4YTCA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune disease
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
289
structure length
284
Chain Sequence
b'TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSARRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 284
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytcA01
5IA0A 4QTEA 3FE3A 2NNWB 3ZEWA 3CKXA 5HE3A 4EWHA 5DRDA 2UVZA 4K8AA 4FIIA 4BC6A 4QPAA 4ZEGA 4DEGA 4W8EA 2ITOA 3R1YA 4XH6A 4GK4A 4AW2A 5HVKA 1W7HA 3LLTA 5D41A 4AFEA 2JGZA 4NCTC 4P90A 4ZJJA 4BZDA 3GOKA 5BVWA 1PW2A 1GNGA 4QMTA 4L42A 4QP8A 1WVWA 2JBOA 3QYWA 3C4XA 3MPTA 5CTPA 5AUYA 3LM0A 3SXFA 4IXPA 3OOMA 4C8BA 1K3AA 5BMSA 4D4YA 4AA0A 2OIBA 2BHHA 2FYSA 3GC9A 1A9UA 4U5JA 4YGAA 5EYKA 4AS0A 2RG6A 4BVUA 3KULB 2BTRA 4S30A 3HRCA 1SMHA 3I7BA 4IWPA 2YM6A 4XBRA 3RTPA 4E73A 2E9OA 4KIPA 4IB1A 3ZSHA 4DN5A 5AADA 5L2WA 5E8UA 4BCOA 4EYJA 3QKKA 4RJ4A 4H3PA 4D9TA 3W2RA 3G6HA 4YURA 2BZHB 4FTUA 2FSMX 2JDRA 4I5CA 3RVGA 2YZAA 1J91A 1YDSE 4I6FA 5DMZA 3VBVA 1M2PA 4FSUA 3P7CA 3S4QA 4CXAA 3NVKI 1GZOA 4H58A 4O6LA 3WE4A 3EH9A 2CGWA 3LXLA 3RM6A 5M06A 4M0YA 2XEZA 5EI8A 1UU7A 5AP1A 3ZLSA 4TXCA 3HGKA 2I6LA 2WELA 1Q3WA 4LI5A 4EJ7A 2DQ7X 2BR1A 3PVWA 3R2YA 2QO9A 4YBKA 5HE0A 3VN9A 2Z2WA 3OBGA 3UE4A 3O96A 4NIFB 2G2HA 5C27A 4MWHA 1YI6A 5CT0A 4ZJVA 4UX9A 1PXMA 1OVEA 3HDMA 3LQ8A 1I44A 4YJQA 5CF8A 5HIEA 4FIEA 4EK5A 3QKMA 5CNOA 5CWZA 4F9YA 3CGFA 4RQKA 4JIKA 3CJGA 5DOSA 4ZSAA 1L8TA 5JZJA 4IM2A 1OITA 4UB7A 4HVDA 3G2FA 2W1HA 2XM8A 1XKKA 2OJFE 3FYKX 2R0IA 4IJ9A 5FXQA 5TKDA 5J1WA 4DTKA 3EFKA 4YLKA 3UZRA 3R9RA 4FTCA 3A60A 5HQ0A 5HEZA 1FGKA 3G9LX 1Z5MA 3ZM9A 2XRUA 3LJ1A 4FIHA 5I3OA 5CAPA 2P55A 2VTNA 5CX9A 5C8NA 4U3ZA 5M4FA 4K11A 3C0IA 1NXKA 3C7QA 4U81A 4ZSLA 4QMSA 4R77A 5FUTA 4EK6A 4G3EA 5ANGA 4RA4A 3PVBA 3UG2A 1XH4A 3HDNA 4QTAA 3H0YA 4B6LA 3LAUA 5A4CA 3DBFA 2VWUA 1V0PA 2WQMA 3C13A 4I6BA 4KWPA 4FUYA 2BPMA 2W1CA 3FY2A 2YJRA 4O0UA 3VUKA 3NVMB 4FV0A 4AZSA 3F5PA 4FOCA 4CT1A 3DQXA 4A9YA 4DINA 4AW0A 3F7WA 2I1MA 3EQCA 3V5WA 4CSVA 4EHVA 2XIYA 4N4SA 3UOLA 3Q9ZA 4XG7A 4E4XA 5KMLA 2ZB0A 5AM6A 2BHEA 4USFA 3F88A 4E4LA 4ZTMA 4H3BA 5HI2A 1R0EA 5EI2A 4IB5A 5KKRC 3VW6A 5HGIA 1KE6A 4UWCA 4FV8A 5IEYA 1XBBA 4GG7A 4JDKA 5CY3A 5HU3A 2IPXA 3ATSA 5EM5A 3CTQA 3NW6A 4OW8A 4DGMA 4JLCA 5JFVA 2G15A 4MVFA 3BGQA 2C3KA 3NUNA 4UZHA 1VZOA 2Y7JA 5E7RA 5FDXA 4MXXA 4FC0A 4FZDB 5HCYA 4D28A 4E26A 1DS5A 5AR2A 4I92A 4M66A 4LG4A 2RSVA 3ZDIA 1PMEA 1YOLA 2PMNX 4FV5A 4EL9A 3UP2A 1Q8ZA 3MY1A 2B54A 2GSFA 3LHJA 2J5EA 5C8MA 2NRUA 4FVRA 1T46A 4D2RA 4N57A 4R8QA 4NIFA 2GTNA 4ZOGA 3WF9A 3JVSA 4K18A 3S95A 2OZOA 3PJ1A 3POOA 4FKWA 4I24A 3E88A 2W99B 3LFNA 4FT0A 4MXCA 3R8ZA 4F6UA 5CAUA 1YHWA 4CV8A 2PMIA 3A7IA 3LCSA 3LXNA 3QALE 3EN6A 4TKSA 2HXLA 5IQFA 3UIXA 2W7XA 5A3XA 3JUHA 3VS1A 4C0TA 3P5KA 5DT4A 4MF0A 4DF3A 3VHKA 3QX4A 2I0EA 1UU8A 5FP5A 1PKDA 2I0VA 5CI6A 4FNYA 3FLNC 3OFMA 5FTQA 4D9UA 4HYUA 4E93A 3F5XA 3CTHA 1SNUA 1XH7A 3KRWA 4TYJA 4FKIA 3SOAA 1H24A 2YLFA 5I5ZA 2CN8A 2EWAA 2GNLA 3VIDA 5J5SA 3FPMA 1BUHA 2EB3A 3IDCA 3QRUA 4M0ZA 4YLLA 3JVRA 4LRKA 4TWNA 3K3IA 4CTCA 4U6RA 3TN8A 2PVNA 4BN1A 1U46A 4RX9A 5LOHA 5HX6A 3GC0A 3CD3A 3DKGA 4YHTA 4F4PA 1KE5A 3F3TA 3MY0A 4JVGA 5HOAA 4C37A 1LR4A 2BROA 4A06A 2FVDA 4HOKA 2WB8A 3OUKA 2XNNA 2EU9A 3UNZA 3IS5A 1URWA 3IOPA 4QMQA 3G9NA 3GCSA 3LOKA 5IDPA 5DG5A 5GZ8A 4U44A 3ZMMA 3VNTA 4MBJA 4QPSA 3V6RA 3DB8A 2I0HA 4ZSJA 1ZOEA 2X7GA 5M44A 4BDJA 2J0MB 4OBOA 5KMNA 2R3RA 4J1RA 3ZFYA 5HZNA 3P86A 5CSWA 4PWNA 4FV1A 1H1PA 2RGPA 3EN9A 1ZMVA 3L1SA 4LOPA 2DYLA 3GU7A 4UY9A 4F7SA 3F3UA 1Y8GA 3GUBA 3R8VA 3IONA 4QQTA 3R8LA 1Q5KA 4C4GA 2B9IA 3RZBA 5L8KA 1EH4A 2WTVA 3BZ3A 3VS3A 4AOTA 3NAXA 4EORA 4TWPA 4DH7A 5J5TA 2C3IB 2C5YA 5F20A 1DI8A 5IKWA 1WZYA 2JFLA 4L43A 5TE0A 3C5IA 3A4OX 2W96B 5DN3A 4JL9A 4OTGA 5ACBC 4HVIA 2O0UA 3RGFA 4BYIA 4D4VA 4BI1A 4JOAA 3RPOA 1QMZA 5CEKA 1R78A 5CAOA 1JSVA 5HCZA 4H1MA 2FSOX 3NX8A 2G9XA 2C6IA 3OWLA 4IX5A 4F9CA 4HCVA 3L9MA 4L00A 5KMJA 3KVXA 4GG5A 5CEIA 2CDZA 3ENHA 3E7OA 4J96A 4WO5A 4WNOA 3VS5A 3V5LA 5JK3A 1UKHA 3QTRA 4FKLA 4IZYA 3G15A 2BDWA 3I5NA 4F6WA 5AX3A 4GYIA 3ULIA 4IANA 4QQ5A 3V8TA 2Z7LA 4ZY4A 3O51A 1W98A 4I20A 4AE6A 3FI2A 2BILB 3VUDA 4J52A 4MBLA 2WQBA 4BCFA 4E6CA 3MVHA 5C26A 5CASA 3HLLA 3BYMA 4L52A 2BFXA 4KKHA 4LGDA 5DIAA 2WMAA 4YJTA 3DB6A 5B2MA 1RE8A 3QU0A 4Q5EA 4GJ3A 1XH5A 4WD5A 4FTQA 2GHLA 2HY81 2XKDA 3PFQA 2YISA 4MQ1A 3R9NA 4CFWA 3FUPA 1Q8YA 4EOKA 4UYNA 4QRCA 3QTWA 3V8SA 3IK3A 4XRJA 5BVFA 4JRVA 3U55A 2RF9A 3DAJA 4V04A 4YZDA 3WIKA 4CMUA 2BFYA 1ZYSA 2WAJA 1JNKA 3Q4ZA 5AP3A 3BLRA 4K9YA 3HMMA 2QOKA 1Q3DA 2XH5A 3AG9A 4FVQA 5DRBA 2CKOA 2FSTX 4FOBA 3ACJA 5EHOA 4S34A 2JITA 5CNNA 3VRZA 4D0XA 4F08A 3UPXA 3WYYA 3TNIA 4A9TA 4AXAA 2R7IA 2PVMA 2GQSA 2F2UA 2ZM3A 1BYGA 4L7FA 5EOBA 5HTCA 5I4NA 3POZA 2ZV7A 4LFIA 3QQUA 1YDTE 3PE1A 4EOJA 5AEPA 5AFVA 4IADA 4Y85A 5I3RA 3SW7A 1OL7A 3DLZA 4QYYA 3GFEA 2GQRA 2GHMA 3MFTA 3O0GA 4QP7A 4CV9A 3ZUUA 2XS0A 2IVUA 2UZUE 4EOSA 1CSNA 2QQ7A 5IQIA 3D2KA 3L8XA 1IASA 3A8WA 4OTQA 5E8YA 4ANSA 5BUEA 3QQGA 2GTMA 5AAEA 4K6ZA 4I5MA 4NK9A 3Q04A 4YTHA 5BUIA 4O2ZA 5LWNA 4CQGA 4O7LA 3TI1A 3TV7A 1MRYA 3IECA 4EQUA 4EZ7A 4YZ9A 4BTMA 1XH8A 3U51A 1YI4A 4L67A 3QA8A 2F9GA 2JKKA 2YAAA 3S1HA 4IC8A 3KU2A 3R7IA 4QTDA 3CS9A 2BRHA 4PRJA 3EYHA 2GMXA 3S2PA 1TKIA 3FDNA 1H0WA 4RZVA 4UEUA 5DGZA 4RPVA 4EH9A 3L8VA 4BDGA 4W8DA 4TY1A 4XNEA 2XJ0A 3BQRA 4GEOA 1NT2A 5IQAA 1OPLA 2BKZA 4AGDA 4EOPA 2J5FA 2HY0A 4FT9A 1PXLA 4D55A 4P5QA 4YJPA 3EQPA 1GZ8A 4TYHB 3R8MA 3FMHA 3G0FA 4AUAA 3CP9A 4PMPA 2VWBA 5E9EA 3BLQA 3VUGA 4C3RA 5K4JA 3EJ1A 4BCMA 4O7NA 2XZSA 2B9FA 2CGXA 5E92A 4CZTA 2PZ5A 4PPAA 5HCXA 2Y9QA 1LP4A 3HZTA 4FKUA 5A14A 5LMKA 4I0SA 5EK7A 3AT4A 5ANIA 4IM3A 4RC4A 3G33A 3GEQA 3RPRA 3FSFA 3GQLA 2BDFA 1ZYLA 2AUHA 4D58A 4EBWA 2VO7A 3FXWA 4WNKA 3ZRMA 2J90A 2VTIA 3QCQA 4BCIA 3H4JA 4RIYB 2B1PA 4DFXE 4IBMA 5EKOA 4BCNA 4FG7A 3CKWA 2C3LA 3DTCA 1YXVA 5AAFA 3VVHA 4FT3A 2VD5A 4BCHA 3DFCB 5CYIA 1GIHA 4GRBA 3KQ7A 5EKNA 4GT5A 3ZTXA 2BDJA 1Q61A 2FUMA 3UMWA 2VX0A 4RZWA 1IRKA 3C9WA 3FMDA 5IZFA 3I7CA 4MXZA 4JRNA 3LFBA 4FEWA 5F4NA 2JAMA 3R71A 3COHA 3MH1A 1T45A 4Q2AA 4B0GA 4U3YA 4ACHA 3WBLA 5LVOA 2CKPA 3C51A 4O7TA 4ZTHA 3LFDA 4ZY5A 5KZ0A 3C4FA 2PYWA 3QD0A 4XP0A 2WTDA 2KTYA 4K2RA 4LQMA 3FY0A 3MH3A 1KSWA 2R5TA 3ZXZA 1RJBA 5KHXA 1KOBA 1YXXA 3E8NA 4YC3A 3UPZA 4RJ8A 5HBHA 4MTAA 5F1ZA 3MVJA 4BL1A 3DXNA 1YRPA 4NCTA 1CDKA 4JDHA 4MK0A 5HD7A 1PRYA 4U42A 5LMAA 5L6PA 1SVEA 3Q9WA 3C1XA 4BTFA 5AUTA 4GVAA 4DG2E 1J7LA 3QD2B 1ZYJA 2WMXA 1H1RA 2WTKB 4PUZA 4V05A 3E63A 3QTZA 1JVPP 2RL5A 3UOKA 2O5KA 2XKFA 2ZAZA 4G31A 5LQFA 5EDQA 3PZHA 2ITZA 2UW8A 3QD4A 4JDIA 2CSNA 1H1SA 4IZ7A 3OXZA 3CC6A 2PZRA 3KN5A 2F4JA 4BDDA 2QG7A 1PKGA 1Q97A 2BKKA 4DG0E 5EDPA 1M14A 5JQ5A 4AU8A 3FMMA 4QTBA 5C8KA 5K5XA 2YIQA 4PMMA 2BZJA 3GI3A 4NWMA 1QPCA 4UMUA 4EK3A 4ZS4A 3CCNA 3PVGA 4CLJA 1FINA 3RWPA 2DUVA 2NPQA 3F3ZA 4I4FA 4QTCA 4UMQA 5DPVA 3HRFA 2UVYA 3MTFA 3JXWA 4MEDA 2C6LA 2CNUA 3VBXA 4JBPA 1LUFA 4ZZMA 1YKRA 4CFUA 1CMKE 4RX7A 3OHTA 3UZPA 4X2FA 2W4OA 1FOTA 3VUHA 3DDQA 4FKJA 5AUXA 4RIYA 1PYXA 4U80A 3HEGA 4CQEA 1YXUA 2J51A 2WMUA 1UWHA 5B2KA 4IAZA 2WIPA 2XIKA 2WO6A 3EQFA 4MBIA 4JI9A 1PF8A 3PWYA 4FT5A 4CFVA 4AA5A 5JRQA 1U54B 5AV0A 3UC3A 2OW3A 3KXZA 3FL4A 3LXPA 4ZZNA 3UOJA 1BI7A 2PVRA 4BF2A 4RBLA 2X8DA 3WZDA 1YVJA 4HPTE 4BBEA 3CD8A 4RRVA 2IZUA 5EM6A 3VF9A 4DHFA 4FKPA 4KIKB 4LRJA 5AV3A 2YA9A 2VTMA 4FNZA 2JFMA 4ITHA 4J8NA 5CEQA 1OIUA 3NPCA 1H08A 4RT7A 4EZ5A 2QLUA 2VAGA 3O8PA 2C30A 4AN3A 4QMOA 2REIA 3KMUA 2P0CA 3PJ3A 4PNIA 4FL1A 4I5HA 5CAVA 5E8XA 2HWOA 4OTDA 5I9UA 2BMCA 3VS0A 1IAJA 2YN8A 3TZ8A 4BI2A 3R6XA 3ET7A 4H3QA 2IW9A 3ZFMA 4NYEA 2C5VA 3DY7A 4ASDA 3ZLYA 3OTUA 1H27A 2C6TA 1J7IA 4CGAA 2C6EA 4YJOA 5L8JA 1CKIA 1F0QA 3ZHPC 2FO0A 3Q4CA 4ZXTA 1M2QA 4JJRA 4EQMA 4EYMA 2PTKA 1H26A 3SRVB 4TL0A 2GNHA 3DDPA 5M09A 2HXQA 4IFGA 5I0BA 3NW7A 4OUCA 4RJ6A 4HNFA 2GS6A 4OTHA 3VUIA 2XKEA 4QOXA 2JDVA 5FDPA 4HJOA 1URCA 3MIYA 2XBAA 2W1IA 2WHBA 2XK4A 2XYUA 3PXZA 3MSSA 4LL5A 5E1EA 5HE1A 3DJ7A 4MNEB 1ZLTA 3TUBA 2BRGA 3RPVA 4D1SA 4IWQA 4GU6A 3UIMA 2B52A 4JXFA 5L6WL 5CU4A 2BRBA 3SXSA 3QCSA 4X7QA 4ZIMA 4RVTA 2IVVA 4IX4A 2QOCA 3ATTA 5IUGA 3RBWA 4GFMA 5HVYA 1RW8A 4H05A 3W2QA 5E8ZA 2JDSA 1UA2A 2CKEA 1YWVA 4UXQA 1NVSA 2JKOA 4QP2A 2H96A 3EQIA 3A7HA 4L3JA 4X0MA 3QKLA 1R1WA 3DJ6A 3MTLA 3I6UA 2OKRA 3DK6A 4WUAA 3MH0A 3W2OA 5KE0A 4FBXA 1U54A 5BVKA 4GFOA 4FL3A 5IQHA 1PXIA 4FSZA 3K54A 3PG1A 4EWQA 2R3FA 3OXIA 3HX4A 4KKEA 3KN6A 4N0SA 5AP2A 2CNQA 3BKBA 3EKNA 4O0SA 4LV5A 1ZOGA 4AZTA 1G5SA 5A4EA 4GS6A 1OBGA 2C6OA 2WIHA 3G0EA 2HWPA 3PXYA 4P4CA 2OIDA 3CLYA 4IAIA 2PSQA 4PP9A 5EH0A 2GDOA 4BCKA 3KKVA 5IU2A 1WBSA 2E9UA 4HCUA 4K1BA 3PY1A 3N4TA 4AZVA 3Q96A 4F0GA 4CEGA 3CR0A 3UBDA 5AP6A 4LMUA 3UOHA 5AA8A 3KC3A 2F49A 3OEFX 3S00A 2VWWA 4WT6A 4CCBA 3DAKA 1UVRA 3BEGA 3HV4A 4FA2A 3TCPA 3PA3A 2PUIA 2GU8A 2XIXA 4Z7GA 4JG8A 3NAYA 2CHLA 3LFFA 4G3GA 4IIRA 1ZWSA 5C4LA 3RAWA 4JAJA 3B8RA 3BU5A 5BMMA 2C4GA 5G1XA 4BDBA 2WEVA 5AR3A 2PE0A 2VGOA 3OZ6A 2V5QA 4M84A 5A4QA 2VWZA 2BUJA 2UVXA 2WEIA 3HL7A 3LZBA 4JQ8A 3TKUA 5L8LA 4G5PA 2VTAA 4AT3A 4C58A 5E1SA 3ZRKA 4F7LA 5M08A 3PIZA 1WBWA 4N6YA 3UYTA 2FA2A 5H2UA 3D5UA 2QKWB 3D7TB 4E1ZA 3VAPA 4TNBA 3QFVA 4XG8A 4E6AA 3QCXA 3QGWA 2R3HA 5IH4A 4AF3A 4O83A 3HKOA 3QX2A 4L8MA 2W4KA 1FMKA 2PVKA 4I41A 1XWSA 2PL0A 2YACA 1YXTA 4J7BA 4G6LA 2WU7A 3V5TA 4AGCA 4C3PA 4E3CA 3NNUA 4KIOA 1AGWA 3D15A 4C38A 4DEIA 3AD5A 4JG7A 3QC4A 4IW0A 4FTAA 4MX9A 4O0VA 4YO4A 5J1VA 3F2RA 4DT9A 3ORMA 5M57A 5EHLA 3N51A 3U8WA 4S2ZA 3HUBA 3A61A 4JQ7A 2OJ9A 3HYHA 3Q9YA 4XEYA 3UO4A 4C36A 4A9RA 2P2HA 5JEBA 4PDSA 4D1ZA 1R0PA 2FB8A 4FTOA 2W5AA 5D9HA 3HMPA 3P79A 3TZMA 4F0FA 4Q9ZA 4FX3A 4GT4A 3BHHA 4QMVA 3ORIA 4XV9A 3KXGA 4BICA 1CTPE 3CIKA 4QMWA 1OIRA 3FHIA 1MP8A 3SG9A 4FK3A 5D10A 2FH9A 3LMGA 4X2KA 4YMJA 2CLQA 3NUUA 5HHWA 2WU6A 2JIIA 3JPVA 3GFWA 2OFVA 4O0WA 1OMWA 4IWDA 4RX5A 3LIJA 3O7LD 4G3FA 5DT3A 4IVDA 3QA0A 3BEAA 4PV0A 1ZRZA 4EBVA 4YUQA 5D12A 4EOMA 2R3IA 2JD5A 2WQNA 2XJ2A 3HMOA 3O8UA 4ID7A 3BPRA 3FMKA 4RFMA 3HAMA 1WFCA 2B53A 4FKGA 2IZSA 2V7AA 4M12A 3Q52A 4HGLA 3W8QA 3DA6A 3ZXTA 4O7WA 4I1ZA 3WF8A 4AW5A 1XO2B 4FV6A 5GJFA 5FXSA 2W1EA 2YDIA 3A8XA 3MWUA 3OP5A 1OL6A 3COKA 4QMYA 3VBQA 4OTPA 3IPHA 4M8TA 3WOWA 4BKZA 4B8LA 5CLPA 2A2AA 3IKAA 1ZYCA 3JYAA 5HBJA 5FD2A 2VWXA 3FI8A 3DCVA 2PWLA 5LMBA 5ANJA 4RIXB 3UG1A 3KXHA 4Z16A 1BKXA 2F7ZE 4HYHA 5HG7A 2PUPA 4FG9A 4RG0A 4QMXA 1W82A 4C59A 2PE2A 2GS7A 3D7TA 1FVVA 4TYHA 3BHVA 3W8LA 5CF5A 2ITXA 4M69A 4RIOA 3FLYA 3D83A 4ASXA 1V0OA 3GC7A 4UN0C 5L2SA 2FSLX 3NYXA 4RIWB 3RPYA 4PPCA 5EM8A 2ERZE 3OWKA 1FPUA 2E9NA 5TO8A 1FVTA 4J98A 2C3JA 3BE2A 2J0IA 5DI1A 3EN5A 2Y4PA 3ERKA 1XBAA 4MAOA 4TNDA 5T6KA 4PMTA 5JGAA 3IW7A 3LCDA 2QOQA 4HVHA 2A27A 2YCFA 5BNJA 4M67A 2GFCA 3QGYA 4ZJIA 4DGLC 5IH5A 3QRTA 4U79A 4IAKA 3NLBA 3MN3A 3CJFA 4RWKA 3PJCA 3HA6A 3NDMA 1ZY4A 2VTRA 4U45A 2UZDA 3OW3A 4IMYA 3SD0A 3RK9A 4U8ZA 2WTKC 3KRLA 1FBNA 3KGAA 5FEDA 5HO6A 4OTIA 4TRLA 3SC1A 3W18A 4AT5A 1GZKA 4CRSA 5CQUA 3W2SA 4NW6A 4BTJA 4ZLOA 3U54A 1J1BA 2GS2A 3KULA 3A2CA 2R3MA 3NIEA 4GYGA 5AIRA 5D11A 3BI6A 2HW6A 4FYOA 4AT4A 3W1FA 4F1TA 2JDTA 2X4ZA 3GC8A 1SNXA 1QPEA 4FKOA 1YDRE 4QNYA 2O8YA 2WGJA 2XNBA 5I9XA 4FSWA 3V8WA 1QPDA 1WMKA 2QR7A 2VWVA 3F3VA 3PIXA 4FK6A 4WSYA 4DCAA 1F5QA 5AUUA 3RPSA 3QRJA 3DZQA 2OSCA 3BBWA 2I40A 2WQEA 3W32A 2XK6A 5AP0A 2EVAA 3CQUA 4I0TA 3IW8A 2WMBA 1PJKA 2HENA 5C9CA 3GU5A 4TTHB 3KRXA 3MFUA 3FZTA 5J79A 4X21A 1KE7A 5AP7A 4DGGA 2XIRA 3FKOA 2QOLA 2J2IB 5EYCA 4BI0A 4ZY6A 1IR3A 3FL5A 5CQWA 4XCUA 3Q60A 5M55A 3PP0A 4ZP5A 2E9PA 3DPKA 4AGUA 3BGPA 3I0OA 4WG4A 4C57A 4IHPA 4UALA 4FNXA 3IQ7A 4NW5A 3TKHA 4EH4A 3QTUA 5A4TA 2OZAB 3FEGA 5H9BA 3O50A 2UW6A 4FL2A 1KE8A 4M3QA 4RIXA 4QP1A 1E1XA 3UMXA 4F7NA 1ZOHA 3ODYX 4PNKA 2W06A 2VTHA 5HG5A 2Q0BA 4RVMA 5DEWA 4AAAA 2V7OA 4JG6A 5CALA 2SRCA 4F99A 1JOWB 3OCGA 4EH8A 4RIWA 3OY3A 3RI1A 3I6WA 3P4KA 3ULZA 1VJYA 4ANLA 3AOXA 1M7QA 3VC4A 4AFJA 4FV3A 3DLSA 4OR5A 4XP3A 3MGYA 5CI7A 4KUJA 4K77A 3RALA 2GNJA 4L44A 4AA4A 2PVYA 4CYIA 1GY3A 3R22A 5H8GA 4D4RA 3E62A 4FUXA 3KXXA 3O71A 2W5HA 3BYVA 2O63A 2QO2A 4ANQA 3Q5IA 5DVRA 3P7AA 2YCSA 1TQIA 4LV8A 4AW1A 4FZ7A 3FXXA 2X9EA 2QHNA 3BBTB 3C0HA 5EW8A 3R2BA 5FWKK 4BTKA 3FLWA 4EJNA 3PLSA 5KMOA 4APCA 3DKOA 3MB7A 2ZM4A 4ZSGA 3EOCA 2R2PA 3VQHA 3DQWA 4FV7A 5J9YA 4XLVA 5KMIA 4ORKA 4BZOA 2YDJA 5FXRA 4RGJA 4QNAA 3IG7A 4IH8A 3OY1A 3EKKA 5JZNA 5JMSA 4YTIA 1WAKA 1XQZA 4Y83A 4APPA 4HGTA 4ZLYA 3WYXA 5BVDA 4FSMA 3ZBFA 4ACDA 4LOQA 4DH1A 3WZUA 5GNKA 4KS7A 2HK5A 1PHKA 4MD7E 2ZV9A 4UMRA 3HP5A 4LL0A 3ELJA 2CCHA 2NO3A 3H30A 3Q53A 3BRBA 4D0WA 4GCJA 4E8AA 5CEOA 2J9MA 3AC3A 4RWIA 4HPUE 4MNFA 4Y8DA 4UMTA 3ORZA 4MQ2A 5E4HA 4RMZA 3ZO4A 3PSBA 4PQNA 2YIWA 4ZTSA 5HESA 3MA6A 3QCYA 1MRVA 5AJQA 4MD9E 2Z02A 3SW4A 3OTVA 3BU6A 5TF9A 4NT4A 2E2BA 5E8VA 3Q3BA 5HICA 2UZNA 3VBWA 4USEA 2Z7QA 5M53A 3R63A 3IW5A 4G9RA 4QP3A 2WMWA 4JBQA 3F5UA 5ACKA 3PUPA 2WPAA 3ORKA 3TV6A 3E8CA 4KABA 2JKMA 2HOGA 4W4WA 2VUWA 4Y95A 4FKSA 4FSNA 4FF8A 3A99A 3BV2A 3PLAE 2OLCA 3AMYA 1YHSA 3RNYA 5IQCA 4OTFA 3NR9A 3B8QA 3TNWA 4BRXA 4CKRA 3SG8A 1H00A 2C6DA 1M17A 4RWLA 1FVRA 3QQJA 1OIQA 3UIBA 4FKRA 1KV2A 2BAQA 4C61A 2PVHA 2PZYA 3KL8A 1YWRA 2C0IA 2GFSA 4UWBA 5IUIA 4C4HA 1NVQA 5KBRA 2C68A 3QQKA 3QQHA 4I5PA 4KINA 3I0QA 1ZXEA 2ONLC 3I5ZA 2Y8OA 2OJJA 3C0GA 3C4ZA 2P3GX 3EFJA 2CLXA 3QL8A 4E5AX 2R64A 4AP7A 1OM1A 3OCTA 5GHVA 2Q0NA 3PXKA 3W55A 3DAEA 3MA3A 2V55A 3G51A 2WMTA 3QTIA 5IISA 4O82A 3QC9A 4FGBA 5B0XA 4B7TA 4NU1A 2I7QA 3RNIA 2UW5A 1QCFA 4I21A 2C5NA 4XLIA 1JLUE 1V1KA 2VN9A 2YM7A 4QMNA 3CPCA 3TNHA 5JFWA 2WMRA 3KY2A 5KX8A 2W5BA 2Z8CA 1SM2A 3WF7A 4EH5A 4NJDA 4A9SA 5EYDA 5BYZA 4C7TA 2UV2A 3SGCA 1M52A 4JAIA 3FLZA 2HZIA 3I60A 4YLJA 4ERWA 4DH8A 4PX6A 2ZVAA 2BZIB 3D9VA 4EHZA 2PMLX 5GJDA 3TV4A 3PVUA 4O38A 5CVHA 2UZLA 1P14A 2UZTA 3QQFA 2WXVA 4GV1A 4XS2A 3ZLXA 4MXYA 4CG9A 2IN6A 3MB6A 1OUKA 5AX9A 3R8PA 4AZWA 4I3ZA 1ATPE 1U5RA 5AR5A 3W33A 2PULA 3B2TA 2I0YA 3QTQA 3M11A 4WRSA 2ZMDA 1KV1A 3QD3A 4WHZA 2GNFA 3QTXA 2VU3A 2DS1A 4PMSA 5HNIX 2ZOQA 4LGHA 4TYEA 5IA1A 3OEZA 3QF9A 4IAAA 5EG3A 4BGGA 3HECA 3MV5A 3F5GA 4E6DA 5IA2A 5HLNA 4TN6A 4A4OA 4L53A 5LVNA 4FEUA 3CQEA 2C0TA 1JWHA 3JY9A 3RCDA 1FMOE 4KIQA 1GOLA 2ZB1A 4J99A 1LPUA 3NCZA 4ANMA 3JY0A 3PA5A 4FEVA 1PY5A 2OU7A 4J71A 3TTIA 1PMNA 2QU5A 4L7SA 4PTGA 5HORA 3C5UA 4U0IA 4AWIA 4YJNA 4FEQA 1XHAA 5DNRA 3GVUA 4UYAA 3ZO3A 5C4KA 1Y91A 4CMOA 3QRKA 2VV9A 3NZ0A 4GU9A 2EXCX 4ZTNA 3W2CA 5J7HA 4E20A 5AR8A 4I22A 2PVLA 4A7CA 4DBXA 2ERKA 2B55A 3ORNA 4DGOA 3EQRA 3AMAA 4JBOA 5EDRA 5HG8A 4AZEA 4DAWA 4B8MA 1K9AA 2ZDTA 4AQCA 5D7VA 4RFZA 2V0DA 1J7UA 3QLFA 5AUWA 3TT0A 4KRDA 1UU9A 3AC4A 4YPSA 5IG1A 4B99A 4DLIA 1H8FA 4PDPA 3BWFA 2EB2A 4YTFA 3EB0A 5TR6A 4B4LA 2HZ0A 1OKZA 4IM0A 2QURA 2CPKE 3G5DA 4QD6A 2C6MA 2WTIA 3IO7A 4L9IA 4ZTQA 5AV4A 3ZO1A 3VBYA 3UJGA 5A6NA 3VO3A 2C6KA 4GMYA 2W0JA 5BPYA 4WNPA 4F64A 3WARA 1OUYA 2GNGA 2H34A 3NUAA 4FV4A 4D1XA 3DGKA 3L8SA 5FLFA 2JLDA 3O2MA 1JKTA 2WTCA 4IACA 5HTBA 3R7YA 3UNKA 3HAVA 5HTIA 2R9SA 2UZVA 2WOUA 4NSTA 1F3MC 2X39A 5DE2A 4Z7HA 5KO1A 5HD4A 3P0MA 5I9YA 5KCVA 2CGVA 3HMIA 4RA5A 2XNMA 4GK3A 5FEEA 3NIZA 4R5YA 4D2VA 2EXEA 3AT2A 5CT7A 5AM7A 4RC2A 2C47A 4KAOA 4WSQA 1MRUA 4F70A 2C69A 1JBPE 4PF4A 3EMGA 5D7AA 3R7GA 3NSZA 3O8TA 1Y6AA 5F9EA 2YAKA 2GHGA 3RP9A 2AC3A 4N70A 4F09A 5L2IA 3R7VA 2WZJA 3I81A 5CS6A 3FC1X 1REJA 2B4SB 5FM2A 3R7OA 5IH6A 3TM0A 4AN2A 2PE1A 2QOBA 3SQQA 2VTSA 2R3PA 5CF4A 4O7VA 1J3HA 4QT1A 3U9NA 2OK1A 5IUHA 4BZNA 2VTPA 4DBNA 2XVDA 4XYFA 2QHMA 3QRIA 2IW8A 3RCJA 4NFNA 4OT6A 5FM3A 1YWNA 2NRYA 3BCEA 3K5UA 3OW4A 2YIRA 2Z7RA 4CD0A 4X6QC 4FVPA 5CAQA 5CSHA 3PJ8A 1CKJA 4AN9A 3ORXA 4FTIA 4J53A 1IAHA 2R3GA 3GB2A 3PP1A 4IWOA 3Q2JA 1KWPA 4USDA 2V62A 4C2WA 5KUPA 5EFQA 1G8SA 2R3JA 4J97A 3R1SA 3NNWA 1ZARA 2IJMA 2X2LA 4GUBA 4YJRA 5KZIA 2G01A 3QUDA 2QODA 3E93A 2O3PA 5ANOA 3CQWA 5BYLA 2YIYA 1ND4A 3FI3A 3VHEA 3QQLA 3Q2MA 2F57A 3CEKA 2OI4X 3UVQA 2PVJA 4C4IA 4YZCA 4RWJA 3E8EA 5GIOE 5JFXA 3E87A 3I1AA 1GIJA 4RJ7A 5LVMA 3PWDA 5BX0A 2C5XA 1H07A 2RIOA 3R1QA 4BDFA 3OXTA 3ZYAA 1XR1A 2X7FA 5JRSA 4U41A 5AR4A 1ZY5A 4X3FB 4IAYA 2OIQA 4KKGA 3SOCA 4DITA 4R78A 1UNLA 5T3QA 4XOZA 4HCTA 4GFGA 2A19B 3BHYA 2A1AB 2UZBA 2XNPA 3FZPA 3TZ9A 3BLHA 3ZO2A 4EH3A 2GCDA 2R3OA 2W1FA 2OGVA 4F1MA 2X9FA 4IEBA 4IQ6A 1UKIA 3E64A 2YDKA 3OT3A 5FGKA 4ZLZA 2CMWA 5LCJA 4O7RA 3ZZEA 4MWIA 3C4CA 3KFAA 3NGAA 2WTWA 4FT7A 1JKSA 3IGOA 4EH2A 3ZEPA 3RK5A 4DTBA 2G1TA 3TTJA 5FQDC 4G16A 3OVVA 3OCSA 4EI4A 2QOOA 2RFEA 1Y6BA 1ZYDA 1TQPA 2WD1A 1UNGA 3NS9A 3O23A 3PE2A 4JT3A 5EI6A 1HOWA 2BCJA 3EFLA 4D5HA 2B9HA 1OL2A 3AC5A 4A9UA 3TUDA 5C01A 3I4BA 4FR4A 3T9IA 2AYPA 4NFMA 3V51A 3EIDA 5JT2A 3PZEA 4DCEA 2VGPA 3UDBA 1CKPA 4BDKA 2XM9A 2QI8A 2HCKA 1WBTA 2RFDA 3LFCA 3OWPA 3HV5A 4D2WA 3OF0A 4C4EA 2JBPA 2QO7A 2VO3A 3FMJA 4YBJA 3EL7A 4W4XA 3FBVA 4CMTA 3LKMA 2V22A 4BR3A 5IQEA 1PYEA 4BCJA 2IVSA 2QVSE 4LUDA 4XG4A 4C35A 2PMOX 4LGGA 3LVPA 4XBUA 3VQUA 5D1JA 1JSUA 3P78A 1YXSA 3LMIA 5DLSA 3DFAA 3IOKA 4S33A 2F7EE 4O7ZA 3VWAA 2W17A 1XBCA 5L3AA 4CG8A 1GAGA 4O0RA 3RHKA 1ERKA 4IAFA 3QTSA 4HNIA 3R28A 3UQGA 3GP0A 1QL6A 4IC7A 5HKMA 4EEVA 4XX9A 4KIKA 3VJOA 1OKYA 2OO8X 4WOVA 1JKLA 2ETMA 3D5WA 5CSVA 5HO7A 2WQOA 3F2AA 4GSBA 4R3RA 3WZKA 5L2TA 4BCQA 3FWQA 5HX8A 2ACXA 1NW1A 2WFYA 1W0XC 2JIVA 4ZAUA 3S0OA 5HLPA 4YHJA 4DYMA 4EK4A 5K5NA 3TDWA 3A7FA 2ITPA 3EZRA 3Q6WA 4IZ5A 3RKBA 1QPJA 5TT7A 5DT0A 3BE9A 4NEUA 4NKSA 1H01A 4FODA 4QMUA 4R7HA 3O7LB 3QAME 3M2WA 4GJ2A 1REKA 4IX6A 4ERKA 3TEIA 1UWJA 3NYNA 2ZMCA 3DNEA 5HIBA 4O0TA 3ZLWA 4PTEA 4U43A 3KXNA 3ID6C 4K0YA 2QKRA 4LM5A 3SRVA 4WG5A 4F65A 3FZOA 2XF0A 5BYYA 4ACCA 4CTBA 4W4VA 3TJDA 4EHEA 5BVOA 2QCSA 4PP7A 2BZKB 5HNGA 3HVCA 4XG3A 3EQBA 4YJVA 4MD8E 4YP8A 4BDEA 4C3FA 3GU4A 4MNEA 2ITUA 4A4XA 4JQEA 4TT7A 4CZUA 5IQGA 2OXDA 3P9JA 2Q83A 1GJOA 3QYZA 4FTTA 4O0XA 5EQPA 4O1OA 4Q9SA 4OGRA 3BGZA 4ZK5A 3KF7A 5K0KA 2XCHA 1YHVA 2LGCA 3ACKA 5ANDA 3FKLA 5FTGA 4QP6A 4NKAA 4M97A 4DFUA 3KCFA 4QMMA 2YERA 3PXQA 3VS6A 1WBOA 2X6DA 4IX3A 3D7ZA 3NW5A 5C1QB 3E7VA 5F95A 4WUNA 3CGOA 4FTRA 2YM4A 3HMNA 5CF6A 3NUPA 1DI9A 4JNWA 5FBNC 2VTJA 2BAJA 3Q4UA 3FXZA 3SKCA 3RAIA 2YIXA 3DV3A 2IZRA 5HVJA 2BIYA 3UVPA 4U97A 2H6DA 2QNJA 3VS7A 3U6JA 3R0TA 5JH6A 3IW6A 4KS8A 2XUUA 3MBLA 3C4EA 1XJDA 4AZFA 1H0VA 2C0OA 2YM8A 3OOGA 3V01A 1TVOA 4KBAA 3RWQA 3DK7A 2IWIA 3EQGA 4I6QA 4ZSEA 1MQBA 2OH0E 3V5JA 5J95A 4MCVA 2J7TA 4LYNA 3EL8A 4XG2A 4ZMFA 4P7EA 4EUTA 3PRIA 3ALNA 3EHAA 5EW9A 3UO6A 4UXLA 5KMKA 4EC9A 4XV3A 3F9NA 3QWKA 4W9WA 3WZJA 1E9HA 3PDTA 4WRGA 3C4WA 3D94A 3MYGA 4BIEA 4YU2A 2C1BA 3LM5A 5CU3A 5FP6A 5IQBA 4E5WA 3RMFA 5IMXA 3CPBA 2XCKA 4J8MA 4G34A 4M68A 4R1VA 3F7ZA 4XP2A 3T3VA 3R21A 3MY5A 5DFPA 5K0XA 4FZAB 3ZUTA 3FQSA 3LPBA 2GQGA 4JS8A 4A07A 2WOTA 4OTRA 2XRWA 4MXOA 4CLIA 3FZ1A 4RLKA 3U6IA 1O6KA 4CRLA 2ONLA 4DFYA 2VX3A 4X3JA 3N4UA 3NRMA 4FG8A 4Y72A 2PK9A 3GQIA 3FMEA 3ANRA 4UMPA 4BYJA 5BVNA 3NUYA 2W9ZB 3L9PA 4IE9A 4WA9A 5CXZA 5JSMA 5HE2A 2QOHA 3CTJA 4QQCA 4QMZA 1P4OA 4FTNA 3JS2A 4RJ5A 5FRIA 1ZMWA 3TIYA 4BDHA 3QZHA 1OZ1A 1JQHA 2YLEA 1IG1A 1STCE 3AGLA 3E92A 4E6QA 5B7VA 3S3IA 3R9OA 3ITZA 3E3BX 2B7AA 3FQEA 3OMVA 3T9TA 1OKVA 4F0IA 3PY3A 1B38A 4K33A 1Q41A 2UUEA 2PPQA 3HV6A 3ZCLA 4ASZA 4D2SA 3RJCA 3ZC6A 2YFXA 2QOFA 2ZDUA 4WG3A 3U87A 4D5KA 1IEPA 4CKIA 4DEEA 1BL7A 2QLQA 4F9WA 4DEHA 5L4QA 4O6EA 1ZMUA 4QMLA 4GT3A 4IZAA 3NWWA 3LFQA 3JR1A 5A6OA 3Q5ZA 2QONA 4NL0A 5CEMA 3A7JA 2PUUA 3QHWA 1O6LA 3COIA 5IF1A 4JR3A 4OAUC 4O1PA 4X2NA 4EK8A 1YOMA 4N6ZA 3MESA 4DE4A 2E9VA 2R3KA 2YWPA 3OT8A 4L3LA 2GPHA 2R3QA 4E4NA 5A46A 4NM5A 3NEWA 2W1ZA 4NH1A 3SDJA 3ZH8A 4W9XA 5AIKA 5AV1A 4FEXA 3SLSA 3R9HA 3VBTA 2JC6A 5AP4A 4QP9A 3AC1A 5CSXA 3PXRA 2IW6A 3R00A 2IZTA 4FIFA 2PZPA 5AAGA 2YCQA 4RVKA 4C02A 5CU0A 4V0GB 3GXLA 4ARKA 4DT8A 3W16A 4Y73A 3GT8A 3DKCA 3QXOA 1H1QA 1WVYA 3R8UA 3EQDA 4RC3A 3UNJA 3Q32A 3HV7A 4ONAA 4HYIA 5GJGA 3H10A 4ANNA 5GZAA 1NVRA 3DBQA 1A48A 5I9WA 3TNPC 3BHUA 3VJNA 5M4UA 3ZOSA 4JR7A 5H8EA 1MQ4A 2X2KA 3L9NA 4AE9A 3NYOA 4QP4A 1FGIA 3FZRA 2W1DA 3ZSIA 3RAHA 4PL5A 1YOJA 3KCKA 3ETAA 3RHXA 2YABA 3PYYA 4BB4A 2ZYBA 2OG8A 4F63A 4DEDA 2A0CX 2R3LA 1WCCA 2X8IA 3ZUVA 3M1SA 4LUEA 2XIZA 1J1CA 3PRFA 1WVXA 3AXWA 1GZNA 5G6VA 2G2IA 4TW9A 4ZTLA 4BBFA 4U9AA 5IDNA 1JPAA 2OBJA 3BHTA 1JKKA 2LAVA 2CKQA 4O21A 4YSJA 3MIAA 4A4LA 2VTTA 3LJ2A 5BQ0A 5JGDA 2CGUA 2XBJA 5CVGA 4JIAA 4ENXA 3DZOA 2ZV2A 4H1JA 5HIDA 1HCKA 5I9ZA 2BRNA 2H8HA 4BDAA 5BVEA 3D14A 1W84A 5LJJA 1KOAA 1U4DA 3HUCA 3REPA 3UGCA 4CFXA 2XKCA 3MS9A 3UVRA 2VWIA 4TWOA 4FKQA 3AT3A 3HP2A 4IFCA 5CEPA 1H4LA 3R9DA 4XHKB 5EHYA 1SVHA 3GOPA 2CNVA 3PSDA 5AP5A 4H39A 1DAYA 3F82A 4FSQA 4LMNA 4NM0A 3GU8A 4AX8A 1BX6A 3D4QA 4WIHA 4HW7A 3FKNA 4JBVA 3BQCA 4C2VA 4KSPA 4X3FC 4BBMA 4BWKA 2X0GA 2XMYA 1GIIA 2IVTA 3SX9A 3FMLA 3R01A 4WKQA 4DLJA 2R7BA 4WBOA 4PL3A 5M56A 2VX1A 1AD5A 4L6QA 4PDOA 3D0EA 1KUTA 4KD1A 3LE6A 4C4JA 3LCKA 3TJCA 1XH6A 3FSKA 4RSSA 1Q62A 2VZ6A 2XNGA 1OL1A 3H9RA 2OWBA 2CN5A 4GUEA 4FSRA 4X2GA 2JAVA 4IVCA 4IDTA 5K3YA 1Q4LA 4GL9A 4XJ0A 4V0GA 3WILA 3IDPA 1APME 4Z55A 3PIYA 2HZ4A 3FI4A 3NNXA 1X8BA 4O27B 4ZTRA 1A06A 3E5AA 4BDCA 4BIBA 4ENYA 4C62A 4X2JA 2ITVA 4DFBA 3AC2A 2RFNA 4GIHA 4TZRA 2X7OA 3QUPA 5EQEA 3H3CA 2HYYA 3F69A 4DG3E 5ANEA 4FE2A 4M7IA 2P4IA 1VEBA 2ESMA 2OFUA 5M07A 4FKVA 2VNWA 4YC8A 1PXJA 3ROCA 2RKUA 3C50A 5BUJA 1Z57A 4BKYA 1Q24A 2UW9A 3E8DA 5DHJA 4Q5HA 2H9VA 2OZAA 3B2WA 4NZWB 3KMMA 4YZBA 2X81A 3NYVA 3R30A 5LWMA 1WBNA 2OF2A 5J87A 3VW8A 3EN4A 1Q8UA 1PMVA 5EQYA 4ALWA 5DA3A 4QYHA 3OD6X 3F2NA 5T68A 2PU8A 3K2LA 2X6EA 4PY1A 1OECA 3QZIA 4XMOA 2HW7A 3RM7A 3PPKA 5AA9A 2J0JA 4G2FA 4ACMA 1PXPA 3WF6A 3GNIB 4I93A 3F6XA 4HZSA 3SAYA 4BWPA 4EUUA 3PXFA 3R04A 4DA5A 3BYOA 5FTOA 3F66A 3FYJX 3SHEA 4ALUA 4XG9A 3TXOA 1SYKA 2HZNA 2VTLA 4MXAA 1VYWA 1P2AA 3LCOA 3V3VA 1BL6A 3UIUA 4EC8A 3DBCA 3GCPA 4YSMA 2OJGA 4O84A 4CNHA 3CY2A 3LW0A 2Y4IB 3GCQA 5M4IA 2O65A 2VRXA 4YJUA 3DBEA 5DEYA 5IEXA 4LRMA 3D5XA 2YWVA 3BYSA 3TG1A 4OTWA 4BWXA 4MF1A 1H25A 3MW1A 5LVPA 3MJ1A 3KRRA 3DT1A 3T8OA 1ZZLA 1YW2A 5GZ9A 3EQHA 3GBZA 3VULA 3R73A 5L6OA 3VF8A 3G90X 3DTWA 3UODA 5JGBA 2VO0A 2YCRA 5E8WA 3PA4A 4F9AA 4C34A 3LFSA 1M2RA 4Y5QA 2QU6A 5IMEA 5DR6A 2B0QA 4U7ZA 1RDQE 1V0BA 2ZJWA 2QOIA 5CVFA 3UTOA 4QQJA 3TKIA 4G1WA 4Y46A 4FZFB 5ITAA 4BCPA 3LMHA 1PXOA 3QZFA 3ANQA 3HV3A 3RZFA 4AOIA 3VUTA 1JAMA 1ZAOA 5CU2A 3CE3A 4MHAA 4P2KA 2WNTA 1HCLA 4Z3VA 4KRCA 4R7IA 3HA8A 3MVMA 4OAVB 4GK2A 1W8CA 3UC4A 5ETAA 5CZIA 4XG6A 4HGEA 5KNJA 2EXMA 4O2PA 3FHRA 4QYFA 2G2FA 1OIYA 2ITWA 4ZS0A 5AMNA 3FV8A 1Q8WA 5CENA 2QR8A 4KSQA 5LVLA 2BRMA 5DR9A 4HYSA 1Q99A 2XP2A 2ZM1A 3KMWA 2Z60A 1UU3A 2OXXA 4EOOA 3LLAA 5E8SA 2QC6A 3PSCA 3UZTA 1Z9XA 2VTQA 3WZEA 4BDIA 4ZMEA 3DBDA 4FSYA 4FIJA 4ASEA 5J8IA 1K2PA 4YZMA 5EYMA 4YNEA 4YNOA 1P5EA 4EQCA 5IA5A 3UYSA 2YM3A 5K9IA 1H1WA 3FLQA 2PUNA 3TDVA 5HBEA 1PMUA 2OF4A 5KHWA 3EWHA 2QD9A 2UW3A 1OI9A 4CFNA 3AC8A 3TWJA 4EKKA 3BWJA 5DBXA 3ZFXA 5M51A 4WNMA 2O2UA 3H9FA 4ACGA 3MI9A 3CSVA 4UZDA 3QZGA 5K4IA 4IVBA 4NUSA 4RQVA 5HU9A 4YJSA 3T3UA 4FNWA 1Y57A 3SXRA 4IVAA 1E1VA 4O22A 5H8BA 5A54A 3SVVA 3BIZA 4R6VA 4HVGA 2EUFB 5J7BA 4G3CA 5E90A 2DWBA 4MKCA 4EKLA 3DXQA 5AUZA 1OB3A 3KEXA 4IDVA 1NY3A 3W10A 5CXHA 4L46A 4IB3A 2XEYA 1R3CA 5C03A 2WMSA 1JSTA 4G5JA 5AUVA 4I23A 4E4MA 3G6GA 3ROYA 4EH7A 4I94A 4R5SA 4II5A 5AWMA 3KRJA 3QWJA 4OBPA 5M4CA 4M13A 2OXYA 3AQVA 4F7JA 3NMUF 3VS4A 4UWYA 2VO6A 3QHRA 4TPTA 4TWCA 3ZONA 2F2CB 4FICA 4NM3A 3FMNA 5A9UA 5GINE 5AR7A 1O6YA 2RFSA 3A62A 4NTTA 1B6CB 4FV2A 3AGMA 3EZVA 3O17A 5JN2A 2WMQA 2W4JA 4M14A 4CFFA 4CKJA 4FTKA 2ITQA 2UW4A 3TZ7A 3UQFA 5JFSA 3AMBA 5HLWA 4PPBA 4QYEA 1Y8YA 4G6OA 4DGNA 4UBAA 3KXMA 4S31A 4O96A 4XV2A 2XYNA 2X1NA 3FJQE 4FMQA 4D2PA 2A4LA 1R39A 4IB0A 3PY0A 4OT5A 4PDYA 3CXWA 3MH2A 3MVLA 4C33A 3DK3A 3RINA 4ZZOA 3MPMA 4G3DA 2XK7A 4Z9LA 1DAWA 2CCIA 1CM8A 3VUMA 2Y0AA 1IA8A 4DEAA 2NP8A 4DH3A 3FQHA 5J9LA 1S9IA 3U9CA 1LEZA 4BHNA 1OBDA 3WIGA 5JQ8A 3U4UA 5F94A 3SA0A 4UV0A 1W83A 2Y6MA 3ORLA 3ZRLA 2HIWA 4EZ3A 5J9ZA 2YEXA 4E7WA 3P23A 4O0YA 4C4FA 5IA3A 3NUXA 5ETFA 3NCGA 1DM2A 3TUCA 4OLIA 3DS6A 4F6SA 5IPJA 5ANKA 3UQCA 2UZEA 3EFWA 2WKMA 4QMPA 4CFMA 4D4SA 3F3WA 4O81A 3GCUA 4I0RA 3NUSA 2XK9A 3GENA 3MFSA 3FZSA 4QYGA 3ZBXA 4AGWA 2R3NA 5HG9A 2UZOA 5KKRB 4ITIA 3PPJA 3M42A 5FEQA 4CVAA 1YI3A 4G17A 2YHVA 4IJPA 1OGUA 2YZLA 4S32A 2AC5A 4KNBA 4NM7A 4YO6A 3NNVA 3KA0A 3OC1A 2R4BA 4ANBA 4GIIA 3TNQB 2BVAA 3K3JA 3KF4A 3KK8A 5GIPE 4DFZE 3AD4A 3CY3A 4KA3A 3RAKA 3P7BA 3ZDUA 2PHKA 1PXNA 1PXKA 5IEVA 4XUFA 2RG5A 2ZV8A 3GU6A 3R02A 4W4YA 4EONA 3ORTA 3V5QA 2VNYA 2XK8A 4WBBB 4DC2A 1P4FA 3TIZA 3ZSGA 3DXPA 2XK3A 5IQDA 4QO9A 4L45A 2B9JA 3ZC5A 3GGFA 1B39A 3IDBA 4FKTA 4FZ6A 2GNIA 5HO8A 5LCKA 4E5BA 4FIGA 5B2LA 3H0ZA 3P1AA 3ODZX 3PTGA 4NTSA 3DU8A 3ZS5A 3UP7A 4BKJA 1G3NA 1BMKA 4H36A 3ZU7A 5CU6A 2XA4A 4JDJA 4BFMA 1NA7A 5DYJA 2W1GA 3AD6A 3BU3A 1O9UA 3COMA 4R1YA 3P08A 5H3QA 3ZZWA 5E8TA 1L3RE 4ANOA 4JX3A 3U6HA 1OL5A 4QPMA 4FTJA 5CZHA 4BY9E 4DH5A 2IO6A 2PVFA 4FYNA 4GVJA 3A4PA 3OCBA 4O91A 3WI6A 1WBVA 3LXKA 2FGIA 3LJ0A 4NJ3A 1Q8TA 3IGGA 1UV5A 5CANA 1YQJA 4J95A 2HELA 4LOOA 5DWRA 2XNOA 3F61A 3D2IA 4FI1A 2J6MA 2XB7A 2BAKA 4FSTA 4GH2A 4L01A 4DEBA 4CCUA 5EM7A 5TOZA 4YR8A 3QLGA 4L3PA 3A7GA 1U5QA 4GKIA 5E91A 2YITA 3FPQA 3VS2A 4RLLA 4XV1A 3EN7A 2YM5A 4GKHA 4EOIA 2W05A 4OBQA 2JDOA 3ALOA 5HNBA 4DTAA 4O7SA 4D2TA 2YJSA 3KK9A 4HZRA 4AOJA 4EOLA 1LEWA 3BYUA 1ZZ2A 3Q4TA 5KBQA 4YHFA 3BX5A 3QXPA 3QBNA 3TL8A 1SVGA 2VTOA 3OUNB 2X2MA 2JIUA 2UW0A 1VR2A 1WBPA 5A4LA 2JKQA 1IA9A 3D5VA 5KMMA 2QG5A 1SZMA 1OKWA 2C5OA 2BALA 1BLXA 4BGHA 3UO5A 4RX8A 4YPDA 3ZM4A 3MDYA 3DOGA 4ALVA 3IW4A 2P2IA 3ORPA 3KREA 3PPZA 2VWYA 5FG8A 2Z7SA 2R0UA 3LFEA 3U4WA 2ITNA 4EHGA 4CT2A 2UZWE 1RQQA 2J0LA 3KB7A 4U40A 2W9FB 3CBLA 4B9DA 4EOQA 4RJ3A 2XJ1A 4HVSA 3R1NA 5AV2A 3FC2A 1H28A 1OPKA 2ITTA 2XNEA 1TQMA 4I4EA 3OBJA 2C1AA 3LCTA 4G9CA 5I9VA 4TYGA 3THBA 5JKGA 5LXMA 4I6HA 2HAKA 3RK7A 4KBKA 4XRLA 4FTMA 2ETRA 2O64A 3GCVA 4ITJA 3WE8A 4YZNA 3MPAA 3DJ5A 4FV9A 2CJMA 4X3FA 4G6NA 1FQ1B 3H9OA 2ITYA 4TYIA 3W2PA 4RFYA 4PTCA 1G8AA 3OWJA 2Y6OA 5EW3A 2WMVA 4JX7A 4O86A 3KVWA 3HRBA 2UW7A 3E3PA 3OG7A 3HNGA 4X6RA 5ICPA 4L68A 3MJ2A 4DFLA 4CZYB 3R7EA 4AG8A 2Y4IC 3FLSA 4V01A 3SV0A 1MUOA 3V5PA 4F1OA 3DNDA 1XH9A 3I79A 4PL4A 2BTSA 3PJ2A 4R7BA 3ENMA 4HGSA 2P33A 4BCGA 5LMKC 3L8PA 3WF5A 3N9XA 4Y5HA 4F9BA 4MH7A 4BIDA 2PZIA 3BELA 3II5A 2WTJA 5ETIA 4CYJA 3K5VA 2KULA 3N4VA 1OPJA 2J0KA 4R3PA 5L2QA 5LARA 2ETKA 1AQ1A 2PY3A 1VYZA 2JEDA 2OH4A 4GW8A 3OS3A 1I09A 5ETCA 3MFRA 3VRYA 3R83A 4DFNA 4YC6A 5CSPA 1S9JA 2X4FA 3V04A 4XOYA 3L9LA 2J4ZA 4AACA 3LQ5A 5DR2A 2X8EA 2F7XE 2J50A 4M15A 4MYGA 3PG3A 3LQ3A 4O7YA 2BIKB 4EH6A 3QUEA 2OJIA 3OROA 3EYGA 4BGQA 4YTCA 5IA4A 4R3CA 1M7NA 1BI8A 1U59A 5FBOA 4KB8A 5EOLA 3Q6UA 3FAAA 4FTLA 3TACA 2IG7A 3LFAA 3DKFA 1KE9A 4P5ZA 4FGRA 1UNHA 2OICA 3Q9XA 3V6SA 5DH3A 4KBCA 3BV3A 3R7UA 4BHZA 4RVLA 4M69B
chains in the Genus database with same CATH superfamily
5IA0A 4QTEA 3FE3A 2NNWB 3ZEWA 3CKXA 5HE3A 4EWHA 5DRDA 2UVZA 4K8AA 4FIIA 4BC6A 4QPAA 4ZEGA 4DEGA 4W8EA 2ITOA 3R1YA 4XH6A 4GK4A 4AW2A 5HVKA 1W7HA 3LLTA 5D41A 4AFEA 2JGZA 4NCTC 4P90A 4ZJJA 4BZDA 3GOKA 5BVWA 1PW2A 1GNGA 4QMTA 4L42A 4QP8A 1WVWA 2JBOA 3QYWA 3C4XA 3MPTA 5CTPA 5AUYA 3LM0A 3SXFA 4IXPA 3OOMA 4C8BA 1K3AA 5BMSA 4D4YA 4AA0A 2OIBA 2AQXA 2BHHA 2FYSA 3GC9A 1A9UA 4U5JA 4YGAA 5EYKA 4AS0A 2RG6A 4BVUA 3KULB 2BTRA 4S30A 3HRCA 1SMHA 3I7BA 4IWPA 2YM6A 4XBRA 3RTPA 4E73A 2E9OA 4KIPA 4IB1A 3ZSHA 4DN5A 5AADA 5L2WA 5E8UA 4BCOA 4EYJA 3QKKA 4RJ4A 4H3PA 4D9TA 3W2RA 3G6HA 4YURA 2BZHB 4FTUA 2FSMX 2JDRA 4I5CA 3RVGA 2YZAA 1J91A 1YDSE 4I6FA 5DMZA 3VBVA 1M2PA 4FSUA 3P7CA 3S4QA 4CXAA 3NVKI 1GZOA 4H58A 4O6LA 3WE4A 3EH9A 2CGWA 3LXLA 3RM6A 5M06A 4M0YA 2XEZA 5EI8A 1UU7A 5AP1A 3ZLSA 4TXCA 3HGKA 2I6LA 2WELA 1Q3WA 4LI5A 4EJ7A 2DQ7X 2BR1A 3PVWA 3R2YA 2QO9A 4YBKA 5HE0A 3VN9A 2Z2WA 3OBGA 3UE4A 3O96A 4NIFB 2G2HA 5C27A 4MWHA 1YI6A 5CT0A 4ZJVA 4UX9A 1PXMA 1OVEA 3HDMA 3LQ8A 1I44A 4YJQA 5CF8A 5HIEA 4FIEA 4EK5A 3QKMA 5CNOA 5CWZA 4F9YA 3CGFA 4RQKA 4JIKA 3CJGA 5DOSA 4ZSAA 1L8TA 5JZJA 4IM2A 1OITA 4UB7A 4HVDA 3G2FA 2W1HA 2XM8A 1XKKA 2A98A 2OJFE 2R0IA 3FYKX 4IJ9A 5FXQA 5TKDA 5J1WA 4DTKA 3EFKA 4YLKA 3UZRA 3R9RA 4FTCA 3A60A 5HQ0A 5HEZA 3AKLA 1FGKA 3G9LX 1Z5MA 3ZM9A 2XRUA 3LJ1A 4FIHA 5I3OA 5CAPA 2P55A 2VTNA 5CX9A 5C8NA 4U3ZA 5M4FA 4K11A 3C0IA 1NXKA 3C7QA 4U81A 4ZSLA 4QMSA 4R77A 5FUTA 4EK6A 4G3EA 5ANGA 4RA4A 3PVBA 3UG2A 1XH4A 3HDNA 4QTAA 3H0YA 4B6LA 3LAUA 5A4CA 3DBFA 2VWUA 1V0PA 2WQMA 3C13A 4I6BA 4KWPA 4FUYA 2BPMA 2W1CA 3FY2A 2YJRA 4O0UA 3VUKA 3NVMB 4FV0A 4AZSA 3F5PA 4FOCA 4CT1A 3DQXA 4A9YA 4DINA 4AW0A 3F7WA 2I1MA 4O4FA 3EQCA 3V5WA 4CSVA 4EHVA 2XIYA 4N4SA 3UOLA 3Q9ZA 4XG7A 4E4XA 5KMLA 2ZB0A 5AM6A 2BHEA 4USFA 3F88A 4E4LA 4ZTMA 4H3BA 5HI2A 1R0EA 5EI2A 4IB5A 5KKRC 3VW6A 5HGIA 1KE6A 4UWCA 4FV8A 5IEYA 1XBBA 4GG7A 4JDKA 5CY3A 5HU3A 2IPXA 3ATSA 5EM5A 3CTQA 3NW6A 4OW8A 4DGMA 4JLCA 5JFVA 2G15A 4MVFA 3BGQA 2C3KA 3NUNA 4UZHA 1VZOA 2Y7JA 5E7RA 5FDXA 4MXXA 4FC0A 4FZDB 5HCYA 4D28A 4E26A 1DS5A 5AR2A 4I92A 4M66A 4LG4A 2RSVA 3ZDIA 1PMEA 1YOLA 2PMNX 4FV5A 4EL9A 3UP2A 1Q8ZA 3MY1A 2B54A 2GSFA 3LHJA 2J5EA 5C8MA 2NRUA 4FVRA 1T46A 4D2RA 4N57A 4R8QA 4NIFA 2GTNA 4ZOGA 3WF9A 3JVSA 4K18A 3S95A 2OZOA 3PJ1A 3POOA 4FKWA 4I24A 3E88A 2W99B 3LFNA 4FT0A 4MXCA 3R8ZA 4F6UA 5CAUA 1YHWA 4CV8A 2PMIA 3A7IA 3LCSA 3LXNA 3QALE 3EN6A 4TKSA 2HXLA 5IQFA 3UIXA 2W7XA 5A3XA 3JUHA 3VS1A 4C0TA 3P5KA 5DT4A 4MF0A 4DF3A 3VHKA 3QX4A 2I0EA 1UU8A 5FP5A 1PKDA 2I0VA 5CI6A 4FNYA 3FLNC 3OFMA 5FTQA 4D9UA 4HYUA 4E93A 3F5XA 3CTHA 1SNUA 1XH7A 3KRWA 4TYJA 4FKIA 3SOAA 1H24A 2YLFA 5I5ZA 2CN8A 2EWAA 2GNLA 3VIDA 5J5SA 3FPMA 1BUHA 2EB3A 3IDCA 3QRUA 4M0ZA 4YLLA 3JVRA 4LRKA 4TWNA 3K3IA 4CTCA 4U6RA 3TN8A 2PVNA 4BN1A 1U46A 4RX9A 5LOHA 5HX6A 3GC0A 3CD3A 3DKGA 4YHTA 4F4PA 1KE5A 3F3TA 3MY0A 4JVGA 5HOAA 4C37A 1LR4A 2BROA 4A06A 2FVDA 4HOKA 2WB8A 3OUKA 2XNNA 2EU9A 3UNZA 3IS5A 1URWA 3IOPA 4QMQA 3G9NA 3GCSA 3LOKA 5IDPA 5DG5A 5GZ8A 4U44A 3ZMMA 3VNTA 4MBJA 4QPSA 3V6RA 3DB8A 2I0HA 4ZSJA 1ZOEA 2X7GA 5M44A 4BDJA 2J0MB 4OBOA 5KMNA 2R3RA 4J1RA 3ZFYA 5HZNA 3P86A 5CSWA 4PWNA 4FV1A 1H1PA 2RGPA 3EN9A 1ZMVA 3L1SA 4LOPA 2DYLA 3GU7A 4UY9A 4F7SA 3F3UA 1Y8GA 3GUBA 3R8VA 3IONA 4QQTA 3R8LA 1Q5KA 4C4GA 2B9IA 3RZBA 5L8KA 2AEGA 1EH4A 2WTVA 3BZ3A 3VS3A 4AOTA 3NAXA 4EORA 4TWPA 4DH7A 5J5TA 2C3IB 2C5YA 5F20A 1DI8A 5IKWA 1WZYA 2JFLA 4L43A 5TE0A 3C5IA 3A4OX 2W96B 5DN3A 4JL9A 4OTGA 5ACBC 4HVIA 2O0UA 3RGFA 4BYIA 4D4VA 4BI1A 4JOAA 3RPOA 1QMZA 5CEKA 1R78A 5CAOA 1JSVA 5HCZA 4H1MA 2FSOX 3NX8A 2G9XA 2C6IA 3OWLA 4IX5A 4F9CA 4HCVA 3L9MA 4L00A 5KMJA 3KVXA 4GG5A 5CEIA 2CDZA 3ENHA 3E7OA 4J96A 4WO5A 4WNOA 3VS5A 3V5LA 5JK3A 1UKHA 3QTRA 4FKLA 4IZYA 3G15A 2BDWA 3I5NA 4F6WA 5AX3A 4GYIA 3ULIA 4IANA 4QQ5A 3V8TA 2Z7LA 4ZY4A 3O51A 1W98A 4I20A 4AE6A 3FI2A 1TFFA 2BILB 3VUDA 4J52A 4MBLA 2WQBA 4BCFA 4E6CA 3MVHA 5C26A 5CASA 3HLLA 3BYMA 4L52A 2BFXA 4KKHA 4LGDA 5DIAA 2WMAA 4YJTA 3DB6A 5B2MA 1RE8A 4AXEA 3QU0A 4Q5EA 4GJ3A 1XH5A 4WD5A 4FTQA 2GHLA 2HY81 2XKDA 3PFQA 2YISA 4MQ1A 3R9NA 4CFWA 3FUPA 1Q8YA 4EOKA 4UYNA 4QRCA 3QTWA 3V8SA 3IK3A 4XRJA 5BVFA 4JRVA 3U55A 3W0QA 2RF9A 3DAJA 4V04A 4YZDA 3WIKA 4CMUA 2BFYA 1ZYSA 2WAJA 1JNKA 3Q4ZA 5AP3A 3BLRA 4K9YA 3HMMA 2QOKA 1Q3DA 2XH5A 3AG9A 4FVQA 5DRBA 2CKOA 2FSTX 4FOBA 3ACJA 5EHOA 4S34A 2JITA 5CNNA 3VRZA 4D0XA 4F08A 3UPXA 3WYYA 3TNIA 4A9TA 4AXAA 2R7IA 4AXFA 2PVMA 2GQSA 2F2UA 2ZM3A 1BYGA 4L7FA 5EOBA 5HTCA 5I4NA 3POZA 2ZV7A 4LFIA 3QQUA 1YDTE 3PE1A 4EOJA 5AEPA 5AFVA 4IADA 4Y85A 4QEBA 5I3RA 3SW7A 1OL7A 3DLZA 4QYYA 3GFEA 2GQRA 2GHMA 3MFTA 3O0GA 4QP7A 4CV9A 3ZUUA 2XS0A 2IVUA 2UZUE 4EOSA 1CSNA 2QQ7A 5IQIA 3D2KA 3L8XA 1IASA 3A8WA 4OTQA 5E8YA 4ANSA 5BUEA 3QQGA 2GTMA 5AAEA 4K6ZA 4I5MA 4NK9A 3Q04A 4YTHA 5BUIA 4O2ZA 5LWNA 4CQGA 4O7LA 3TI1A 3TV7A 1MRYA 3IECA 4EQUA 4EZ7A 4YZ9A 4BTMA 1XH8A 3U51A 1YI4A 4L67A 3QA8A 2F9GA 2JKKA 2YAAA 3S1HA 4IC8A 3KU2A 3R7IA 4QTDA 3CS9A 2BRHA 4PRJA 3EYHA 2GMXA 3S2PA 1TKIA 3FDNA 1H0WA 4RZVA 4UEUA 5DGZA 4RPVA 4EH9A 3L8VA 4BDGA 4W8DA 4TY1A 4XNEA 2XJ0A 3BQRA 4GEOA 1NT2A 5IQAA 1OPLA 2BKZA 4AGDA 4EOPA 2J5FA 2HY0A 4FT9A 1PXLA 4D55A 4P5QA 4YJPA 3EQPA 1GZ8A 4TYHB 3R8MA 3FMHA 3G0FA 4AUAA 3CP9A 4PMPA 2VWBA 5E9EA 3BLQA 3VUGA 4C3RA 5K4JA 3EJ1A 4BCMA 4O7NA 2XZSA 2B9FA 2CGXA 5E92A 4CZTA 2PZ5A 4PPAA 5HCXA 2Y9QA 1LP4A 3HZTA 4FKUA 4O4BB 5A14A 4I0SA 5EK7A 5LMKA 3AT4A 5ANIA 4IM3A 4RC4A 3G33A 3GEQA 3RPRA 3FSFA 3GQLA 2BDFA 1ZYLA 2AUHA 4D58A 4EBWA 2VO7A 3FXWA 4WNKA 3ZRMA 2J90A 2VTIA 3QCQA 4BCIA 3H4JA 4RIYB 2B1PA 4DFXE 4IBMA 5EKOA 4BCNA 4FG7A 3CKWA 2C3LA 3DTCA 1YXVA 5AAFA 3VVHA 4FT3A 2VD5A 1ST0A 4BCHA 3DFCB 5CYIA 1GIHA 4GRBA 3KQ7A 5EKNA 4GT5A 3ZTXA 2BDJA 1Q61A 2FUMA 3UMWA 2VX0A 4RZWA 1VLRA 1IRKA 3C9WA 3FMDA 5IZFA 3I7CA 4MXZA 4JRNA 3LFBA 4FEWA 5F4NA 2JAMA 3R71A 3COHA 3MH1A 1T45A 4Q2AA 4B0GA 4U3YA 4ACHA 3WBLA 5LVOA 2CKPA 3C51A 4O7TA 4ZTHA 3LFDA 2XANA 4ZY5A 5KZ0A 3C4FA 2PYWA 3QD0A 4XP0A 2WTDA 2KTYA 4K2RA 4LQMA 3FY0A 3MH3A 1KSWA 2R5TA 3ZXZA 1RJBA 5KHXA 1KOBA 1YXXA 3E8NA 4YC3A 3UPZA 4RJ8A 5HBHA 4MTAA 5F1ZA 3MVJA 4BL1A 3DXNA 1YRPA 4NCTA 1CDKA 4JDHA 4MK0A 5HD7A 1PRYA 4U42A 5LMAA 5L6PA 1SVEA 3Q9WA 3C1XA 4BTFA 5AUTA 4GVAA 4DG2E 1J7LA 3QD2B 1ZYJA 2WMXA 1H1RA 2WTKB 4PUZA 4V05A 3E63A 3QTZA 1JVPP 2RL5A 3UOKA 2O5KA 2XKFA 2ZAZA 4G31A 5LQFA 5EDQA 3PZHA 2ITZA 2UW8A 3QD4A 4JDIA 2CSNA 1H1SA 4IZ7A 3OXZA 3CC6A 2PZRA 3KN5A 2F4JA 4BDDA 2QG7A 1PKGA 1Q97A 2BKKA 4DG0E 5EDPA 1M14A 5JQ5A 4AU8A 3FMMA 4QTBA 5C8KA 5K5XA 2YIQA 4PMMA 2BZJA 3GI3A 4NWMA 1QPCA 4UMUA 4EK3A 4ZS4A 3CCNA 3PVGA 4CLJA 1FINA 3RWPA 2DUVA 2NPQA 3F3ZA 4I4FA 4QTCA 4UMQA 5DPVA 3HRFA 2UVYA 3MTFA 3JXWA 4MEDA 2C6LA 2CNUA 3BL9A 3VBXA 4JBPA 1LUFA 4ZZMA 1YKRA 4CFUA 1CMKE 4RX7A 3OHTA 3UZPA 4X2FA 2W4OA 1FOTA 3VUHA 3DDQA 4FKJA 5AUXA 4RIYA 1PYXA 4U80A 3HEGA 4CQEA 1YXUA 2J51A 2WMUA 1UWHA 5B2KA 4IAZA 2WIPA 2XIKA 2WO6A 3EQFA 4MBIA 4JI9A 1PF8A 3PWYA 4FT5A 4CFVA 4AA5A 5JRQA 1U54B 5AV0A 3UC3A 2OW3A 3KXZA 3FL4A 3LXPA 4ZZNA 3UOJA 1BI7A 2PVRA 4BF2A 4RBLA 2X8DA 3WZDA 1YVJA 4HPTE 4BBEA 3CD8A 4RRVA 2IZUA 5EM6A 3VF9A 4DHFA 4FKPA 4KIKB 4LRJA 5AV3A 2YA9A 2VTMA 4FNZA 2JFMA 4ITHA 4J8NA 5CEQA 1OIUA 3NPCA 1H08A 4RT7A 4EZ5A 2QLUA 2VAGA 3O8PA 2C30A 4AN3A 4QMOA 2REIA 3KMUA 2P0CA 3PJ3A 4PNIA 4FL1A 4I5HA 5CAVA 5E8XA 2HWOA 4OTDA 5I9UA 2BMCA 3VS0A 1IAJA 2YN8A 3TZ8A 4BI2A 3KIOC 3R6XA 3ET7A 4H3QA 2IW9A 3ZFMA 4NYEA 2C5VA 3DY7A 4ASDA 3ZLYA 3OTUA 1H27A 2C6TA 1J7IA 4CGAA 2C6EA 4YJOA 5L8JA 1CKIA 1F0QA 3ZHPC 2FO0A 3Q4CA 4ZXTA 1M2QA 4JJRA 4EQMA 4EYMA 2PTKA 1H26A 3SRVB 4TL0A 2GNHA 3DDPA 5M09A 2HXQA 4IFGA 5I0BA 3NW7A 4OUCA 4RJ6A 4HNFA 2GS6A 4OTHA 3VUIA 2XKEA 4QOXA 2JDVA 5FDPA 4HJOA 1URCA 3MIYA 2XBAA 2W1IA 2WHBA 2XK4A 2XYUA 3PXZA 3MSSA 4LL5A 5E1EA 5HE1A 4FRFA 3DJ7A 4MNEB 1ZLTA 3TUBA 2BRGA 3RPVA 4D1SA 4IWQA 4GU6A 3UIMA 2B52A 4JXFA 5L6WL 5CU4A 2BRBA 3SXSA 3QCSA 4X7QA 4ZIMA 4RVTA 2IVVA 4IX4A 2QOCA 3ATTA 5IUGA 3RBWA 4GFMA 5HVYA 1RW8A 4H05A 3W2QA 5E8ZA 2JDSA 1UA2A 2CKEA 1YWVA 4UXQA 1NVSA 2JKOA 4QP2A 2H96A 3EQIA 3A7HA 4L3JA 4X0MA 3QKLA 1R1WA 3DJ6A 3MTLA 3I6UA 2OKRA 3DK6A 4WUAA 3MH0A 3W2OA 5KE0A 4FBXA 1U54A 5BVKA 4GFOA 4FL3A 3UDTA 1PXIA 5IQHA 4FSZA 3K54A 3PG1A 4EWQA 2R3FA 3OXIA 3HX4A 4KKEA 3KN6A 4N0SA 5AP2A 2CNQA 3BKBA 3EKNA 4O0SA 4LV5A 1ZOGA 4AZTA 1G5SA 5A4EA 4GS6A 1OBGA 2C6OA 2WIHA 3G0EA 5BV3A 2HWPA 3PXYA 3O5AA 4P4CA 2OIDA 3CLYA 4IAIA 2PSQA 4PP9A 5EH0A 4O4EA 2GDOA 4BCKA 3KKVA 5IU2A 1WBSA 2E9UA 4HCUA 4K1BA 3PY1A 3N4TA 4AZVA 3Q96A 4F0GA 4CEGA 3CR0A 3UBDA 5AP6A 4LMUA 3UOHA 5AA8A 3KC3A 2F49A 3OEFX 3S00A 2VWWA 4WT6A 4CCBA 3DAKA 1UVRA 3BEGA 3HV4A 4FA2A 3TCPA 3PA3A 2PUIA 2GU8A 2XIXA 4Z7GA 4JG8A 3NAYA 2CHLA 3LFFA 4G3GA 4IIRA 1ZWSA 5C4LA 3RAWA 4JAJA 3B8RA 3BU5A 5BMMA 2C4GA 5G1XA 4BDBA 2WEVA 2IF8A 2PE0A 2VGOA 5AR3A 3OZ6A 2V5QA 4M84A 5A4QA 2VWZA 2BUJA 2UVXA 2WEIA 3HL7A 3LZBA 4JQ8A 3TKUA 5L8LA 4G5PA 2VTAA 4AT3A 4C58A 5E1SA 3ZRKA 4F7LA 5M08A 3PIZA 1WBWA 4N6YA 3UYTA 2FA2A 5H2UA 3D5UA 2QKWB 3D7TB 4E1ZA 3VAPA 4TNBA 3QFVA 4XG8A 4E6AA 3QCXA 3QGWA 2R3HA 5IH4A 4AF3A 1XMLA 4O83A 3HKOA 3QX2A 4L8MA 2W4KA 1FMKA 2PVKA 4I41A 1XWSA 2PL0A 2YACA 1YXTA 4J7BA 4G6LA 2WU7A 3V5TA 4AGCA 4C3PA 4E3CA 3NNUA 4KIOA 1AGWA 3D15A 4C38A 4DEIA 3AD5A 4JG7A 3QC4A 4IW0A 4FTAA 4MX9A 4O0VA 4YO4A 5J1VA 3F2RA 3AKKA 4DT9A 3ORMA 5M57A 5EHLA 3PUFC 3N51A 3U8WA 4S2ZA 3HUBA 3A61A 4JQ7A 2OJ9A 3HYHA 3Q9YA 4XEYA 3UO4A 4C36A 4A9RA 2P2HA 5JEBA 4PDSA 4D1ZA 1R0PA 2FB8A 4FTOA 2W5AA 5D9HA 3HMPA 3P79A 3TZMA 4F0FA 4Q9ZA 4FX3A 4GT4A 3BHHA 4QMVA 3ORIA 4XV9A 3KXGA 4BICA 1CTPE 3CIKA 4QMWA 1OIRA 3FHIA 1MP8A 3SG9A 4FK3A 5D10A 2FH9A 3LMGA 4X2KA 4YMJA 2CLQA 3NUUA 5HHWA 2WU6A 2JIIA 4BJJB 3JPVA 3GFWA 2OFVA 4O0WA 1OMWA 4IWDA 4RX5A 3LIJA 3O7LD 4G3FA 5DT3A 4IVDA 3QA0A 3BEAA 4PV0A 1ZRZA 4EBVA 4YUQA 5D12A 4EOMA 2R3IA 2JD5A 2WQNA 2XJ2A 3HMOA 3O8UA 4ID7A 3BPRA 3FMKA 4RFMA 3HAMA 1WFCA 2B53A 4FKGA 2IZSA 2V7AA 4M12A 3Q52A 4HGLA 3W8QA 3DA6A 3ZXTA 4O7WA 4I1ZA 3WF8A 4AW5A 1XO2B 4FV6A 5GJFA 5FXSA 2W1EA 2YDIA 3A8XA 2XALA 3MWUA 3OP5A 1OL6A 3COKA 4QMYA 3VBQA 4OTPA 3IPHA 4M8TA 3WOWA 4BKZA 4B8LA 5CLPA 2A2AA 3IKAA 1ZYCA 3JYAA 5HBJA 5FD2A 2VWXA 3FI8A 3DCVA 2PWLA 5LMBA 5ANJA 4RIXB 3UG1A 3KXHA 4Z16A 1BKXA 2F7ZE 4HYHA 5HG7A 2PUPA 4FG9A 4RG0A 4QMXA 1W82A 4C59A 2PE2A 2GS7A 3D7TA 1FVVA 4TYHA 3BHVA 3W8LA 5CF5A 4DHIB 2ITXA 4M69A 4RIOA 3FLYA 3D83A 4ASXA 1V0OA 3GC7A 4UN0C 5L2SA 2FSLX 3NYXA 4RIWB 3RPYA 4PPCA 5EM8A 2ERZE 3OWKA 1FPUA 2E9NA 5TO8A 1FVTA 4J98A 3W0RA 2C3JA 3BE2A 2J0IA 5DI1A 3EN5A 2Y4PA 3ERKA 1XBAA 4MAOA 4TNDA 5T6KA 4PMTA 5JGAA 3IW7A 3LCDA 2QOQA 4HVHA 2A27A 2YCFA 5BNJA 4M67A 2GFCA 3QGYA 4ZJIA 4DGLC 5IH5A 3QRTA 4U79A 4IAKA 3NLBA 3MN3A 3CJFA 4RWKA 3PJCA 3HA6A 3NDMA 1ZY4A 2VTRA 4U45A 2UZDA 3OW3A 4IMYA 3SD0A 3RK9A 4U8ZA 2WTKC 3KRLA 1FBNA 3KGAA 5FEDA 5HO6A 4OTIA 4TRLA 3SC1A 3W18A 4AT5A 1GZKA 4CRSA 5CQUA 3W2SA 4NW6A 4BTJA 4ZLOA 3U54A 1J1BA 2GS2A 3KULA 3A2CA 2R3MA 3NIEA 4GYGA 5AIRA 5D11A 3BI6A 2HW6A 4FYOA 4AT4A 3W1FA 4F1TA 2JDTA 2X4ZA 3GC8A 1SNXA 1QPEA 4FKOA 1YDRE 4QNYA 2O8YA 2WGJA 2XNBA 5I9XA 4FSWA 3V8WA 1QPDA 1WMKA 2QR7A 2VWVA 3F3VA 3PIXA 4FK6A 4WSYA 4DCAA 1F5QA 5AUUA 3RPSA 3QRJA 3DZQA 2OSCA 3BBWA 2I40A 2WQEA 3W32A 2XK6A 5AP0A 2EVAA 3CQUA 4I0TA 3IW8A 2WMBA 1PJKA 2HENA 5C9CA 3GU5A 4TTHB 3KRXA 3MFUA 3FZTA 5J79A 4X21A 1KE7A 5AP7A 4DGGA 2XIRA 3FKOA 2QOLA 2J2IB 5EYCA 4BI0A 4ZY6A 1IR3A 3FL5A 5CQWA 4XCUA 3Q60A 5M55A 3PP0A 4ZP5A 2E9PA 3DPKA 4AGUA 3BGPA 3I0OA 4WG4A 4C57A 4IHPA 4UALA 4FNXA 3IQ7A 4NW5A 3TKHA 4EH4A 3QTUA 5A4TA 2OZAB 3FEGA 5H9BA 3O50A 2UW6A 4FL2A 1KE8A 4M3QA 4RIXA 4QP1A 1E1XA 3UMXA 4F7NA 3BL7A 1ZOHA 3ODYX 4PNKA 2W06A 2VTHA 5HG5A 2Q0BA 4RVMA 5DEWA 4AAAA 2V7OA 4JG6A 5CALA 2SRCA 4F99A 1JOWB 3OCGA 4EH8A 4RIWA 3OY3A 3RI1A 2NYAA 3I6WA 3P4KA 3ULZA 1VJYA 4ANLA 3AOXA 1M7QA 3VC4A 4AFJA 4FV3A 3DLSA 4OR5A 4XP3A 3MGYA 5CI7A 4KUJA 4K77A 3RALA 2GNJA 4L44A 4AA4A 2PVYA 4CYIA 1GY3A 3R22A 5H8GA 4D4RA 3E62A 4FUXA 3NFGB 3KXXA 3O71A 2W5HA 3BYVA 2O63A 2QO2A 4ANQA 3Q5IA 5DVRA 3P7AA 2YCSA 1TQIA 4LV8A 4AW1A 4FZ7A 3FXXA 2X9EA 2QHNA 3BBTB 3C0HA 5EW8A 3R2BA 5FWKK 4BTKA 3FLWA 4EJNA 3PLSA 5KMOA 4APCA 3DKOA 3MB7A 2ZM4A 4ZSGA 3EOCA 2R2PA 3VQHA 3DQWA 4FV7A 5J9YA 4XLVA 5KMIA 4ORKA 4BZOA 2YDJA 5FXRA 4RGJA 4QNAA 3IG7A 4IH8A 3OY1A 3EKKA 5JZNA 5JMSA 4YTIA 1WAKA 1XQZA 4Y83A 4APPA 4HGTA 4ZLYA 3WYXA 5BVDA 4FSMA 3ZBFA 4ACDA 4LOQA 4DH1A 3WZUA 5GNKA 4KS7A 2HK5A 1PHKA 4MD7E 2ZV9A 4UMRA 3HP5A 4LL0A 3ELJA 2CCHA 2NO3A 3H30A 3Q53A 3BRBA 4D0WA 4GCJA 4E8AA 5CEOA 2J9MA 3AC3A 4RWIA 4HPUE 4MNFA 4Y8DA 4UMTA 3ORZA 4MQ2A 5E4HA 4RMZA 3ZO4A 3PSBA 4PQNA 2YIWA 4ZTSA 5HESA 3MA6A 3QCYA 1MRVA 5AJQA 4MD9E 2Z02A 3SW4A 3OTVA 3BU6A 5TF9A 4NT4A 2E2BA 5E8VA 3Q3BA 5HICA 2UZNA 3VBWA 4USEA 2Z7QA 5M53A 3R63A 3IW5A 4G9RA 4QP3A 2WMWA 4JBQA 3F5UA 5ACKA 3PUPA 2WPAA 3ORKA 3TV6A 3E8CA 4KABA 2JKMA 2HOGA 4W4WA 2VUWA 4Y95A 4FKSA 4FSNA 4FF8A 3A99A 3BV2A 3PLAE 2OLCA 3AMYA 1YHSA 3RNYA 5IQCA 4OTFA 3NR9A 3B8QA 3TNWA 4BRXA 4CKRA 3SG8A 1H00A 2C6DA 1M17A 4RWLA 1FVRA 3QQJA 1OIQA 3UIBA 4FKRA 1KV2A 2BAQA 4C61A 2PVHA 2PZYA 3KL8A 1YWRA 2C0IA 2GFSA 4UWBA 5IUIA 4C4HA 1NVQA 5KBRA 2C68A 3QQKA 3QQHA 4I5PA 4KINA 3I0QA 1ZXEA 2ONLC 3I5ZA 2Y8OA 2OJJA 3C0GA 3C4ZA 2P3GX 3EFJA 2CLXA 3QL8A 4E5AX 2R64A 4AP7A 1OM1A 3OCTA 5GHVA 2Q0NA 3PXKA 3W55A 3DAEA 3MA3A 2V55A 3G51A 2WMTA 3QTIA 5IISA 4O82A 3QC9A 4FGBA 5B0XA 4B7TA 4NU1A 2I7QA 3RNIA 2UW5A 1QCFA 4I21A 2C5NA 4XLIA 1JLUE 1V1KA 2VN9A 2YM7A 4QMNA 3CPCA 3TNHA 5JFWA 2WMRA 3KY2A 5KX8A 2W5BA 2Z8CA 1SM2A 3WF7A 4EH5A 4NJDA 4A9SA 5EYDA 5BYZA 4C7TA 2UV2A 3SGCA 1M52A 4JAIA 3FLZA 2HZIA 3I60A 4YLJA 4ERWA 4DH8A 4PX6A 2ZVAA 2BZIB 3D9VA 4EHZA 2PMLX 3BLAA 5GJDA 3TV4A 3PVUA 4O38A 5CVHA 2UZLA 1P14A 2UZTA 3QQFA 2WXVA 4GV1A 4XS2A 3ZLXA 4MXYA 4CG9A 2IN6A 3MB6A 1OUKA 5AX9A 3R8PA 4AZWA 4I3ZA 1ATPE 1U5RA 5AR5A 3W33A 2PULA 3B2TA 2I0YA 3QTQA