4YTMB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-biphenyl-3-yl-2-(trifluoromethyl)benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
250
structure length
250
Chain Sequence
b'KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ytmB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ytmB01
2Y5CA 3HUIA 4IDIA 3AMZA 1TYGB 4ITKA 4YTMB 1JWBD 2WP9B 3NRZA 3DWMA 3W9CB 2G1EA 3W5UB 2ACZB 3AE1B 1JRPA 1KRHA 3AE4B 3AEAB 3CF4A 1CJEA 1XLPA 1QOGA 1YJJA 3P4QB 2M19A 3ETRA 3AE7B 3EUB2 1KFYB 3NVYA 3AE3B 1XLOA 4WQMA 3AE9B 2WDRB 1JALA 1T3QA 2L83A 3VRBB 1KF6B 1JW9D 1E10A 1FM0D 1QOFA 1I7HA 1DOIA 2PKOA 1ZUD2 4N6EB 1XLQA 1NYQA 3AEEB 2WDQB 1L6VA 2KAJA 3AEBB 3AEGB 3NVVA 1N60A 3B2FA 2KMMA 2Q5WD 2DWQA 1TKGA 2WQYB 1ZXIA 2JX5A 3AN1A 2E3TA 4WWMA 3AE2B 1VJKA 2HTME 1PUTA 2MH7A 1FRRA 4YTNB 4C80A 1ZOYB 1PFDA 1OFFA 2WLBA 1FIQA 3AE6B 1NI3A 2LEKA 1UWMA 2K22A 5AUIA 1RYJA 1IUEA 2L52A 4ZHPA 3RPFC 3LXFA 1DOXA 3VR8B 2BS3B 3P1MA 1QF6A 5C2TB 1J7CA 1WRIA 5GXGB 2CU3A 1PDXA 3AEFB 4US9A 4USAA 3ABVB 3VR9B 1GTEA 1FFVA 3P4SB 1WYGA 5EE9A 1FRDA 4ZHOA 4YSXB 1H7XA 1DGJA 2CJNA 2H88B 2N0SB 1H7WA 2BT6A 1NVID 3DWGC 3SFDB 1RFKA 1FMAD 2CJOA 3CWIA 5EE1A 1WXQA 1E0ZA 4LTUA 1GPXA 1CZPA 3NS1A 5AUKA 3AM9A 2K9XA 5H92C 4N59A 3SR6A 4C7YA 2WU5B 1QOBA 1SF0A 1A70A 2W3SA 3FC4A 2MJDA 2PVGC 1N62A 3NVWA 3AV8A 4YTPB 1V97A 1L0VB 1N5XA 1ROEA 3HRDD 1NEKB 4YXDB 1FXAA 1AWDA 3NVZA 2M56B 1GTHA 1E6EB 3W5VB 1QOAA 4YSYB 1FO4A 1YQ3B 1J7BA 1OQRA 1RWSA 2OHFA 4ZOHC 1GT8A 2DBYA 1VLBA 1YJIA 1ZP0B 1EWYC 5EE3A 1JROA 2MJEA 3AEDB 1SIJA 4N58A 2BS4B 1FFUA 3AE8B 1FXIA 4HRSA 1WGKA 1DOYA 1NYRA 4KX6B 1SB3C 2WS3B 4A9AA 4YSZB 1WWTA 3L4PA 2WDVB 2JQRB 4US8A 3WCQA 5G5HA 2PIAA 1OQQA 3SFEB 4JX1C 1F0ZA 1N5WA 2K5PA 2B76B 1AYFA 1TKEA 5G5GA 1TJEA 4C7ZA 5C3JB 3AH7A 1NENB 4P6VF 3AECB 1R7SA 2H89B 4HROA 3AB5A 3P4PB 4YT0B 1TKYA 1J7AA 3P4RB 1N61A 3B2GA 1E7PB 2WU2B 2FBWB 3VRAB 1RM6C 2QIEB 3KWLA 3LB8C 1B9RA 3FAHA 1JWAD 3B9JA 4FXCA 5EE0A 3HVZA 1L5PA 3ZYYX 5MPOA 2PVOD 1N63A 1L6UA 1QLBB 3P63A 2W55A 2MJ3A 1E9MA 4JWSC 5H8YE 2EKIA 3AE5B 1XLNA 2BS2B 1QT9A 3PO0A 2QJLA 1GAQB 2AX5A 1JQ4A 3BIID 1VDVA 4JWUC 3CIRB 1YQ4B 1XO3A 2W3RA 1V8CA 2W54A
chains in the Genus database with same CATH superfamily
3ZJUA 4EZLA 3AMZA 4AOFA 5I4DA 2LWPA 2VRRB 2WP9B 1KM7A 3PTFC 3N20C 3BYYB 2CHWA 3DDCB 2KC1A 2D5GA 4A90A 4S0RA 2NCNA 4K3CA 4ZYSA 1EF5A 1I7HA 2BVCA 3IBEA 4OHJA 4RCOA 3VFKA 2O6VD 5IO9A 4ICVA 2KJRA 4WIPA 1WGHA 3ML9A 2IGGA 5IOIA 3ZQ4A 2CS4A 2KXJA 4BKTA 4NJ6A 1V2YA 4FJZA 2BS3B 2KDEB 2O2VA 1FFVA 2K8HA 4HDOA 2MW5A 5D2MB 5IP4D 1MFWA 2GBMA 3DBHI 2M1MA 4DBGA 3NS1A 3URYA 1TY2A 2DZJA 1S3SG 4LK0M 1N62A 1WMHB 3PZ8A 4GMVA 4ARIA 2M4NA 2KDBA 1QOAA 1FO4A 1OQRA 1F9JA 2DBYA 2KTRB 2TSSA 2KVRA 2LGIA 1ZP0B 1EWYC 2R2OA 4NNJB 5EDSA 3CMMB 4E74A 1X1MA 1SJHD 4O1NA 3V6CB 1LQBA 1NENB 1ZGUB 3WIMA 2E6XA 2FNJB 2IO1B 2NPTA 4M0WB 3SU8X 2L3ZA 4RF0A 1E9MA 2N7JA 2R61A 3QAQA 1QT9A 1JQ4A 1WIAA 2GBJA 1XO3A 2J7QB 3HUIA 4MSQB 2SEBD 2HE7A 2ON8A 3U8ZA 2ACZB 4S17A 3ETRA 5AZGA 4HCNB 5E6JA 3AE3B 2KQ7A 2D2QA 3V3XA 2QMTA 5BYRA 1M94A 2HTHA 1H8CA 1WX9A 1WZ3A 1AARA 3WANA 4B9KA 2E3TA 2JXTA 3EC8A 4Q2JA 1FRRA 2N7EA 1VZ7A 3N1XC 1LM8B 2QEJC 1CQVA 1R4MI 1WYGA 1DGJA 5CHFA 4MJSA 3AM9A 2K9XA 1F2RC 3ZXVA 5JHAA 3APDA 3AV8A 4YTPB 3U4EG 2K6DB 2M56B 2R2QA 4HCPB 2BKRB 1MPEA 2I38A 4KGTA 5KHOA 2GBKA 1YQBA 4B95A 4TUUA 3TEWA 2WXHA 1DOYA 4IM0A 2JU6X 1LGRA 3RT3B 1HEZE 2KT7A 5TSSA 2O2VB 4AUQC 4P6VF 3QQ8B 2D3BA 2D3CA 1RM6C 3ZNGC 2DZKA 2K3UA 2VZKD 3AXCA 1T0YA 4DDGD 1YX6B 5BYSA 2BW2A 4IM2A 4L1BA 1SE9A 2WXQA 2MWSB 1PYWD 4AP4C 4JLCA 4YTMB 2IDYA 1ET9A 4II2B 1IP9A 5CHVC 1KF6B 2AEHA 2L32A 2V3SA 3P2BA 2J53A 4TMAB 3I9V1 3DHIC 2FAZA 3DVGY 3NY5A 3MC8A 2Q5WD 2Y3AA 2NPTB 1L2NA 2DNFA 5JHBA 5CHWA 2BB5A 1OGWA 1NI3A 4BKSA 4HEA1 2L52A 1WGRA 3RPFC 3PZDA 4CHKA 2ONQA 5KHQA 5AZFA 1KLGD 2JY6A 1C77A 3KW5B 1PDXA 2V4LA 4KZCA 2X8XX 4RM9A 5AUIA 4FHJA 3A4SC 1E0ZA 4J3OD 1FCCC 3L0WB 3OG5A 4OVVA 3Q8CA 4A20A 2W3SA 2MJDA 2ZCBA 1L0VB 4W9DA 1XD3B 3APFA 1GG3A 1TT5B 2BBCA 1PQSA 5C1ZA 1T0QC 2LHDA 3AULA 1VLBA 3U7ZA 4C4VA 3E56A 1E8ZA 2MBHA 1NYRA 3IVFA 2WDVB 4EOYA 5G5HA 3RD2A 2M17A 2ZNVC 4C7ZA 1M4VA 4AJYB 3DBRB 3PS6A 4EZJA 3DBLB 4DXGA 4FHKA 4JE3B 4MJSB 2KACA 5BYQA 3KWLA 3LB8C 3KUZA 3FAHA 1WI0A 2KZRA 3P63A 2J4XA 4HPMB 4LNFA 4FADA 1OEYA 4EEWA 1P0RA 1KOTA 1Q0WB 2LGYA 3GE3C 4OVZA 2LRUA 3NOBA 2WXIA 4W9FA 3H9DA 5LLIA 2IJ0A 2LXAA 1ZDVA 2MHJA 3R8BA 2KAJA 1N60A 3WAMA 2EELA 3R2TA 2I2YA 2ZVNA 1P9DU 3BYTB 2RDBC 2AQ3B 3QA8A 3EFCA 2KJHB 2WXRA 4FULA 4ZHPA 1IGCA 1QF6A 3EHVA 4MGIE 2KQ4X 4USAA 4RGNA 2LASA 5CTRC 1ZPSA 4W9KA 4BBNF 3DVGX 3PZ7A 5EE1A 4NY0A 1V5OA 5AUKA 2KLCA 5J17A 2KN4A 2KDMA 5HKHA 3NVWA 2WX0A 3KYCD 4ZRKA 1MVKA 4BVUC 3KVFB 2OJWA 1YQ3B 1J7BA 4XGAB 1GT8A 2L0TA 4DWFA 2K8CA 2XN9C 2BYVE 3AE8B 2OOBB 2J0KA 2L8JA 3DOWA 5HHDG 1C3TA 2N4FA 3ZO5B 4URKA 1V81A 4KVGB 3P42A 2BQQA 4WAAA 1LXDA 2SAKA 3AB5A 4YT0B 2Z59B 3K9PB 1GOZA 1EO6A 2QIEB 1V1PA 1B9RA 2JVCA 2LXCA 1JWAD 3B9JA 5D6JB 3ZKJC 4I6PA 1P3QU 3PRMB 2PVOD 2DYBA 1HQRD 2HDEA 2JWUA 3A9KA 2DAJA 1TS2A 3SEBA 3MHSD 3RNGC 1I4PA 4OZAA 3QWZB 2W3RA 2Y5CA 3R2IA 3GE8C 4XX5A 4EZKA 5DPWA 2DAFA 1CJEA 1XLPA 2V1YA 3L10B 1SSNA 3EGRA 1GB1A 3IXSA 4MGYE 3X0WA 1I42A 2NR2A 2EMTA 1QOFA 5HI1A 3RYTA 3A33B 4HDQA 2L05A 2PMVA 4LNNA 1FNWA 2FUHB 2IZVB 4YTNB 1ZOYB 3TUOA 4B0EA 1UWMA 2XNAC 2KX0A 1STEA 2K1FA 3H1UA 3HK0A 4WH4A 4IM3A 4RNAA 3ABVB 3TEXA 3CWIA 1FMAD 1T0RC 4K81A 3DCGA 4PS7A 4MSMB 3T9LA 4GSWA 1RAXA 1N5XA 5DPRA 1YD8U 4TQ0A 4TV3A 2RMMA 3ZTCA 1JCKB 2W82A 3WA0A 1WM3A 2PEAA 1WXAA 4KX6B 3APCA 3R7QA 3PT2B 4YSZB 4HLEA 3L4PA 3IAM1 2JQRB 1JWUD 3VH4B 2WXGA 2KWVB 1F2RI 3VVWB 4GOCA 1GNUA 3KWVA 4L2YA 4MH8A 4MDKE 4XWWA 3H7PA 1N63A 1R4NI 2RDHA 2MP2B 1Z5SB 4A8XC 4RGMA 3CIRB 4DDID 3L16A 2MBQA 1MG8A 2GBNA 4FN2A 4HPLB 3W9CB 3AE1B 2AX5A 1KRHA 3BVZA 3P4QB 1KTKA 4WQMA 3NVYA 4K1RB 1XLOA 2FIFA 4ANVA 1QQRA 2KHWB 2L83A 2N7DA 1KJTA 4PS3A 3AEEB 2DLBA 1V1PB 2V4IB 1ZXIA 2V3PA 3JW0X 2KTFA 4E71A 1TS3A 4TKNA 1PFDA 3A9KB 4IWPA 2PJHA 3C8YA 4GDLA 4H2AA 3FILA 2RR9A 1C78A 3VTWA 1UGMA 1HA5A 1FXTB 1IGDA 1D4BA 1EF1A 2CJNA 2H88B 3L08A 1WGDA 3ZGZA 1SXTA 2CJOA 2WXMA 5TR5A 4NQLB 1K52A 5H92C 3OJ4B 2IGHA 2LUMA 1D5ZC 4FJYA 1PGXA 4EE2A 2ZVOA 3DBSA 2JZPA 1AW7A 2FCMA 2K39A 1RWSA 3T3NA 4IW0A 3LDZE 1SE3A 2NS5A 3AEDB 2BS4B 3RMKC 1WGKA 1BMLC 1RLFA 2WYQA 1F0ZA 4W9HA 4II3B 3HM3A 2PE9A 1B1ZA 1JMLA 3B0AA 2H89B 3Q8BA 5T8IA 1E7PB 2LJIA 1WH3A 1K50A 4WWOA 1E90A 3H8HA 3BIID 3VUXA 4WQOB 3LJ3A 3ZUNA 2INPE 2KNBA 3RULA 3PREA 4LDTB 2GI9A 5G2NA 3CF4A 3ZRFA 1HTOA 1NBFC 3ML8A 2HJ8A 1YN4A 1WR1A 3H7SA 2MA9B 2INDC 2IPKD 2PKOA 3HM6X 1TTNA 1TY0A 3MHZA 3Q8FA 4W9JA 2HJ1A 2NTSA 3TSSA 2JX5A 2PLPA 4ANXA 4HVBA 4KSLC 3VAWA 4ARCA 1OFFA 2IBIB 1ACCA 1RYJA 2KC2A 4OZCA 4IWOA 2EKEC 2GMIC 5C2TB 2LZ6A 3A9JA 4DK5A 4ZHOA 3A1QB 1KH0A 3VDZA 2QSDA 4RFBA 2IY1B 1CZPA 3SR6A 4ICUA 4IC7B 4YL8A 1VD2A 1AWDA 2LI5A 4ZRPA 3GZNI 1YJIA 4GDLB 3T8MA 2WS3B 3FILB 5LXHA 3RNCC 3IG3A 1SGHA 2C5LC 1J7AA 4JPSA 1N61A 2JYTA 1K51A 3Q3OC 3N9YC 1IPGA 1N6ZA 5E6NA 3ZNZB 1EU4A 3W1SC 5L83A 5E6OA 2AQ2B 4XZ4A 3AE5B 3PO0A 1GAQB 5D94A 1D5XC 1V5TA 1C4PA 2UYZB 1UWXA 3EFUA 4F7ZA 1TS5A 1XEEA 2AL6A 3NRZA 3AEAB 3EUB2 1D5MC 1WE6A 3AE7B 1KFYB 1GUAB 5AEKB 4HJKA 4BKGA 2KOXA 3BY4B 1WE7A 3NHEB 4E3CA 4EKUA 1L6VA 1E7VA 3AEBB 3NVVA 1HTQA 2GRIA 3AE2B 4TSSA 4KKJA 1RRBA 1FNVA 1H4RA 1YNTE 4M8MA 3WAPA 3KH0A 3UQAA 3A4RA 3LXFA 4GN1A 3NUHB 4K7WA 1J7CA 3EA6A 3B1LX 4US9A 1Q1OA 3VR9B 2DZIA 4YSXB 3DWGC 2KO3A 1OTRB 1RFAA 3ZNHB 2AYOB 4HKQA 1XQQA 2KFKA 2FCNA 2D3GA 3GP7A 5GMVA 5FKAC 4KSKC 2O6VA 1I4GA 2KQSA 2IGDA 4IKGA 1HE8A 1TS4A 4YSYB 4REZA 2QC8A 2C60A 3OJ3A 1I4HA 1SIJA 3V60A 3ZDMC 2FCSA 3A9JB 2ZCCA 2MEKA 2PIAA 4R3DA 2A5UA 3DBHB 2MLBA 4ASWC 5JH5C 2NBVB 4MGKE 5C3JB 3Q6BA 2D11A 3P4RB 3VTUA 3VRAB 2FBWB 4AQ7A 1L0XB 1J0GA 4BAXA 1ISNA 2JRIB 3ZVVA 2GOWA 3QK0A 3AN1A 5J2RA 4IDIA 5JXVA 1ZKHA 5DCNA 4LDTD 3MFGA 4AS1A 2GLSA 2ZNVB 4RF1A 1XCQL 2WDRB 2IO2B 1E10A 1OQYA 4JQWC 1XLQA 3TEZA 5LXIB 2KMMA 3PLVA 1TKGA 1L7YA 3Q3JA 2ZW1A 4RM8A 4WAFA 2REXA 4F1SA 2K22A 3ENEA 1WYWB 2W9NA 3L17A 4IG7B 2CU3A 2K0PA 2C7NB 1TZ1A 4CYEA 2BYEA 2PPHA 4A3PA 3SFDB 1FD6A 4JIOU 1HZ6A 4W9IA 2K6QA 1A70A 2RPQA 2PVGC 2ICIA 2KJ6A 2CU1A 1IBXA 3N30A 3GB1A 1GTHA 2J0MA 3QX1A 4WJPA 1WX7A 2M0XA 4ZOHC 3Q3MC 1HXYD 1FCLA 1VZ8A 2J42A 3GZNB 3OAWA 2ZW0A 1DYQA 3RNBC 4HRSA 3C0RB 3UF8A 4XC2A 3AU4A 1R4MB 4KZ0A 4UDUC 4US8A 3L13A 1V49A 2D3AA 1R7SA 2G9HD 4KIKA 2QHOA 1E7UA 2KFKB 4FJVB 4PYUA 2G4DB 3NZ3A 4C56C 1LFDA 2W55A 2MJ3A 3VH3B 1UH6A 2ZEQA 3JSVA 3Q3NC 1HZ5A 1YQ4B 1WF9A 1V6EA 3FKYA 5BO4B 2EMSA 2NBUA 4GDKA 3AU5A 3W5UB 5FR6A 4EUTA 4P16A 5G55A 4P1BC 3Q69A 2V0GA 1E8YA 5IN7A 1DOIA 1SE2A 1EM7A 3RN9C 4RMAA 5DPSA 1VCBA 2RPVA 4LJOB 4ZRQA 3RNFC 2KD0A 2KWUB 4OZBA 1ESFA 1PGAA 2MH7A 4C4VB 2C9WB 3DHHC 4IWQA 4B0MA 3MP9A 3DHGC 1WRIA 2MX2A 3JVZX 2JRHA 1MG4A 1E5WA 2WWZA 3ZXRA 4FBJB 4GLSC 3RI7C 1H7XA 3ZDTA 4GB9A 4XDCA 4GIVA 2CR5A 3L54A 2KDFB 3M95A 3FC4A 1A5RA 5C23A 1V97A 3NJTA 1FXAA 1YX5B 2WXKA 4AJWA 4WJQA 1FFUA 1BXTA 3BWUD 1SB3C 1WWTA 1Y56A 1GC7A 1NDDA 2K5PA 3EECA 1P7EA 3HIZA 3W1YA 1TJEA 4MM3A 1C79A 1L4DB 2G3QB 2WNMA 2N9XA 4XDDA 3ZRCA 3DVNV 3PSEB 1I4QA 1Q5WB 4FXCA 5EE0A 3ZYYX 5MPOA 4DXAB 1IBXB 3UGBB 1WMHA 3HVDA 2YEPB 2KX3A 1BT0A 3E9SA 1V8CA 1TYGB 2M0AA 1UBIA 1J19A 3ZJTA 3DWMA 1YN5A 1JRPA 1YMHE 4WWMA 1MI0A 3VUYA 2L76A 4DQOC 3VRBB 3MC9A 1CK1A 1UUPA 2NMQA 4KIKB 4HWIB 3ZIMA 4KDIC 2WDQB 2XEWA 3AEGB 2ASQA 1SE4A 5IKCM 2BKFA 1VJKA 3OLMD 2WXNA 1WR6E 4BBNC 4HPPA 5LNK1 2KMAA 3VQIA 2NVUI 3AE6B 2LJ5A 3PHWB 3X23A 3JSVB 1V9JA 2I1KA 1U4AA 1WX8A 2FIDA 2BYTA 1UELA 1LO5D 1KLUD 1GB4A 2N9KA 2D10A 3VXWA 1V86A 2WXLA 3M62B 2BGFA 3U2SC 1WJ6A 4C7YA 2BB6A 4ACFA 5IAAC 3ECIA 1YN3A 3OWEB 3UI3A 4XE0A 2GB1A 3NVZA 3D32A 3W5VB 4F8CB 1WXSA 2WDTB 2MJEA 2KVZA 4WWPA 3TMPB 2QILA 4MGZE 1FEHA 1G6JA 2FCQA 2WXFA 2JUOA 1T5XD 4LJPB 3AH7A 2Y5BB 4WWNA 3U52E 3ONSA 2K25A 4EFOA 1KLVA 4QAYA 4BOSC 1L5PA 2WX1A 3W1SA 1FNUA 2KK8A 4BKSD 1P1AA 3VTVA 3BINA 1IYFA 4JWUC 1ZXHA 2MSED 4ZRIA 4G50A 4ITKA 2Y5PA 3PGEA 3PHXB 3AE4B 5D3DA 1C9FA 4KGSA 1QOGA 1YIWA 3AE9B 3IT4B 4MM3B 1SJED 1ZUD2 2WXPA 4N6EB 5IA7A 2DENB 1XCTL 3N1ZC 3SHQA 2WQYB 2DYMA 2HTME 1F52A 1V80A 1Z2MA 1PUTA 2JYEA 3CSFA 3PLUA 3V61A 4W9EA 1E8XA 2UWQA 2DX5B 3V62A 1WM2A 4P1CC 3LYYA 4MT5A 1J8CA 5D7GA 4DHZE 1EWCA 3M3JA 3HRDD 5BMGA 2BT6A 1GPXA 2WHIA 1WXQA 3H7PB 3V6EB 3DBRI 4W9GA 2J0JA 3DBLI 4D2KA 4K3BA 4M00A 1SEBD 4YXDB 2D07B 1Y8RC 1E6EB 2XK5A 2VH1A 3IAS1 1QILA 4LNOA 3U30A 1JROA 2KWDA 4N58A 4P7IA 4OVUA 5BMIA 4GXBA 3WCQA 4JX1C 3GS2A 5G5GA 2LHEA 2DHZA 3AECB 1OEYJ 3DVNU 4HROA 1TKYA 5FR3A 2N1VA 2WU2B 3MC0B 2L7RA 2X38A 3KLSX 3O65B 1WGGA 3IHPC 4PYZA 4ZRJA 3Q14C 1MHHE 4X57B 4YWGG 4TQ1A 2AQ1B 2W54A 1E8WA 4BZAA 1C76A 4NJ7A 1C1YB 3C19A 3AI5A 1QKZA 3I57A 1P7FA 5FK9C 1T3QA 1MJDA 3VHTC 2PTLA 1R4NB 4CO7A 4HXDA 4WJNA 4G11A 1SIFA 4ZYNA 2WLBA 5AZHA 1WFYA 1DOXA 2Z0DB 3P1MA 5BMHA 1GJZA 2JXXA 2FE8A 3IFWB 1MHXA 1JWSD 3AEFB 4CQNA 2MRPA 3P4SB 5EE9A 4KV2A 1FRDA 1CMXB 1XXGA 4DHJB 4LTUA 4L23A 3Q2AC 4XWTA 1QOBA 4M01A 2MCNB 2BWFA 4A3OA 1ENFA 2KLGA 3ZNID 1WXMA 3QJZA 1GC6A 1VRAB 2JPHA 3CSTA 2BTEA 1WXVA 2RGFA 2PE6B 1OQQA 2CHZA 2WXOA 1N5WA 2LVQA 2VH2A 3PRPB 4LNIA 2BPSA 2MBOA 2ZZPB 1WJ4A 3N3KB 3QCAA 3CF6E 4HKZE 2B3AA 2JWZA 1L6UA 3U7DA 3BK2A 2XK5B 1WRDB 3UIOB 2BS2B 4BOZB 2QJLA 4DHZB 2PW9A 3PVLA 3QC8B 2INCC 1S1QB 1K8RB 1JWBD 1VR9A 1WJUA 4OW0A 2G1EA 5L95C 1YJJA 4JL9A 1FPYA 4RH6A 4XYCA 1AN8A 4FA6A 1FM0D 3UINB 3Q8EA 1ZE3D 3DPDA 2INNE 2KWCA 3TL5A 2JF5A 3B2FA 3NZSA 2ZJDA 1K53A 1ET6A 1JWMD 2AWTA 4C80A 4RGOS 1NI2A 2CKHB 4PT5A 3KYDD 2LD9A 3VR8B 3BVMA 1I4XA 2WGSA 2QDFA 4J6IA 1GTEA 5J18A 1XF5L 2K8BA 1NVID 1RFKA 3KUCB 3R3MA 3WALA 2NTTA 3ZLZA 2WU5B 3RUIB 1WSPA 3Q3FA 1I35A 1UD7A 4I6NB 3S2AA 3W2DA 2N9PC 2KDIA 1V1OA 3RFZB 4NJCA 4MH0E 4K7UA 3TIXA 1XT9B 2LGSA 1FXIA 4KDLB 2RSUA 2IO0B 2I1JA 2N9EB 3QIJA 2B76B 5JZEB 1TKEA 3H6NA 3T3OA 1VZ6A 2YEPF 3KUDB 1L4ZB 2N1WA 4C00A 3HVZA 4KKIA 2KFJA 2ZPYA 3TJPA 3R66C 4MACA 4JWSC 1YJ1A 3VUWA 1XLNA 4BFRA 1TGZB 3M63B 2KN5A 4FLHA 2IY0B 1JRUA 1I4RA 3MTNB 2IO3B 2JT4B 1BUIC 2M19A 3R7RA 3WAOA 3NG0A 4JGHB 4NAMA 4IUMB 3TEYA 3V05A 1TZOA 2LGDA 2O6VB 3DQVA 3UIPB 1L0YB 3TBLD 4ANWA 2RD0A 2OJRA 5HG2A 1FIQA 2LEKA 2MP2A 3J9CA 1IUEA 4W9LA 2LRWA 2JZ3B 4W9CA 3I63C 1F1HA 3QHTA 2JSVX 2GBRA 5HFYA 2V3NA 3PV1A 1SBBB 1WGYA 4MEMA 3N1YC 4DHJD 2V9HA 4N59A 5D3IB 4M02A 2HD5B 4NQKE 4NAWA 3N32A 2XBBC 1SF0A 1T6BX 3PRZA 2OEDA 1Q10A 2WXJA 2OHFA 2J52A 4A6QA 4N9F4 2UU7A 1UF0A 2LVOA 4PS8A 4GU2A 2LMCA 2KANA 2QCZA 3ZTDA 3RZWC 4NPNA 1AYFA 4WJOA 3SDLC 3HHMA 3I3TB 1ZDXA 3QARA 2MBBB 2IYDB 3NZUA 3MJWA 5E6PA 1ZW7A 1QLBB 4G0NB 4NZLB 2DYOA 1TBEA 1T0SC 3ZW3A 2LFIA 2BYFA 2Z0EB 1VDVA 1UBQA 2MBEA 3BVGA 4RGTA 4ZDVA 2FUG1 3ALBA 4IOIE 5DPTA 2L1AA 5GXGB 3TCAA 1JALA 2CHXA 3RCZA 1JW9D 4PK1A 4ANUA 4B6WA 1NYQA 2AL3A 2KMCA 3UQBA 3BZDB 2NBWB 4LNKA 2DWQA 3MJ5A 2Z8LA 2C7MB 1EUVB 2A4ZA 3SD5A 4LCDE 2KTRA 4AWJA 2M8SA 1D3ZA 1PGBA 3NS8A 3IT6B 2L00B 2DZMA 1C4CA 1QZEA 2KYWA 1WZ0A 2N0SB 1H7WA 3RNAC 2BWES 4HJGE 2BF8B 3BK1A 2N9LA 4K7SA 4DXFA 4A55A 1TIFA 4LLGM 2MQJA 4M0WA 4MELA 2C7HA 1UZXB 3KQ4A 3GOEA 1ROEA 2G45B 1NEKB 1F77A 3B08A 4G3XB 3JYUA 1YOVB 3RZFA 5EE3A 5CX3A 4GDKB 1WY8A 1UNSA 4A9AA 2YLMA 1EU3A 3ZJVA 4GGQA 3SFEB 4M8NA 4KGRA 3K9OB 3PPAA 3O13A 2RDGA 3P4PB 1WJNA 3A1QA 2JZZA 3B2GA 1P98A 2KKCA 4NAWB 1D6EC 2L0FA 3RNEC 2LGXA 2VZKB 2LVPA 4HK2A 2G4SA 4WURA 2EKIA 2YVCA 2LUEA 2ZPNA 3I5JC 4I6LB 5H8YE 1C4AA 3Q8AA 1UGJA
chains in the Genus database with same CATH topology
2Y5CA 3R2IA 3ZJUA 4IDIA 5JXVA 3AMZA 5I4DA 1C76A 2WP9B 3MFGA 4AS1A 1QKZA 3I57A 1CJEA 1XLPA 3BYYB 4RF1A 1P7FA 5FK9C 1SSNA 2WDRB 1XCQL 2D5GA 1T3QA 3EGRA 3IXSA 4A90A 1GB1A 1E10A 4ZYSA 1QOFA 1I7HA 5HI1A 4OHJA 4RCOA 1XLQA 2PTLA 3TEZA 4WIPA 2KMMA 1TKGA 2PMVA 2IGGA 3ZQ4A 1FNWA 2ZW1A 4YTNB 1ZOYB 3TUOA 4B0EA 2WLBA 4WAFA 1UWMA 2K22A 1DOXA 2XNAC 1STEA 2BS3B 3P1MA 5BMHA 4WH4A 2FE8A 1MHXA 1JWSD 2CU3A 4RNAA 3AEFB 2K0PA 3ABVB 4CQNA 1FFVA 3P4SB 5EE9A 1FRDA 3TEXA 1XXGA 1C4AA 3SFDB 3CWIA 1FMAD 1FD6A 4LTUA 3NS1A 1HZ6A 4L23A 4XWTA 3URYA 1QOBA 1TY2A 1A70A 4LK0M 2PVGC 1N62A 2ICIA 3PZ8A 1N5XA 1IBXA 4ARIA 1ENFA 3GB1A 1GTHA 1QOAA 4TQ0A 1FO4A 4ZOHC 1OQRA 1HXYD 2DBYA 2RMMA 1FCLA 1VZ8A 2TSSA 2LGIA 1ZP0B 1JCKB 1EWYC 1VRAB 2J42A 2W82A 2ZW0A 1DYQA 2BTEA 4HRSA 4KX6B 4YSZB 3L4PA 3IAM1 2JQRB 1JWUD 4UDUC 4US8A 1OQQA 2WXGA 2WXOA 1N5WA 1SJHD 4O1NA 1F2RI 1NENB 3KWVA 4L2YA 4MH8A 1R7SA 2G9HD 2E6XA 4HKZE 4XWWA 1N63A 3NZ3A 4C56C 1L6UA 2RDHA 2W55A 4RF0A 2MJ3A 1E9MA 2N7JA 3BK2A 2R61A 4A8XC 2BS2B 1QT9A 2QJLA 1JQ4A 2PW9A 4RGMA 3CIRB 1HZ5A 1YQ4B 1XO3A 3HUIA 2SEBD 1JWBD 1VR9A 2ON8A 4OW0A 3W9CB 2G1EA 3W5UB 2ACZB 3AE1B 2AX5A 1KRHA 1YJJA 3ETRA 3BVZA 4RH6A 3P4QB 1KTKA 4P16A 3NVYA 4WQMA 5E6JA 3AE3B 1XLOA 1QQRA 2L83A 3Q69A 1AN8A 1FM0D 2V0GA 3V3XA 1DOIA 2QMTA 1SE2A 3Q8EA 5BYRA 1EM7A 1ZE3D 3AEEB 2DLBA 2INNE 1V1PB 2V4IB 3B2FA 2RPVA 1ZXIA 4ZRQA 2E3TA 2V3PA 1K53A 1ET6A 1TS3A 1JWMD 2JXTA 1ESFA 4OZBA 1PGAA 2MH7A 4Q2JA 1FRRA 4C80A 1PFDA 4RGOS 4PT5A 1VZ7A 4B0MA 3C8YA 3MP9A 3VR8B 4H2AA 3FILA 3BVMA 1C78A 1WRIA 1I4XA 2QEJC 1HA5A 1CQVA 1GTEA 1IGDA 1WYGA 1D4BA 4GLSC 1H7XA 1DGJA 1XF5L 2CJNA 2H88B 4XDCA 1NVID 3ZGZA 1RFKA 1SXTA 2CJOA 2WXMA 2NTTA 1K52A 3AM9A 2K9XA 5H92C 1F2RC 2WU5B 2IGHA 2LUMA 1D5ZC 1WSPA 3FC4A 1PGXA 4EE2A 3AV8A 4YTPB 3U4EG 1V97A 1FXAA 2M56B 2JZPA 1AW7A 3W2DA 1RWSA 3T3NA 2WXKA 1MPEA 1V1OA 2I38A 1SE3A 3RFZB 4KGTA 4NJCA 3AEDB 3TEWA 2BS4B 1FFUA 1FXIA 1WGKA 1BXTA 2WXHA 3BWUD 1DOYA 1SB3C 2JU6X 1WWTA 1BMLC 1Y56A 1HEZE 1F0ZA 2K5PA 5TSSA 2B76B 1P7EA 1TKEA 1TJEA 1C79A 1B1ZA 1L4DB 4P6VF 1JMLA 2WNMA 4TQ1A 2H89B 3Q8BA 4XDDA 1VZ6A 2YEPF 3T3OA 5T8IA 1L4ZB 1E7PB 2LJIA 1RM6C 1I4QA 4FXCA 5EE0A 3HVZA 2K3UA 4KKIA 3ZYYX 5MPOA 2VZKD 1K50A 4MACA 1IBXB 4JWSC 5BYSA 2BW2A 1XLNA 4L1BA 3HVDA 3H8HA 2YEPB 3BIID 2WXQA 3E9SA 1V8CA 1PYWD 2INPE 1TYGB 2M0AA 1I4RA 3ZJTA 2GI9A 4YTMB 3DWMA 1BUIC 1JRPA 1YN5A 3CF4A 1YMHE 2M19A 4WWMA 2IDYA 1MI0A 1YN4A 1ET9A 4DQOC 4NAMA 3VRBB 1KF6B 2L32A 2IPKD 3TEYA 1CK1A 2PKOA 1UUPA 1TZOA 2NMQA 3V05A 2J53A 4TMAB 3I9V1 1TY0A 2WDQB 3MHZA 3AEGB 3Q8FA 1SE4A 1L0YB 2Q5WD 2Y3AA 2NTSA 3TSSA 2JX5A 2PLPA 1VJKA 5HG2A 2WXNA 2BB5A 4ARCA 1OFFA 5LNK1 3VQIA 1FIQA 3AE6B 1NI3A 2LEKA 3J9CA 1ACCA 1RYJA 4HEA1 1IUEA 2L52A 4OZCA 3RPFC 2ONQA 5C2TB 1KLGD 2W54A 1C77A 1PDXA 2BYTA 1LO5D 2JSVX 1KLUD 5HFYA 1GB4A 2N9KA 4ZHOA 2V3NA 5AUIA 1KH0A 2WXLA 1SBBB 2QSDA 4J3OD 1FCCC 4RFBA 1E0ZA 1CZPA 3U2SC 3SR6A 4C7YA 2BB6A 4N59A 5D3IB 3Q8CA 1SF0A 2W3SA 1YN3A 2MJDA 1T6BX 3OWEB 1L0VB 3UI3A 4XE0A 1AWDA 2GB1A 3NVZA 4ZRPA 3W5VB 2OEDA 1Q10A 2WXJA 2OHFA 2BBCA 2J52A 2LHDA 1VLBA 1YJIA 3U7ZA 4A6QA 2MJEA 3E56A 4GDLB 1NYRA 2LMCA 2WS3B 3FILB 2QILA 2WDVB 1FEHA 5G5HA 2WXFA 1AYFA 1T5XD 4C7ZA 3AH7A 1M4VA 3U52E 4DXGA 1J7AA 4JE3B 1N61A 2JYTA 4JPSA 1ZDXA 2KACA 5BYQA 1K51A 3KWLA 3LB8C 3FAHA 1L5PA 3N9YC 3W1SA 3P63A 1QLBB 1FNUA 1EU4A 4NZLB 2DYOA 2J4XA 5H8YE 2AQ2B 3AE5B 3PO0A 1GAQB 2LFIA 4JWUC 1VDVA 1ZXHA 1D5XC 3BVGA 4RGTA 1C4PA 4OVZA 4ITKA 2FUG1 1UWXA 2Y5PA 1TS5A 1XEEA 4IOIE 2L1AA 3NRZA 3AE4B 3AEAB 3EUB2 5D3DA 4KGSA 1QOGA 1C9FA 1D5MC 5GXGB 3AE7B 2WXIA 1KFYB 3AE9B 1JALA 3IT4B 1JW9D 4MM3B 1SJED 2IJ0A 1ZDVA 1ZUD2 2WXPA 4N6EB 1NYQA 1XCTL 3R8BA 1L6VA 2KAJA 3AEBB 3NVVA 3BZDB 1N60A 2DWQA 2GRIA 2WQYB 3MJ5A 2DYMA 2Z8LA 2EELA 3AE2B 2HTME 3R2TA 4KKJA 4TSSA 2I2YA 1PUTA 2JYEA 3BYTB 2AQ3B 1FNVA 1YNTE 2WXRA 4ZHPA 1IGCA 3LXFA 3NUHB 1QF6A 1J7CA 3EA6A 1PGBA 2KQ4X 3LYYA 4US9A 3IT6B 4USAA 4MT5A 3VR9B 4RGNA 1C4CA 1ZPSA 5D7GA 4YSXB 1EWCA 3HRDD 2N0SB 1H7WA 2BT6A 3DWGC 5BMGA 3PZ7A 5EE1A 1GPXA 1WXQA 4HJGE 3BK1A 4HKQA 2N9LA 5AUKA 4DXFA 4A55A 2KN4A 4LLGM 2KDMA 3GP7A 4M0WA 4D2KA 5FKAC 3NVWA 3KQ4A 1I4GA 1ROEA 1SEBD 1NEKB 4YXDB 2IGDA 1F77A 1MVKA 1E6EB 4IKGA 1TS4A 4YSYB 1YQ3B 1J7BA 4REZA 1GT8A 3IAS1 1QILA 1I4HA 2XN9C 5EE3A 1JROA 2KWDA 4GDKB 1SIJA 4N58A 3AE8B 1UNSA 4A9AA 5HHDG 5BMIA 1EU3A 3ZJVA 3WCQA 2MEKA 2PIAA 4R3DA 3SFEB 4JX1C 3GS2A 5G5GA 2LHEA 4KGRA 5C3JB 3P42A 3AECB 3O13A 2RDGA 4HROA 2SAKA 3AB5A 3P4PB 4YT0B 1TKYA 5FR3A 1GOZA 3P4RB 3B2GA 2WU2B 2FBWB 3VRAB 1V1PA 2QIEB 4NAWB 3MC0B 1D6EC 4AQ7A 1JWAD 3B9JA 1B9RA 2X38A 2PVOD 2VZKB 1L0XB 3KLSX 4WURA 1HQRD 2EKIA 2HDEA 2JWUA 1TS2A 3SEBA 1MHHE 1I4PA 4YWGG 4OZAA 2AQ1B 2W3RA 3Q8AA 3AN1A 1UGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5C A;  3HUI A;  4IDI A;  3AMZ A;  1TYG B;  4ITK A;  4YTM B;  1JWB D;  2WP9 B;  3NRZ A;  3DWM A;  3W9C B;  2G1E A;  3W5U B;  2ACZ B;  3AE1 B;  1JRP A;  1KRH A;  3AE4 B;  3AEA B;  3CF4 A;  1CJE A;  1XLP A;  1QOG A;  1YJJ A;  3P4Q B;  2M19 A;  3ETR A;  3AE7 B;  3EUB 2;  1KFY B;  3NVY A;  3AE3 B;  1XLO A;  4WQM A;  3AE9 B;  2WDR B;  1JAL A;  1T3Q A;  2L83 A;  3VRB B;  1KF6 B;  1JW9 D;  1E10 A;  1FM0 D;  1QOF A;  1I7H A;  1DOI A;  2PKO A;  1ZUD 2;  4N6E B;  1XLQ A;  1NYQ A;  3AEE B;  2WDQ B;  1L6V A;  2KAJ A;  3AEB B;  3AEG B;  3NVV A;  1N60 A;  3B2F A;  2KMM A;  2Q5W D;  2DWQ A;  1TKG A;  2WQY B;  1ZXI A;  2JX5 A;  3AN1 A;  2E3T A;  4WWM A;  3AE2 B;  1VJK A;  2HTM E;  1PUT A;  2MH7 A;  1FRR A;  4YTN B;  4C80 A;  1ZOY B;  1PFD A;  1OFF A;  2WLB A;  1FIQ A;  3AE6 B;  1NI3 A;  2LEK A;  1UWM A;  2K22 A;  5AUI A;  1RYJ A;  1IUE A;  2L52 A;  4ZHP A;  3RPF C;  3LXF A;  1DOX A;  3VR8 B;  2BS3 B;  3P1M A;  1QF6 A;  5C2T B;  1J7C A;  1WRI A;  5GXG B;  2CU3 A;  1PDX A;  3AEF B;  4US9 A;  4USA A;  3ABV B;  3VR9 B;  1GTE A;  1FFV A;  3P4S B;  1WYG A;  5EE9 A;  1FRD A;  4ZHO A;  4YSX B;  1H7X A;  1DGJ A;  2CJN A;  2H88 B;  2N0S B;  1H7W A;  2BT6 A;  1NVI D;  3DWG C;  3SFD B;  1RFK A;  1FMA D;  2CJO A;  3CWI A;  5EE1 A;  1WXQ A;  1E0Z A;  4LTU A;  1GPX A;  1CZP A;  3NS1 A;  5AUK A;  3AM9 A;  2K9X A;  5H92 C;  4N59 A;  3SR6 A;  4C7Y A;  2WU5 B;  1QOB A;  1SF0 A;  1A70 A;  2W3S A;  3FC4 A;  2MJD A;  2PVG C;  1N62 A;  3NVW A;  3AV8 A;  4YTP B;  1V97 A;  1L0V B;  1N5X A;  1ROE A;  3HRD D;  1NEK B;  4YXD B;  1FXA A;  1AWD A;  3NVZ A;  2M56 B;  1GTH A;  1E6E B;  3W5V B;  1QOA A;  4YSY B;  1FO4 A;  1YQ3 B;  1J7B A;  1OQR A;  1RWS A;  2OHF A;  4ZOH C;  1GT8 A;  2DBY A;  1VLB A;  1YJI A;  1ZP0 B;  1EWY C;  5EE3 A;  1JRO A;  2MJE A;  3AED B;  1SIJ A;  4N58 A;  2BS4 B;  1FFU A;  3AE8 B;  1FXI A;  4HRS A;  1WGK A;  1DOY A;  1NYR A;  4KX6 B;  1SB3 C;  2WS3 B;  4A9A A;  4YSZ B;  1WWT A;  3L4P A;  2WDV B;  2JQR B;  4US8 A;  3WCQ A;  5G5H A;  2PIA A;  1OQQ A;  3SFE B;  4JX1 C;  1F0Z A;  1N5W A;  2K5P A;  2B76 B;  1AYF A;  1TKE A;  5G5G A;  1TJE A;  4C7Z A;  5C3J B;  3AH7 A;  1NEN B;  4P6V F;  3AEC B;  1R7S A;  2H89 B;  4HRO A;  3AB5 A;  3P4P B;  4YT0 B;  1TKY A;  1J7A A;  3P4R B;  1N61 A;  3B2G A;  1E7P B;  2WU2 B;  2FBW B;  3VRA B;  1RM6 C;  2QIE B;  3KWL A;  3LB8 C;  1B9R A;  3FAH A;  1JWA D;  3B9J A;  4FXC A;  5EE0 A;  3HVZ A;  1L5P A;  3ZYY X;  5MPO A;  2PVO D;  1N63 A;  1L6U A;  1QLB B;  3P63 A;  2W55 A;  2MJ3 A;  1E9M A;  4JWS C;  5H8Y E;  2EKI A;  3AE5 B;  1XLN A;  2BS2 B;  1QT9 A;  3PO0 A;  2QJL A;  1GAQ B;  2AX5 A;  1JQ4 A;  3BII D;  1VDV A;  4JWU C;  3CIR B;  1YQ4 B;  1XO3 A;  2W3R A;  1V8C A;  2W54 A; 
#chains in the Genus database with same CATH topology
 3ZJU A;  4EZL A;  3AMZ A;  4AOF A;  5I4D A;  2LWP A;  2VRR B;  2WP9 B;  1KM7 A;  3PTF C;  3N20 C;  3BYY B;  2CHW A;  3DDC B;  2KC1 A;  2D5G A;  4A90 A;  4S0R A;  2NCN A;  4K3C A;  4ZYS A;  1EF5 A;  1I7H A;  2BVC A;  3IBE A;  4OHJ A;  4RCO A;  3VFK A;  2O6V D;  5IO9 A;  4ICV A;  2KJR A;  4WIP A;  1WGH A;  3ML9 A;  2IGG A;  5IOI A;  3ZQ4 A;  2CS4 A;  2KXJ A;  4BKT A;  4NJ6 A;  1V2Y A;  4FJZ A;  2BS3 B;  2KDE B;  2O2V A;  1FFV A;  2K8H A;  4HDO A;  2MW5 A;  5D2M B;  5IP4 D;  1MFW A;  2GBM A;  3DBH I;  2M1M A;  4DBG A;  3NS1 A;  3URY A;  1TY2 A;  2DZJ A;  1S3S G;  4LK0 M;  1N62 A;  1WMH B;  3PZ8 A;  4GMV A;  4ARI A;  2M4N A;  2KDB A;  1QOA A;  1FO4 A;  1OQR A;  1F9J A;  2DBY A;  2KTR B;  2TSS A;  2KVR A;  2LGI A;  1ZP0 B;  1EWY C;  2R2O A;  4NNJ B;  5EDS A;  3CMM B;  4E74 A;  1X1M A;  1SJH D;  4O1N A;  3V6C B;  1LQB A;  1NEN B;  1ZGU B;  3WIM A;  2E6X A;  2FNJ B;  2IO1 B;  2NPT A;  4M0W B;  3SU8 X;  2L3Z A;  4RF0 A;  1E9M A;  2N7J A;  2R61 A;  3QAQ A;  1QT9 A;  1JQ4 A;  1WIA A;  2GBJ A;  1XO3 A;  2J7Q B;  3HUI A;  4MSQ B;  2SEB D;  2HE7 A;  2ON8 A;  3U8Z A;  2ACZ B;  4S17 A;  3ETR A;  5AZG A;  4HCN B;  5E6J A;  3AE3 B;  2KQ7 A;  2D2Q A;  3V3X A;  2QMT A;  5BYR A;  1M94 A;  2HTH A;  1H8C A;  1WX9 A;  1WZ3 A;  1AAR A;  3WAN A;  4B9K A;  2E3T A;  2JXT A;  3EC8 A;  4Q2J A;  1FRR A;  2N7E A;  1VZ7 A;  3N1X C;  1LM8 B;  2QEJ C;  1CQV A;  1R4M I;  1WYG A;  1DGJ A;  5CHF A;  4MJS A;  3AM9 A;  2K9X A;  1F2R C;  3ZXV A;  5JHA A;  3APD A;  3AV8 A;  4YTP B;  3U4E G;  2K6D B;  2M56 B;  2R2Q A;  4HCP B;  2BKR B;  1MPE A;  2I38 A;  4KGT A;  5KHO A;  2GBK A;  1YQB A;  4B95 A;  4TUU A;  3TEW A;  2WXH A;  1DOY A;  4IM0 A;  2JU6 X;  1LGR A;  3RT3 B;  1HEZ E;  2KT7 A;  5TSS A;  2O2V B;  4AUQ C;  4P6V F;  3QQ8 B;  2D3B A;  2D3C A;  1RM6 C;  3ZNG C;  2DZK A;  2K3U A;  2VZK D;  3AXC A;  1T0Y A;  4DDG D;  1YX6 B;  5BYS A;  2BW2 A;  4IM2 A;  4L1B A;  1SE9 A;  2WXQ A;  2MWS B;  1PYW D;  4AP4 C;  4JLC A;  4YTM B;  2IDY A;  1ET9 A;  4II2 B;  1IP9 A;  5CHV C;  1KF6 B;  2AEH A;  2L32 A;  2V3S A;  3P2B A;  2J53 A;  4TMA B;  3I9V 1;  3DHI C;  2FAZ A;  3DVG Y;  3NY5 A;  3MC8 A;  2Q5W D;  2Y3A A;  2NPT B;  1L2N A;  2DNF A;  5JHB A;  5CHW A;  2BB5 A;  1OGW A;  1NI3 A;  4BKS A;  4HEA 1;  2L52 A;  1WGR A;  3RPF C;  3PZD A;  4CHK A;  2ONQ A;  5KHQ A;  5AZF A;  1KLG D;  2JY6 A;  1C77 A;  3KW5 B;  1PDX A;  2V4L A;  4KZC A;  2X8X X;  4RM9 A;  5AUI A;  4FHJ A;  3A4S C;  1E0Z A;  4J3O D;  1FCC C;  3L0W B;  3OG5 A;  4OVV A;  3Q8C A;  4A20 A;  2W3S A;  2MJD A;  2ZCB A;  1L0V B;  4W9D A;  1XD3 B;  3APF A;  1GG3 A;  1TT5 B;  2BBC A;  1PQS A;  5C1Z A;  1T0Q C;  2LHD A;  3AUL A;  1VLB A;  3U7Z A;  4C4V A;  3E56 A;  1E8Z A;  2MBH A;  1NYR A;  3IVF A;  2WDV B;  4EOY A;  5G5H A;  3RD2 A;  2M17 A;  2ZNV C;  4C7Z A;  1M4V A;  4AJY B;  3DBR B;  3PS6 A;  4EZJ A;  3DBL B;  4DXG A;  4FHK A;  4JE3 B;  4MJS B;  2KAC A;  5BYQ A;  3KWL A;  3LB8 C;  3KUZ A;  3FAH A;  1WI0 A;  2KZR A;  3P63 A;  2J4X A;  4HPM B;  4LNF A;  4FAD A;  1OEY A;  4EEW A;  1P0R A;  1KOT A;  1Q0W B;  2LGY A;  3GE3 C;  4OVZ A;  2LRU A;  3NOB A;  2WXI A;  4W9F A;  3H9D A;  5LLI A;  2IJ0 A;  2LXA A;  1ZDV A;  2MHJ A;  3R8B A;  2KAJ A;  1N60 A;  3WAM A;  2EEL A;  3R2T A;  2I2Y A;  2ZVN A;  1P9D U;  3BYT B;  2RDB C;  2AQ3 B;  3QA8 A;  3EFC A;  2KJH B;  2WXR A;  4FUL A;  4ZHP A;  1IGC A;  1QF6 A;  3EHV A;  4MGI E;  2KQ4 X;  4USA A;  4RGN A;  2LAS A;  5CTR C;  1ZPS A;  4W9K A;  4BBN F;  3DVG X;  3PZ7 A;  5EE1 A;  4NY0 A;  1V5O A;  5AUK A;  2KLC A;  5J17 A;  2KN4 A;  2KDM A;  5HKH A;  3NVW A;  2WX0 A;  3KYC D;  4ZRK A;  1MVK A;  4BVU C;  3KVF B;  2OJW A;  1YQ3 B;  1J7B A;  4XGA B;  1GT8 A;  2L0T A;  4DWF A;  2K8C A;  2XN9 C;  2BYV E;  3AE8 B;  2OOB B;  2J0K A;  2L8J A;  3DOW A;  5HHD G;  1C3T A;  2N4F A;  3ZO5 B;  4URK A;  1V81 A;  4KVG B;  3P42 A;  2BQQ A;  4WAA A;  1LXD A;  2SAK A;  3AB5 A;  4YT0 B;  2Z59 B;  3K9P B;  1GOZ A;  1EO6 A;  2QIE B;  1V1P A;  1B9R A;  2JVC A;  2LXC A;  1JWA D;  3B9J A;  5D6J B;  3ZKJ C;  4I6P A;  1P3Q U;  3PRM B;  2PVO D;  2DYB A;  1HQR D;  2HDE A;  2JWU A;  3A9K A;  2DAJ A;  1TS2 A;  3SEB A;  3MHS D;  3RNG C;  1I4P A;  4OZA A;  3QWZ B;  2W3R A;  2Y5C A;  3R2I A;  3GE8 C;  4XX5 A;  4EZK A;  5DPW A;  2DAF A;  1CJE A;  1XLP A;  2V1Y A;  3L10 B;  1SSN A;  3EGR A;  1GB1 A;  3IXS A;  4MGY E;  3X0W A;  1I42 A;  2NR2 A;  2EMT A;  1QOF A;  5HI1 A;  3RYT A;  3A33 B;  4HDQ A;  2L05 A;  2PMV A;  4LNN A;  1FNW A;  2FUH B;  2IZV B;  4YTN B;  1ZOY B;  3TUO A;  4B0E A;  1UWM A;  2XNA C;  2KX0 A;  1STE A;  2K1F A;  3H1U A;  3HK0 A;  4WH4 A;  4IM3 A;  4RNA A;  3ABV B;  3TEX A;  3CWI A;  1FMA D;  1T0R C;  4K81 A;  3DCG A;  4PS7 A;  4MSM B;  3T9L A;  4GSW A;  1RAX A;  1N5X A;  5DPR A;  1YD8 U;  4TQ0 A;  4TV3 A;  2RMM A;  3ZTC A;  1JCK B;  2W82 A;  3WA0 A;  1WM3 A;  2PEA A;  1WXA A;  4KX6 B;  3APC A;  3R7Q A;  3PT2 B;  4YSZ B;  4HLE A;  3L4P A;  3IAM 1;  2JQR B;  1JWU D;  3VH4 B;  2WXG A;  2KWV B;  1F2R I;  3VVW B;  4GOC A;  1GNU A;  3KWV A;  4L2Y A;  4MH8 A;  4MDK E;  4XWW A;  3H7P A;  1N63 A;  1R4N I;  2RDH A;  2MP2 B;  1Z5S B;  4A8X C;  4RGM A;  3CIR B;  4DDI D;  3L16 A;  2MBQ A;  1MG8 A;  2GBN A;  4FN2 A;  4HPL B;  3W9C B;  3AE1 B;  2AX5 A;  1KRH A;  3BVZ A;  3P4Q B;  1KTK A;  4WQM A;  3NVY A;  4K1R B;  1XLO A;  2FIF A;  4ANV A;  1QQR A;  2KHW B;  2L83 A;  2N7D A;  1KJT A;  4PS3 A;  3AEE B;  2DLB A;  1V1P B;  2V4I B;  1ZXI A;  2V3P A;  3JW0 X;  2KTF A;  4E71 A;  1TS3 A;  4TKN A;  1PFD A;  3A9K B;  4IWP A;  2PJH A;  3C8Y A;  4GDL A;  4H2A A;  3FIL A;  2RR9 A;  1C78 A;  3VTW A;  1UGM A;  1HA5 A;  1FXT B;  1IGD A;  1D4B A;  1EF1 A;  2CJN A;  2H88 B;  3L08 A;  1WGD A;  3ZGZ A;  1SXT A;  2CJO A;  2WXM A;  5TR5 A;  4NQL B;  1K52 A;  5H92 C;  3OJ4 B;  2IGH A;  2LUM A;  1D5Z C;  4FJY A;  1PGX A;  4EE2 A;  2ZVO A;  3DBS A;  2JZP A;  1AW7 A;  2FCM A;  2K39 A;  1RWS A;  3T3N A;  4IW0 A;  3LDZ E;  1SE3 A;  2NS5 A;  3AED B;  2BS4 B;  3RMK C;  1WGK A;  1BML C;  1RLF A;  2WYQ A;  1F0Z A;  4W9H A;  4II3 B;  3HM3 A;  2PE9 A;  1B1Z A;  1JML A;  3B0A A;  2H89 B;  3Q8B A;  5T8I A;  1E7P B;  2LJI A;  1WH3 A;  1K50 A;  4WWO A;  1E90 A;  3H8H A;  3BII D;  3VUX A;  4WQO B;  3LJ3 A;  3ZUN A;  2INP E;  2KNB A;  3RUL A;  3PRE A;  4LDT B;  2GI9 A;  5G2N A;  3CF4 A;  3ZRF A;  1HTO A;  1NBF C;  3ML8 A;  2HJ8 A;  1YN4 A;  1WR1 A;  3H7S A;  2MA9 B;  2IND C;  2IPK D;  2PKO A;  3HM6 X;  1TTN A;  1TY0 A;  3MHZ A;  3Q8F A;  4W9J A;  2HJ1 A;  2NTS A;  3TSS A;  2JX5 A;  2PLP A;  4ANX A;  4HVB A;  4KSL C;  3VAW A;  4ARC A;  1OFF A;  2IBI B;  1ACC A;  1RYJ A;  2KC2 A;  4OZC A;  4IWO A;  2EKE C;  2GMI C;  5C2T B;  2LZ6 A;  3A9J A;  4DK5 A;  4ZHO A;  3A1Q B;  1KH0 A;  3VDZ A;  2QSD A;  4RFB A;  2IY1 B;  1CZP A;  3SR6 A;  4ICU A;  4IC7 B;  4YL8 A;  1VD2 A;  1AWD A;  2LI5 A;  4ZRP A;  3GZN I;  1YJI A;  4GDL B;  3T8M A;  2WS3 B;  3FIL B;  5LXH A;  3RNC C;  3IG3 A;  1SGH A;  2C5L C;  1J7A A;  4JPS A;  1N61 A;  2JYT A;  1K51 A;  3Q3O C;  3N9Y C;  1IPG A;  1N6Z A;  5E6N A;  3ZNZ B;  1EU4 A;  3W1S C;  5L83 A;  5E6O A;  2AQ2 B;  4XZ4 A;  3AE5 B;  3PO0 A;  1GAQ B;  5D94 A;  1D5X C;  1V5T A;  1C4P A;  2UYZ B;  1UWX A;  3EFU A;  4F7Z A;  1TS5 A;  1XEE A;  2AL6 A;  3NRZ A;  3AEA B;  3EUB 2;  1D5M C;  1WE6 A;  3AE7 B;  1KFY B;  1GUA B;  5AEK B;  4HJK A;  4BKG A;  2KOX A;  3BY4 B;  1WE7 A;  3NHE B;  4E3C A;  4EKU A;  1L6V A;  1E7V A;  3AEB B;  3NVV A;  1HTQ A;  2GRI A;  3AE2 B;  4TSS A;  4KKJ A;  1RRB A;  1FNV A;  1H4R A;  1YNT E;  4M8M A;  3WAP A;  3KH0 A;  3UQA A;  3A4R A;  3LXF A;  4GN1 A;  3NUH B;  4K7W A;  1J7C A;  3EA6 A;  3B1L X;  4US9 A;  1Q1O A;  3VR9 B;  2DZI A;  4YSX B;  3DWG C;  2KO3 A;  1OTR B;  1RFA A;  3ZNH B;  2AYO B;  4HKQ A;  1XQQ A;  2KFK A;  2FCN A;  2D3G A;  3GP7 A;  5GMV A;  5FKA C;  4KSK C;  2O6V A;  1I4G A;  2KQS A;  2IGD A;  4IKG A;  1HE8 A;  1TS4 A;  4YSY B;  4REZ A;  2QC8 A;  2C60 A;  3OJ3 A;  1I4H A;  1SIJ A;  3V60 A;  3ZDM C;  2FCS A;  3A9J B;  2ZCC A;  2MEK A;  2PIA A;  4R3D A;  2A5U A;  3DBH B;  2MLB A;  4ASW C;  5JH5 C;  2NBV B;  4MGK E;  5C3J B;  3Q6B A;  2D11 A;  3P4R B;  3VTU A;  3VRA B;  2FBW B;  4AQ7 A;  1L0X B;  1J0G A;  4BAX A;  1ISN A;  2JRI B;  3ZVV A;  2GOW A;  3QK0 A;  3AN1 A;  5J2R A;  4IDI A;  5JXV A;  1ZKH A;  5DCN A;  4LDT D;  3MFG A;  4AS1 A;  2GLS A;  2ZNV B;  4RF1 A;  1XCQ L;  2WDR B;  2IO2 B;  1E10 A;  1OQY A;  4JQW C;  1XLQ A;  3TEZ A;  5LXI B;  2KMM A;  3PLV A;  1TKG A;  1L7Y A;  3Q3J A;  2ZW1 A;  4RM8 A;  4WAF A;  2REX A;  4F1S A;  2K22 A;  3ENE A;  1WYW B;  2W9N A;  3L17 A;  4IG7 B;  2CU3 A;  2K0P A;  2C7N B;  1TZ1 A;  4CYE A;  2BYE A;  2PPH A;  4A3P A;  3SFD B;  1FD6 A;  4JIO U;  1HZ6 A;  4W9I A;  2K6Q A;  1A70 A;  2RPQ A;  2PVG C;  2ICI A;  2KJ6 A;  2CU1 A;  1IBX A;  3N30 A;  3GB1 A;  1GTH A;  2J0M A;  3QX1 A;  4WJP A;  1WX7 A;  2M0X A;  4ZOH C;  3Q3M C;  1HXY D;  1FCL A;  1VZ8 A;  2J42 A;  3GZN B;  3OAW A;  2ZW0 A;  1DYQ A;  3RNB C;  4HRS A;  3C0R B;  3UF8 A;  4XC2 A;  3AU4 A;  1R4M B;  4KZ0 A;  4UDU C;  4US8 A;  3L13 A;  1V49 A;  2D3A A;  1R7S A;  2G9H D;  4KIK A;  2QHO A;  1E7U A;  2KFK B;  4FJV B;  4PYU A;  2G4D B;  3NZ3 A;  4C56 C;  1LFD A;  2W55 A;  2MJ3 A;  3VH3 B;  1UH6 A;  2ZEQ A;  3JSV A;  3Q3N C;  1HZ5 A;  1YQ4 B;  1WF9 A;  1V6E A;  3FKY A;  5BO4 B;  2EMS A;  2NBU A;  4GDK A;  3AU5 A;  3W5U B;  5FR6 A;  4EUT A;  4P16 A;  5G55 A;  4P1B C;  3Q69 A;  2V0G A;  1E8Y A;  5IN7 A;  1DOI A;  1SE2 A;  1EM7 A;  3RN9 C;  4RMA A;  5DPS A;  1VCB A;  2RPV A;  4LJO B;  4ZRQ A;  3RNF C;  2KD0 A;  2KWU B;  4OZB A;  1ESF A;  1PGA A;  2MH7 A;  4C4V B;  2C9W B;  3DHH C;  4IWQ A;  4B0M A;  3MP9 A;  3DHG C;  1WRI A;  2MX2 A;  3JVZ X;  2JRH A;  1MG4 A;  1E5W A;  2WWZ A;  3ZXR A;  4FBJ B;  4GLS C;  3RI7 C;  1H7X A;  3ZDT A;  4GB9 A;  4XDC A;  4GIV A;  2CR5 A;  3L54 A;  2KDF B;  3M95 A;  3FC4 A;  1A5R A;  5C23 A;  1V97 A;  3NJT A;  1FXA A;  1YX5 B;  2WXK A;  4AJW A;  4WJQ A;  1FFU A;  1BXT A;  3BWU D;  1SB3 C;  1WWT A;  1Y56 A;  1GC7 A;  1NDD A;  2K5P A;  3EEC A;  1P7E A;  3HIZ A;  3W1Y A;  1TJE A;  4MM3 A;  1C79 A;  1L4D B;  2G3Q B;  2WNM A;  2N9X A;  4XDD A;  3ZRC A;  3DVN V;  3PSE B;  1I4Q A;  1Q5W B;  4FXC A;  5EE0 A;  3ZYY X;  5MPO A;  4DXA B;  1IBX B;  3UGB B;  1WMH A;  3HVD A;  2YEP B;  2KX3 A;  1BT0 A;  3E9S A;  1V8C A;  1TYG B;  2M0A A;  1UBI A;  1J19 A;  3ZJT A;  3DWM A;  1YN5 A;  1JRP A;  1YMH E;  4WWM A;  1MI0 A;  3VUY A;  2L76 A;  4DQO C;  3VRB B;  3MC9 A;  1CK1 A;  1UUP A;  2NMQ A;  4KIK B;  4HWI B;  3ZIM A;  4KDI C;  2WDQ B;  2XEW A;  3AEG B;  2ASQ A;  1SE4 A;  5IKC M;  2BKF A;  1VJK A;  3OLM D;  2WXN A;  1WR6 E;  4BBN C;  4HPP A;  5LNK 1;  2KMA A;  3VQI A;  2NVU I;  3AE6 B;  2LJ5 A;  3PHW B;  3X23 A;  3JSV B;  1V9J A;  2I1K A;  1U4A A;  1WX8 A;  2FID A;  2BYT A;  1UEL A;  1LO5 D;  1KLU D;  1GB4 A;  2N9K A;  2D10 A;  3VXW A;  1V86 A;  2WXL A;  3M62 B;  2BGF A;  3U2S C;  1WJ6 A;  4C7Y A;  2BB6 A;  4ACF A;  5IAA C;  3ECI A;  1YN3 A;  3OWE B;  3UI3 A;  4XE0 A;  2GB1 A;  3NVZ A;  3D32 A;  3W5V B;  4F8C B;  1WXS A;  2WDT B;  2MJE A;  2KVZ A;  4WWP A;  3TMP B;  2QIL A;  4MGZ E;  1FEH A;  1G6J A;  2FCQ A;  2WXF A;  2JUO A;  1T5X D;  4LJP B;  3AH7 A;  2Y5B B;  4WWN A;  3U52 E;  3ONS A;  2K25 A;  4EFO A;  1KLV A;  4QAY A;  4BOS C;  1L5P A;  2WX1 A;  3W1S A;  1FNU A;  2KK8 A;  4BKS D;  1P1A A;  3VTV A;  3BIN A;  1IYF A;  4JWU C;  1ZXH A;  2MSE D;  4ZRI A;  4G50 A;  4ITK A;  2Y5P A;  3PGE A;  3PHX B;  3AE4 B;  5D3D A;  1C9F A;  4KGS A;  1QOG A;  1YIW A;  3AE9 B;  3IT4 B;  4MM3 B;  1SJE D;  1ZUD 2;  2WXP A;  4N6E B;  5IA7 A;  2DEN B;  1XCT L;  3N1Z C;  3SHQ A;  2WQY B;  2DYM A;  2HTM E;  1F52 A;  1V80 A;  1Z2M A;  1PUT A;  2JYE A;  3CSF A;  3PLU A;  3V61 A;  4W9E A;  1E8X A;  2UWQ A;  2DX5 B;  3V62 A;  1WM2 A;  4P1C C;  3LYY A;  4MT5 A;  1J8C A;  5D7G A;  4DHZ E;  1EWC A;  3M3J A;  3HRD D;  5BMG A;  2BT6 A;  1GPX A;  2WHI A;  1WXQ A;  3H7P B;  3V6E B;  3DBR I;  4W9G A;  2J0J A;  3DBL I;  4D2K A;  4K3B A;  4M00 A;  1SEB D;  4YXD B;  2D07 B;  1Y8R C;  1E6E B;  2XK5 A;  2VH1 A;  3IAS 1;  1QIL A;  4LNO A;  3U30 A;  1JRO A;  2KWD A;  4N58 A;  4P7I A;  4OVU A;  5BMI A;  4GXB A;  3WCQ A;  4JX1 C;  3GS2 A;  5G5G A;  2LHE A;  2DHZ A;  3AEC B;  1OEY J;  3DVN U;  4HRO A;  1TKY A;  5FR3 A;  2N1V A;  2WU2 B;  3MC0 B;  2L7R A;  2X38 A;  3KLS X;  3O65 B;  1WGG A;  3IHP C;  4PYZ A;  4ZRJ A;  3Q14 C;  1MHH E;  4X57 B;  4YWG G;  4TQ1 A;  2AQ1 B;  2W54 A;  1E8W A;  4BZA A;  1C76 A;  4NJ7 A;  1C1Y B;  3C19 A;  3AI5 A;  1QKZ A;  3I57 A;  1P7F A;  5FK9 C;  1T3Q A;  1MJD A;  3VHT C;  2PTL A;  1R4N B;  4CO7 A;  4HXD A;  4WJN A;  4G11 A;  1SIF A;  4ZYN A;  2WLB A;  5AZH A;  1WFY A;  1DOX A;  2Z0D B;  3P1M A;  5BMH A;  1GJZ A;  2JXX A;  2FE8 A;  3IFW B;  1MHX A;  1JWS D;  3AEF B;  4CQN A;  2MRP A;  3P4S B;  5EE9 A;  4KV2 A;  1FRD A;  1CMX B;  1XXG A;  4DHJ B;  4LTU A;  4L23 A;  3Q2A C;  4XWT A;  1QOB A;  4M01 A;  2MCN B;  2BWF A;  4A3O A;  1ENF A;  2KLG A;  3ZNI D;  1WXM A;  3QJZ A;  1GC6 A;  1VRA B;  2JPH A;  3CST A;  2BTE A;  1WXV A;  2RGF A;  2PE6 B;  1OQQ A;  2CHZ A;  2WXO A;  1N5W A;  2LVQ A;  2VH2 A;  3PRP B;  4LNI A;  2BPS A;  2MBO A;  2ZZP B;  1WJ4 A;  3N3K B;  3QCA A;  3CF6 E;  4HKZ E;  2B3A A;  2JWZ A;  1L6U A;  3U7D A;  3BK2 A;  2XK5 B;  1WRD B;  3UIO B;  2BS2 B;  4BOZ B;  2QJL A;  4DHZ B;  2PW9 A;  3PVL A;  3QC8 B;  2INC C;  1S1Q B;  1K8R B;  1JWB D;  1VR9 A;  1WJU A;  4OW0 A;  2G1E A;  5L95 C;  1YJJ A;  4JL9 A;  1FPY A;  4RH6 A;  4XYC A;  1AN8 A;  4FA6 A;  1FM0 D;  3UIN B;  3Q8E A;  1ZE3 D;  3DPD A;  2INN E;  2KWC A;  3TL5 A;  2JF5 A;  3B2F A;  3NZS A;  2ZJD A;  1K53 A;  1ET6 A;  1JWM D;  2AWT A;  4C80 A;  4RGO S;  1NI2 A;  2CKH B;  4PT5 A;  3KYD D;  2LD9 A;  3VR8 B;  3BVM A;  1I4X A;  2WGS A;  2QDF A;  4J6I A;  1GTE A;  5J18 A;  1XF5 L;  2K8B A;  1NVI D;  1RFK A;  3KUC B;  3R3M A;  3WAL A;  2NTT A;  3ZLZ A;  2WU5 B;  3RUI B;  1WSP A;  3Q3F A;  1I35 A;  1UD7 A;  4I6N B;  3S2A A;  3W2D A;  2N9P C;  2KDI A;  1V1O A;  3RFZ B;  4NJC A;  4MH0 E;  4K7U A;  3TIX A;  1XT9 B;  2LGS A;  1FXI A;  4KDL B;  2RSU A;  2IO0 B;  2I1J A;  2N9E B;  3QIJ A;  2B76 B;  5JZE B;  1TKE A;  3H6N A;  3T3O A;  1VZ6 A;  2YEP F;  3KUD B;  1L4Z B;  2N1W A;  4C00 A;  3HVZ A;  4KKI A;  2KFJ A;  2ZPY A;  3TJP A;  3R66 C;  4MAC A;  4JWS C;  1YJ1 A;  3VUW A;  1XLN A;  4BFR A;  1TGZ B;  3M63 B;  2KN5 A;  4FLH A;  2IY0 B;  1JRU A;  1I4R A;  3MTN B;  2IO3 B;  2JT4 B;  1BUI C;  2M19 A;  3R7R A;  3WAO A;  3NG0 A;  4JGH B;  4NAM A;  4IUM B;  3TEY A;  3V05 A;  1TZO A;  2LGD A;  2O6V B;  3DQV A;  3UIP B;  1L0Y B;  3TBL D;  4ANW A;  2RD0 A;  2OJR A;  5HG2 A;  1FIQ A;  2LEK A;  2MP2 A;  3J9C A;  1IUE A;  4W9L A;  2LRW A;  2JZ3 B;  4W9C A;  3I63 C;  1F1H A;  3QHT A;  2JSV X;  2GBR A;  5HFY A;  2V3N A;  3PV1 A;  1SBB B;  1WGY A;  4MEM A;  3N1Y C;  4DHJ D;  2V9H A;  4N59 A;  5D3I B;  4M02 A;  2HD5 B;  4NQK E;  4NAW A;  3N32 A;  2XBB C;  1SF0 A;  1T6B X;  3PRZ A;  2OED A;  1Q10 A;  2WXJ A;  2OHF A;  2J52 A;  4A6Q A;  4N9F 4;  2UU7 A;  1UF0 A;  2LVO A;  4PS8 A;  4GU2 A;  2LMC A;  2KAN A;  2QCZ A;  3ZTD A;  3RZW C;  4NPN A;  1AYF A;  4WJO A;  3SDL C;  3HHM A;  3I3T B;  1ZDX A;  3QAR A;  2MBB B;  2IYD B;  3NZU A;  3MJW A;  5E6P A;  1ZW7 A;  1QLB B;  4G0N B;  4NZL B;  2DYO A;  1TBE A;  1T0S C;  3ZW3 A;  2LFI A;  2BYF A;  2Z0E B;  1VDV A;  1UBQ A;  2MBE A;  3BVG A;  4RGT A;  4ZDV A;  2FUG 1;  3ALB A;  4IOI E;  5DPT A;  2L1A A;  5GXG B;  3TCA A;  1JAL A;  2CHX A;  3RCZ A;  1JW9 D;  4PK1 A;  4ANU A;  4B6W A;  1NYQ A;  2AL3 A;  2KMC A;  3UQB A;  3BZD B;  2NBW B;  4LNK A;  2DWQ A;  3MJ5 A;  2Z8L A;  2C7M B;  1EUV B;  2A4Z A;  3SD5 A;  4LCD E;  2KTR A;  4AWJ A;  2M8S A;  1D3Z A;  1PGB A;  3NS8 A;  3IT6 B;  2L00 B;  2DZM A;  1C4C A;  1QZE A;  2KYW A;  1WZ0 A;  2N0S B;  1H7W A;  3RNA C;  2BWE S;  4HJG E;  2BF8 B;  3BK1 A;  2N9L A;  4K7S A;  4DXF A;  4A55 A;  1TIF A;  4LLG M;  2MQJ A;  4M0W A;  4MEL A;  2C7H A;  1UZX B;  3KQ4 A;  3GOE A;  1ROE A;  2G45 B;  1NEK B;  1F77 A;  3B08 A;  4G3X B;  3JYU A;  1YOV B;  3RZF A;  5EE3 A;  5CX3 A;  4GDK B;  1WY8 A;  1UNS A;  4A9A A;  2YLM A;  1EU3 A;  3ZJV A;  4GGQ A;  3SFE B;  4M8N A;  4KGR A;  3K9O B;  3PPA A;  3O13 A;  2RDG A;  3P4P B;  1WJN A;  3A1Q A;  2JZZ A;  3B2G A;  1P98 A;  2KKC A;  4NAW B;  1D6E C;  2L0F A;  3RNE C;  2LGX A;  2VZK B;  2LVP A;  4HK2 A;  2G4S A;  4WUR A;  2EKI A;  2YVC A;  2LUE A;  2ZPN A;  3I5J C;  4I6L B;  5H8Y E;  1C4A A;  3Q8A A;  1UGJ A; 
#chains in the Genus database with same CATH homology
 2Y5C A;  3R2I A;  3ZJU A;  4IDI A;  5JXV A;  3AMZ A;  5I4D A;  1C76 A;  2WP9 B;  3MFG A;  4AS1 A;  1QKZ A;  3I57 A;  1CJE A;  1XLP A;  3BYY B;  4RF1 A;  1P7F A;  5FK9 C;  1SSN A;  2WDR B;  1XCQ L;  2D5G A;  1T3Q A;  3EGR A;  3IXS A;  4A90 A;  1GB1 A;  1E10 A;  4ZYS A;  1QOF A;  1I7H A;  5HI1 A;  4OHJ A;  4RCO A;  1XLQ A;  2PTL A;  3TEZ A;  4WIP A;  2KMM A;  1TKG A;  2PMV A;  2IGG A;  3ZQ4 A;  1FNW A;  2ZW1 A;  4YTN B;  1ZOY B;  3TUO A;  4B0E A;  2WLB A;  4WAF A;  1UWM A;  2K22 A;  1DOX A;  2XNA C;  1STE A;  2BS3 B;  3P1M A;  5BMH A;  4WH4 A;  2FE8 A;  1MHX A;  1JWS D;  2CU3 A;  4RNA A;  3AEF B;  2K0P A;  3ABV B;  4CQN A;  1FFV A;  3P4S B;  5EE9 A;  1FRD A;  3TEX A;  1XXG A;  1C4A A;  3SFD B;  3CWI A;  1FMA D;  1FD6 A;  4LTU A;  3NS1 A;  1HZ6 A;  4L23 A;  4XWT A;  3URY A;  1QOB A;  1TY2 A;  1A70 A;  4LK0 M;  2PVG C;  1N62 A;  2ICI A;  3PZ8 A;  1N5X A;  1IBX A;  4ARI A;  1ENF A;  3GB1 A;  1GTH A;  1QOA A;  4TQ0 A;  1FO4 A;  4ZOH C;  1OQR A;  1HXY D;  2DBY A;  2RMM A;  1FCL A;  1VZ8 A;  2TSS A;  2LGI A;  1ZP0 B;  1JCK B;  1EWY C;  1VRA B;  2J42 A;  2W82 A;  2ZW0 A;  1DYQ A;  2BTE A;  4HRS A;  4KX6 B;  4YSZ B;  3L4P A;  3IAM 1;  2JQR B;  1JWU D;  4UDU C;  4US8 A;  1OQQ A;  2WXG A;  2WXO A;  1N5W A;  1SJH D;  4O1N A;  1F2R I;  1NEN B;  3KWV A;  4L2Y A;  4MH8 A;  1R7S A;  2G9H D;  2E6X A;  4HKZ E;  4XWW A;  1N63 A;  3NZ3 A;  4C56 C;  1L6U A;  2RDH A;  2W55 A;  4RF0 A;  2MJ3 A;  1E9M A;  2N7J A;  3BK2 A;  2R61 A;  4A8X C;  2BS2 B;  1QT9 A;  2QJL A;  1JQ4 A;  2PW9 A;  4RGM A;  3CIR B;  1HZ5 A;  1YQ4 B;  1XO3 A;  3HUI A;  2SEB D;  1JWB D;  1VR9 A;  2ON8 A;  4OW0 A;  3W9C B;  2G1E A;  3W5U B;  2ACZ B;  3AE1 B;  2AX5 A;  1KRH A;  1YJJ A;  3ETR A;  3BVZ A;  4RH6 A;  3P4Q B;  1KTK A;  4P16 A;  3NVY A;  4WQM A;  5E6J A;  3AE3 B;  1XLO A;  1QQR A;  2L83 A;  3Q69 A;  1AN8 A;  1FM0 D;  2V0G A;  3V3X A;  1DOI A;  2QMT A;  1SE2 A;  3Q8E A;  5BYR A;  1EM7 A;  1ZE3 D;  3AEE B;  2DLB A;  2INN E;  1V1P B;  2V4I B;  3B2F A;  2RPV A;  1ZXI A;  4ZRQ A;  2E3T A;  2V3P A;  1K53 A;  1ET6 A;  1TS3 A;  1JWM D;  2JXT A;  1ESF A;  4OZB A;  1PGA A;  2MH7 A;  4Q2J A;  1FRR A;  4C80 A;  1PFD A;  4RGO S;  4PT5 A;  1VZ7 A;  4B0M A;  3C8Y A;  3MP9 A;  3VR8 B;  4H2A A;  3FIL A;  3BVM A;  1C78 A;  1WRI A;  1I4X A;  2QEJ C;  1HA5 A;  1CQV A;  1GTE A;  1IGD A;  1WYG A;  1D4B A;  4GLS C;  1H7X A;  1DGJ A;  1XF5 L;  2CJN A;  2H88 B;  4XDC A;  1NVI D;  3ZGZ A;  1RFK A;  1SXT A;  2CJO A;  2WXM A;  2NTT A;  1K52 A;  3AM9 A;  2K9X A;  5H92 C;  1F2R C;  2WU5 B;  2IGH A;  2LUM A;  1D5Z C;  1WSP A;  3FC4 A;  1PGX A;  4EE2 A;  3AV8 A;  4YTP B;  3U4E G;  1V97 A;  1FXA A;  2M56 B;  2JZP A;  1AW7 A;  3W2D A;  1RWS A;  3T3N A;  2WXK A;  1MPE A;  1V1O A;  2I38 A;  1SE3 A;  3RFZ B;  4KGT A;  4NJC A;  3AED B;  3TEW A;  2BS4 B;  1FFU A;  1FXI A;  1WGK A;  1BXT A;  2WXH A;  3BWU D;  1DOY A;  1SB3 C;  2JU6 X;  1WWT A;  1BML C;  1Y56 A;  1HEZ E;  1F0Z A;  2K5P A;  5TSS A;  2B76 B;  1P7E A;  1TKE A;  1TJE A;  1C79 A;  1B1Z A;  1L4D B;  4P6V F;  1JML A;  2WNM A;  4TQ1 A;  2H89 B;  3Q8B A;  4XDD A;  1VZ6 A;  2YEP F;  3T3O A;  5T8I A;  1L4Z B;  1E7P B;  2LJI A;  1RM6 C;  1I4Q A;  4FXC A;  5EE0 A;  3HVZ A;  2K3U A;  4KKI A;  3ZYY X;  5MPO A;  2VZK D;  1K50 A;  4MAC A;  1IBX B;  4JWS C;  5BYS A;  2BW2 A;  1XLN A;  4L1B A;  3HVD A;  3H8H A;  2YEP B;  3BII D;  2WXQ A;  3E9S A;  1V8C A;  1PYW D;  2INP E;  1TYG B;  2M0A A;  1I4R A;  3ZJT A;  2GI9 A;  4YTM B;  3DWM A;  1BUI C;  1JRP A;  1YN5 A;  3CF4 A;  1YMH E;  2M19 A;  4WWM A;  2IDY A;  1MI0 A;  1YN4 A;  1ET9 A;  4DQO C;  4NAM A;  3VRB B;  1KF6 B;  2L32 A;  2IPK D;  3TEY A;  1CK1 A;  2PKO A;  1UUP A;  1TZO A;  2NMQ A;  3V05 A;  2J53 A;  4TMA B;  3I9V 1;  1TY0 A;  2WDQ B;  3MHZ A;  3AEG B;  3Q8F A;  1SE4 A;  1L0Y B;  2Q5W D;  2Y3A A;  2NTS A;  3TSS A;  2JX5 A;  2PLP A;  1VJK A;  5HG2 A;  2WXN A;  2BB5 A;  4ARC A;  1OFF A;  5LNK 1;  3VQI A;  1FIQ A;  3AE6 B;  1NI3 A;  2LEK A;  3J9C A;  1ACC A;  1RYJ A;  4HEA 1;  1IUE A;  2L52 A;  4OZC A;  3RPF C;  2ONQ A;  5C2T B;  1KLG D;  2W54 A;  1C77 A;  1PDX A;  2BYT A;  1LO5 D;  2JSV X;  1KLU D;  5HFY A;  1GB4 A;  2N9K A;  4ZHO A;  2V3N A;  5AUI A;  1KH0 A;  2WXL A;  1SBB B;  2QSD A;  4J3O D;  1FCC C;  4RFB A;  1E0Z A;  1CZP A;  3U2S C;  3SR6 A;  4C7Y A;  2BB6 A;  4N59 A;  5D3I B;  3Q8C A;  1SF0 A;  2W3S A;  1YN3 A;  2MJD A;  1T6B X;  3OWE B;  1L0V B;  3UI3 A;  4XE0 A;  1AWD A;  2GB1 A;  3NVZ A;  4ZRP A;  3W5V B;  2OED A;  1Q10 A;  2WXJ A;  2OHF A;  2BBC A;  2J52 A;  2LHD A;  1VLB A;  1YJI A;  3U7Z A;  4A6Q A;  2MJE A;  3E56 A;  4GDL B;  1NYR A;  2LMC A;  2WS3 B;  3FIL B;  2QIL A;  2WDV B;  1FEH A;  5G5H A;  2WXF A;  1AYF A;  1T5X D;  4C7Z A;  3AH7 A;  1M4V A;  3U52 E;  4DXG A;  1J7A A;  4JE3 B;  1N61 A;  2JYT A;  4JPS A;  1ZDX A;  2KAC A;  5BYQ A;  1K51 A;  3KWL A;  3LB8 C;  3FAH A;  1L5P A;  3N9Y C;  3W1S A;  3P63 A;  1QLB B;  1FNU A;  1EU4 A;  4NZL B;  2DYO A;  2J4X A;  5H8Y E;  2AQ2 B;  3AE5 B;  3PO0 A;  1GAQ B;  2LFI A;  4JWU C;  1VDV A;  1ZXH A;  1D5X C;  3BVG A;  4RGT A;  1C4P A;  4OVZ A;  4ITK A;  2FUG 1;  1UWX A;  2Y5P A;  1TS5 A;  1XEE A;  4IOI E;  2L1A A;  3NRZ A;  3AE4 B;  3AEA B;  3EUB 2;  5D3D A;  4KGS A;  1QOG A;  1C9F A;  1D5M C;  5GXG B;  3AE7 B;  2WXI A;  1KFY B;  3AE9 B;  1JAL A;  3IT4 B;  1JW9 D;  4MM3 B;  1SJE D;  2IJ0 A;  1ZDV A;  1ZUD 2;  2WXP A;  4N6E B;  1NYQ A;  1XCT L;  3R8B A;  1L6V A;  2KAJ A;  3AEB B;  3NVV A;  3BZD B;  1N60 A;  2DWQ A;  2GRI A;  2WQY B;  3MJ5 A;  2DYM A;  2Z8L A;  2EEL A;  3AE2 B;  2HTM E;  3R2T A;  4KKJ A;  4TSS A;  2I2Y A;  1PUT A;  2JYE A;  3BYT B;  2AQ3 B;  1FNV A;  1YNT E;  2WXR A;  4ZHP A;  1IGC A;  3LXF A;  3NUH B;  1QF6 A;  1J7C A;  3EA6 A;  1PGB A;  2KQ4 X;  3LYY A;  4US9 A;  3IT6 B;  4USA A;  4MT5 A;  3VR9 B;  4RGN A;  1C4C A;  1ZPS A;  5D7G A;  4YSX B;  1EWC A;  3HRD D;  2N0S B;  1H7W A;  2BT6 A;  3DWG C;  5BMG A;  3PZ7 A;  5EE1 A;  1GPX A;  1WXQ A;  4HJG E;  3BK1 A;  4HKQ A;  2N9L A;  5AUK A;  4DXF A;  4A55 A;  2KN4 A;  4LLG M;  2KDM A;  3GP7 A;  4M0W A;  4D2K A;  5FKA C;  3NVW A;  3KQ4 A;  1I4G A;  1ROE A;  1SEB D;  1NEK B;  4YXD B;  2IGD A;  1F77 A;  1MVK A;  1E6E B;  4IKG A;  1TS4 A;  4YSY B;  1YQ3 B;  1J7B A;  4REZ A;  1GT8 A;  3IAS 1;  1QIL A;  1I4H A;  2XN9 C;  5EE3 A;  1JRO A;  2KWD A;  4GDK B;  1SIJ A;  4N58 A;  3AE8 B;  1UNS A;  4A9A A;  5HHD G;  5BMI A;  1EU3 A;  3ZJV A;  3WCQ A;  2MEK A;  2PIA A;  4R3D A;  3SFE B;  4JX1 C;  3GS2 A;  5G5G A;  2LHE A;  4KGR A;  5C3J B;  3P42 A;  3AEC B;  3O13 A;  2RDG A;  4HRO A;  2SAK A;  3AB5 A;  3P4P B;  4YT0 B;  1TKY A;  5FR3 A;  1GOZ A;  3P4R B;  3B2G A;  2WU2 B;  2FBW B;  3VRA B;  1V1P A;  2QIE B;  4NAW B;  3MC0 B;  1D6E C;  4AQ7 A;  1JWA D;  3B9J A;  1B9R A;  2X38 A;  2PVO D;  2VZK B;  1L0X B;  3KLS X;  4WUR A;  1HQR D;  2EKI A;  2HDE A;  2JWU A;  1TS2 A;  3SEB A;  1MHH E;  1I4P A;  4YWG G;  4OZA A;  2AQ1 B;  2W3R A;  3Q8A A;  3AN1 A;  1UGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...