4YTCA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune disease
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
289
structure length
284
Chain Sequence
TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSARRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 284
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytcA01
3EQHA 3TNQB 1CMKE 5HI2A 3PVGA 3F69A 4H39A 4WRSA 4WG5A 4PL5A 2X4FA 3DTWA 3NYNA 4W9XA 1U46A 3HDMA 3GI3A 2EXEA 3UYTA 1UU7A 2ZOQA 4CCUA 5DOSA 4MCVA 3GC0A 3QKKA 4D4YA 3LFCA 1FBNA 1H0WA 3C51A 4JX7A 5EHOA 4TWNA 5HVYA 2GPHA 4L53A 5AAEA 4FI1A 3ZSHA 4IANA 4K11A 4IWQA 5M53A 4QQ5A 3DB6A 5FBOA 5EM6A 2ITNA 1O6LA 1W98A 1BLXA 5GJDA 3SV0A 3FI4A 5DT3A 3WYXA 4CT1A 4F7SA 5JN2A 2F2CB 4BRXA 4J8MA 4RIWB 3AGLA 3LLAA 3GU8A 1UVRA 4AOTA 4ASDA 4OTPA 4UYAA 3FUPA 4NW5A 4NW6A 2QONA 4EHGA 3CSVA 2JKQA 3W2RA 4FTQA 2ZAZA 4GCJA 3P08A 2BCJA 4FX3A 4M97A 4FICA 4KBCA 4RIXB 4PF4A 2IVUA 3D94A 4DF3A 2XK7A 3C4WA 2P2HA 4FKIA 5ETAA 2CJMA 5HCXA 4BF2A 5GINE 3VQHA 5AR4A 4USEA 1YDSE 1WBOA 2C6KA 4BCNA 3HV6A 3MPMA 5I9ZA 2PUNA 3HV7A 3DNEA 1UWJA 4HCUA 3O7LB 5AP2A 4ANSA 3CR0A 3OBGA 4DCAA 2BKKA 3MY1A 4GK4A 5LVOA 3QC4A 2UZEA 4CEGA 4CXAA 5LMKC 3P1AA 3T3UA 1UA2A 1E1XA 4GW8A 3JS2A 4C36A 2GNFA 1JKLA 3BWFA 2Z7QA 2GS6A 2WGJA 4HJOA 3PY1A 4BBMA 4MBIA 4DFYA 4O27B 4IVCA 4PP7A 1DI8A 1PXPA 3LFFA 4DTKA 5J9YA 2GTNA 3MPTA 2W5HA 3DNDA 3TCPA 3F82A 4BWKA 2O2UA 4LQMA 2VZ6A 4F64A 4TRLA 4A9YA 3KREA 3C4ZA 4ZLZA 3VBWA 4BI1A 3CJFA 4NYEA 4C8BA 2PMIA 3K5VA 3MBLA 3VVHA 1FVTA 4M12A 3OTVA 2C1AA 1ND4A 4FSYA 4Y83A 5FEEA 5TT7A 5AADA 3SVVA 4D55A 2HZNA 5F4NA 5CF4A 4PWNA 2RFEA 4QNAA 1DI9A 3RGFA 4BKJA 2YAKA 3IW7A 1AD5A 3VQUA 3D5VA 3O8PA 3L8XA 4PTCA 4MBJA 5HU9A 2XNNA 2RFDA 4KKEA 2JKMA 4WNOA 2WMXA 4XV9A 3VUTA 4P7EA 5J1VA 2R3HA 3QYWA 4MXCA 3BGQA 2X2KA 4BDDA 3HVCA 4QMPA 1V0BA 3UQFA 3IGOA 3P4KA 3VF9A 5I9UA 3H0ZA 4ZMEA 5CI7A 2YAAA 4C7TA 3DGKA 2R3QA 3ULZA 4AT3A 4BHNA 2GQGA 3GQLA 4BCHA 2A1AB 1YOMA 5G1XA 3AT2A 3FY0A 4DH8A 5IA2A 1F3MC 4D4SA 5JZNA 3RK9A 4DEGA 4YZMA 3EZRA 4BCFA 3VS5A 3MFSA 2CNQA 4HYUA 4XG3A 2JIIA 5FXRA 2JAVA 3EN7A 4FKOA 2I0YA 2R0IA 4KA3A 3GC8A 1OL2A 4EOKA 5E9EA 1ZOHA 4D2TA 5AP5A 1SVEA 2B52A 5D7AA 5DGZA 1V0PA 4JI9A 3V04A 3KMMA 3AT3A 3ORKA 4FEUA 3E63A 2WMQA 5TE0A 2WOTA 2GNGA 5E8YA 2FUMA 4CV8A 3PZEA 2VWIA 1RDQE 2RFSA 3R73A 4KRCA 4U79A 3TG1A 1Z5MA 2GCDA 2VWZA 3QCSA 2WD1A 2ZVAA 2BPMA 1QPCA 3D2KA 3DZOA 4AT5A 4DG3E 2WIHA 3R8LA 4NIFB 3LFSA 3NEWA 2YIXA 4K9YA 5HD7A 5M08A 2CN5A 2ITUA 3MTLA 4II5A 4EZ3A 4CRLA 4A06A 2GU8A 5BVEA 5AR5A 4MYGA 4O0TA 3TN8A 3C13A 4K18A 5GHVA 2WZJA 4O0RA 3VBXA 4XV3A 5A54A 3RZFA 2JDSA 3U6IA 3SOAA 3N51A 4NKSA 1F5QA 4J71A 1J91A 4F9AA 2J0IA 4DH1A 2W1CA 1O6YA 4ZTQA 3D83A 4HVDA 3D2IA 3FV8A 3QZFA 3B2WA 4F1OA 4O0YA 3W8LA 1Q62A 3R9OA 3LFBA 3CE3A 3PLSA 1Y6AA 3DDPA 5C27A 4ACGA 4O82A 2BAQA 1U5QA 3RNYA 3FL4A 4CLIA 5JH6A 5AV1A 3QTXA 4IX3A 1BX6A 4EH7A 3QUEA 2XM8A 4YP8A 3DBQA 4O7YA 2JDRA 4RC2A 2JKKA 5HO6A 3P79A 4G3DA 2YCRA 1BKXA 3E8DA 4IWDA 1YXVA 2QQ7A 1FGKA 3FJQE 4EK6A 4YR8A 3A61A 5HIBA 4AX8A 1T45A 3EIDA 3M2WA 4UWCA 4BYIA 3GUBA 2W1IA 2CKEA 4YJUA 1FQ1B 2XK8A 2EVAA 4L3LA 4UYNA 3R28A 1XBAA 2W9ZB 3U51A 2RIOA 1OL6A 3R04A 3PYYA 5E8UA 4BWXA 4O38A 4V0GB 4YURA 1Q97A 1Q8UA 3RK7A 2CGVA 4IAYA 3TDVA 1KV1A 2ONLA 3PJ2A 2PMOX 4FODA 4D0XA 4ZP5A 3BCEA 5TOZA 3BELA 3ITZA 1P4OA 2GS2A 2ZDTA 3N9XA 3ZC6A 3VUHA 3ZLXA 4YUQA 4O0WA 1ZMWA 4PNIA 3IW4A 2OBJA 4DG0E 1JLUE 3R7EA 4CYIA 1G5SA 4YJNA 2GQSA 4O7ZA 4WHZA 3TZ7A 2XNOA 5I9YA 4ZY6A 1K3AA 2YACA 4AGUA 4IDTA 4TN6A 4E5BA 3G9LX 4R5SA 2X0GA 4AFEA 4MF1A 5DIAA 4ASXA 5HTIA 1OIQA 2HXLA 4I0TA 5FBNC 3ANRA 3MSSA 4JQ7A 5I5ZA 3NVMB 4EH2A 4RQKA 4IM0A 4QP7A 5EDPA 5E4HA 2XNEA 4KKGA 3UO5A 3G15A 4QP1A 3EH9A 1OUYA 2HWOA 3NIZA 3QQUA 4ASZA 4UN0C 3WF9A 3OY1A 3OROA 5JFXA 1KSWA 3U4UA 3QXPA 4JR7A 3V3VA 4DBXA 1R1WA 3A99A 4KBKA 1NY3A 4G9CA 3FI8A 2QC6A 3FKOA 3VNTA 4YO4A 3O71A 3F3TA 3TT0A 4EK4A 5ETCA 2IZUA 4ZTLA 3BX5A 5E8TA 5FTGA 5D41A 2C5OA 4L3PA 4EOOA 5KKRC 3VS6A 4H1MA 3ZS5A 1NW1A 4OBOA 1XKKA 2JFLA 1MRUA 2PUUA 3OWKA 3COKA 3VUIA 5HG7A 3R7UA 4ANLA 1P5EA 2ZM3A 2ZV7A 3VHKA 2ITVA 4ZOGA 4AZEA 3QWJA 2QOHA 2OWBA 1Q3WA 4CFFA 4HVSA 3D5UA 2QOKA 2QI8A 4JBPA 3DJ5A 3ZDIA 3BYMA 3PJ1A 4BDJA 3GENA 5IQDA 3IOPA 5BUEA 3KL8A 3RNIA 3Q5IA 3PIZA 4GJ2A 4IAFA 4YC6A 3KXXA 4GT4A 3E64A 3ELJA 1IG1A 2Z7LA 4IVDA 5AV3A 3EQIA 3ROCA 3FE3A 4EJNA 3POOA 1ZYDA 4HVIA 4R5YA 4TNDA 2BZJA 2W17A 5AV2A 3EL8A 2B4SB 2BZHB 3RP9A 4BCKA 4EC8A 3OUKA 4D0WA 2ETRA 3QGYA 4DEAA 2QOBA 3I0QA 1J7UA 1YVJA 3EQCA 3Q9WA 4RLKA 4XS2A 3BI6A 3OT3A 4YO6A 2J0LA 3OXIA 1XH9A 4JVGA 3EQFA 2XKEA 4UXQA 1BI8A 3R7VA 5L6WL 2ITPA 4ZJVA 1Q61A 5CZIA 4LFIA 3B8QA 3EQGA 4ITHA 5E8XA 2OZOA 4KSPA 2B9HA 5A4QA 1FVRA 4GG5A 4NM7A 2VAGA 3CBLA 3FWQA 2RF9A 3P5KA 3EL7A 3W8QA 5F9EA 3OWLA 1WVXA 3UDBA 1Y6BA 4A9TA 4F7NA 3DA6A 2VTMA 4UV0A 1IA8A 2W4KA 4K33A 5EFQA 4BI0A 3NYOA 4QTEA 3PIYA 4ZZMA 3FMMA 4CZYB 1H07A 2WO6A 2ACXA 4XG2A 4DEBA 4L67A 3IQ7A 1H0VA 2BHHA 3EFJA 3MH3A 4DH5A 5CX9A 5L2WA 5K0KA 4BYJA 2JDOA 3Q2MA 4FK6A 4PPAA 4TYHA 3SLSA 4RIYB 3GCSA 1IEPA 2OKRA 2UVZA 1H1RA 4BCPA 2BAJA 4U81A 3IPHA 3LCOA 3MS9A 5HCYA 4O91A 3AC4A 3PE2A 2F4JA 3DFAA 4MBLA 2FYSA 1PJKA 5E7RA 2VWXA 4GMYA 1L3RE 3HX4A 3PTGA 2OO8X 2X6EA 3PA4A 2JKOA 2BRNA 4J98A 3UBDA 3ZFYA 4Z55A 5K4IA 1B39A 1STCE 3CPCA 2P0CA 4DGNA 3RAKA 5BMSA 2F7EE 5KNJA 3D4QA 3QHWA 4ZSGA 5EQPA 4YBJA 1OPKA 2OFUA 3TKHA 4PDOA 3QL8A 1E9HA 4L8MA 4YNOA 3MWUA 2BDWA 5DRDA 1H1WA 3U9NA 1U5RA 3I7CA 4S30A 3Q4UA 5A4EA 4KINA 4ZS4A 1E1VA 2YDKA 4OAUC 2YCFA 4JJRA 1YHSA 2O5KA 5CSPA 1RE8A 4LM5A 3EYGA 4LMNA 3V8SA 3VBVA 4EWHA 5E1EA 1SNXA 1PYXA 4C4EA 3Q9XA 4O84A 3I6WA 5IQCA 3LOKA 2XKDA 5FDPA 2R3RA 2UVXA 3ORXA 1ZLTA 4OR5A 2X8EA 3FMDA 3FZ1A 4E6DA 1PMUA 2WPAA 3H0YA 4FKSA 3FMNA 4F9CA 4QMUA 2QOQA 4G6LA 2O63A 3ROYA 2ERKA 4ZEGA 3R02A 3F2AA 3QQJA 4FMQA 3DQXA 4LGHA 5IPJA 2I6LA 5JFSA 2OGVA 3AD6A 3KF7A 3O51A 3CQWA 2XF0A 5KBRA 3JVRA 3GFWA 3PE1A 4ALUA 3F3UA 4RIWA 2G1TA 3QHRA 3VW8A 3VULA 2G15A 3ZM4A 2WEIA 4IZAA 4C34A 3P9JA 3DU8A 4RJ5A 4HVGA 2WOUA 2YABA 4AUAA 3E3BX 4Z9LA 3QWKA 2E9OA 2HOGA 3CQUA 4XG9A 3N4TA 1H01A 5M57A 3D15A 4JS8A 5EM8A 4RMZA 4KS7A 5H8GA 3UMWA 5JT2A 2ONLC 2JEDA 4XG8A 5G6VA 4CKRA 4YPSA 3LLTA 5EHLA 2BZKB 4NK9A 4X6QC 3DCVA 4A9SA 4D2PA 3SG9A 3BYUA 3BBTB 1YOJA 3MY0A 3PXRA 4MNFA 2R3NA 5J79A 4HCTA 4RT7A 2XYUA 1JKTA 4E73A 1AQ1A 4JLCA 2XJ1A 5K5NA 3U54A 2J4ZA 4PL4A 2C30A 4UY9A 3R8UA 1W7HA 3T9TA 3VN9A 3V6RA 4M66A 2GNLA 5DNRA 4E4LA 4BWPA 4LOPA 4JAIA 4C4GA 1WBSA 2NO3A 3O8TA 4ANBA 2B9FA 5CXZA 5CU6A 5GZ8A 1IAJA 4LG4A 5J8IA 2WTKC 4QMOA 1GIHA 5AIKA 3RWQA 3H9FA 4D1ZA 1J3HA 2R2PA 4LMUA 3OF0A 1OBGA 4X21A 3PG3A 3UP2A 5A4LA 1I09A 1YXXA 5EDQA 3WILA 2WQNA 4QMNA 3OW4A 4AZTA 4DFXE 4L3JA 3IO7A 3KULB 5HEZA 3LXNA 5GJGA 2CMWA 4KD1A 4BDEA 4YHFA 2CGXA 4NM5A 4BDIA 4RRVA 3MVLA 3MYGA 2A19B 4L45A 5M4CA 4DA5A 2YITA 1JPAA 4NCTA 4XG6A 5EM5A 2ZYBA 4AT4A 4ITJA 3QA0A 2DQ7X 3VJOA 5CANA 4Y5QA 1Y91A 4FYOA 5AUVA 5HGIA 4E26A 4ZLYA 3R22A 3UVPA 4QP8A 5FEQA 1REJA 4EH6A 3MFUA 3VS0A 1S9IA 2YM5A 1JBPE 2OXXA 4GVAA 3UOLA 3GU7A 2PSQA 3MW1A 4JR3A 4NT4A 4EUTA 2OFVA 1PMVA 4D1SA 1R78A 4ERKA 5E8ZA 3HAMA 3Q53A 2C4GA 1K2PA 4FT0A 4F0FA 2GMXA 3HA8A 3CS9A 4A4OA 3OTUA 4FV1A 5T68A 4I21A 3NW5A 4EZ7A 3LJ0A 4FV8A 4F6WA 1J1CA 5HLWA 3CPBA 1XR1A 4C61A 4L42A 2XIXA 3F3VA 2YM4A 3QLFA 4BCOA 1U54B 4DT8A 1LEZA 3LXPA 3VWAA 1ZMUA 1MQ4A 1R0PA 2GHGA 3BHVA 4PPCA 3ZO1A 4S31A 4C38A 3D14A 4LRMA 4N70A 4RC3A 4RFYA 4XV1A 4GJ3A 3EFLA 5IUGA 4IW0A 2PVFA 5CNOA 5FXQA 3K2LA 3EFKA 3RBWA 5LWNA 4ZLOA 1HOWA 4R78A 1SM2A 5HTCA 3HMNA 4FKPA 1H1QA 3WBLA 3RAIA 1M7NA 4QMXA 4Q5EA 2VNYA 3RJCA 3ZLYA 4C58A 5CQUA 3ZXTA 4C4HA 3OY3A 1NA7A 4EOPA 3R01A 2SRCA 4ID7A 4EK8A 3UODA 2IW6A 3CTHA 5J95A 2YA9A 3SG8A 4JT3A 1Q99A 3DLSA 4NIFA 4Q5HA 4DGLC 3TKIA 2V62A 4O21A 4CSVA 3FHIA 2QODA 3NDMA 1G8AA 3ORNA 1YOLA 3WF5A 4AW2A 5AR7A 3JUHA 4YZDA 3DJ7A 2I1MA 1UKHA 3H4JA 3KRRA 4N0SA 4XRLA 3KKVA 4FE2A 4L52A 2W4JA 3UC4A 2ZMCA 3OEFX 4KSQA 1G8SA 4FEVA 2P55A 3EQPA 3NNWA 4G6NA 5CS6A 4O6LA 1FOTA 5HESA 5J1WA 2C6DA 3OCGA 5CT7A 5AAFA 3DK7A 4TWCA 2X8DA 4LYNA 3KCKA 5L8JA 4FTNA 4ZIMA 4QTCA 2XA4A 2C6MA 1X8BA 1WBVA 1GAGA 3GBZA 3QUDA 2R4BA 4GS6A 5FXSA 4QTAA 2ITOA 3OWJA 1UNHA 4N6YA 4FC0A 5AJQA 4E6AA 4GH2A 4L00A 4FV7A 4ENYA 3DAKA 4G3CA 2XK3A 5JZJA 4RWLA 5KMIA 4BY9E 1OKYA 4ZTSA 4H05A 5HX8A 2WQEA 4B8LA 2VWVA 3OOMA 4RJ4A 2OICA 2R3KA 2WMTA 3C0HA 3FZTA 4LRKA 4R6VA 2XIYA 4FSRA 1OVEA 1KE8A 2B9JA 2OSCA 2Q0BA 3OXTA 4FTCA 2PVHA 5EI2A 2IVSA 2VX3A 3KRWA 3QC9A 5BVFA 2ZB0A 5CEOA 3GCUA 3CP9A 4XNEA 4YHTA 1IRKA 3R7YA 3SC1A 3TUBA 5HO7A 5C4LA 2OJGA 1W83A 2C5NA 4BB4A 4JG8A 4RG0A 3JPVA 3OMVA 2PMNX 5KMJA 2JLDA 3V5LA 3NCGA 5C8NA 4HYHA 1ZYCA 4V0GA 1G3NA 5EYKA 4DFZE 2R3JA 5IA4A 4P90A 1W0XC 5AM6A 5EOBA 3VC4A 2ITZA 3WYYA 4U6RA 4RBLA 5BMMA 4A9RA 4PNKA 3O17A 2PE0A 1UU9A 2EB2A 3UP7A 3LIJA 4H1JA 5CEKA 4EK5A 4GVJA 3W16A 5KMNA 4O1PA 2W1GA 5HO8A 3AXWA 2G2FA 2OXDA 4XP2A 2X1NA 3PWYA 4JDHA 1O9UA 2BRBA 2IN6A 2RG6A 2E2BA 3OG7A 4FTKA 3HDNA 4ZSEA 3COMA 4ANOA 5JQ5A 2PVRA 3PRIA 5IUHA 2C3KA 4YZ9A 2AC3A 2XRWA 4O2PA 3SKCA 4OTQA 5HQ0A 3QQKA 3TM0A 3U55A 2WMBA 3ORIA 3LCKA 4WBOA 5TO8A 4FR4A 4EBWA 4JQEA 5JGBA 3ATSA 4ITIA 2B53A 1SZMA 2HAKA 4YTCA 5BVKA 3I7BA 3VS2A 4BDBA 4UMQA 4K8AA 3HAVA 4B99A 4JRVA 2R7IA 4YGAA 2G2HA 3OBJA 4IFCA 4JNWA 3KRJA 4N6ZA 4I5PA 5B2KA 2YZAA 4RX7A 2R5TA 1H28A 4BDKA 4HGSA 5HVKA 3ORLA 4CZTA 1URCA 1OKVA 5KE0A 3FDNA 2VTIA 4RJ3A 2HZIA 2VTHA 2ZV2A 3OS3A 4IAZA 5E8VA 4V04A 5K5XA 2J0MB 2QOCA 4GT3A 4OTIA 5K9IA 3FZOA 4DTAA 1RW8A 2JIUA 3BEAA 3U87A 3N4VA 3NVKI 4S2ZA 2P33A 2QHMA 3QD3A 2FSLX 3RHXA 3QKMA 3MA3A 3FMHA 3FKNA 2R3PA 3UO6A 4Y72A 3U6HA 4E93A 2CCIA 4MNEB 3BLHA 4QMQA 3LVPA 5IU2A 4YSJA 2C6LA 2C47A 2J0KA 4EYJA 4BBFA 4QMSA 2E9PA 4FKTA 5H2UA 3QZIA 4BTMA 4EOQA 2W06A 4MAOA 4NCTC 4J97A 5IISA 4XHKB 4BDAA 3GCPA 3CD3A 2UW9A 1XH8A 2VX0A 4PY1A 3DFCB 4YTIA 5CXHA 3WF7A 4YZCA 2WMAA 5LVNA 3MIYA 3LM0A 2ITTA 4OW8A 1YHVA 3ZHPC 4FG9A 4L43A 5HLPA 5J9LA 1APME 4NH1A 4IB5A 3OWPA 1GNGA 3ET7A 2YFXA 5FQDC 3P78A 4MH7A 4RLLA 1W84A 1CTPE 2AYPA 4C3FA 4H3BA 4L01A 5JRQA 3AD4A 2YERA 4F6UA 3RM7A 4AN2A 2HELA 4AW1A 2QOLA 4YC8A 2JD5A 5FM2A 5A4TA 4FTAA 1JAMA 3AC2A 2BIYA 4ERWA 2OU7A 2FH9A 2W7XA 1VR2A 3Q4TA 4TYIA 4XP3A 1KUTA 3Q96A 4ZS0A 4DN5A 4J53A 1K9AA 5L2TA 4FUYA 3BV3A 5ETFA 5GIPE 2AUHA 3IDBA 5AEPA 3SAYA 1HCKA 4J96A 3UIBA 2Z2WA 3HZTA 4MK0A 1XHAA 4FKUA 4GK3A 5TR6A 3PY0A 4G6OA 3WARA 5IH5A 1OBDA 1JWHA 4I6BA 4XOZA 3NX8A 4AOJA 2DYLA 3FLSA 3OCSA 3O8UA 4RIYA 4X3FB 3JYAA 5CSHA 4OAVB 3W1FA 2C1BA 3QF9A 2ITWA 3L8SA 4XLVA 4KBAA 4D2VA 1WFCA 3NUXA 4HGLA 4M0YA 5CU3A 5EKOA 4GUBA 4TTHB 1R0EA 3DOGA 3MH1A 4QPAA 2YEXA 3F9NA 4EOMA 3DZQA 4QP6A 4PTEA 1VJYA 5I3RA 2OJJA 3KU2A 4BI2A 3DT1A 3HKOA 1H27A 2XB7A 3COIA 4FGBA 4EOJA 3F3ZA 2BMCA 4EHEA 2J90A 2BAKA 4G9RA 2BTRA 3WF6A 2VNWA 3WE8A 3DXQA 4N57A 4M13A 3C0IA 4A9UA 1H24A 1ZYJA 2PVLA 2ZB1A 4B9DA 4EUUA 2JGZA 4BZNA 2VO0A 5HOAA 3AD5A 3C4FA 3KRXA 2Y6MA 4FSMA 5CEQA 4QYEA 2OF2A 2PK9A 4E6QA 5CF8A 2VTPA 1Y57A 3ZZEA 1LPUA 5AV4A 3R1NA 3S4QA 3KEXA 3U6JA 5K4JA 2YLEA 1ZYSA 3TTJA 4OLIA 3SXFA 3TI1A 4IAKA 5CSWA 4DAWA 5CEIA 4C4JA 3AMBA 3IG7A 2IVVA 4APCA 1WVWA 3EYHA 4H3PA 3FQHA 3LCDA 4CG8A 3OCTA 1OPLA 4FUXA 2OH0E 3LZBA 4HYIA 2YWVA 3G9NA 4RJ8A 5T3QA 5I9VA 2WAJA 3FI2A 3KRLA 3DBDA 1OITA 4E6CA 5AR8A 4O83A 3QRUA 4QMTA 2FSTX 3HYHA 3QRKA 3Q2JA 2WNTA 2QKWB 3OZ6A 4H58A 3AT4A 1ERKA 4XOYA 2XK9A 5DT4A 3LHJA 1KWPA 4AFJA 3R8VA 2W05A 5CAUA 1ZARA 3VIDA 4QMMA 4LUDA 4EEVA 1H25A 4GG7A 5IA5A 5ANEA 3BLQA 4AZVA 1DS5A 3O7LD 1ATPE 4PDSA 4F0IA 5JFWA 3NNVA 3DBCA 2PWLA 4IWOA 1UNLA 4JIKA 3QRJA 4W8EA 4QT1A 3KK8A 1PXJA 3HMPA 1YDRE 3QQHA 3R7GA 5IG1A 2IPXA 3BYOA 4M69B 2UW3A 3IW8A 4FG8A 4FVRA 4MEDA 5AV0A 3SD0A 2YWPA 3C50A 4EL9A 4L7FA 3NUAA 3ZH8A 3R9DA 4BTKA 5LQFA 5L6PA 5HU3A 2J7TA 2W1FA 4RVTA 4MQ1A 2Z02A 3AMYA 3PUPA 4M7IA 3FLWA 3H3CA 3FZSA 1YKRA 2VTLA 2WQBA 3DKFA 4Y8DA 2BKZA 5IA0A 3VBTA 4ZSLA 2XIRA 3GU5A 3UJGA 2XK6A 5IZFA 4YMJA 3NZ0A 4F63A 3L8PA 4D5HA 5J7BA 2JFMA 1J7LA 3IKAA 1Y8YA 3HECA 4HNIA 4KNBA 2A4LA 2Q0NA 5EW8A 1GOLA 3QQLA 5I9XA 5C01A 2OJFE 4DG2E 4TWPA 2VD5A 4LUEA 4CT2A 3VS1A 2VTSA 4RA5A 4JBOA 3Q04A 1YXUA 1KOBA 3LFQA 2XEZA 4QYYA 3O0GA 2C68A 3KN6A 4FSWA 4ONAA 3P7AA 3KULA 4A7CA 2V7OA 4DH7A 2IG7A 3ENHA 4IM3A 4EJ7A 4IEBA 4O0XA 1M2QA 2XKCA 2FO0A 3VUGA 4FKJA 5EQEA 1YHWA 2C3LA 4OTWA 1H08A 4U42A 2YM8A 3BHTA 3R6XA 1NXKA 4W4VA 4YJRA 3TUDA 4WD5A 5ITAA 3TWJA 4F08A 4G5PA 4KUJA 5T6KA 5EKNA 1H1SA 1YXSA 1Z57A 2Y4IC 2EWAA 3PVWA 3IW5A 3R21A 3RAWA 4FKLA 2QO7A 3V6SA 3QZGA 4MXXA 2W4OA 2YN8A 2PZYA 4UMRA 2XYNA 1FPUA 3RVGA 2VO6A 1B6CB 1JKKA 2PE1A 3UYSA 3ID6C 3II5A 2PHKA 2YJRA 3QRIA 1ZXEA 2HXQA 4IM2A 1XH4A 4Y95A 3WZUA 3OP5A 4Z3VA 3ZEWA 2WHBA 5HD4A 1DM2A 3R7IA 3ZOSA 1U54A 3UQCA 2X7GA 2JAMA 4FIHA 5EG3A 2YM7A 2XNPA 5BVWA 2WU6A 3LE6A 1KE6A 4I0RA 1OB3A 3NUPA 4MVFA 3UG1A 3GP0A 3PJ8A 4QP4A 4DBNA 1FGIA 1SVGA 2WTIA 2Y0AA 4LL5A 4YJSA 3RKBA 4MX9A 5A14A 3CCNA 3OEZA 3EN4A 3R83A 2C3JA 2A27A 3AC8A 4FTLA 4M68A 4WNPA 1PMNA 5FWKK 5BQ0A 1GZNA 4FEXA 2REIA 1VYWA 3PXKA 3VS7A 2IJMA 3FZRA 4I93A 3PP0A 3LMHA 2PVNA 3CGOA 2JDVA 3GEQA 3AG9A 4W4YA 4Q2AA 4YHJA 4HYSA 4FZ7A 5AP7A 2IWIA 3HV3A 3NAYA 4L9IA 4O0VA 4A4LA 3V5TA 2ZDUA 4DEIA 2XIKA 3DBEA 3O23A 3EMGA 1R3CA 3TNPC 4AF3A 3C5UA 3FLQA 3FC2A 4EH5A 5IQBA 4BC6A 4D2RA 2GS7A 5IQHA 3BPRA 3MPAA 3PXQA 3MB7A 4BZOA 2IZSA 2WTDA 5AUTA 4APPA 3LCTA 4FTTA 4I5CA 4IFGA 4J99A 4YJVA 3LQ8A 1AGWA 3MIAA 3R1YA 1QPJA 3SHEA 3R1QA 4TZRA 3T8OA 3ZO3A 3L8VA 4ZAUA 4MF0A 4YTHA 5A3XA 3ORPA 3WZEA 5K3YA 3T3VA 5K0XA 3PDTA 2BR1A 3H30A 4IAAA 5AIRA 3RK5A 4U9AA 4C3PA 4BICA 1PKDA 4U97A 3ZZWA 4WRGA 2Q83A 2C0IA 5CYIA 3NCZA 3B8RA 2R9SA 2C6IA 2ITYA 4EOIA 1P4FA 3FBVA 3UNJA 2UZVA 5ANJA 3DKGA 3VHEA 4G2FA 4RGJA 3MVHA 4XMOA 5IDPA 5C9CA 4EHZA 1L8TA 3A7GA 4XX9A 3G6GA 1WVYA 3ZCLA 4DGGA 4KRDA 4LV8A 2UZOA 4Q9SA 4CFNA 2H34A 4GYIA 3LFNA 4XEYA 5KZIA 3R2BA 1NVQA 1U4DA 2X7OA 1PF8A 4J7BA 4NU1A 4AZSA 5M4FA 3FSKA 5L8LA 3HUCA 4LI5A 2Y7JA 3CTJA 5C8MA 2HWPA 4RJ6A 4PMTA 4IVBA 5HIDA 3NUNA 3DV3A 1PXMA 2WIPA 3D7TB 3ZRKA 3C1XA 5BYYA 1GZKA 5BYZA 4EH8A 1ZZLA 5D12A 4M3QA 4ENXA 1OIRA 4K2RA 4OGRA 5J87A 4JIAA 4AA0A 3QLGA 4BGHA 4D9UA 5B2MA 5M56A 5LVLA 1ZWSA 3NMUF 3HGKA 3CKXA 3IDCA 3ACKA 4AW0A 3UVRA 4BN1A 1GIIA 2JC6A 3TNWA 4U3ZA 2OK1A 3Q52A 2WTVA 3BLRA 1DAWA 3MN3A 2F2UA 2QR7A 1JKSA 2VTTA 1JNKA 3R2YA 4QOXA 5IKWA 2GQRA 3JR1A 3W2PA 4RFMA 3Q9YA 5FTOA 5KBQA 3PG1A 3MESA 1V0OA 2VTJA 3I5NA 2PTKA 4FL2A 4ZXTA 3SX9A 3F5PA 2BDFA 2BDJA 5HBJA 1A9UA 2QU5A 1JSTA 2WB8A 4S34A 5L4QA 3LAUA 4F6SA 3QTIA 4FSUA 3SW4A 3LCSA 3NS9A 2XBJA 3SOCA 5LCKA 4XH6A 4RIOA 3LJ2A 1ZZ2A 4W9WA 4AAAA 4FIEA 2H8HA 3Q3BA 4AS0A 5AP3A 4O22A 4FZDB 1Q5KA 4PTGA 3BU6A 4E4MA 3FEGA 3MH2A 4NTSA 4FZFB 4R1VA 4U44A 3T9IA 2QG7A 2YZLA 4O1OA 1GIJA 3QQFA 4O7NA 3BIZA 3ZRMA 3VUDA 5HNGA 1SMHA 3THBA 2OH4A 4D2SA 3O96A 5BPYA 2FB8A 3Q6WA 5CASA 3PWDA 3W18A 5FUTA 5IMXA 3NLBA 4RFZA 2W96B 4USDA 3W2OA 4F9BA 4ZY4A 5A6NA 5DT0A 5KUPA 4I1ZA 3SRVB 4FTOA 2GSFA 4YJQA 4BCJA 3CTQA 4CNHA 4DINA 5AUUA 3S0OA 3TIYA 3FPMA 3VS4A 5FLFA 4O96A 2C3IB 4EH9A 3H10A 5JSMA 3BQCA 3AC1A 3MJ2A 2X7FA 3MGYA 4PMSA 5L6OA 2YIYA 4MNEA 4YNEA 2ITQA 2WMVA 4FIGA 1M7QA 2W5BA 5HX6A 3AC3A 4QYHA 4ZTMA 3PLAE 5LXMA 2BHEA 2GFSA 1IR3A 5ANDA 2CPKE 1UWHA 5F20A 4QYGA 5EM7A 5J9ZA 1YW2A 2RG5A 3PFQA 4WIHA 5IQGA 2HCKA 2I0VA 3GVUA 4ZZOA 4ZSAA 5IEYA 2IW9A 1REKA 2CKPA 3F5GA 4TT7A 5CVGA 4O81A 4NM3A 2QOIA 3FMKA 4W4WA 1J1BA 5DI1A 3HP5A 4RWJA 4C57A 4CZUA 3LFDA 3SXSA 5ICPA 4BBEA 2UV2A 1VZOA 4O0SA 3FHRA 3K3JA 3HMMA 4KB8A 1YI3A 3ZRLA 2XBAA 3G6HA 3GCVA 1WBPA 1H4LA 1T46A 4P2KA 4K1BA 4FA2A 4CKJA 4LGGA 1YQJA 3FXXA 2BIKB 2UZTA 3NUUA 5EOLA 1BL6A 4RA4A 5EDRA 4GFOA 3P7BA 4U7ZA 2OJ9A 1GZOA 5JGDA 3EOCA 3NYVA 4GK2A 2WQMA 5BVDA 4AE9A 2OIDA 5DVRA 4H3QA 5KMKA 1TQIA 4ACMA 3A2CA 3QA8A 4UMTA 2BFXA 2QLUA 4CGAA 5C4KA 4I20A 4AZWA 3F88A 3BGPA 4FNWA 5KCVA 2NP8A 1J7IA 3DAEA 1SVHA 3FLYA 3VAPA 2HZ4A 4LOQA 3QCQA 4KS8A 4I6HA 4JX3A 2B54A 2HW7A 4QPMA 3S2PA 3FXWA 1QPEA 2PE2A 3DAJA 5KMMA 4X3FA 4MXZA 2Z7SA 4LGDA 1W8CA 4IAIA 3GOPA 4IB0A 4QMWA 3BGZA 1H8FA 3FZPA 2XZSA 4IZ7A 3QQGA 3IK3A 1XQZA 3TXOA 2IVTA 3G0FA 2NRUA 3FMEA 4U0IA 4D2WA 2O64A 1UU3A 4A4XA 4AGDA 2ITXA 1PMEA 2BROA 3WE4A 4DCEA 4N4SA 4NSTA 5HE0A 5LMKA 3OW3A 3EHAA 3AMAA 4FIIA 4FEWA 4FZAB 3MB6A 4I24A 4XV2A 2WTKB 4O2ZA 4DITA 5M44A 1Z9XA 2XCKA 3QTUA 3QD2B 4IXPA 2C0OA 1Y8GA 3A62A 4GV1A 4BR3A 5DWRA 5I0BA 4GU9A 2DUVA 3F6XA 3PVUA 3QTSA 3DB8A 5E91A 3PZHA 2V22A 4X2KA 3RPSA 4R8QA 3A4OX 2C5XA 1BMKA 3GCQA 3R00A 4M14A 4O0UA 4X3JA 2PVKA 4CLJA 4IDVA 3HNGA 1OI9A 2QURA 3MA6A 4YJTA 5HBHA 4D9TA 1FMKA 3BYSA 4KKHA 4O7TA 3NNXA 4AW5A 1IAHA 1JQHA 3BE9A 4PMMA 3LMGA 4JG6A 3UNZA 3HLLA 4AE6A 3BHUA 4WNKA 2JIVA 3VBYA 4ANQA 2RFNA 2ZV8A 2IO6A 5E8WA 3RTPA 4B8MA 4S32A 2NRYA 3KQ7A 4FT5A 4QP2A 4TNBA 3W55A 2NPQA 2PZRA 4EOSA 2I0EA 5HG5A 3TUCA 1PRYA 3EKKA 4C59A 4IQ6A 4IX6A 3BHHA 2FGIA 3M1SA 4EQUA 4PDYA 4V01A 2HYYA 5FDXA 2OZAB 4KIPA 4PX6A 5HE3A 4C3RA 3A7HA 3EN5A 3MTFA 5KX8A 4O7WA 3BQRA 5CF6A 4I4EA 3RCDA 4HPTE 2VWYA 4FV2A 5L2IA 4P4CA 1F0QA 5AWMA 2DWBA 3IDPA 2PZ5A 4EWQA 3F2NA 3NWWA 3RPRA 3TV7A 4CFUA 3OUNB 4EH3A 5CSVA 3FY2A 4FBXA 5J5TA 4M69A 4UMPA 5AA8A 3LKMA 3SQQA 2KULA 3OD6X 5AUYA 5HCZA 2AC5A 2R3OA 5FRIA 2R64A 2CDZA 2A2AA 3ZUTA 3PY3A 3VRZA 3ENMA 3KA0A 1Q41A 4OTGA 5GNKA 4ZK5A 3GOKA 2BTSA 4I0SA 4UBAA 3RAHA 1PHKA 3IW6A 3BKBA 5D11A 1MRYA 3WIKA 2J6MA 4RX5A 4U5JA 3RMFA 4IB3A 4RPVA 4EBVA 4P5ZA 1TQPA 4ZSJA 4IADA 2PVYA 4FKQA 4EC9A 4WUAA 4Y5HA 3HRFA 2IW8A 3W32A 3P23A 4QQCA 1U59A 3ZC5A 3ZSIA 1Q8YA 1IASA 5CTPA 3WI6A 1XH5A 2E9UA 4R3PA 4CTCA 2F7ZE 4JBQA 5D7VA 2Y4PA 2JBPA 5KMLA 5CAQA 3A8WA 4CFWA 3BHYA 5AP1A 4IWPA 1ZYLA 3KC3A 4YBKA 4BVUA 2X6DA 5HBEA 4QYFA 3OVVA 2O8YA 2UVYA 3A7IA 3R1SA 2EUFB 2GTMA 4G3EA 4BHZA 4HGEA 4ZTRA 3SA0A 2J50A 5DA3A 1IA9A 4CYJA 4YPDA 3HMIA 3UTOA 1OL7A 3CKWA 2BRGA 2EXCX 2CGUA 2ZM1A 5CF5A 4GKIA 2ZV9A 4E7WA 4DEDA 3RHKA 2CGWA 1QMZA 3GC9A 2UW7A 3D7ZA 2BILB 4EOLA 3VJNA 4XUFA 5FP6A 4BCMA 3D9VA 2R3LA 4R1YA 2W5AA 3KMWA 5DLSA 1NVRA 3FMJA 3MDYA 5A6OA 4FK3A 3EQDA 3RM6A 1OKWA 5J5SA 4FV5A 2JBOA 2OG8A 5AX3A 4ACCA 3NW6A 3FAAA 2G01A 2WFYA 4X2JA 3G90X 4NM0A 3U4WA 4FOCA 4IC8A 5I3OA 4MD9E 5JMSA 2W0JA 3NUYA 4R3CA 4MXAA 5HZNA 2GNHA 4CMOA 2XS0A 5IH6A 2PYWA 5FTQA 2WMRA 4ALWA 2A0CX 3G0EA 3C4CA 3GFEA 4XYFA 3KB7A 4D5KA 4GFMA 5F95A 2W1HA 1FVVA 4F1TA 4G3GA 4FSZA 4PDPA 2RKUA 4JAJA 2C69A 4I5MA 2LAVA 2WKMA 2CLQA 3DKOA 4J95A 2X9EA 4U43A 4CMTA 4UZDA 1TQMA 2XRUA 2W9FB 2XUUA 4QTBA 4J52A 3AOXA 3DS6A 2Y6OA 3DBFA 2YIRA 4E3CA 3ZBXA 1NT2A 1RQQA 2XJ0A 4JDKA 2BZIB 4L46A 3L9MA 2QCSA 3ODYX 2XM9A 2ZJWA 3E8EA 3I5ZA 4TW9A 4ZJJA 4DT9A 1H1PA 3NAXA 3EQBA 4FKVA 4WUNA 5CAVA 3E88A 3M11A 2OJIA 3QTZA 2EXMA 4BDHA 3R8ZA 5LJJA 2J0JA 1OMWA 1PXIA 2J5FA 1MP8A 3FI3A 3KFAA 4IVAA 5LARA 3I81A 1HCLA 4EKLA 2VTRA 2XP2A 2C6TA 3KXMA 4MXYA 4GIHA 5H8BA 3EJ1A 3AQVA 3VUKA 4AN3A 4GFGA 3GQIA 3KXZA 2JDTA 3HL7A 3KXNA 4ZJIA 4BIBA 4NL0A 3PXFA 1MQBA 3K54A 4X3FC 5JGAA 1M14A 3BU3A 3POZA 3FYKX 3ZYAA 4BKZA 4F1MA 4QQJA 4XG7A 2G9XA 2QO9A 1OZ1A 3NIEA 3QX2A 4Y46A 4ANNA 4FV0A 4QQTA 4WO5A 2H6DA 3CJGA 3QU0A 5CEPA 3KF4A 4YLJA 3QTWA 4IC7A 4C62A 3KVWA 5HKMA 2EU9A 2PZIA 5BUIA 5ANGA 5DE2A 5DHJA 3WOWA 3MVMA 4UWYA 3E92A 2QOFA 4I22A 4QRCA 3W10A 2Y8OA 4CFXA 5LCJA 4YLKA 2WMUA 2J9MA 1LP4A 3ALNA 1QPDA 4BL1A 3FSFA 3PSDA 2FSMX 4P5QA 5DFPA 5DMZA 4ACHA 4I5HA 4EHVA 1TKIA 3E93A 4GT5A 4MWIA 3FKLA 3PP1A 1KV2A 5KZ0A 4FNXA 1A48A 5L2QA 1R39A 1EH4A 4CRSA 3QTQA 4IHPA 4EORA 1A06A 4YSMA 3UOJA 3PA3A 4E8AA 1OM1A 3NSZA 5B2LA 3C4EA 4DFBA 2X2LA 3BYVA 3P0MA 2QHNA 3D7TA 5ANOA 1FINA 5FM3A 3ORZA 3NNUA 4NEUA 3ZLSA 4XBRA 3KXGA 5GZAA 3UOHA 1GY3A 2WTCA 4IX4A 4JDIA 3RPYA 1YWVA 3FLNC 2XKFA 2C6OA 4HZSA 4I6QA 4DHFA 2O3PA 2QD9A 2R3FA 2X81A 4F7JA 4X2GA 3TV6A 4FT3A 1KE5A 2GFCA 3OFMA 1LR4A 4QPSA 3MY5A 5LVMA 2Z8CA 5DH3A 2IZRA 1ZMVA 3MI9A 5CZHA 3UC3A 3K5UA 3UG2A 1KE9A 4FSQA 4XP0A 4WNMA 4FTMA 5CSXA 4PP9A 4RZVA 2UW0A 2I40A 4QP9A 1OL1A 5H9BA 3RPVA 3UO4A 2VO3A 3PSCA 4OT6A 4C33A 5ANKA 4FIJA 1WBWA 3Q6UA 4FKGA 4KABA 3MJ1A 4XCUA 2WTJA 3PPZA 3NGAA 3GC7A 3NRMA 5B7VA 5AMNA 5CLPA 4L6QA 4C4IA 3NPCA 3UPXA 3W2SA 4F99A 4WA9A 4IZYA 5CVHA 4AU8A 4PMPA 5M4IA 4DC2A 2OI4X 3HRCA 3NYXA 3F2RA 5ETIA 4GL9A 3PA5A 4MTAA 4FSTA 4JG7A 4RC4A 3RZBA 3ANQA 3ALOA 4FV6A 2W99B 2W1EA 4U45A 3QTRA 4BCQA 3OT8A 1LEWA 5CU2A 3GB2A 1WBTA 3DTCA 3KK9A 4E5WA 2QOOA 3E7OA 5EW3A 4MHAA 4C02A 3ULIA 3MH0A 3GU4A 3C5IA 3KGAA 2QU6A 2RSVA 3EB0A 2HZ0A 4E20A 1OECA 3E3PA 3TEIA 4MXOA 2I7QA 5M09A 3C9WA 3QD4A 4GKHA 2J5EA 5EQYA 5C8KA 2PZPA 3I60A 2F49A 3TJDA 5CAOA 4S33A 3DXNA 4K0YA 3V5JA 1MRVA 5IH4A 3FYJX 1I44A 4U8ZA 5HLNA 3ZONA 2ETMA 4WOVA 3SRVA 4C35A 2XIZA 5FP5A 2UZNA 5AUZA 2VUWA 2XNGA 1WMKA 5CENA 2PULA 4YJPA 3RINA 5D9HA 4WG4A 3CLYA 4R3RA 3VS3A 1V1KA 2UZDA 3CXWA 4IX5A 3DXPA 3FQSA 3LFEA 4M67A 4ANMA 3OXZA 2CN8A 2XJ2A 4MWHA 4F70A 3DKCA 1TVOA 1ZOGA 4CKIA 2XNBA 5AR2A 3LMIA 3HUBA 4L7SA 3NW7A 4KAOA 3PSBA 4V05A 5M51A 3TZ8A 4R7HA 3I6UA 5LOHA 1PY5A 3IS5A 3AC5A 3MV5A 2OF4A 3I4BA 4CV9A 1UNGA 5ANIA 3UZPA 1CSNA 5AAGA 4FKWA 1WZYA 3QYZA 2BALA 3BWJA 3PXZA 4DFNA 4TKSA 3QFVA 3FQEA 4IBMA 5ACBC 5HHWA 1PW2A 3ZSGA 4EZ5A 1ZY4A 4CD0A 4UWBA 4HNFA 3TDWA 2OXYA 4AOIA 5C26A 2B55A 2VN9A 3V8WA 3UMXA 1XH7A 5CEMA 2XCHA 5BYLA 3UZTA 3HRBA 3GU6A 4XG4A 4R7IA 2QNJA 2XEYA 3LFAA 4KIOA 5EHYA 3E7VA 4L68A 4D28A 4YU2A 5BUJA 3TZMA 3QGWA 4WBBB 5LMAA 1H00A 1OL5A 3ZFMA 3VUMA 5IDNA 4G16A 3BRBA 4AWIA 3JY0A 3TZ9A 3ZU7A 3UGCA 4U3YA 2PUIA 3WZJA 4FZ6A 4Z7GA 4KIKB 5I9WA 2VV9A 4CQEA 3OOGA 3EWHA 1O6KA 3VW6A 4XLIA 2YHVA 3QD0A 3CEKA 5HG9A 4D4RA 1SNUA 4HPUE 1OIUA 3ZO2A 5HIEA 4HCVA 5BVOA 4XJ0A 4KIQA 3L9NA 3V8TA 2P4IA 5FG8A 5CALA 4D4VA 5AUWA 1M2PA 4Q9ZA 2PPQA 3RI1A 5DR6A 5A46A 3KCFA 4K77A 4DFLA 3GT8A 3O50A 2YCQA 3FLZA 5JQ8A 4UX9A 3R30A 1Q8WA 2WXVA 1UKIA 3A8XA 3HEGA 1MUOA 2F57A 4BKYA 2H9VA 5C1QB 4K6ZA 3DJ6A 4GUEA 3PJ3A 1NVSA 2I0HA 1FMOE 4BIEA 1BYGA 2NNWB 3QUPA 3F5XA 2PL0A 3ZUUA 2HIWA 4R7BA 4LL0A 3ACJA 1JVPP 4F7LA 3UNKA 4RWIA 3TJCA 2GNJA 5A9UA 3S95A 3GGFA 4C37A 4ORKA 3UQGA 2XK4A 3V5QA 2YDIA 2DS1A 2F7XE 4AN9A 1M52A 2C0TA 3DPKA 3LXKA 3QRTA 4M0ZA 3V51A 4E5AX 5KMOA 3ZDUA 2CCHA 4ALVA 5I4NA 4FL3A 3GXLA 3CGFA 4BDGA 4EQMA 2GDOA 2HY81 3D0EA 3ZLWA 5IA3A 3JVSA 4YLLA 2W1ZA 5IQFA 4FT9A 1JOWB 2BVAA 4O6EA 4X0MA 1QL6A 4PV0A 4FSNA 4AGCA 4FTIA 4BCIA 4I41A 4DFUA 2CKQA 4AG8A 2WELA 4QMVA 3CD8A 2J51A 5AR3A 2R0UA 4CCBA 5KHXA 1YI4A 4TY1A 4O7RA 3UPZA 3PXYA 4I94A 4FV3A 3AGMA 5BNJA 2Y4IB 4EH4A 2PVMA 2X2MA 5B0XA 1VYZA 4WSQA 3OHTA 4C2WA 2E9NA 5DBXA 5FEDA 3OC1A 4G3FA 2FA2A 2OZAA 3HA6A 2WQOA 4M8TA 5DN3A 3EQRA 4AXAA 3JY9A 4YTFA 1OPJA 2UUEA 3PRFA 4FT7A 1YRPA 3A7FA 1VEBA 3QCXA 3R7OA 5E90A 5L2SA 5L3AA 3NUSA 3QZHA 2VRXA 2UW5A 5CT0A 1W82A 3LQ3A 4ARKA 2C5YA 3JXWA 2GHMA 5KKRB 5E1SA 3R9RA 2IZTA 3LM5A 4DTBA 5CWZA 3L1SA 3TIZA 4G1WA 5F1ZA 4BTFA 4B4LA 1WAKA 5M55A 3EFWA 4JQ8A 2ETKA 2VWWA 3DK3A 5CU0A 4RWKA 3ERKA 4ZTHA 3WZDA 3KN5A 4FF8A 2R3MA 4CFVA 3UZRA 2B1PA 4X2FA 4OTHA 4YZBA 4ZMFA 3REPA 4WG3A 4ZTNA 3Q5ZA 3R63A 4DGMA 1Q3DA 3UVQA 3UOKA 5CNNA 3QX4A 3L9PA 4M15A 5AP0A 3S3IA 3TKUA 4ZY5A 1WCCA 1WBNA 2J2IB 4NWMA 5CU4A 5AP4A 4CTBA 5EH0A 4AGWA 2UZWE 2VWUA 3TACA 4B7TA 3F66A 4R77A 2OIQA 5AA9A 4DYMA 4MQ2A 4RX9A 3G5DA 2V0DA 3W2QA 3DY7A 4BIDA 2HK5A 2G2IA 3LJ1A 5JK3A 4LRJA 5IQEA 1GJOA 3E5AA 2V5QA 4OTDA 5AFVA 1Q24A 5DEYA 2UW6A 1PXNA 4ASEA 4XBUA 3P86A 2YIQA 3G51A 3RALA 5IF1A 1M17A 4O7LA 2QO2A 5AP6A 5HICA 2V55A 4IIRA 5AM7A 3R9HA 1P2AA 5HORA 5M07A 4CG9A 3VF8A 4IE9A 4G31A 2VTNA 1YWNA 2HW6A 5IEXA 3LW0A 4UALA 5F94A 1YDTE 1XO2B 1XWSA 3B2TA 4AZFA 4TL0A 4D58A 5IQIA 2R7BA 3H9OA 3I79A 2ZM4A 2XNMA 5HG8A 3FL5A 3CIKA 4BGQA 2X39A 2WEVA 3CY2A 3C4XA 2H96A 4FKRA 4MD8E 4YJOA 5D10A 3FC1X 4FV9A 5CY3A 5IUIA 4BFMA 5KO1A 4O7SA 5DG5A 3TL8A 4Y73A 1GZ8A 4BGGA 4AA5A 5FGKA 4BTJA 2VX1A 2C5VA 2VWBA 5KHWA 3IOKA 3TNHA 2FVDA 2YJSA 1P14A 3SGCA 5HTBA 4AACA 3C7QA 5EK7A 3MFTA 2YIWA 3KXHA 3QBNA 3ZXZA 4I6FA 1XBCA 2UZLA 3KVXA 4TXCA 2X4ZA 4DEHA 4DLIA 2W1DA 5IA1A 1H26A 2CKOA 2XH5A 2VO7A 4I4FA 4JRNA 4DGOA 4TWOA 4MD7E 5EI6A 2P3GX 4Z7HA 4I92A 1KOAA 1CKPA 2UW8A 5EYMA 5IEVA 3C0GA 4QMZA 4AA4A 3S1HA 3F7ZA 1YWRA 3TNIA 2P2IA 4UB7A 4HZRA 5DPVA 2PUPA 2JITA 4NUSA 4OTRA 4OBQA 4AQCA 4PRJA 4X2NA 3GNIB 4EYMA 4CVAA 1UV5A 2C6EA 3Q4CA 2YDJA 3MVJA 4YC3A 3CY3A 4TYEA 4RX8A 3UIUA 1UU8A 4GSBA 4FVQA 2QG5A 4JDJA 3A7JA 3O2MA 4RIXA 4F0GA 4FG7A 4F4PA 1Q4LA 5AUXA 4F9YA 3ZEPA 1CKJA 3HV5A 2VU3A 2YISA 3R8PA 3ZTXA 4OTFA 3PJCA 2Z60A 2X8IA 3BE2A 4QNYA 1ZY5A 4XRJA 4C0TA 1OGUA 2CHLA 3WZKA 1JSVA 4RQVA 3ETAA 3IECA 4NKAA 2BRMA 4D1XA 2OIBA 3DK6A 4X6RA 4PPBA 4QMYA 4A07A 3LQ5A 4BDCA 5EW9A 4NTTA 2ESMA 4WT6A 3IONA 4NJDA 4FNZA 5CQWA 2CNUA 4IJPA 2B0QA 4FTJA 4UEUA 5CAPA 4GRBA 3DQWA 4CMUA 2FSOX 2R3IA 3QXOA 2CSNA 2B7AA 2YLFA 2YM3A 4NFNA 4TPTA 2VTQA 5FD2A 5HNIX 4RZWA 2QR8A 3UIMA 4J8NA 4LOOA 4GIIA 3R8MA 3RWPA 1OKZA 5J7HA 1RJBA 3A4PA 2OLCA 3ORMA 1Q8ZA 2YCSA 4JOAA 3ZFXA 4FNYA 3ZMMA 1KE7A 4G17A 1M2RA 3NR9A 5C03A 4G34A 1QCFA 3SXRA 1ZRZA 3QKLA 2UZUE 1JSUA 5DR9A 3TTIA 5IQAA 4C4FA 3S00A 3W2CA 3KMUA 4ACDA 5JFVA 1URWA 3D5WA 3PPKA 4FV4A 4MKCA 4PUZA 4U41A 5IMEA 4L44A 4H36A 4DLJA 4BZDA 1ZAOA 4EK3A 3U8WA 3V5PA 3HV4A 5AX9A 3ZM9A 3F7WA 3HP2A 4GU6A 2B9IA 2R3GA 2VTOA 4PQNA 3QAME 2UW4A 4NFMA 3Q9ZA 4IMYA 2RGPA 1BL7A 3VBQA 1Q8TA 4E4NA 4LV5A 2GHLA 4IJ9A 4Z16A 3UE4A 4JBVA 4YZNA 2HENA 4OBPA 4RVKA 2BUJA 3RPOA 4DE4A 4HGTA 4BDFA 4RJ7A 3R0TA 4WSYA 3BU5A 3FPQA 4AP7A 2ERZE 3LXLA 2X9FA 1CKIA 3BZ3A 5CI6A 1PXLA 5E92A 2PU8A 2BFYA 4B6LA 4I3ZA 1S9JA 4EQCA 4UMUA 3E62A 5HE1A 3SDJA 4U80A 4E1ZA 2GNIA 4QO9A 3COHA 1PXKA 4DEEA 1PYEA 3BBWA 1CM8A 4PL3A 5H3QA 3V01A 3F5UA 3ZBFA 4IB1A 1YXTA 3F3WA 1BUHA 2HY0A 3Q4ZA 4EI4A 5JEBA 2BRHA 2WU7A 4FL1A 4DH3A 2WMSA 4GEOA 3W33A 4QMLA 5D1JA 4EONA 4F9WA 4FEQA 5A4CA 2PMLX 1LUFA 4RVLA 2LGCA 5HNBA 4U40A 4HVHA 4F65A 3CC6A 1CDKA 3PPJA 3F61A 1YI6A 1XJDA 3KY2A 4FIFA 4FTUA 3U9CA 3E8CA 3WIGA 2E9VA 4JL9A 2Y9QA 4I23A 1B38A 2CLXA 3ZUVA 3D5XA 4HW7A 5BVNA 2QLQA 1XBBA 2XMYA 3SW7A 5LVPA 4RVMA 5GIOE 4TYJA 5EI8A 3VRYA 5CVFA 4C2VA 3N4UA 2XVDA 2PY3A 3EZVA 3MFRA 3Q32A 5ACKA 4IZ5A 4NZWB 3A60A 3I1AA 4QP3A 2OW3A 3IGGA 4E4XA 2VGPA 5TF9A 1SYKA 2RL5A 5DR2A 3PVBA 4OUCA 4W8DA 3ATTA 3UIXA 2F9GA 4EKKA 4O7VA 5EYCA 4M84A 5DYJA 4HOKA 4B0GA 4OT5A 5M4UA 3V5WA 1OIYA 5L8KA 2EB3A 4FVPA 1PXOA 4KWPA 5HVJA 3R71A 5LMBA 1PKGA 3L9LA 3EN6A 2VTAA 3OCBA 4TYGA 2KTYA 3DLZA 3TV4A 3PIXA 3HMOA 5DEWA 5BX0A 2PVJA 2WTWA 4QD6A 5M06A 3CQEA 4G5JA 4QTDA 5E8SA 4TYHB 3E8NA 3ORTA 2YM6A 3FMLA 5JRSA 4GYGA 4UZHA 4JXFA 2O0UA 4UXLA 4CQGA 2WMWA 3QALE 3P7CA 1BI7A 3E87A 5EYDA 4ZZNA 3K3IA 2UZBA 4FYNA 2Z7RA 5LWMA 4IH8A 4IACA 3R9NA 4FGRA 2ZMDA 4FTRA 3EN9A 3BEGA 2O65A 5GJFA 3BV2A 5JKGA 3RCJA 3VO3A 3H9RA 1OUKA 4WKQA 4FOBA 2V7AA 4RSSA 4CFMA 2CNVA 2VGOA 5TKDA 3ZO4A 3QCYA 4USFA 1DAYA 4KIKA 4F09A 3DDQA 3EKNA 3ODZX 5HE2A 3FXZA 4BCGA 3G33A 3G2FA 4O86A 4J1RA 1XH6A 2QKRA 3LPBA 4Y85A 3I0OA 5H8EA 5DRBA 2QVSE 3WF8A 1ZOEA 4NJ3A 4W4XA 3M42A 3Q60A 4X7QA 5GZ9A
chains in the Genus database with same CATH superfamily
3EQHA 3TNQB 1VLRA 1CMKE 5HI2A 3PVGA 3F69A 4H39A 4WRSA 4WG5A 4PL5A 2X4FA 3DTWA 3NYNA 4W9XA 1U46A 3HDMA 3GI3A 2EXEA 3UYTA 1UU7A 2ZOQA 4CCUA 5DOSA 4MCVA 3GC0A 3QKKA 4D4YA 3LFCA 1FBNA 1H0WA 3C51A 4JX7A 5EHOA 4TWNA 5HVYA 2GPHA 4L53A 5AAEA 4FI1A 3ZSHA 4IANA 4K11A 4IWQA 4LDTA 5M53A 4QQ5A 3DB6A 5FBOA 5EM6A 2ITNA 1O6LA 1W98A 1BLXA 5GJDA 3SV0A 3FI4A 5DT3A 3WYXA 4CT1A 4F7SA 5JN2A 2F2CB 4BRXA 4J8MA 4RIWB 3AGLA 3LLAA 3GU8A 1UVRA 4AOTA 4ASDA 4OTPA 4UYAA 3FUPA 4NW5A 4NW6A 2QONA 4EHGA 3CSVA 2JKQA 3W2RA 4FTQA 2ZAZA 4GCJA 3P08A 2BCJA 4FX3A 4M97A 4FICA 4KBCA 4RIXB 4PF4A 2IVUA 3D94A 4DF3A 2XK7A 3C4WA 2P2HA 4FKIA 5ETAA 2CJMA 5HCXA 4BF2A 5GINE 3VQHA 5AR4A 4USEA 1YDSE 1WBOA 2C6KA 4BCNA 3HV6A 3MPMA 5I9ZA 2PUNA 3HV7A 3DNEA 1UWJA 4HCUA 3O7LB 5AP2A 4ANSA 3CR0A 3OBGA 4DCAA 2BKKA 3MY1A 4GK4A 5LVOA 3QC4A 2UZEA 4CEGA 4CXAA 5LMKC 3P1AA 3T3UA 1UA2A 1E1XA 4GW8A 3JS2A 4C36A 2GNFA 1JKLA 3BWFA 2Z7QA 2GS6A 2WGJA 4HJOA 3PY1A 4BBMA 4MBIA 4DFYA 4O27B 4IVCA 4PP7A 1DI8A 1PXPA 3LFFA 4DTKA 5J9YA 2GTNA 3MPTA 2W5HA 3DNDA 3TCPA 3F82A 4JMQA 4BWKA 2O2UA 4LQMA 2VZ6A 4F64A 4TRLA 4A9YA 3KREA 3C4ZA 4ZLZA 3VBWA 4BI1A 3CJFA 4NYEA 4C8BA 2PMIA 3K5VA 3MBLA 3VVHA 1FVTA 4M12A 3OTVA 2C1AA 1ND4A 4FSYA 4Y83A 5FEEA 5TT7A 5AADA 3SVVA 4D55A 2HZNA 5F4NA 5CF4A 4PWNA 2RFEA 4QNAA 1DI9A 3RGFA 4BKJA 2YAKA 3IW7A 1AD5A 3VQUA 3D5VA 3O8PA 3L8XA 4PTCA 4MBJA 5HU9A 2XNNA 2RFDA 4KKEA 2JKMA 4WNOA 2WMXA 4XV9A 3VUTA 4P7EA 3TMOA 5J1VA 2R3HA 3QYWA 4MXCA 3BGQA 2X2KA 4BDDA 3HVCA 4QMPA 1V0BA 3UQFA 3IGOA 3P4KA 3VF9A 5I9UA 3H0ZA 4ZMEA 5CI7A 2YAAA 4C7TA 3DGKA 1G8JA 2R3QA 3ULZA 4AT3A 4BHNA 2GQGA 3GQLA 4BCHA 2A1AB 1YOMA 5G1XA 3AT2A 3FY0A 4DH8A 5IA2A 1F3MC 4D4SA 5JZNA 3RK9A 4DEGA 4YZMA 3EZRA 4BCFA 3VS5A 3MFSA 2CNQA 4HYUA 4XG3A 2JIIA 5FXRA 2JAVA 3EN7A 4FKOA 2I0YA 2R0IA 4KA3A 3GC8A 1OL2A 4EOKA 5E9EA 1ZOHA 4D2TA 5AP5A 1SVEA 2B52A 5D7AA 5DGZA 1V0PA 4JI9A 3V04A 3KMMA 3AT3A 3ORKA 4FEUA 3E63A 2WMQA 5TE0A 2WOTA 2GNGA 5E8YA 2FUMA 4CV8A 1W2DA 3PZEA 2VWIA 1RDQE 2RFSA 3R73A 4KRCA 4U79A 3TG1A 1Z5MA 2GCDA 2VWZA 3QCSA 2WD1A 2ZVAA 2BPMA 1QPCA 3D2KA 3DZOA 4AT5A 4DG3E 2WIHA 3R8LA 4NIFB 3LFSA 3NEWA 2YIXA 4K9YA 5HD7A 5M08A 2CN5A 2ITUA 3MTLA 4II5A 4EZ3A 4CRLA 4A06A 2GU8A 5BVEA 5AR5A 4MYGA 4O0TA 3TN8A 3C13A 4K18A 5GHVA 2WZJA 4O0RA 3VBXA 4XV3A 5A54A 3RZFA 2JDSA 3U6IA 3SOAA 3N51A 4NKSA 1F5QA 4J71A 1J91A 4F9AA 2J0IA 4DH1A 2W1CA 1O6YA 4ZTQA 3D83A 4HVDA 3D2IA 3FV8A 3QZFA 3B2WA 4F1OA 3W0NA 4O0YA 3W8LA 1Q62A 3R9OA 3LFBA 3CE3A 3PLSA 1Y6AA 3DDPA 5C27A 4ACGA 4O82A 2BAQA 1U5QA 3RNYA 3FL4A 4CLIA 5JH6A 5AV1A 3QTXA 4IX3A 1BX6A 4EH7A 3PFYA 3QUEA 2XM8A 4YP8A 3DBQA 4O7YA 2JDRA 4RC2A 2JKKA 5HO6A 3P79A 4G3DA 2YCRA 1BKXA 3E8DA 4IWDA 1YXVA 2QQ7A 1FGKA 3FJQE 4EK6A 4YR8A 3A61A 5HIBA 4AX8A 1T45A 3EIDA 3M2WA 4UWCA 4BYIA 3GUBA 2W1IA 2CKEA 4YJUA 1FQ1B 2XK8A 2EVAA 4L3LA 4UYNA 3R28A 1XBAA 2W9ZB 3U51A 2RIOA 1OL6A 3R04A 3PYYA 5E8UA 4BWXA 4O38A 4V0GB 4YURA 1Q97A 1Q8UA 3RK7A 2CGVA 4IAYA 3TDVA 1KV1A 2ONLA 3PJ2A 2PMOX 4FODA 4D0XA 4ZP5A 3BCEA 5TOZA 3BELA 3ITZA 1P4OA 2GS2A 2ZDTA 3N9XA 3ZC6A 3VUHA 3ZLXA 4YUQA 4O0WA 1ZMWA 4PNIA 3IW4A 2OBJA 4DG0E 1JLUE 3R7EA 4CYIA 1G5SA 4YJNA 2GQSA 4O7ZA 4WHZA 3TZ7A 2XNOA 5I9YA 4ZY6A 1K3AA 2YACA 4AGUA 4IDTA 4TN6A 4E5BA 3G9LX 4R5SA 2X0GA 4AFEA 4MF1A 5DIAA 4ASXA 5HTIA 1OIQA 2HXLA 4I0TA 5FBNC 3ANRA 3MSSA 4JQ7A 5I5ZA 3NVMB 4EH2A 4RQKA 4IM0A 4QP7A 5EDPA 5E4HA 2XNEA 4KKGA 3UO5A 3G15A 4QP1A 3EH9A 1OUYA 2HWOA 3NIZA 3QQUA 4ASZA 4UN0C 3WF9A 3OY1A 3OROA 5JFXA 1KSWA 3U4UA 3QXPA 4JR7A 3V3VA 4DBXA 1R1WA 3A99A 4KBKA 4I6LA 1NY3A 4G9CA 3FI8A 2QC6A 3FKOA 3VNTA 4YO4A 3O71A 3F3TA 3TT0A 4EK4A 5ETCA 2IZUA 4ZTLA 3BX5A 5E8TA 5FTGA 5D41A 2C5OA 4L3PA 4EOOA 5KKRC 3VS6A 4H1MA 3ZS5A 1NW1A 4OBOA 1XKKA 2JFLA 1MRUA 2PUUA 3OWKA 3COKA 3VUIA 5HG7A 3R7UA 4ANLA 3O5AA 1P5EA 2ZM3A 2ZV7A 3VHKA 2ITVA 4ZOGA 5BV3A 4AZEA 3QWJA 2QOHA 2OWBA 1Q3WA 4CFFA 4HVSA 3D5UA 2QOKA 2QI8A 4JBPA 3DJ5A 3ZDIA 3BYMA 3PJ1A 4BDJA 3GENA 5IQDA 3IOPA 5BUEA 3KL8A 3RNIA 3Q5IA 3PIZA 4GJ2A 4IAFA 4DHIB 4YC6A 3KXXA 4GT4A 3E64A 3ELJA 1IG1A 2Z7LA 4IVDA 5AV3A 3EQIA 3ROCA 3FE3A 4EJNA 3POOA 1ZYDA 4HVIA 4R5YA 4TNDA 2BZJA 2W17A 5AV2A 3EL8A 2B4SB 2BZHB 3RP9A 4BCKA 4EC8A 3OUKA 4D0WA 2ETRA 3QGYA 4DEAA 2QOBA 3I0QA 1J7UA 1YVJA 3EQCA 3Q9WA 4RLKA 4XS2A 3BI6A 3OT3A 4YO6A 2J0LA 3OXIA 1XH9A 4JVGA 3EQFA 2XKEA 4UXQA 1BI8A 3R7VA 5L6WL 2ITPA 4ZJVA 1Q61A 5CZIA 4LFIA 3B8QA 3EQGA 4ITHA 5E8XA 2OZOA 4KSPA 2B9HA 5A4QA 1FVRA 4GG5A 4NM7A 2VAGA 3CBLA 3FWQA 2RF9A 3P5KA 3EL7A 3W8QA 5F9EA 3OWLA 1WVXA 3UDBA 1Y6BA 4A9TA 4F7NA 3DA6A 2VTMA 4UV0A 1IA8A 2W4KA 4K33A 5EFQA 4BI0A 3NYOA 4QTEA 3PIYA 4ZZMA 3FMMA 4CZYB 1H07A 2WO6A 2ACXA 4XG2A 4DEBA 4L67A 3IQ7A 4BJJA 1H0VA 2BHHA 3EFJA 3MH3A 4DH5A 5CX9A 5L2WA 5K0KA 4BYJA 2JDOA 3Q2MA 4FK6A 4PPAA 4TYHA 3SLSA 4RIYB 3GCSA 1IEPA 2OKRA 2UVZA 1H1RA 3W0MA 4BCPA 2BAJA 4U81A 3IPHA 3LCOA 3MS9A 5HCYA 4O91A 3AC4A 3PE2A 2F4JA 3DFAA 4MBLA 2FYSA 1PJKA 5E7RA 2VWXA 4GMYA 1L3RE 3HX4A 3PTGA 2OO8X 2X6EA 3PA4A 2JKOA 2BRNA 4J98A 3UBDA 3ZFYA 4Z55A 5K4IA 1B39A 1STCE 3CPCA 2P0CA 4DGNA 3RAKA 5BMSA 2F7EE 5KNJA 3D4QA 3QHWA 4ZSGA 5EQPA 4YBJA 1OPKA 2OFUA 3TKHA 4PDOA 3QL8A 1E9HA 4L8MA 4YNOA 3MWUA 2BDWA 5DRDA 1H1WA 3U9NA 1U5RA 3I7CA 4S30A 3Q4UA 5A4EA 4KINA 4ZS4A 1E1VA 2YDKA 4OAUC 2YCFA 4JJRA 1YHSA 2O5KA 5CSPA 1RE8A 4LM5A 3EYGA 4LMNA 3V8SA 3VBVA 4EWHA 5E1EA 1SNXA 1PYXA 4C4EA 3Q9XA 4O84A 3I6WA 5IQCA 3LOKA 2XKDA 5FDPA 2R3RA 2UVXA 3ORXA 1ZLTA 4OR5A 2X8EA 3FMDA 3FZ1A 4E6DA 1PMUA 2WPAA 3H0YA 4FKSA 3FMNA 4F9CA 4QMUA 2QOQA 4G6LA 2O63A 3ROYA 2ERKA 4ZEGA 4DDGA 3R02A 3F2AA 3QQJA 4FMQA 3DQXA 4LGHA 5IPJA 2I6LA 5JFSA 2OGVA 3AD6A 3KF7A 3O51A 3CQWA 2XF0A 5KBRA 3JVRA 3GFWA 3PE1A 4ALUA 3F3UA 4RIWA 2G1TA 3QHRA 3VW8A 3VULA 2G15A 3ZM4A 2WEIA 4IZAA 4C34A 3P9JA 3DU8A 4RJ5A 4HVGA 2WOUA 2X0PA 2YABA 4AUAA 3E3BX 4Z9LA 3QWKA 2E9OA 2HOGA 3CQUA 4XG9A 3AKKA 3N4TA 1H01A 5M57A 3D15A 4JS8A 5EM8A 4RMZA 4KS7A 5H8GA 3UMWA 5JT2A 2ONLC 2JEDA 4XG8A 5G6VA 4CKRA 4YPSA 3LLTA 5EHLA 2BZKB 4NK9A 4X6QC 3DCVA 4A9SA 4D2PA 3SG9A 3BYUA 3BBTB 1YOJA 3MY0A 3PXRA 4MNFA 2R3NA 5J79A 4HCTA 4RT7A 2XYUA 1JKTA 4E73A 1AQ1A 4JLCA 2XJ1A 5K5NA 3U54A 2J4ZA 4PL4A 2C30A 4UY9A 3R8UA 1W7HA 3T9TA 3VN9A 3V6RA 4M66A 2GNLA 5DNRA 4E4LA 4BWPA 4LOPA 4JAIA 4C4GA 1WBSA 2NO3A 2XAOA 3O8TA 4ANBA 2B9FA 5CXZA 5CU6A 5GZ8A 2XAMA 1IAJA 4LG4A 5J8IA 2WTKC 4QMOA 1GIHA 5AIKA 3RWQA 3H9FA 4D1ZA 1J3HA 2R2PA 4LMUA 3OF0A 1OBGA 4X21A 3PG3A 3UP2A 5A4LA 1I09A 1YXXA 5EDQA 3WILA 2WQNA 4QMNA 1G8KA 3OW4A 4AZTA 4DFXE 3ML1A 4L3JA 3IO7A 3KULB 5HEZA 3LXNA 5GJGA 2CMWA 4KD1A 4BDEA 4YHFA 2CGXA 4NM5A 4BDIA 4RRVA 3MVLA 3MYGA 2A19B 4L45A 5M4CA 4DA5A 2YITA 1JPAA 4NCTA 4XG6A 5EM5A 2ZYBA 4AT4A 4ITJA 3QA0A 2DQ7X 3VJOA 5CANA 4Y5QA 1Y91A 4FYOA 5AUVA 5HGIA 4E26A 4ZLYA 3R22A 3UVPA 4QP8A 5FEQA 1REJA 4EH6A 3MFUA 3VS0A 1S9IA 2YM5A 1JBPE 2OXXA 4GVAA 3UOLA 3GU7A 4AQKA 2PSQA 3MW1A 4JR3A 4NT4A 4EUTA 2OFVA 1PMVA 4D1SA 1R78A 4ERKA 5E8ZA 3HAMA 3Q53A 2C4GA 1K2PA 4FT0A 4F0FA 2GMXA 3HA8A 3CS9A 4A4OA 3OTUA 4FV1A 5T68A 4I21A 3NW5A 4EZ7A 3LJ0A 4FV8A 4F6WA 1J1CA 5HLWA 3CPBA 1XR1A 4C61A 4L42A 2XIXA 3F3VA 2YM4A 3QLFA 4BCOA 1U54B 4DT8A 1LEZA 3LXPA 3VWAA 1ZMUA 1MQ4A 1R0PA 2GHGA 3BHVA 4PPCA 3ZO1A 4S31A 4C38A 3D14A 4LRMA 4N70A 2AEGA 4RC3A 4RFYA 4XV1A 4GJ3A 3EFLA 5IUGA 4IW0A 2PVFA 5CNOA 5FXQA 3K2LA 3EFKA 3RBWA 5LWNA 4ZLOA 1HOWA 4R78A 1SM2A 5HTCA 3HMNA 4FKPA 1H1QA 3WBLA 3RAIA 1M7NA 4QMXA 4Q5EA 2VNYA 3RJCA 3ZLYA 4C58A 5CQUA 3ZXTA 4C4HA 3OY3A 1NA7A 4EOPA 3R01A 2SRCA 4ID7A 4EK8A 3UODA 2IW6A 3CTHA 5J95A 2YA9A 3SG8A 4JT3A 1Q99A 2A98A 3DLSA 4NIFA 4Q5HA 4DGLC 3TKIA 2V62A 4O21A 4CSVA 3FHIA 2QODA 3NDMA 1G8AA 3ORNA 1YOLA 3WF5A 4AW2A 5AR7A 3JUHA 4YZDA 3DJ7A 2I1MA 1UKHA 3H4JA 3KRRA 4N0SA 4XRLA 3KKVA 4FE2A 4L52A 2W4JA 3UC4A 2ZMCA 1ST0A 3OEFX 4KSQA 1G8SA 4FEVA 2P55A 3EQPA 3NNWA 4G6NA 5CS6A 4O6LA 1FOTA 5HESA 5J1WA 2C6DA 3OCGA 5CT7A 5AAFA 3DK7A 4TWCA 2X8DA 4LYNA 3KCKA 5L8JA 4FTNA 4ZIMA 4QTCA 2XA4A 2C6MA 1X8BA 1WBVA 1GAGA 3GBZA 3QUDA 2R4BA 4GS6A 5FXSA 4QTAA 2ITOA 3OWJA 1UNHA 4N6YA 4FC0A 5AJQA 4E6AA 4GH2A 4L00A 4FV7A 4ENYA 3DAKA 4G3CA 2XK3A 5JZJA 4RWLA 5KMIA 4BY9E 1OKYA 4ZTSA 4H05A 5HX8A 2WQEA 4B8LA 2VWVA 3OOMA 4RJ4A 2OICA 2R3KA 2WMTA 3C0HA 3FZTA 4LRKA 4R6VA 2XIYA 4FSRA 1OVEA 1KE8A 2B9JA 2OSCA 2Q0BA 3OXTA 4FTCA 2PVHA 5EI2A 2IVSA 2VX3A 3KRWA 3QC9A 5BVFA 2ZB0A 5CEOA 3GCUA 3CP9A 4XNEA 4YHTA 1IRKA 3R7YA 3SC1A 3TUBA 5HO7A 5C4LA 2OJGA 1W83A 2C5NA 4BB4A 4JG8A 4RG0A 3JPVA 3OMVA 2PMNX 5KMJA 2JLDA 3V5LA 3NCGA 5C8NA 4HYHA 1ZYCA 4V0GA 1G3NA 5EYKA 4DFZE 2R3JA 5IA4A 4P90A 1W0XC 5AM6A 5EOBA 3VC4A 2ITZA 3WYYA 4U6RA 4RBLA 5BMMA 4A9RA 4PNKA 3O17A 2PE0A 1UU9A 2EB2A 3UP7A 3LIJA 4H1JA 5CEKA 4EK5A 4GVJA 1XMMA 3W16A 5KMNA 4O1PA 2W1GA 5HO8A 3AXWA 3W0OA 2G2FA 2OXDA 4XP2A 2X1NA 3PWYA 4JDHA 1O9UA 2BRBA 2IN6A 2RG6A 2E2BA 3OG7A 4FTKA 3HDNA 4ZSEA 3COMA 4ANOA 5JQ5A 2PVRA 3PRIA 2X0QA 5IUHA 2C3KA 4YZ9A 2AC3A 2XRWA 4O2PA 3SKCA 4OTQA 5HQ0A 3QQKA 3TM0A 3U55A 2WMBA 3ORIA 3W0RA 3LCKA 4WBOA 5TO8A 4FR4A 4EBWA 4JQEA 5JGBA 3ATSA 4ITIA 2B53A 1SZMA 2HAKA 4YTCA 5BVKA 3I7BA 3VS2A 4BDBA 4UMQA 4K8AA 3HAVA 4B99A 4JRVA 2R7IA 4YGAA 2G2HA 3OBJA 4IFCA 4JNWA 3KRJA 4N6ZA 4I5PA 3BL9A 5B2KA 2YZAA 4RX7A 2R5TA 1H28A 4BDKA 4HGSA 5HVKA 3ORLA 4CZTA 1URCA 1OKVA 5KE0A 3FDNA 2VTIA 4RJ3A 2ZFYA 2HZIA 2VTHA 2ZV2A 3OS3A 4IAZA 5E8VA 4V04A 5K5XA 2J0MB 2QOCA 4GT3A 4OTIA 5K9IA 3FZOA 4DTAA 1RW8A 2JIUA 3BEAA 3U87A 3N4VA 3NVKI 4S2ZA 2P33A 2QHMA 3QD3A 2FSLX 3RHXA 3QKMA 3MA3A 3FMHA 3FKNA 2R3PA 3UO6A 4Y72A 3U6HA 4E93A 2CCIA 4MNEB 3BLHA 4QMQA 3LVPA 5IU2A 4YSJA 2C6LA 2C47A 2J0KA 4EYJA 4BBFA 4QMSA 2E9PA 4FKTA 5H2UA 3QZIA 4BTMA 4EOQA 2W06A 4MAOA 4NCTC 2XANA 4J97A 5IISA 4XHKB 4BDAA 3GCPA 3CD3A 2UW9A 1XH8A 2VX0A 4PY1A 3DFCB 4YTIA 5CXHA 3WF7A 4YZCA 2WMAA 5LVNA 3MIYA 3LM0A 2ITTA 4OW8A 1YHVA 3ZHPC 4FG9A 4L43A 5HLPA 5J9LA 1APME 4NH1A 4IB5A 3OWPA 1GNGA 3ET7A 2YFXA 5FQDC 3P78A 4MH7A 4RLLA 1W84A 1CTPE 2AYPA 4C3FA 4H3BA 4L01A 5JRQA 3AD4A 2YERA 4F6UA 3RM7A 4AN2A 2HELA 4AW1A 3UDSA 2QOLA 4YC8A 2JD5A 5FM2A 5A4TA 4FTAA 1JAMA 3AC2A 2BIYA 4ERWA 2OU7A 2FH9A 2W7XA 1VR2A 3Q4TA 4TYIA 4XP3A 1KUTA 3Q96A 4QDEA 4ZS0A 4DN5A 4J53A 1K9AA 5L2TA 4FUYA 1XMLA 3BV3A 5ETFA 5GIPE 2AUHA 3IDBA 5AEPA 3SAYA 1HCKA 4J96A 3UIBA 2Z2WA 3HZTA 4MK0A 1XHAA 4FKUA 4GK3A 5TR6A 3PY0A 4G6OA 3WARA 5IH5A 1OBDA 1JWHA 4I6BA 4XOZA 3NX8A 4AOJA 2DYLA 3FLSA 3OCSA 3O8UA 4RIYA 4X3FB 3JYAA 5CSHA 4OAVB 3W1FA 2C1BA 3QF9A 2ITWA 3L8SA 4XLVA 4KBAA 4D2VA 1WFCA 3NUXA 4HGLA 4M0YA 5CU3A 5EKOA 4GUBA 4TTHB 1R0EA 3DOGA 3MH1A 4QPAA 2YEXA 3F9NA 4EOMA 3DZQA 4QP6A 4PTEA 1VJYA 5I3RA 2OJJA 3KU2A 4BI2A 3DT1A 3HKOA 1H27A 2XB7A 3COIA 4FGBA 4EOJA 3F3ZA 2BMCA 4EHEA 2J90A 2BAKA 4G9RA 2BTRA 3WF6A 2VNWA 3WE8A 3DXQA 4N57A 4M13A 3C0IA 4A9UA 1H24A 1ZYJA 2PVLA 2ZB1A 4B9DA 4EUUA 2JGZA 4BZNA 2VO0A 5HOAA 3AD5A 3C4FA 3KRXA 2Y6MA 4FSMA 5CEQA 4QYEA 2OF2A 2PK9A 4E6QA 5CF8A 2VTPA 1Y57A 3ZZEA 1LPUA 5AV4A 3R1NA 3S4QA 3KEXA 3U6JA 4QEBA 5K4JA 2YLEA 1ZYSA 2XALA 3TTJA 4OLIA 3SXFA 3TI1A 4IAKA 5CSWA 4DAWA 5CEIA 4C4JA 3AMBA 3IG7A 2IVVA 4APCA 1WVWA 3EYHA 4H3PA 3FQHA 3LCDA 4CG8A 3OCTA 1OPLA 4FUXA 2OH0E 3LZBA 4HYIA 2YWVA 3G9NA 4RJ8A 5T3QA 5I9VA 2WAJA 3FI2A 3KRLA 3DBDA 1OITA 4E6CA 5AR8A 4O83A 3QRUA 4QMTA 2FSTX 3HYHA 3QRKA 3Q2JA 2WNTA 2QKWB 3OZ6A 4H58A 3AT4A 1ERKA 4XOYA 2XK9A 5DT4A 3LHJA 1KWPA 4AFJA 3R8VA 2W05A 5CAUA 1ZARA 3VIDA 4QMMA 4LUDA 4EEVA 1H25A 4GG7A 5IA5A 1W2FA 5ANEA 3BLQA 4AZVA 1DS5A 3O7LD 1ATPE 4PDSA 4F0IA 5JFWA 3NNVA 3DBCA 2PWLA 4IWOA 1UNLA 4JIKA 3QRJA 4W8EA 4QT1A 3KK8A 1PXJA 3HMPA 1YDRE 3QQHA 3R7GA 4DDIA 5IG1A 2IPXA 3BYOA 4M69B 2UW3A 3IW8A 4FG8A 4FVRA 4MEDA 5AV0A 3KIOC 3SD0A 2YWPA 3C50A 4EL9A 4L7FA 3NUAA 3ZH8A 3R9DA 4BTKA 5LQFA 5L6PA 5HU3A 2J7TA 2W1FA 4RVTA 4MQ1A 2Z02A 3AMYA 3PUPA 4M7IA 3FLWA 3H3CA 3FZSA 1YKRA 2VTLA 2WQBA 3DKFA 4Y8DA 2BKZA 5IA0A 3VBTA 4ZSLA 2XIRA 3GU5A 3UJGA 2XK6A 5IZFA 4YMJA 3NFFB 3NZ0A 4F63A 3L8PA 4D5HA 5J7BA 2JFMA 1J7LA 3IKAA 1Y8YA 3HECA 4HNIA 4KNBA 2A4LA 2Q0NA 5EW8A 1GOLA 3QQLA 5I9XA 5C01A 2OJFE 4DG2E 4TWPA 2VD5A 4LUEA 4CT2A 3VS1A 2VTSA 4RA5A 4JBOA 3Q04A 1YXUA 1KOBA 4O4FA 3LFQA 2XEZA 4AXDA 4QYYA 3O0GA 2C68A 3KN6A 4FSWA 4ONAA 3P7AA 3KULA 4A7CA 2V7OA 4DH7A 2IG7A 3ENHA 4IM3A 4EJ7A 4IEBA 4O0XA 1M2QA 2XKCA 2FO0A 3VUGA 4FKJA 5EQEA 1YHWA 2C3LA 4OTWA 1H08A 4U42A 2YM8A 3BHTA 3R6XA 1NXKA 4W4VA 4YJRA 3TUDA 4WD5A 5ITAA 3TWJA 4F08A 4G5PA 3P5JC 4KUJA 5T6KA 5EKNA 1H1SA 1YXSA 1Z57A 2Y4IC 2EWAA 3PVWA 3IW5A 3R21A 3RAWA 4FKLA 2QO7A 3V6SA 3QZGA 4MXXA 2W4OA 2YN8A 2PZYA 4UMRA 2XYNA 1FPUA 3RVGA 2VO6A 1B6CB 1JKKA 2PE1A 3UYSA 3ID6C 3II5A 2PHKA 2YJRA 3QRIA 1ZXEA 2HXQA 4IM2A 1XH4A 4Y95A 3WZUA 3OP5A 4Z3VA 3ZEWA 2WHBA 5HD4A 1DM2A 3R7IA 3ZOSA 1U54A 3UQCA 2X7GA 2JAMA 4FIHA 5EG3A 2YM7A 2XNPA 5BVWA 2WU6A 3LE6A 1KE6A 4I0RA 1OB3A 3NUPA 4MVFA 3UG1A 3GP0A 3PJ8A 4QP4A 4DBNA 1FGIA 1SVGA 2WTIA 2Y0AA 4LL5A 4YJSA 3RKBA 4MX9A 5A14A 3CCNA 3OEZA 3EN4A 3R83A 2C3JA 2A27A 3AC8A 4FTLA 4M68A 4WNPA 1PMNA 5FWKK 5BQ0A 1GZNA 4FEXA 2REIA 1VYWA 3PXKA 3VS7A 2IJMA 3FZRA 4I93A 3PP0A 3LMHA 2PVNA 3CGOA 2JDVA 3GEQA 3AG9A 4W4YA 4Q2AA 4YHJA 4HYSA 4FZ7A 5AP7A 2IWIA 3HV3A 3NAYA 4L9IA 4O0VA 4A4LA 3V5TA 2ZDUA 4DEIA 2XIKA 3DBEA 3O23A 3EMGA 1R3CA 3TNPC 4AF3A 3C5UA 3FLQA 3FC2A 4EH5A 5IQBA 4BC6A 4D2RA 2GS7A 5IQHA 3BPRA 3MPAA 3PXQA 3MB7A 4BZOA 2IZSA 2WTDA 5AUTA 4APPA 3LCTA 4FTTA 4I5CA 4IFGA 4J99A 4YJVA 3LQ8A 1AGWA 3MIAA 3R1YA 1QPJA 3SHEA 3R1QA 4TZRA 3T8OA 3ZO3A 3L8VA 4ZAUA 4MF0A 4YTHA 5A3XA 3ORPA 3WZEA 5K3YA 3T3VA 5K0XA 3PDTA 2BR1A 3H30A 4IAAA 5AIRA 3RK5A 4U9AA 4C3PA 4BICA 1PKDA 4U97A 3ZZWA 4WRGA 2Q83A 2C0IA 5CYIA 3NCZA 3B8RA 2R9SA 2C6IA 2ITYA 4EOIA 1ST4A 1P4FA 3FBVA 3UNJA 2UZVA 5ANJA 3DKGA 3VHEA 4G2FA 4RGJA 3MVHA 4XMOA 5IDPA 5C9CA 4EHZA 1L8TA 3A7GA 4XX9A 3G6GA 1WVYA 3ZCLA 4DGGA 4KRDA 4LV8A 2UZOA 4Q9SA 4CFNA 2H34A 4GYIA 3LFNA 4XEYA 5KZIA 3R2BA 1NVQA 1U4DA 2X7OA 1PF8A 4J7BA 4NU1A 4AZSA 5M4FA 3FSKA