;  1PBD A;  3NYE A;  4U74 A;  4B3S T;  2ZZ0 A;  2RS1 4;  1WYB A;  5FXV A;  4E7S A;  3ABV A;  3HYX A;  2E8I A;  3MXZ A;  1EBD A;  3N9M A;  4H9O C;  4ZS3 A;  3UFG A;  1VOM A;  2RA1 A;  3DTO A;  4CCQ A;  3DA1 A;  4Q4V 4;  1BR4 A;  1GOS A;  4JDR A;  1MMN A;  1X9B A;  3UUX B;  4UVC B;  2YN6 A;  4B64 A;  2DNX A;  2XM2 A;  3UKA A;  2NTX A;  3H3M A;  2P9B A;  2V5C A;  4HWH A;  5FXX A;  4H9S E;  1DOC A;  2RGO A;  2WOI A;  4DNA A;  2W62 A;  4YSX A;  3UQ7 A;  2GR3 A;  3UU8 A;  5J7X A;  2XLT A;  2NR4 A;  4DMV A;  1PO1 4;  1MND A;  3IHR A;  3IC9 A;  1CC6 A;  2K5B B;  2JQH A;  4GCM A;  1BR2 A;  3T1Y T;  4AI6 A;  2JB3 A;  2XYO A;  3N9N A;  4PAG A;  3AB1 A;  4H4S A;  3NN0 X;  5J60 A;  5L3F B;  3NVO A;  1I94 T;  4QHO A;  2Q9Q D;  5L46 A;  3JAF A;  1ZP0 A;  3UKF A;  3RPU A;  2JMK A;  3ZC0 A;  5EB4 A;  5JDG A;  2EHO D;  1IJ5 A;  4H4T A;  4JNA A;  1G8X A;  3B13 A;  2DKI A;  5JRC B;  2D0T A;  2RP4 A;  1MIY A;  3NK1 X;  3J7Y q;  4I0U A;  3O1H A;  2Z6E A;  1DOE A;  1XMQ T;  1T72 A;  2XQ9 A;  3HL6 A;  1B5Q A;  4KHZ F;  2I59 A;  5M4Y A;  2YVG A;  3RP7 A;  2AAQ A;  2VVL G;  1QJD A;  3H8L A;  1NG3 A;  4AOS A;  3AEC A;  2BS3 A;  1ZKQ A;  2CWY A;  4O5U A;  1HNZ T;  2WHD A;  2CHO A;  4AKR B;  3DJD A;  4X1I E;  4H4R A;  1HX8 A;  3MK7 C;  2XAJ B;  3HKB E;  4EB6 E;  2V7K A;  4IL9 A;  3P7I A;  1UKV G;  3CNP A;  3TLS A;  3FXE B;  4B67 A;  2VKD A;  3DJE A;  1H8T D;  1RVF 4;  3PUG A;  1NCQ D;  3TLV A;  1Q1R A;  3ZLI A;  3ZJ2 A;  1WFD A;  1IUU A;  5KOW A;  2YM1 A;  2XZE A;  4PFP A;  3ALL A;  3PUW F;  5TR3 A;  3JBG 4;  2YU2 A;  4CN4 A;  4FX9 A;  4JNQ A;  2YG3 A;  3GA8 A;  1E6E A;  2BC0 A;  4CY8 A;  3GN5 B;  5AQJ B;  1L9E A;  5H6Q B;  4ZXL A;  3SFD A;  2WOW A;  5C3J A;  4G2A A;  4G9K A;  2X8G A;  3UUB A;  1KNP A;  2GK9 A;  2MBG A;  3LK3 B;  4X5T A;  5AQM B;  1N32 T;  3ZT6 A;  2QA7 A;  5LGT B;  1Y56 B;  4COF A;  1S35 A;  4MLK A;  4CNJ A; 
#chains in the Genus database with same CATH homology
 1PJ5 A;  1YKJ A;  4TLX A;  4X9M A;  2BK3 A;  3VQR A;  1MO9 A;  1OJA A;  1PJ6 A;  4IVO B;  1O5W A;  2YR6 A;  3DME A;  1VQW A;  5JCK A;  4NWZ A;  4FDC B;  1BGJ A;  1H82 A;  3RHA A;  1FCD A;  1EL7 A;  2IVE A;  1JRY A;  2C75 A;  1DXL A;  2AR8 A;  3IHG A;  1EL8 A;  1AOG A;  2YG4 A;  2BXR A;  1GRB A;  3UKL A;  1NEK A;  4KX6 A;  4N9X A;  1MOK A;  1H6V A;  3HZL A;  2ARD A;  5EB5 A;  2YQU A;  3OC4 A;  4J33 A;  3K7T A;  1NHR A;  1CF3 A;  1H83 A;  2BK4 A;  4B69 A;  2W0H A;  2YLZ A;  1Q1W A;  1Y0P A;  4GDP A;  4ADW A;  1TDE A;  4C5O A;  3LB8 A;  3NIX A;  1KSS A;  4IA6 A;  1PN0 A;  3CNJ A;  5GSN A;  2RAB A;  4I59 A;  2BXS A;  1S3E A;  1CC4 A;  4GAP A;  3FMW A;  2WP6 A;  3NH3 X;  3OZ2 A;  4K22 A;  1W4X A;  3DK8 A;  1KFY A;  1CJ4 A;  3UKP A;  2OLO A;  2XFQ A;  4CNK A;  4RSL A;  5KMP A;  4CCR A;  5KVH A;  1GT8 A;  2GH5 A;  3AD8 B;  1O95 A;  1EL9 A;  2C76 A;  1GRA A;  4A65 A;  2Q6U A;  4BJZ A;  2FJA A;  3GYI A;  5KVI A;  3UOY A;  2IID A;  1L0V A;  2BRA A;  2YLW A;  4PAB A;  2XLR A;  3NGC X;  1V59 A;  3PO7 A;  1GSN A;  4YSH A;  2XVH A;  2R46 A;  4XWZ A;  4AT0 A;  2WPC A;  4B65 A;  3CPJ G;  3BHF A;  1H86 A;  3NYF A;  4EQS A;  1K4Q A;  1PBB A;  2O9Z A;  3B6D A;  2YAU A;  5EBK A;  3QFB A;  2JKC A;  4K5S A;  1COY A;  3SZW A;  3E1T A;  1JRZ A;  3NK2 X;  3L8K A;  4U2S A;  3R9U A;  2V61 A;  3NTA A;  4Y4L A;  3V3N A;  2VOU A;  4BJY A;  3GMC A;  3M13 A;  4GAV A;  1PJ7 A;  1JNZ A;  1GTE A;  4OCG A;  4OPU A;  1TRB A;  1MXT A;  3CGE A;  4B68 A;  4OPL A;  3EPT A;  2WDQ A;  3II4 A;  4O5Q A;  2BS2 A;  1BWC A;  1DJQ A;  1F6M A;  1ZDL A;  2WPF A;  4NTD A;  4OPC A;  3FBS A;  1H84 A;  4XWR A;  3K7Q X;  4H4X A;  4CRT A;  1PDH A;  1IJH A;  1BKW A;  5HXI A;  3NN6 X;  4HB9 A;  4U8O A;  3ADA B;  5EOW A;  1NDA A;  4AOX A;  2BK5 A;  4ECH A;  2VZ2 A;  4NNJ A;  2V3B A;  3PVC A;  2I0Z A;  4H4W A;  2E4G A;  1F3P A;  3VRA A;  3DJG X;  4BUR A;  2XFU A;  4YXD A;  1CJC A;  1XPQ A;  3ALJ A;  4WX1 A;  3AE5 A;  4EM3 A;  3AXB A;  4GUV A;  1K0I A;  3CIR A;  2R0G A;  2EQ6 A;  3D8X A;  1LJ1 A;  2GMH A;  3GWD A;  4B63 A;  1E1N A;  2GAG B;  5FS7 A;  4BK1 A;  2R45 A;  4HA6 A;  1GER A;  4KPR A;  2BA9 A;  2V5Z A;  1ELI A;  3AWI A;  4U8K A;  1PHH A;  2GRT A;  4FK1 C;  2GV8 A;  3UP4 A;  3BNU A;  2YWL A;  4ZCC A;  1RSG A;  4RG3 A;  4X9N A;  1YY5 A;  4B1B A;  4Y4N A;  3GQH A;  1FL2 A;  1S3B A;  2BAC A;  3ZYX A;  1PBE A;  4H4V A;  3UCL A;  2XLS A;  2WDV A;  5C2T A;  3G5R A;  4USR A;  5M10 A;  3RP8 A;  1NEN A;  2YVF A;  1YQ4 A;  3KD9 A;  1TYP A;  1KNR A;  2C70 A;  3G5S A;  3GDN A;  3NLC A;  1QLB A;  1XHC A;  4EM4 A;  5CQF A;  4H4Y A;  5JCL A;  3GMB A;  2WP5 A;  2B9W A;  3ISH A;  4ZCD A;  2GAH B;  4NTC A;  4MJW A;  2WDR A;  4YWO A;  4J57 A;  1N4U A;  2YG6 A;  3NG7 X;  4II2 A;  1LV0 A;  2WP9 A;  2V6O A;  1P2E A;  1YQ3 A;  3FIM B;  2GQW A;  3AE9 A;  4OPT A;  3SXI A;  3SZF A;  4EMW A;  1NHP A;  2BC1 A;  4K8D A;  2C66 A;  3T31 A;  1ZY8 A;  5IQ4 A;  1D4D A;  1D7Y A;  1K0J A;  2XLU A;  3CGD A;  3M0O A;  4II3 A;  2WBA A;  4NEW A;  2YG5 A;  4YTP A;  4K7Z A;  1GV4 A;  3AE7 A;  4TLZ A;  4LII A;  1JU2 A;  1RYI A;  4TM4 A;  4WCT A;  3P1W A;  3AE2 A;  3P9U A;  4J31 A;  4C3X A;  1IUW A;  3EAN A;  2XVE A;  1BGN A;  3T37 A;  4H2R A;  4NEV A;  4YKF A;  3CGC A;  2WOV A;  2QCU A;  2CDU A;  2BCP A;  3M12 A;  1BF3 A;  1D5T A;  2C72 A;  2XFN A;  2ZBW A;  4Z43 A;  4Z2T A;  1QO8 A;  5KOX A;  1OJC A;  3UOZ A;  3CPH G;  2V60 A;  4AP3 A;  3QJ4 A;  4X4J A;  3DK9 A;  5FS8 A;  4EQW A;  3AEF A;  2YLS A;  5LV9 A;  2RGJ A;  1H7X A;  3SGL A;  2GR1 A;  3Q9T A;  2TMD A;  2WES A;  3BNM A;  3UKH A;  2X8H A;  4ICY A;  4EMI A;  3F8P A;  3LZW A;  4H2P A;  4YTN A;  4NTE A;  5KMS A;  4Z2U A;  1LTX R;  4C77 A;  1KF6 A;  3QSE A;  2EQ9 A;  3CNT A;  4A99 A;  2R0P A;  3G5Q A;  1JOA A;  3LZX A;  1H7W A;  2QA1 A;  5FMH A;  1E1K A;  3SX6 A;  3ICT A;  3QVP A;  2RGH A;  2B7R A;  2XVF A;  1GAL A;  2J3N A;  4U8P A;  1XAN A;  3SYI A;  3UOX A;  1CL0 A;  3GD4 A;  4C74 A;  4H50 A;  5BUL A;  3AE4 A;  5IPY A;  5CKU A;  4GR1 A;  3RNM A;  4B66 A;  1M6I A;  3ATQ A;  1K0L A;  2APG A;  2YLR A;  2IVD A;  4U8I A;  1XDI A;  3QFA A;  2C4C A;  4TM1 A;  4OPG A;  3AEE A;  2BYB A;  5GRT A;  3DGH A;  3SUC A;  1TDN A;  2FJE A;  3UTH A;  4U8J A;  3AD9 B;  1GND A;  2YG7 A;  2YVJ A;  3H8I A;  3AYI A;  4Z2R A;  1F8R A;  2OA1 A;  1DJN A;  2R9Z A;  4OPI A;  2Y6R A;  4J56 A;  4A6N B;  2BRY A;  2QAE A;  3FPZ A;  3AE8 A;  3DH9 A;  3NK0 X;  5DBJ A;  4GF7 A;  3UOV A;  3AE1 A;  1GRG A;  1TDK A;  2A87 A;  2VVL A;  2XLP A;  3B3R A;  2TPR A;  2WQY A;  2Q0K A;  3T2K A;  3FG2 P;  3VR9 A;  3LOV A;  4DSG A;  2ACZ A;  1OJT A;  2B9Y A;  1BZL A;  2Q7V A;  4H4Z A;  4G6G A;  5U25 A;  1GET A;  4I58 A;  3T0K A;  2H89 A;  2PHH A;  2GQF A;  2XVJ A;  1FEA A;  3DGZ A;  1S2Y A;  3NNE A;  5FS6 A;  4EQX A;  1FOH A;  1GES A;  2B9X A;  4OPD A;  3AEA A;  1GRH A;  3SQP A;  3C4N A;  1TYT A;  5KNL A;  4G74 A;  2X8C A;  4H4U A;  1Y56 A;  3K30 A;  1F8S A;  3I6D A;  3P4S A;  1PBF A;  4EIP A;  1B37 A;  3AED A;  3UKQ A;  1P2H A;  3SFE A;  1IUX A;  4BV6 A;  3P4P A;  3HYW A;  1OJ9 A;  3GYJ A;  2X3N A;  1OJD A;  3GYX A;  3NHO X;  4GDE A;  4OVI A;  4E0V A;  1JNR A;  3AE6 A;  3KPF A;  4ZN0 A;  3GQK A;  1LQU A;  2C65 A;  4A9W A;  5JCM A;  1L9D A;  1ZX9 A;  3SZC A;  4IVM B;  3AEG A;  2JAE A;  3EAO A;  3QSM A;  2FJD A;  2GR0 A;  4AT2 A;  3IHM A;  3QVR A;  1DNC A;  1REO A;  1S2Q A;  3LJP A;  4JY3 A;  4TM3 A;  1H81 A;  4PAA A;  4APN A;  3GRS A;  2Y6Q A;  3GD3 A;  3BI2 A;  3KKJ A;  2ZZC A;  3CN8 A;  3SZ0 A;  4D03 A;  1F8W A;  3D1C A;  3GDP A;  1E7P A;  3RED A;  1E1M A;  5M0Z A;  4YSZ A;  3K7M X;  3SY4 A;  1O94 A;  1N4V A;  1ONF A;  3AYL A;  1DOD A;  1JRX A;  1KSU A;  1L9C A;  2C7G A;  3ITJ A;  3L1R A;  3DK4 A;  1IUT A;  2NVK X;  3H4K A;  3T2Y A;  4A79 A;  3GSI A;  5KMQ A;  1FEB A;  2GEW A;  2YLX A;  2A8X A;  2XFP A;  2FJB A;  3ALM A;  2WU5 A;  1TDF A;  2WEU A;  3CNS A;  4USQ A;  4XXG A;  2UZZ A;  1HYU A;  3UTG A;  3BI4 A;  2R4E A;  1NPX A;  2CFY A;  3UP5 A;  1B8S A;  3IWA A;  2BAB A;  4RG4 A;  3LXD A;  2XDO A;  4IV9 A;  4A5L A;  2B7S A;  4UP3 A;  5U63 A;  4YSY A;  1PBD A;  4AP1 A;  3NYE A;  1NG4 A;  2WET A;  2ZZ0 A;  2H88 A;  1JEH A;  2GF3 A;  4U8L A;  2BCG G;  4JN9 A;  3ABV A;  2WPE A;  3HYX A;  2E5V A;  1PS9 A;  1EBD A;  2CVJ A;  3T14 A;  3S61 A;  2WS3 A;  5KWF A;  2A89 A;  2QA2 A;  2JBV A;  3Q6J A;  4BK2 A;  1D4C A;  4LA1 A;  1KDG A;  3C4A A;  4BK3 A;  1PBC A;  3DA1 A;  4CCQ A;  1GOS A;  2FBW A;  3KVE A;  4JDR A;  1LQT A;  5FS9 A;  4REK A;  5HY5 A;  2DKH A;  1X31 B;  2F5Z A;  4TM0 A;  2C64 A;  1M64 A;  4B64 A;  1GXF A;  2Z5X A;  2YM2 A;  1CJ2 A;  3UKA A;  2C67 A;  4YTM A;  3I3L A;  5BUK A;  2NPX A;  2B76 A;  3GRT A;  2Z5Y A;  1ZOY A;  2GVC A;  4IA5 A;  1DOC A;  2RGO A;  2E1M A;  2WOI A;  4U2T A;  1RP0 A;  4DNA A;  1CC2 A;  2OAL A;  2V3A A;  4YSX A;  1GTH A;  2GR3 A;  1ZMD A;  5J7X A;  3V76 A;  3UTF A;  2XLT A;  4EMJ A;  3ICS A;  3F8R A;  2XVI A;  3T2Z A;  4DSH A;  3CMM A;  1CC6 A;  2PYX A;  3IC9 A;  1DOB A;  1N4W A;  2X50 A;  1Z6L A;  3IF9 A;  4GCM A;  2YR4 A;  3P4R A;  2VQB A;  3P4Q A;  2R0C A;  2JB3 A;  2XYO A;  1GEU A;  4UDP A;  2JB2 A;  3AB1 A;  3CPI G;  3NN0 X;  4H4S A;  5BRT A;  5J60 A;  4K2X A;  1NHQ A;  2CUL A;  4U2L A;  2LFC A;  5L46 A;  3VRD B;  2OLN A;  2EQ7 A;  1ZP0 A;  1VDC A;  3UKF A;  4A6N A;  3ICR A;  5HYM A;  2WU2 A;  5EB4 A;  4J34 A;  5KMR A;  5HHF A;  3KLJ A;  3CTY A;  4G73 A;  3AD7 B;  4H4T A;  4JNA A;  4Z25 A;  1VRQ B;  4H2N A;  2DKI A;  3NYC A;  2GB0 A;  2C73 A;  4H4P A;  1GRF A;  2EQ8 A;  1IUS A;  3NK1 X;  1GRT A;  1PXA A;  2Q0L A;  1YQZ A;  3PS9 A;  1DOE A;  1TDO A;  3DJJ A;  1VG0 A;  3WE0 A;  3AE3 A;  1N1P A;  1B5Q A;  2C3D A;  3EF6 A;  4YT0 A;  5KRQ A;  2YVG A;  3O0H A;  3RP7 A;  2AAQ A;  2VVL G;  1QJD A;  4JQ9 A;  3H8L A;  3JSK A;  1NG3 A;  1ZMC A;  3AEC A;  1LVL A;  3KPK A;  4J36 A;  4AOS A;  2BS3 A;  3NKS A;  1CHU A;  4A7A A;  1ZKQ A;  1IUV A;  4O5U A;  4Z44 A;  3UTE A;  2VVM A;  3S5W A;  1PXB A;  2GR2 A;  2WHD A;  4CBQ A;  1PXC A;  3DJD A;  3V3O A;  1GPE A;  4H4R A;  4FK1 A;  3URH A;  2VRM A;  3NT6 A;  3AEB A;  4J2W A;  4D04 A;  2YLT A;  4UDR A;  4Y4M A;  5BVA A;  1UKV G;  3CGB A;  3CNP A;  4M52 A;  4Z24 A;  4B67 A;  1GRE A;  3GWF A;  4YKG A;  2BS4 A;  1D7L A;  3DJE A;  1VG9 A;  1ZK7 A;  2OAM A;  1Q1R A;  5JCI A;  2YR5 A;  2VQ7 A;  2XCG A;  4NZH A;  5ER0 A;  2AQJ A;  1E39 A;  1IUU A;  5KOW A;  2R4J A;  3QSS A;  2YM1 A;  4UDQ A;  1SEZ A;  3ALL A;  5TR3 A;  4EQR A;  4LU6 A;  1CJ3 A;  2XFO A;  3KA7 A;  4FX9 A;  4JNQ A;  4JY2 A;  4U8M A;  1NHS A;  1EL5 A;  2YG3 A;  4C3Y A;  3VRB A;  4CY6 A;  1E6E A;  3F8D A;  4U8N A;  2ZZB A;  3C96 A;  2C3C A;  2BC0 A;  3VR8 A;  4CY8 A;  2VRL A;  5U1O A;  2JK6 A;  1L9E A;  4H2Q A;  2GMJ A;  3HYV A;  3UKK A;  3BI5 A;  3SFD A;  4H7U A;  2WOW A;  3ZDN A;  5C3J A;  5KXJ A;  4K5R A;  3NTD A;  4G9K A;  4Z26 A;  2X8G A;  1CBO A;  1D4E A;  1KNP A;  1FEC A;  3LAD A;  3BHK A;  1B4V A;  3RP6 A;  3SM8 A;  3CND A;  4G6H A;  4EIQ A;  1Q9I A;  1NAA A;  3ATR A;  2JB1 A;  5JCN A;  4P9S A;  3NRN A;  1LPF A;  1ZOV A;  3KU9 A;  4H4Q A;  4DGK A;  4GRT A;  2HQM A;  1E1L A;  1Y56 B;  3COX A;  3AYJ A;  5IQ1 A;  4CNJ A;  2X99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...