4YT6L

Factor viia in complex with the inhibitor 4-{[(r)-[5-ethoxy-2-fluoro-3-(propan-2-yloxy)phenyl](4-phenyl-1h-imidazol-2-yl)methyl]amino}benzenecarboximidamide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
55
structure length
55
Chain Sequence
ICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of potent, selective phenylimidazole-based FVIIa inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Coagulation factor VII (heavy chain)
total genus 13
structure length 55
sequence length 55
ec nomenclature ec 3.4.21.21: Coagulation factor VIIa.
pdb deposition date 2015-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 4yt6L00
1FE2A 2BOHA 4D0EA 4BTUA 1APQA 3N8VA 1WU1B 2XC4L 1KSNB 4M11A 4NA9L 3IITB 1EMNA 2WYGB 1DIYA 1PGEA 2RHPA 3F1SB 3CA7A 3HPTA 4TGFA 4A7IA 1UZQA 1YO8A 1PFXL 3P5BL 1BF9A 4Z6AL 2BQWA 3HO3A 4LMFA 1L3YA 4CSYA 1B9WA 1U67A 3LC5B 3HO5A 4O02B 1LPGA 1NT0A 4Y6DB 1YUFA 2W86A 1IQIL 1SZBA 3ZYIB 3KCGL 4PH9A 2EI7B 2BO2A 4X8UL 3TK6B 4Y71B 1F0SB 2G00L 2FLGA 1CQEA 2Y82B 3LIWB 1NFUB 1EGFA 4X8VL 2P26A 1N1IA 4E1GA 5IKQA 2EI8B 2PHBB 2Q1JB 3HO4A 2WPHE 1KLOA 2M74A 1LMJA 3SOBB 3GCXE 4Y7BB 4XL1A 1NFXB 2Y80B 3TBDA 2P3UA 3OLTA 1G1RA 1IGXA 2KB9A 5KN5C 1DVAL 3POYA 1Z6EL 4YT7L 3LN0A 3MDLA 4MMXB 1UZPA 3K9XA 1W7XL 3N8ZA 3PGHA 5IKTA 2MGRA 2P94L 1DDXA 1ATAA 1F7EA 1CVUA 1YUGA 3LN1A 2XC5L 4BDXA 1HREA 4JYVL 4ZAEB 4JYUL 3QH0A 3KK6A 2P3FN 1UZKA 3TGFA 5JVYA 4BDWA 1G2MB 3KQDL 4XBMA 4CUDA 2PR3B 1APOA 2J34B 2RNLA 1FSBA 2MHPA 2BOKL 3U7UG 1NPEB 2XBYL 5CKMA 2P28B 1NQLB 1NFYB 1WHEA 4X8TL 1GK5A 1G1SA 1M1XB 1U8CB 2XBWL 4BTTA 1EBVA 2KV4A 3OLUA 1HCGB 2J4IB 2VWMK 2Y38A 3NTBA 3LTFB 2B7DL 1J9CL 3ASIA 1K36A 1UZJA 2UWOB 1TOZA 2I9AA 1G2LB 2P93L 2WPLE 3GISX 4BXWA 1HX2A 2MGPA 2Y5FL 3N8WA 1EAIC 1EMOA 5JBBE 5KIRA 2XBVL 2FLRL 3NTGA 2Y5GL 3ENSA 4Z0KB 1HJ7A 2J94B 1IVOC 2WG4B 5JW1A 3BPSE 5L30L 1PXXA 3EGFA 2BQ7A 1KIGL 1IOEL 4ZXXL 1IGZA 3F6UL 4OTYA 1HAEA 1JBUL 4AQTA 3ELAL 2VH0B 3GCWE 2RA0L 1ADXA 3LC3B 4RRWA 2P3TA 3M37L 4RRXA 3QMOA 4ISIL 1IQLL 2OYUP 4YT6L 3IJEB 1IQML 2XBXL 4RRZA 1FF7A 2WG3C 1XKBA 2BMGA 5FDQA 5CKQA 1IJQA 3TZIA 4X8SL 1W8BL 1XFEA 4G1MB 2JKHL 4ZXYL 3TH3L 1EPIA 1FAKL 1IP0A 1ATDA 1N7DA 4BTIA 2FD6A 3CFWA 1OB1C 1P9JA 2AYLA 2BOUA 2FLBL 2W2NE 3FBYA 3BT2A 2XC0L 2WFTA 1RFNB 4O1ZA 1C5MF 1IQKL 3V65B 3N8XA 3Q7DA 2WPIE 1DX5I 1XDTR 2EI6B 3QCWA 2J38B 1Z6CA 3HS7A 1V3XB 3KL6B 4ZHAB 3HS6A 3MQEA 5JB8E 4COXA 2K2SB 1NFWB 5JB9E 1ATEA 2W26B 3V64C 1HZ8A 1YGCL 2NPRA 2DDUA 3Q3KB 1Q4GA 1URKA 3HS5A 2VWOL 2TGFA 1FAXL 3N8YB 5I46L 5JBAE 3SOQA 3R05A 3KQEL 2VVCK 1F0RB 2WFXB 2Y7ZB 3BT1A 1G1TA 2Y5HL 4LORA 1I0UA 2Y7XB 1CEJA 1FJSL 3FFGL 4FM5A 2VVVL 4Y79B 1F7MA 4D90A 4M10A 3SW2A 4NG9L 2Y81B 1CVWL 5K0HB 3C9AC 2W2OE 2P16L 5IKRA 2VVUL 4JZDL 3M36L 1TLEA 2W2QE 4ZH8B 2VH6B 1K37A 2FZZL 1L5GB 1P0SL 2KL7A 1MQ6L 1QFKL 1HT8A 1IQEL 2OYEP 2UWPB 2WYJB 4YZUB 1LQDA 1CCVA 1EPJA 4XLWA 5CKNA 1KLJL 3CS7L 3ZYJB 5JVZA 2GD4A 3TK5B 5JBCE 2ADXA 5L2ZL 2WPKE 3KQBL 1EPHA 1PTHA 1NZIA 4Z0LA 2D1JB 4JZFL 1EZQB 2K2TA 3NT1A 1AUTL 4RS0A 1YUKB 3FCSB 5L2YL 5F1AA 6COXA 2UWLB 3DEMA 3H5CB 2J2UB 2H9EL 1FFMA 4C16A 3LAQA 1XKAL 1EQGA 4ISHL 2VWLL 3U73A 1PRHA 1IQFL 1JL9A 2J95B 2VJ3A 5CISA 4OTJA 2W2PE 4CUFA 4CUEA 2W3IB 4RRYA 1LPZA 2P95L 3N8WB 2YGPA 2CJIB 1IQHL 1EQHA 1COUA 1ATBA 2F9BL 4JZEL 1IQGL 1IQNL 3N8YA 1HAFA 4NGAL 1MOXC 1MQ5L 4RUTA 1JV2B 4MMZB 1DQBA 4BXSA 2YGOA 3RR3A 3KQCL 1IQJL 1KLIL 5COXA 5E8DA 2VWNL 1TPGA 1ZAQA 1A3PA 1LPKA 2W3KB 1EPGA 3SOVA 1O5DL 2WPME 5IKVA 1CX2A 3LTGD 2BOXA 1HRFA 4D0FA 3CENL 2I9BA 1IOXA 3KRKA 5EGMB 4MMYB 3ZYGA 1X7AL 2BZ6L 2P3FL 1HT5A 4Y76B 4Y7AB 2WPJE 1G1QA 2PUQL 1CCFA 2BQ6A 1WHFA 3NJPC 5F19A 2W2ME
chains in the Genus database with same CATH superfamily
1FE2A 2BOHA 4D0EA 4BTUA 1APQA 3N8VA 1WU1B 2XC4L 1KSNB 4M11A 2HOXA 4NA9L 3IITB 4GU3A 1EMNA 2WYGB 1DIYA 1PGEA 2RHPA 3F1SB 3CA7A 3HPTA 4TGFA 4A7IA 1UZQA 1YO8A 2BT7A 1PFXL 3P5BL 1BF9A 4Z6AL 2BQWA 3HO3A 4LMFA 1L3YA 4CSYA 1B9WA 1U67A 3LC5B 3HO5A 4O02B 1LPGA 1NT0A 4Y6DB 1YUFA 1V1HA 2W86A 1IQIL 1SZBA 3ZYIB 3KCGL 4PH9A 2EI7B 2BO2A 4X8UL 3TK6B 4Y71B 1F0SB 2G00L 2FLGA 1CQEA 2Y82B 3LIWB 1NFUB 1EGFA 4X8VL 2P26A 1N1IA 4E1GA 5IKQA 2EI8B 2PHBB 3HO4A 2Q1JB 2WPHE 1KLOA 2M74A 1LMJA 3SOBB 3GCXE 4Y7BB 4XL1A 1NFXB 2Y80B 3TBDA 2P3UA 3OLTA 1G1RA 1IGXA 2KB9A 2VRSA 5KN5C 1DVAL 3POYA 1Z6EL 4YT7L 3LN0A 3MDLA 4MMXB 1UZPA 3K9XA 1W7XL 3N8ZA 3PGHA 5IKTA 2MGRA 2P94L 1DDXA 1ATAA 1F7EA 1CVUA 1YUGA 3LN1A 2XC5L 4BDXA 1HREA 4JYVL 4ZAEB 4JYUL 3QH0A 3KK6A 2P3FN 1UZKA 3TGFA 5JVYA 4BDWA 1G2MB 3KQDL 4XBMA 4CUDA 2PR3B 1APOA 2H9EC 1KKEA 2J34B 2RNLA 1FSBA 2MHPA 2BOKL 3U7UG 1LMMA 1NPEB 2XBYL 5CKMA 2P28B 1NQLB 1NFYB 1WHEA 4X8TL 1GK5A 1G1SA 1M1XB 1U8CB 2XBWL 4BTTA 1EBVA 2KV4A 3OLUA 1HCGB 2J4IB 2VWMK 2Y38A 3NTBA 3LTFB 2B7DL 1J9CL 3ASIA 1K36A 1UZJA 2UWOB 1TOZA 2I9AA 1G2LB 2P93L 2WPLE 3GISX 4BXWA 1HX2A 2MGPA 2Y5FL 3N8WA 1EAIC 1EMOA 5JBBE 5KIRA 2XBVL 2FLRL 3NTGA 2Y5GL 3ENSA 4Z0KB 1HJ7A 2J94B 1IVOC 2WG4B 5JW1A 3BPSE 5L30L 1PXXA 3EGFA 2BQ7A 1KIGL 1IOEL 4ZXXL 1IGZA 3F6UL 4OTYA 1HAEA 1JBUL 4AQTA 3ELAL 2VH0B 3GCWE 2RA0L 1ADXA 3LC3B 4RRWA 2P3TA 3M37L 4RRXA 3QMOA 4ISIL 1IQLL 2OYUP 4YT6L 3IJEB 1IQML 2XBXL 4RRZA 1FF7A 2WG3C 1LK9A 2HORA 1XKBA 2BMGA 5FDQA 5CKQA 1IJQA 3TZIA 4X8SL 1W8BL 1XFEA 4G1MB 2JKHL 4ZXYL 3TH3L 1EPIA 1FAKL 1IP0A 1ATDA 2WZPP 1N7DA 4BTIA 2FD6A 3CFWA 1OB1C 1P9JA 2AYLA 2BOUA 2FLBL 2W2NE 3FBYA 3BT2A 2XC0L 2WFTA 4GU4A 1RFNB 4O1ZA 1C5MF 1IQKL 3V65B 3N8XA 3Q7DA 2WPIE 1DX5I 1XDTR 2EI6B 3QCWA 2J38B 1Z6CA 3HS7A 1V3XB 3KL6B 4ZHAB 3HS6A 3MQEA 5JB8E 4COXA 2K2SB 1NFWB 5JB9E 1ATEA 2W26B 3V64C 1HZ8A 1YGCL 2NPRA 2DDUA 3Q3KB 1Q4GA 1URKA 3HS5A 2VWOL 2TGFA 1FAXL 3N8YB 5I46L 5JBAE 3SOQA 1QIUA 3R05A 3KQEL 2VVCK 1F0RB 2WFXB 2Y7ZB 3BT1A 1G1TA 2Y5HL 2BSFA 4LORA 1I0UA 2Y7XB 2JJLA 1CEJA 1FJSL 3FFGL 4FM5A 2VVVL 4Y79B 1F7MA 4D90A 4M10A 3SW2A 4NG9L 2Y81B 1CVWL 5K0HB 3C9AC 2W2OE 2P16L 5IKRA 2VVUL 4JZDL 3M36L 4A94C 1TLEA 1V1IA 2W2QE 4ZH8B 2VH6B 1K37A 2FZZL 1L5GB 1P0SL 2KL7A 1MQ6L 1QFKL 1HT8A 1IQEL 2OYEP 2UWPB 2WYJB 4YZUB 1LQDA 1CCVA 1EPJA 4XLWA 5CKNA 1KLJL 3CS7L 2BT8A 3ZYJB 5JVZA 2GD4A 3TK5B 5JBCE 2ADXA 5L2ZL 2WPKE 3KQBL 1EPHA 1PTHA 1NZIA 4Z0LA 2D1JB 4JZFL 1EZQB 2K2TA 3NT1A 1AUTL 4RS0A 1YUKB 3FCSB 5L2YL 5F1AA 6COXA 2UWLB 3DEMA 3H5CB 2J2UB 2H9EL 1FFMA 4C16A 3LAQA 1XKAL 1EQGA 4ISHL 2VWLL 3U73A 1PRHA 1IQFL 1JL9A 2J95B 2VJ3A 5CISA 4OTJA 2W2PE 4CUFA 4CUEA 2W3IB 4RRYA 1LPZA 2P95L 3N8WB 2YGPA 2CJIB 1IQHL 1EQHA 1COUA 1ATBA 2F9BL 4JZEL 1IQGL 1IQNL 3N8YA 1HAFA 4NGAL 1MOXC 1MQ5L 4RUTA 1JV2B 4MMZB 1DQBA 4BXSA 2YGOA 3RR3A 3KQCL 2KNIA 1IQJL 1KLIL 5COXA 5E8DA 2VWNL 1TPGA 1ZAQA 1A3PA 1LPKA 2W3KB 1EPGA 3SOVA 1O5DL 2WPME 5IKVA 1CX2A 3LTGD 2BOXA 3S6XA 1HRFA 4D0FA 3CENL 2YGQA 2I9BA 1IOXA 3KRKA 5EGMB 4MMYB 3ZYGA 1X7AL 2BZ6L 2P3FL 1HT5A 4Y76B 4Y7AB 2WPJE 1G1QA 2PUQL 1CCFA 2BQ6A 1WHFA 3NJPC 5F19A 2W2ME
chains in the Genus database with same CATH topology
1FE2A 2BOHA 4D0EA 4BTUA 1APQA 3N8VA 1WU1B 2XC4L 1KSNB 4M11A 4NA9L 3IITB 1EMNA 2WYGB 1DIYA 1PGEA 2RHPA 3F1SB 3CA7A 3HPTA 4TGFA 4A7IA 1UZQA 1YO8A 1PFXL 3P5BL 1BF9A 4Z6AL 2BQWA 3HO3A 4LMFA 1L3YA 4CSYA 1B9WA 1U67A 3LC5B 3HO5A 4O02B 1LPGA 1NT0A 4Y6DB 1YUFA 2W86A 1IQIL 1SZBA 3ZYIB 3KCGL 4PH9A 2EI7B 2BO2A 4X8UL 3TK6B 4Y71B 1F0SB 2G00L 2FLGA 1CQEA 2Y82B 3LIWB 1NFUB 1EGFA 4X8VL 2P26A 1N1IA 4E1GA 5IKQA 2EI8B 2PHBB 3HO4A 2Q1JB 2WPHE 1KLOA 2M74A 1LMJA 3SOBB 3GCXE 4Y7BB 4XL1A 1NFXB 2Y80B 3TBDA 2P3UA 3OLTA 1G1RA 1IGXA 2KB9A 5KN5C 1DVAL 3POYA 1Z6EL 4YT7L 3LN0A 3MDLA 4MMXB 1UZPA 3K9XA 1W7XL 3N8ZA 3PGHA 5IKTA 2MGRA 2P94L 1DDXA 1ATAA 1F7EA 1CVUA 1YUGA 3LN1A 2XC5L 4BDXA 1HREA 4JYVL 4ZAEB 4JYUL 3QH0A 3KK6A 2P3FN 1UZKA 3TGFA 5JVYA 4BDWA 1G2MB 3KQDL 4XBMA 4CUDA 2PR3B 1APOA 2H9EC 2J34B 2RNLA 1FSBA 2MHPA 2BOKL 3U7UG 1LMMA 1NPEB 2XBYL 5CKMA 2P28B 1NQLB 1NFYB 1WHEA 4X8TL 1GK5A 1G1SA 1M1XB 1U8CB 2XBWL 4BTTA 1EBVA 2KV4A 3OLUA 1HCGB 2J4IB 2VWMK 2Y38A 3NTBA 3LTFB 2B7DL 1J9CL 3ASIA 1K36A 1UZJA 2UWOB 1TOZA 2I9AA 1G2LB 2P93L 2WPLE 3GISX 4BXWA 1HX2A 2MGPA 2Y5FL 3N8WA 1EAIC 1EMOA 5JBBE 5KIRA 2XBVL 2FLRL 3NTGA 2Y5GL 3ENSA 4Z0KB 1HJ7A 2J94B 1IVOC 2WG4B 5JW1A 3BPSE 5L30L 1PXXA 3EGFA 2BQ7A 1KIGL 1IOEL 4ZXXL 1IGZA 3F6UL 4OTYA 1HAEA 1JBUL 4AQTA 3ELAL 2VH0B 3GCWE 2RA0L 1ADXA 3LC3B 4RRWA 2P3TA 3M37L 4RRXA 3QMOA 4ISIL 1IQLL 2OYUP 4YT6L 3IJEB 1IQML 2XBXL 4RRZA 1FF7A 2WG3C 1XKBA 2BMGA 5FDQA 5CKQA 1IJQA 3TZIA 4X8SL 1W8BL 1XFEA 4G1MB 2JKHL 4ZXYL 3TH3L 1EPIA 1FAKL 1IP0A 1ATDA 2WZPP 1N7DA 4BTIA 2FD6A 3CFWA 1OB1C 1P9JA 2AYLA 2BOUA 2FLBL 2W2NE 3FBYA 3BT2A 2XC0L 2WFTA 1RFNB 4O1ZA 1C5MF 1IQKL 3V65B 3N8XA 3Q7DA 2WPIE 1DX5I 1XDTR 2EI6B 3QCWA 2J38B 1Z6CA 3HS7A 1V3XB 3KL6B 4ZHAB 3HS6A 3MQEA 5JB8E 4COXA 2K2SB 1NFWB 5JB9E 1ATEA 2W26B 3V64C 1HZ8A 1YGCL 2NPRA 2DDUA 3Q3KB 1Q4GA 1URKA 3HS5A 2VWOL 2TGFA 1FAXL 3N8YB 5I46L 5JBAE 3SOQA 3R05A 3KQEL 2VVCK 1F0RB 2WFXB 2Y7ZB 3BT1A 1G1TA 2Y5HL 4LORA 1I0UA 2Y7XB 1CEJA 1FJSL 3FFGL 4FM5A 2VVVL 4Y79B 1F7MA 4D90A 4M10A 3SW2A 4NG9L 2Y81B 1CVWL 5K0HB 3C9AC 2W2OE 2P16L 5IKRA 2VVUL 4JZDL 3M36L 4A94C 1TLEA 2W2QE 4ZH8B 2VH6B 1K37A 2FZZL 1L5GB 1P0SL 2KL7A 1MQ6L 1QFKL 1HT8A 1IQEL 2OYEP 2UWPB 2WYJB 4YZUB 1LQDA 1CCVA 1EPJA 4XLWA 5CKNA 1KLJL 3CS7L 3ZYJB 5JVZA 2GD4A 3TK5B 5JBCE 2ADXA 5L2ZL 2WPKE 3KQBL 1EPHA 1PTHA 1NZIA 4Z0LA 2D1JB 4JZFL 1EZQB 2K2TA 3NT1A 1AUTL 4RS0A 1YUKB 3FCSB 5L2YL 5F1AA 6COXA 2UWLB 3DEMA 3H5CB 2J2UB 2H9EL 1FFMA 4C16A 3LAQA 1XKAL 1EQGA 4ISHL 2VWLL 3U73A 1PRHA 1IQFL 1JL9A 2J95B 2VJ3A 5CISA 4OTJA 2W2PE 4CUFA 4CUEA 2W3IB 4RRYA 1LPZA 2P95L 3N8WB 2YGPA 2CJIB 1IQHL 1EQHA 1COUA 1ATBA 2F9BL 4JZEL 1IQGL 1IQNL 3N8YA 1HAFA 4NGAL 1MOXC 1MQ5L 4RUTA 1JV2B 4MMZB 1DQBA 4BXSA 2YGOA 3RR3A 3KQCL 2KNIA 1IQJL 1KLIL 5COXA 5E8DA 2VWNL 1TPGA 1ZAQA 1A3PA 1LPKA 2W3KB 1EPGA 3SOVA 1O5DL 2WPME 5IKVA 1CX2A 3LTGD 2BOXA 3S6XA 1HRFA 4D0FA 3CENL 2YGQA 2I9BA 1IOXA 3KRKA 5EGMB 4MMYB 3ZYGA 1X7AL 2BZ6L 2P3FL 1HT5A 4Y76B 4Y7AB 2WPJE 1G1QA 2PUQL 1CCFA 2BQ6A 1WHFA 3NJPC 5F19A 2W2ME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FE2 A;  2BOH A;  4D0E A;  4BTU A;  1APQ A;  3N8V A;  1WU1 B;  2XC4 L;  1KSN B;  4M11 A;  4NA9 L;  3IIT B;  1EMN A;  2WYG B;  1DIY A;  1PGE A;  2RHP A;  3F1S B;  3CA7 A;  3HPT A;  4TGF A;  4A7I A;  1UZQ A;  1YO8 A;  1PFX L;  3P5B L;  1BF9 A;  4Z6A L;  2BQW A;  3HO3 A;  4LMF A;  1L3Y A;  4CSY A;  1B9W A;  1U67 A;  3LC5 B;  3HO5 A;  4O02 B;  1LPG A;  1NT0 A;  4Y6D B;  1YUF A;  2W86 A;  1IQI L;  1SZB A;  3ZYI B;  3KCG L;  4PH9 A;  2EI7 B;  2BO2 A;  4X8U L;  3TK6 B;  4Y71 B;  1F0S B;  2G00 L;  2FLG A;  1CQE A;  2Y82 B;  3LIW B;  1NFU B;  1EGF A;  4X8V L;  2P26 A;  1N1I A;  4E1G A;  5IKQ A;  2EI8 B;  2PHB B;  2Q1J B;  3HO4 A;  2WPH E;  1KLO A;  2M74 A;  1LMJ A;  3SOB B;  3GCX E;  4Y7B B;  4XL1 A;  1NFX B;  2Y80 B;  3TBD A;  2P3U A;  3OLT A;  1G1R A;  1IGX A;  2KB9 A;  5KN5 C;  1DVA L;  3POY A;  1Z6E L;  4YT7 L;  3LN0 A;  3MDL A;  4MMX B;  1UZP A;  3K9X A;  1W7X L;  3N8Z A;  3PGH A;  5IKT A;  2MGR A;  2P94 L;  1DDX A;  1ATA A;  1F7E A;  1CVU A;  1YUG A;  3LN1 A;  2XC5 L;  4BDX A;  1HRE A;  4JYV L;  4ZAE B;  4JYU L;  3QH0 A;  3KK6 A;  2P3F N;  1UZK A;  3TGF A;  5JVY A;  4BDW A;  1G2M B;  3KQD L;  4XBM A;  4CUD A;  2PR3 B;  1APO A;  2J34 B;  2RNL A;  1FSB A;  2MHP A;  2BOK L;  3U7U G;  1NPE B;  2XBY L;  5CKM A;  2P28 B;  1NQL B;  1NFY B;  1WHE A;  4X8T L;  1GK5 A;  1G1S A;  1M1X B;  1U8C B;  2XBW L;  4BTT A;  1EBV A;  2KV4 A;  3OLU A;  1HCG B;  2J4I B;  2VWM K;  2Y38 A;  3NTB A;  3LTF B;  2B7D L;  1J9C L;  3ASI A;  1K36 A;  1UZJ A;  2UWO B;  1TOZ A;  2I9A A;  1G2L B;  2P93 L;  2WPL E;  3GIS X;  4BXW A;  1HX2 A;  2MGP A;  2Y5F L;  3N8W A;  1EAI C;  1EMO A;  5JBB E;  5KIR A;  2XBV L;  2FLR L;  3NTG A;  2Y5G L;  3ENS A;  4Z0K B;  1HJ7 A;  2J94 B;  1IVO C;  2WG4 B;  5JW1 A;  3BPS E;  5L30 L;  1PXX A;  3EGF A;  2BQ7 A;  1KIG L;  1IOE L;  4ZXX L;  1IGZ A;  3F6U L;  4OTY A;  1HAE A;  1JBU L;  4AQT A;  3ELA L;  2VH0 B;  3GCW E;  2RA0 L;  1ADX A;  3LC3 B;  4RRW A;  2P3T A;  3M37 L;  4RRX A;  3QMO A;  4ISI L;  1IQL L;  2OYU P;  4YT6 L;  3IJE B;  1IQM L;  2XBX L;  4RRZ A;  1FF7 A;  2WG3 C;  1XKB A;  2BMG A;  5FDQ A;  5CKQ A;  1IJQ A;  3TZI A;  4X8S L;  1W8B L;  1XFE A;  4G1M B;  2JKH L;  4ZXY L;  3TH3 L;  1EPI A;  1FAK L;  1IP0 A;  1ATD A;  1N7D A;  4BTI A;  2FD6 A;  3CFW A;  1OB1 C;  1P9J A;  2AYL A;  2BOU A;  2FLB L;  2W2N E;  3FBY A;  3BT2 A;  2XC0 L;  2WFT A;  1RFN B;  4O1Z A;  1C5M F;  1IQK L;  3V65 B;  3N8X A;  3Q7D A;  2WPI E;  1DX5 I;  1XDT R;  2EI6 B;  3QCW A;  2J38 B;  1Z6C A;  3HS7 A;  1V3X B;  3KL6 B;  4ZHA B;  3HS6 A;  3MQE A;  5JB8 E;  4COX A;  2K2S B;  1NFW B;  5JB9 E;  1ATE A;  2W26 B;  3V64 C;  1HZ8 A;  1YGC L;  2NPR A;  2DDU A;  3Q3K B;  1Q4G A;  1URK A;  3HS5 A;  2VWO L;  2TGF A;  1FAX L;  3N8Y B;  5I46 L;  5JBA E;  3SOQ A;  3R05 A;  3KQE L;  2VVC K;  1F0R B;  2WFX B;  2Y7Z B;  3BT1 A;  1G1T A;  2Y5H L;  4LOR A;  1I0U A;  2Y7X B;  1CEJ A;  1FJS L;  3FFG L;  4FM5 A;  2VVV L;  4Y79 B;  1F7M A;  4D90 A;  4M10 A;  3SW2 A;  4NG9 L;  2Y81 B;  1CVW L;  5K0H B;  3C9A C;  2W2O E;  2P16 L;  5IKR A;  2VVU L;  4JZD L;  3M36 L;  1TLE A;  2W2Q E;  4ZH8 B;  2VH6 B;  1K37 A;  2FZZ L;  1L5G B;  1P0S L;  2KL7 A;  1MQ6 L;  1QFK L;  1HT8 A;  1IQE L;  2OYE P;  2UWP B;  2WYJ B;  4YZU B;  1LQD A;  1CCV A;  1EPJ A;  4XLW A;  5CKN A;  1KLJ L;  3CS7 L;  3ZYJ B;  5JVZ A;  2GD4 A;  3TK5 B;  5JBC E;  2ADX A;  5L2Z L;  2WPK E;  3KQB L;  1EPH A;  1PTH A;  1NZI A;  4Z0L A;  2D1J B;  4JZF L;  1EZQ B;  2K2T A;  3NT1 A;  1AUT L;  4RS0 A;  1YUK B;  3FCS B;  5L2Y L;  5F1A A;  6COX A;  2UWL B;  3DEM A;  3H5C B;  2J2U B;  2H9E L;  1FFM A;  4C16 A;  3LAQ A;  1XKA L;  1EQG A;  4ISH L;  2VWL L;  3U73 A;  1PRH A;  1IQF L;  1JL9 A;  2J95 B;  2VJ3 A;  5CIS A;  4OTJ A;  2W2P E;  4CUF A;  4CUE A;  2W3I B;  4RRY A;  1LPZ A;  2P95 L;  3N8W B;  2YGP A;  2CJI B;  1IQH L;  1EQH A;  1COU A;  1ATB A;  2F9B L;  4JZE L;  1IQG L;  1IQN L;  3N8Y A;  1HAF A;  4NGA L;  1MOX C;  1MQ5 L;  4RUT A;  1JV2 B;  4MMZ B;  1DQB A;  4BXS A;  2YGO A;  3RR3 A;  3KQC L;  1IQJ L;  1KLI L;  5COX A;  5E8D A;  2VWN L;  1TPG A;  1ZAQ A;  1A3P A;  1LPK A;  2W3K B;  1EPG A;  3SOV A;  1O5D L;  2WPM E;  5IKV A;  1CX2 A;  3LTG D;  2BOX A;  1HRF A;  4D0F A;  3CEN L;  2I9B A;  1IOX A;  3KRK A;  5EGM B;  4MMY B;  3ZYG A;  1X7A L;  2BZ6 L;  2P3F L;  1HT5 A;  4Y76 B;  4Y7A B;  2WPJ E;  1G1Q A;  2PUQ L;  1CCF A;  2BQ6 A;  1WHF A;  3NJP C;  5F19 A;  2W2M E; 
#chains in the Genus database with same CATH topology
 1FE2 A;  2BOH A;  4D0E A;  4BTU A;  1APQ A;  3N8V A;  1WU1 B;  2XC4 L;  1KSN B;  4M11 A;  2HOX A;  4NA9 L;  3IIT B;  4GU3 A;  1EMN A;  2WYG B;  1DIY A;  1PGE A;  2RHP A;  3F1S B;  3CA7 A;  3HPT A;  4TGF A;  4A7I A;  1UZQ A;  1YO8 A;  2BT7 A;  1PFX L;  3P5B L;  1BF9 A;  4Z6A L;  2BQW A;  3HO3 A;  4LMF A;  1L3Y A;  4CSY A;  1B9W A;  1U67 A;  3LC5 B;  3HO5 A;  4O02 B;  1LPG A;  1NT0 A;  4Y6D B;  1YUF A;  1V1H A;  2W86 A;  1IQI L;  1SZB A;  3ZYI B;  3KCG L;  4PH9 A;  2EI7 B;  2BO2 A;  4X8U L;  3TK6 B;  4Y71 B;  1F0S B;  2G00 L;  2FLG A;  1CQE A;  2Y82 B;  3LIW B;  1NFU B;  1EGF A;  4X8V L;  2P26 A;  1N1I A;  4E1G A;  5IKQ A;  2EI8 B;  2PHB B;  3HO4 A;  2Q1J B;  2WPH E;  1KLO A;  2M74 A;  1LMJ A;  3SOB B;  3GCX E;  4Y7B B;  4XL1 A;  1NFX B;  2Y80 B;  3TBD A;  2P3U A;  3OLT A;  1G1R A;  1IGX A;  2KB9 A;  2VRS A;  5KN5 C;  1DVA L;  3POY A;  1Z6E L;  4YT7 L;  3LN0 A;  3MDL A;  4MMX B;  1UZP A;  3K9X A;  1W7X L;  3N8Z A;  3PGH A;  5IKT A;  2MGR A;  2P94 L;  1DDX A;  1ATA A;  1F7E A;  1CVU A;  1YUG A;  3LN1 A;  2XC5 L;  4BDX A;  1HRE A;  4JYV L;  4ZAE B;  4JYU L;  3QH0 A;  3KK6 A;  2P3F N;  1UZK A;  3TGF A;  5JVY A;  4BDW A;  1G2M B;  3KQD L;  4XBM A;  4CUD A;  2PR3 B;  1APO A;  2H9E C;  1KKE A;  2J34 B;  2RNL A;  1FSB A;  2MHP A;  2BOK L;  3U7U G;  1LMM A;  1NPE B;  2XBY L;  5CKM A;  2P28 B;  1NQL B;  1NFY B;  1WHE A;  4X8T L;  1GK5 A;  1G1S A;  1M1X B;  1U8C B;  2XBW L;  4BTT A;  1EBV A;  2KV4 A;  3OLU A;  1HCG B;  2J4I B;  2VWM K;  2Y38 A;  3NTB A;  3LTF B;  2B7D L;  1J9C L;  3ASI A;  1K36 A;  1UZJ A;  2UWO B;  1TOZ A;  2I9A A;  1G2L B;  2P93 L;  2WPL E;  3GIS X;  4BXW A;  1HX2 A;  2MGP A;  2Y5F L;  3N8W A;  1EAI C;  1EMO A;  5JBB E;  5KIR A;  2XBV L;  2FLR L;  3NTG A;  2Y5G L;  3ENS A;  4Z0K B;  1HJ7 A;  2J94 B;  1IVO C;  2WG4 B;  5JW1 A;  3BPS E;  5L30 L;  1PXX A;  3EGF A;  2BQ7 A;  1KIG L;  1IOE L;  4ZXX L;  1IGZ A;  3F6U L;  4OTY A;  1HAE A;  1JBU L;  4AQT A;  3ELA L;  2VH0 B;  3GCW E;  2RA0 L;  1ADX A;  3LC3 B;  4RRW A;  2P3T A;  3M37 L;  4RRX A;  3QMO A;  4ISI L;  1IQL L;  2OYU P;  4YT6 L;  3IJE B;  1IQM L;  2XBX L;  4RRZ A;  1FF7 A;  2WG3 C;  1LK9 A;  2HOR A;  1XKB A;  2BMG A;  5FDQ A;  5CKQ A;  1IJQ A;  3TZI A;  4X8S L;  1W8B L;  1XFE A;  4G1M B;  2JKH L;  4ZXY L;  3TH3 L;  1EPI A;  1FAK L;  1IP0 A;  1ATD A;  2WZP P;  1N7D A;  4BTI A;  2FD6 A;  3CFW A;  1OB1 C;  1P9J A;  2AYL A;  2BOU A;  2FLB L;  2W2N E;  3FBY A;  3BT2 A;  2XC0 L;  2WFT A;  4GU4 A;  1RFN B;  4O1Z A;  1C5M F;  1IQK L;  3V65 B;  3N8X A;  3Q7D A;  2WPI E;  1DX5 I;  1XDT R;  2EI6 B;  3QCW A;  2J38 B;  1Z6C A;  3HS7 A;  1V3X B;  3KL6 B;  4ZHA B;  3HS6 A;  3MQE A;  5JB8 E;  4COX A;  2K2S B;  1NFW B;  5JB9 E;  1ATE A;  2W26 B;  3V64 C;  1HZ8 A;  1YGC L;  2NPR A;  2DDU A;  3Q3K B;  1Q4G A;  1URK A;  3HS5 A;  2VWO L;  2TGF A;  1FAX L;  3N8Y B;  5I46 L;  5JBA E;  3SOQ A;  1QIU A;  3R05 A;  3KQE L;  2VVC K;  1F0R B;  2WFX B;  2Y7Z B;  3BT1 A;  1G1T A;  2Y5H L;  2BSF A;  4LOR A;  1I0U A;  2Y7X B;  2JJL A;  1CEJ A;  1FJS L;  3FFG L;  4FM5 A;  2VVV L;  4Y79 B;  1F7M A;  4D90 A;  4M10 A;  3SW2 A;  4NG9 L;  2Y81 B;  1CVW L;  5K0H B;  3C9A C;  2W2O E;  2P16 L;  5IKR A;  2VVU L;  4JZD L;  3M36 L;  4A94 C;  1TLE A;  1V1I A;  2W2Q E;  4ZH8 B;  2VH6 B;  1K37 A;  2FZZ L;  1L5G B;  1P0S L;  2KL7 A;  1MQ6 L;  1QFK L;  1HT8 A;  1IQE L;  2OYE P;  2UWP B;  2WYJ B;  4YZU B;  1LQD A;  1CCV A;  1EPJ A;  4XLW A;  5CKN A;  1KLJ L;  3CS7 L;  2BT8 A;  3ZYJ B;  5JVZ A;  2GD4 A;  3TK5 B;  5JBC E;  2ADX A;  5L2Z L;  2WPK E;  3KQB L;  1EPH A;  1PTH A;  1NZI A;  4Z0L A;  2D1J B;  4JZF L;  1EZQ B;  2K2T A;  3NT1 A;  1AUT L;  4RS0 A;  1YUK B;  3FCS B;  5L2Y L;  5F1A A;  6COX A;  2UWL B;  3DEM A;  3H5C B;  2J2U B;  2H9E L;  1FFM A;  4C16 A;  3LAQ A;  1XKA L;  1EQG A;  4ISH L;  2VWL L;  3U73 A;  1PRH A;  1IQF L;  1JL9 A;  2J95 B;  2VJ3 A;  5CIS A;  4OTJ A;  2W2P E;  4CUF A;  4CUE A;  2W3I B;  4RRY A;  1LPZ A;  2P95 L;  3N8W B;  2YGP A;  2CJI B;  1IQH L;  1EQH A;  1COU A;  1ATB A;  2F9B L;  4JZE L;  1IQG L;  1IQN L;  3N8Y A;  1HAF A;  4NGA L;  1MOX C;  1MQ5 L;  4RUT A;  1JV2 B;  4MMZ B;  1DQB A;  4BXS A;  2YGO A;  3RR3 A;  3KQC L;  2KNI A;  1IQJ L;  1KLI L;  5COX A;  5E8D A;  2VWN L;  1TPG A;  1ZAQ A;  1A3P A;  1LPK A;  2W3K B;  1EPG A;  3SOV A;  1O5D L;  2WPM E;  5IKV A;  1CX2 A;  3LTG D;  2BOX A;  3S6X A;  1HRF A;  4D0F A;  3CEN L;  2YGQ A;  2I9B A;  1IOX A;  3KRK A;  5EGM B;  4MMY B;  3ZYG A;  1X7A L;  2BZ6 L;  2P3F L;  1HT5 A;  4Y76 B;  4Y7A B;  2WPJ E;  1G1Q A;  2PUQ L;  1CCF A;  2BQ6 A;  1WHF A;  3NJP C;  5F19 A;  2W2M E; 
#chains in the Genus database with same CATH homology
 1FE2 A;  2BOH A;  4D0E A;  4BTU A;  1APQ A;  3N8V A;  1WU1 B;  2XC4 L;  1KSN B;  4M11 A;  4NA9 L;  3IIT B;  1EMN A;  2WYG B;  1DIY A;  1PGE A;  2RHP A;  3F1S B;  3CA7 A;  3HPT A;  4TGF A;  4A7I A;  1UZQ A;  1YO8 A;  1PFX L;  3P5B L;  1BF9 A;  4Z6A L;  2BQW A;  3HO3 A;  4LMF A;  1L3Y A;  4CSY A;  1B9W A;  1U67 A;  3LC5 B;  3HO5 A;  4O02 B;  1LPG A;  1NT0 A;  4Y6D B;  1YUF A;  2W86 A;  1IQI L;  1SZB A;  3ZYI B;  3KCG L;  4PH9 A;  2EI7 B;  2BO2 A;  4X8U L;  3TK6 B;  4Y71 B;  1F0S B;  2G00 L;  2FLG A;  1CQE A;  2Y82 B;  3LIW B;  1NFU B;  1EGF A;  4X8V L;  2P26 A;  1N1I A;  4E1G A;  5IKQ A;  2EI8 B;  2PHB B;  3HO4 A;  2Q1J B;  2WPH E;  1KLO A;  2M74 A;  1LMJ A;  3SOB B;  3GCX E;  4Y7B B;  4XL1 A;  1NFX B;  2Y80 B;  3TBD A;  2P3U A;  3OLT A;  1G1R A;  1IGX A;  2KB9 A;  5KN5 C;  1DVA L;  3POY A;  1Z6E L;  4YT7 L;  3LN0 A;  3MDL A;  4MMX B;  1UZP A;  3K9X A;  1W7X L;  3N8Z A;  3PGH A;  5IKT A;  2MGR A;  2P94 L;  1DDX A;  1ATA A;  1F7E A;  1CVU A;  1YUG A;  3LN1 A;  2XC5 L;  4BDX A;  1HRE A;  4JYV L;  4ZAE B;  4JYU L;  3QH0 A;  3KK6 A;  2P3F N;  1UZK A;  3TGF A;  5JVY A;  4BDW A;  1G2M B;  3KQD L;  4XBM A;  4CUD A;  2PR3 B;  1APO A;  2H9E C;  2J34 B;  2RNL A;  1FSB A;  2MHP A;  2BOK L;  3U7U G;  1LMM A;  1NPE B;  2XBY L;  5CKM A;  2P28 B;  1NQL B;  1NFY B;  1WHE A;  4X8T L;  1GK5 A;  1G1S A;  1M1X B;  1U8C B;  2XBW L;  4BTT A;  1EBV A;  2KV4 A;  3OLU A;  1HCG B;  2J4I B;  2VWM K;  2Y38 A;  3NTB A;  3LTF B;  2B7D L;  1J9C L;  3ASI A;  1K36 A;  1UZJ A;  2UWO B;  1TOZ A;  2I9A A;  1G2L B;  2P93 L;  2WPL E;  3GIS X;  4BXW A;  1HX2 A;  2MGP A;  2Y5F L;  3N8W A;  1EAI C;  1EMO A;  5JBB E;  5KIR A;  2XBV L;  2FLR L;  3NTG A;  2Y5G L;  3ENS A;  4Z0K B;  1HJ7 A;  2J94 B;  1IVO C;  2WG4 B;  5JW1 A;  3BPS E;  5L30 L;  1PXX A;  3EGF A;  2BQ7 A;  1KIG L;  1IOE L;  4ZXX L;  1IGZ A;  3F6U L;  4OTY A;  1HAE A;  1JBU L;  4AQT A;  3ELA L;  2VH0 B;  3GCW E;  2RA0 L;  1ADX A;  3LC3 B;  4RRW A;  2P3T A;  3M37 L;  4RRX A;  3QMO A;  4ISI L;  1IQL L;  2OYU P;  4YT6 L;  3IJE B;  1IQM L;  2XBX L;  4RRZ A;  1FF7 A;  2WG3 C;  1XKB A;  2BMG A;  5FDQ A;  5CKQ A;  1IJQ A;  3TZI A;  4X8S L;  1W8B L;  1XFE A;  4G1M B;  2JKH L;  4ZXY L;  3TH3 L;  1EPI A;  1FAK L;  1IP0 A;  1ATD A;  2WZP P;  1N7D A;  4BTI A;  2FD6 A;  3CFW A;  1OB1 C;  1P9J A;  2AYL A;  2BOU A;  2FLB L;  2W2N E;  3FBY A;  3BT2 A;  2XC0 L;  2WFT A;  1RFN B;  4O1Z A;  1C5M F;  1IQK L;  3V65 B;  3N8X A;  3Q7D A;  2WPI E;  1DX5 I;  1XDT R;  2EI6 B;  3QCW A;  2J38 B;  1Z6C A;  3HS7 A;  1V3X B;  3KL6 B;  4ZHA B;  3HS6 A;  3MQE A;  5JB8 E;  4COX A;  2K2S B;  1NFW B;  5JB9 E;  1ATE A;  2W26 B;  3V64 C;  1HZ8 A;  1YGC L;  2NPR A;  2DDU A;  3Q3K B;  1Q4G A;  1URK A;  3HS5 A;  2VWO L;  2TGF A;  1FAX L;  3N8Y B;  5I46 L;  5JBA E;  3SOQ A;  3R05 A;  3KQE L;  2VVC K;  1F0R B;  2WFX B;  2Y7Z B;  3BT1 A;  1G1T A;  2Y5H L;  4LOR A;  1I0U A;  2Y7X B;  1CEJ A;  1FJS L;  3FFG L;  4FM5 A;  2VVV L;  4Y79 B;  1F7M A;  4D90 A;  4M10 A;  3SW2 A;  4NG9 L;  2Y81 B;  1CVW L;  5K0H B;  3C9A C;  2W2O E;  2P16 L;  5IKR A;  2VVU L;  4JZD L;  3M36 L;  4A94 C;  1TLE A;  2W2Q E;  4ZH8 B;  2VH6 B;  1K37 A;  2FZZ L;  1L5G B;  1P0S L;  2KL7 A;  1MQ6 L;  1QFK L;  1HT8 A;  1IQE L;  2OYE P;  2UWP B;  2WYJ B;  4YZU B;  1LQD A;  1CCV A;  1EPJ A;  4XLW A;  5CKN A;  1KLJ L;  3CS7 L;  3ZYJ B;  5JVZ A;  2GD4 A;  3TK5 B;  5JBC E;  2ADX A;  5L2Z L;  2WPK E;  3KQB L;  1EPH A;  1PTH A;  1NZI A;  4Z0L A;  2D1J B;  4JZF L;  1EZQ B;  2K2T A;  3NT1 A;  1AUT L;  4RS0 A;  1YUK B;  3FCS B;  5L2Y L;  5F1A A;  6COX A;  2UWL B;  3DEM A;  3H5C B;  2J2U B;  2H9E L;  1FFM A;  4C16 A;  3LAQ A;  1XKA L;  1EQG A;  4ISH L;  2VWL L;  3U73 A;  1PRH A;  1IQF L;  1JL9 A;  2J95 B;  2VJ3 A;  5CIS A;  4OTJ A;  2W2P E;  4CUF A;  4CUE A;  2W3I B;  4RRY A;  1LPZ A;  2P95 L;  3N8W B;  2YGP A;  2CJI B;  1IQH L;  1EQH A;  1COU A;  1ATB A;  2F9B L;  4JZE L;  1IQG L;  1IQN L;  3N8Y A;  1HAF A;  4NGA L;  1MOX C;  1MQ5 L;  4RUT A;  1JV2 B;  4MMZ B;  1DQB A;  4BXS A;  2YGO A;  3RR3 A;  3KQC L;  2KNI A;  1IQJ L;  1KLI L;  5COX A;  5E8D A;  2VWN L;  1TPG A;  1ZAQ A;  1A3P A;  1LPK A;  2W3K B;  1EPG A;  3SOV A;  1O5D L;  2WPM E;  5IKV A;  1CX2 A;  3LTG D;  2BOX A;  3S6X A;  1HRF A;  4D0F A;  3CEN L;  2YGQ A;  2I9B A;  1IOX A;  3KRK A;  5EGM B;  4MMY B;  3ZYG A;  1X7A L;  2BZ6 L;  2P3F L;  1HT5 A;  4Y76 B;  4Y7A B;  2WPJ E;  1G1Q A;  2PUQ L;  1CCF A;  2BQ6 A;  1WHF A;  3NJP C;  5F19 A;  2W2M E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...