4YT0D

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with 2-methyl-n-[3-(1-methylethoxy)phenyl]benzamide.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
129
structure length
129
Chain Sequence
b'TSAAVTGAAPPQFDPIAAEKGFKPLHSHGTLFKIERYFAAAMVPLIPAAYFIHGREMDLCLALALTLHVHWGVWGVVNDYGRPFVLGDTLAAAVRVGAYIFTACLLAGLLYFNEHDVGLTRAFEMVWEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 41
structure length 129
sequence length 129
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05328 CybS CybS, succinate dehydrogenase cytochrome B small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4yt0D00
5C2TC 1KF6D 1QLBC 3P4RD 4YTMC 2WQYD 4YTNC 3VRAD 3ABVD 2WDQD 3AE4C 3AEED 3CIRC 3VR9C 4YT0C 2ACZC 1YQ4D 2FBWD 2WDVC 2WU2C 4YSXC 4YSYC 2BS3C 3AEAC 1ZOYC 4YTPD 2WU5D 2WDRC 3AE1C 4YSZD 2WS3D 3AEFD 3AE8C 1KFYC 3P4QC 2B76D 3VRBD 3AE5D 1NEKD 2H88C 1ZP0C 3AECD 3AEDC 3SFED 3AE4D 4KX6D 3SFDD 2WU2D 3AE2D 3VR8C 4YSXD 3P4PC 4YSYD 3AE7D 4YXDD 3AEAD 3AEGD 1ZOYD 1YQ3C 2WQYC 2WDRD 3AE6D 5C3JD 1L0VC 3AEBD 3VRAC 3ABVC 2H89D 3AE3C 2WDQC 3AEEC 3AE9C 2FBWC 1YQ4C 3P4QD 3P4SD 1NEND 2WP9C 5C2TD 4YTMD 4YTND 2WU5C 3CIRD 4YSZC 2WS3C 3VR9D 4YT0D 2ACZD 2WDVD 2B76C 3VR8D 1KF6C 2BS4C 3P4RC 3AE5C 1NEKC 1YQ3D 3AE1D 3AE8D 1KFYD 1L0VD 3AECC 3AE3D 3SFEC 3AE9D 4KX6C 3SFDC 3AE2C 4YTPC 4YXDC 2WP9D 3AE7C 2H88D 3AEGC 2BS2C 3AEFC 1ZP0D 3AEDD 3AE6C 5C3JC 3AEBC 2H89C 3P4PD 3VRBC 3P4SC 1NENC 1E7PC
chains in the Genus database with same CATH superfamily
5C2TC 1KF6D 1QLBC 3P4RD 4YTMC 2WQYD 4YTNC 3VRAD 3ABVD 2WDQD 3AE4C 3AEED 3CIRC 3VR9C 4YT0C 2ACZC 1YQ4D 2FBWD 2WDVC 2WU2C 4YSXC 4YSYC 2BS3C 3AEAC 1ZOYC 4YTPD 2WU5D 2WDRC 3AE1C 4YSZD 2WS3D 3AEFD 3AE8C 1KFYC 3P4QC 4FJVA 3VONA 2B76D 3VRBD 3AE5D 1NEKD 2H88C 1ZP0C 3AECD 3AEDC 3SFED 3AE4D 1TFFA 4KX6D 3SFDD 2WU2D 3AE2D 3VR8C 4YSXD 3P4PC 4YSYD 3AE7D 4YXDD 3AEAD 3AEGD 1ZOYD 1YQ3C 2WQYC 2WDRD 3AE6D 5C3JD 1L0VC 3AEBD 3VRAC 3ABVC 2H89D 3AE3C 2WDQC 3AEEC 3AE9C 2ZFYA 2FBWC 1YQ4C 4DDIA 3P4QD 3P4SD 1NEND 2WP9C 5C2TD 4YTMD 4YTND 2WU5C 4DHJA 3CIRD 4YSZC 2WS3C 3VR9D 4YT0D 2ACZD 2WDVD 2B76C 3VR8D 1KF6C 2BS4C 3P4RC 3AE5C 1NEKC 1YQ3D 3AE1D 3AE8D 1KFYD 4DDGA 1L0VD 3AECC 3AE3D 3SFEC 3AE9D 4KX6C 3SFDC 4DHIB 3AE2C 4YTPC 4DHZA 4YXDC 2WP9D 3AE7C 2H88D 3AEGC 2BS2C 4LDTA 3AEFC 1ZP0D 3AEDD 3AE6C 5C3JC 3AEBC 2H89C 4I6LA 3P4PD 3VRBC 3P4SC 1NENC 1E7PC
chains in the Genus database with same CATH topology
5C2TC 1KF6D 1QLBC 3P4RD 4YTMC 2WQYD 4YTNC 3VRAD 3ABVD 2WDQD 3AE4C 3AEED 3CIRC 3VR9C 4YT0C 2ACZC 1YQ4D 2FBWD 2WDVC 2WU2C 4YSXC 4YSYC 2BS3C 3AEAC 1ZOYC 4YTPD 2WU5D 2WDRC 3AE1C 4YSZD 2WS3D 3AEFD 3AE8C 1KFYC 3P4QC 2B76D 3VRBD 3AE5D 1NEKD 2H88C 1ZP0C 3AECD 3AEDC 3SFED 3AE4D 4KX6D 3SFDD 2WU2D 3AE2D 3VR8C 4YSXD 3P4PC 4YSYD 3AE7D 4YXDD 3AEAD 3AEGD 1ZOYD 1YQ3C 2WQYC 2WDRD 3AE6D 5C3JD 1L0VC 3AEBD 3VRAC 3ABVC 2H89D 3AE3C 2WDQC 3AEEC 3AE9C 2FBWC 1YQ4C 3P4QD 3P4SD 1NEND 2WP9C 5C2TD 4YTMD 4YTND 2WU5C 3CIRD 4YSZC 2WS3C 3VR9D 4YT0D 2ACZD 2WDVD 2B76C 3VR8D 1KF6C 2BS4C 3P4RC 3AE5C 1NEKC 1YQ3D 3AE1D 3AE8D 1KFYD 1L0VD 3AECC 3AE3D 3SFEC 3AE9D 4KX6C 3SFDC 3AE2C 4YTPC 4YXDC 2WP9D 3AE7C 2H88D 3AEGC 2BS2C 3AEFC 1ZP0D 3AEDD 3AE6C 5C3JC 3AEBC 2H89C 3P4PD 3VRBC 3P4SC 1NENC 1E7PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2T C;  1KF6 D;  1QLB C;  3P4R D;  4YTM C;  2WQY D;  4YTN C;  3VRA D;  3ABV D;  2WDQ D;  3AE4 C;  3AEE D;  3CIR C;  3VR9 C;  4YT0 C;  2ACZ C;  1YQ4 D;  2FBW D;  2WDV C;  2WU2 C;  4YSX C;  4YSY C;  2BS3 C;  3AEA C;  1ZOY C;  4YTP D;  2WU5 D;  2WDR C;  3AE1 C;  4YSZ D;  2WS3 D;  3AEF D;  3AE8 C;  1KFY C;  3P4Q C;  2B76 D;  3VRB D;  3AE5 D;  1NEK D;  2H88 C;  1ZP0 C;  3AEC D;  3AED C;  3SFE D;  3AE4 D;  4KX6 D;  3SFD D;  2WU2 D;  3AE2 D;  3VR8 C;  4YSX D;  3P4P C;  4YSY D;  3AE7 D;  4YXD D;  3AEA D;  3AEG D;  1ZOY D;  1YQ3 C;  2WQY C;  2WDR D;  3AE6 D;  5C3J D;  1L0V C;  3AEB D;  3VRA C;  3ABV C;  2H89 D;  3AE3 C;  2WDQ C;  3AEE C;  3AE9 C;  2FBW C;  1YQ4 C;  3P4Q D;  3P4S D;  1NEN D;  2WP9 C;  5C2T D;  4YTM D;  4YTN D;  2WU5 C;  3CIR D;  4YSZ C;  2WS3 C;  3VR9 D;  4YT0 D;  2ACZ D;  2WDV D;  2B76 C;  3VR8 D;  1KF6 C;  2BS4 C;  3P4R C;  3AE5 C;  1NEK C;  1YQ3 D;  3AE1 D;  3AE8 D;  1KFY D;  1L0V D;  3AEC C;  3AE3 D;  3SFE C;  3AE9 D;  4KX6 C;  3SFD C;  3AE2 C;  4YTP C;  4YXD C;  2WP9 D;  3AE7 C;  2H88 D;  3AEG C;  2BS2 C;  3AEF C;  1ZP0 D;  3AED D;  3AE6 C;  5C3J C;  3AEB C;  2H89 C;  3P4P D;  3VRB C;  3P4S C;  1NEN C;  1E7P C; 
#chains in the Genus database with same CATH topology
 5C2T C;  1KF6 D;  1QLB C;  3P4R D;  4YTM C;  2WQY D;  4YTN C;  3VRA D;  3ABV D;  2WDQ D;  3AE4 C;  3AEE D;  3CIR C;  3VR9 C;  4YT0 C;  2ACZ C;  1YQ4 D;  2FBW D;  2WDV C;  2WU2 C;  4YSX C;  4YSY C;  2BS3 C;  3AEA C;  1ZOY C;  4YTP D;  2WU5 D;  2WDR C;  3AE1 C;  4YSZ D;  2WS3 D;  3AEF D;  3AE8 C;  1KFY C;  3P4Q C;  4FJV A;  3VON A;  2B76 D;  3VRB D;  3AE5 D;  1NEK D;  2H88 C;  1ZP0 C;  3AEC D;  3AED C;  3SFE D;  3AE4 D;  1TFF A;  4KX6 D;  3SFD D;  2WU2 D;  3AE2 D;  3VR8 C;  4YSX D;  3P4P C;  4YSY D;  3AE7 D;  4YXD D;  3AEA D;  3AEG D;  1ZOY D;  1YQ3 C;  2WQY C;  2WDR D;  3AE6 D;  5C3J D;  1L0V C;  3AEB D;  3VRA C;  3ABV C;  2H89 D;  3AE3 C;  2WDQ C;  3AEE C;  3AE9 C;  2ZFY A;  2FBW C;  1YQ4 C;  4DDI A;  3P4Q D;  3P4S D;  1NEN D;  2WP9 C;  5C2T D;  4YTM D;  4YTN D;  2WU5 C;  4DHJ A;  3CIR D;  4YSZ C;  2WS3 C;  3VR9 D;  4YT0 D;  2ACZ D;  2WDV D;  2B76 C;  3VR8 D;  1KF6 C;  2BS4 C;  3P4R C;  3AE5 C;  1NEK C;  1YQ3 D;  3AE1 D;  3AE8 D;  1KFY D;  4DDG A;  1L0V D;  3AEC C;  3AE3 D;  3SFE C;  3AE9 D;  4KX6 C;  3SFD C;  4DHI B;  3AE2 C;  4YTP C;  4DHZ A;  4YXD C;  2WP9 D;  3AE7 C;  2H88 D;  3AEG C;  2BS2 C;  4LDT A;  3AEF C;  1ZP0 D;  3AED D;  3AE6 C;  5C3J C;  3AEB C;  2H89 C;  4I6L A;  3P4P D;  3VRB C;  3P4S C;  1NEN C;  1E7P C; 
#chains in the Genus database with same CATH homology
 5C2T C;  1KF6 D;  1QLB C;  3P4R D;  4YTM C;  2WQY D;  4YTN C;  3VRA D;  3ABV D;  2WDQ D;  3AE4 C;  3AEE D;  3CIR C;  3VR9 C;  4YT0 C;  2ACZ C;  1YQ4 D;  2FBW D;  2WDV C;  2WU2 C;  4YSX C;  4YSY C;  2BS3 C;  3AEA C;  1ZOY C;  4YTP D;  2WU5 D;  2WDR C;  3AE1 C;  4YSZ D;  2WS3 D;  3AEF D;  3AE8 C;  1KFY C;  3P4Q C;  2B76 D;  3VRB D;  3AE5 D;  1NEK D;  2H88 C;  1ZP0 C;  3AEC D;  3AED C;  3SFE D;  3AE4 D;  4KX6 D;  3SFD D;  2WU2 D;  3AE2 D;  3VR8 C;  4YSX D;  3P4P C;  4YSY D;  3AE7 D;  4YXD D;  3AEA D;  3AEG D;  1ZOY D;  1YQ3 C;  2WQY C;  2WDR D;  3AE6 D;  5C3J D;  1L0V C;  3AEB D;  3VRA C;  3ABV C;  2H89 D;  3AE3 C;  2WDQ C;  3AEE C;  3AE9 C;  2FBW C;  1YQ4 C;  3P4Q D;  3P4S D;  1NEN D;  2WP9 C;  5C2T D;  4YTM D;  4YTN D;  2WU5 C;  3CIR D;  4YSZ C;  2WS3 C;  3VR9 D;  4YT0 D;  2ACZ D;  2WDV D;  2B76 C;  3VR8 D;  1KF6 C;  2BS4 C;  3P4R C;  3AE5 C;  1NEK C;  1YQ3 D;  3AE1 D;  3AE8 D;  1KFY D;  1L0V D;  3AEC C;  3AE3 D;  3SFE C;  3AE9 D;  4KX6 C;  3SFD C;  3AE2 C;  4YTP C;  4YXD C;  2WP9 D;  3AE7 C;  2H88 D;  3AEG C;  2BS2 C;  3AEF C;  1ZP0 D;  3AED D;  3AE6 C;  5C3J C;  3AEB C;  2H89 C;  3P4P D;  3VRB C;  3P4S C;  1NEN C;  1E7P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...