4YTMB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-biphenyl-3-yl-2-(trifluoromethyl)benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 60
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ytmB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ytmB01
2DBYA 2Q5WD 2WU2B 2WLBA 4LTUA 3VRBB 1NEKB 1J7BA 1E6EB 3DWMA 5C2TB 1ZP0B 1FRRA 3AB5A 2BT6A 3VR8B 4ZHOA 2W3RA 1RFKA 3B2GA 3AEFB 3KWLA 2JQRB 1E10A 3AEAB 2QIEB 3P4PB 1VLBA 4IDIA 2PVGC 1F0ZA 5EE9A 1WWTA 3LB8C 1DOYA 3VRAB 1NI3A 1L5PA 3W5VB 2BS3B 1H7WA 4N6EB 3CIRB 4HROA 1E0ZA 1QF6A 1JWAD 3SFDB 1N62A 3NS1A 1GTHA 4YSYB 1KRHA 2WU5B 2WDVB 3AN1A 1J7CA 1VJKA 1L0VB 2MH7A 1QOBA 1SF0A 3AH7A 3NVVA 1N5XA 4C80A 4US9A 3AEEB 4YTNB 3AEDB 1TKGA 1WGKA 1TKEA 2MJ3A 1NYQA 5EE1A 4YSXB 3ABVB 1IUEA 2AX5A 2LEKA 4N59A 4WWMA 4USAA 1ZXIA 3NVZA 3SR6A 1L6UA 1JW9D 3AMZA 1FMAD 3P1MA 2EKIA 5AUKA 1TYGB 4YT0B 5H92C 2WS3B 3NVWA 2WP9B 5MPOA 4JX1C 1GAQB 1J7AA 1XLPA 2N0SB 1ROEA 1RYJA 1RM6C 1XO3A 1PFDA 2BS4B 2PVOD 3AV8A 1FO4A 1DOXA 1QOFA 3HVZA 1YJJA 1GT8A 4YTPB 1EWYC 1NYRA 3AE7B 1OQQA 1ZUD2 1FIQA 4P6VF 1QOGA 3HUIA 4US8A 2K22A 1XLQA 3P4QB 3WCQA 1V8CA 1E9MA 4HRSA 2HTME 1PDXA 3P4RB 2W54A 1QLBB 1AWDA 1ZOYB 1R7SA 1XLNA 2M56B 1B9RA 5C3JB 1FXIA 4JWUC 2H89B 5G5GA 3L4PA 1OQRA 3NRZA 2FBWB 1WXQA 2WDRB 2E3TA 2MJEA 3AECB 1GPXA 1SIJA 2W55A 2K9XA 1AYFA 3FAHA 1T3QA 1VDVA 4N58A 3W9CB 2DWQA 1GTEA 1TJEA 5G5HA 2QJLA 2PKOA 2Y5CA 2L52A 1H7XA 3AE8B 3AEBB 2WDQB 3ZYYX 1YQ4B 3AE6B 1FXAA 1V97A 3CWIA 1NENB 4ZHPA 3AEGB 1N5WA 1TKYA 4WQMA 1WRIA 2BS2B 1KFYB 3AE4B 3DWGC 2CJNA 3P4SB 2B76B 2WQYB 3SFEB 3PO0A 3BIID 2KAJA 4C7ZA 4ITKA 1A70A 2W3SA 1XLOA 5GXGB 4YTMB 1I7HA 2PIAA 1L6VA 3ETRA 3AE2B 3AE3B 5AUIA 1JRPA 1JWBD 4KX6B 1SB3C 2K5PA 3FC4A 4ZOHC 1JALA 1N63A 3W5UB 1RWSA 2CJOA 3AE9B 1NVID 1CJEA 1KF6B 2G1EA 4A9AA 1DGJA 3AM9A 2KMMA 3RPFC 1FFVA 1PUTA 3B2FA 2L83A 4YSZB 2M19A 2OHFA 4YXDB 5EE0A 2H88B 5H8YE 1E7PB 4JWSC 1DOIA 1N60A 1FM0D 3B9JA 4C7YA 1JQ4A 3AE1B 3P63A 1CZPA 1QOAA 1YJIA 3LXFA 5EE3A 3AE5B 1N61A 3VR9B 2JX5A 1UWMA 3CF4A 3HRDD 2MJDA 3EUB2 2CU3A 1JROA 1FRDA 1QT9A 1WYGA 2ACZB 1YQ3B 3NVYA 4FXCA 1FFUA 1OFFA
chains in the Genus database with same CATH superfamily
2WLBA 4K7UA 2INDC 4M01A 4HKQA 3A9JA 3B2GA 1IBXB 2QIEB 4AJWA 3H9DA 1YN5A 2K1FA 4LNOA 1LXDA 2NBVB 2DZKA 1L4DB 3DVNV 4HROA 1WE6A 4KV2A 1J7CA 3FILB 4HDQA 2O2VB 3NVVA 1WZ3A 1N5XA 1WX9A 1CQVA 3MTNB 1NYQA 4YSXB 1WJ4A 5DPRA 1IUEA 2LI5A 3AMZA 1OEYJ 2WXFA 1D6EC 1YJ1A 5IKCM 2YVCA 2JYEA 2MEKA 3RD2A 1EWYC 1TS4A 1I4GA 2O6VD 4CHKA 1R7SA 1YNTE 4RGMA 1M94A 3QIJA 1T3QA 5LXHA 1FPYA 2M0XA 1WXVA 4FHJA 1V49A 1KLVA 1V97A 1N5WA 3QHTA 2RPVA 3PO0A 2JYTA 1HQRD 2KAJA 1SJHD 4XYCA 3RFZB 1SE9A 2A4ZA 1NVID 3TCAA 1UD7A 4BKSD 1XCTL 2QHOA 2L83A 2LXCA 2LGDA 1UF0A 1CK1A 1WXMA 3O13A 1ISNA 2L3ZA 3LDZE 2RGFA 2MJDA 3EUB2 3JSVA 1WE7A 1OFFA 2W54A 4RMAA 2K8CA 3DWMA 4RM8A 2KD0A 1PQSA 3K9PB 4RGNA 2JQRB 2KDIA 4G3XB 3RZWC 2KNBA 1MHHE 1R4NI 2GLSA 3AU4A 3ZJVA 1KTKA 1E0ZA 4WWOA 3AN1A 4TQ0A 2D3AA 1WSPA 4MM3A 2LD9A 1T5XD 3V6CB 1TKGA 3WALA 2L05A 1WGKA 1I4HA 5E6OA 2JWZA 2WXJA 2INNE 1WI0A 2WP9B 1R4MI 2JPHA 3UIOB 1J7AA 1XEEA 2XN9C 2Y5PA 1FO4A 1P9DU 2HTHA 4OVUA 1XF5L 1GB1A 5D94A 1K52A 2M8SA 2XBBC 4IG7B 3DBLI 3OAWA 2KJHB 3H7PA 1UBIA 3P4RB 4LNIA 1ZOYB 2KN5A 2C60A 3PSEB 4MACA 3DQVA 2CHZA 3DHIC 5GMVA 4DK5A 2C9WB 1YQ4B 3AE6B 2BB6A 3ZTDA 2LVOA 2WQYB 4HPPA 4DXAB 3U8ZA 2UWQA 3JW0X 3AE3B 1WH3A 4FJYA 3PREA 3FC4A 2N1WA 4W9GA 2NR2A 4BAXA 4RM9A 1RWSA 1J8CA 1KF6B 4X57B 2ZCBA 1TY0A 5IA7A 1PUTA 4YSZB 3Q3MC 1EUVB 3L13A 3P63A 4PS8A 2MQJA 4KDLB 4EKUA 2J53A 3CF4A 2KDMA 3E9SA 4GDKA 3VDZA 1XCQL 3PPAA 2WU2B 2MP2A 2M1MA 3RNCC 1ZP0B 3RNFC 3U7DA 4RNAA 1AARA 1ET6A 4JIOU 3ZVVA 4LLGM 5LLIA 2MH7A 4GDLA 1UGJA 2GBKA 4US9A 2PEAA 1PGBA 4F7ZA 3W1SA 4WQOB 4XDDA 4N9F4 3N30A 3PZ8A 4IW0A 4KZ0A 4EFOA 5D7GA 3B1LX 1R4NB 3HVZA 2I1JA 4A20A 1YN4A 4KDIC 4B9KA 2IYDB 4BBNC 2HTME 2KQSA 4DHJB 2K6QA 2Z59B 3HM6X 1TS3A 2KK8A 2DHZA 3P2BA 2DX5B 2E3TA 2YEPB 1IP9A 2K9XA 4XGAB 2O6VA 2KJ6A 4XWTA 1R4MB 2N9XA 3HHMA 4FHKA 2WDQB 3VH3B 2WHIA 1VZ8A 3EC8A 1EU4A 3WIMA 3AE2B 2ZCCA 3T9LA 5HKHA 3Q3JA 4P1CC 1JALA 2N4FA 3IBEA 2REXA 1J19A 4MJSA 2EELA 1JQ4A 4ICVA 3GB1A 1BMLC 3BK1A 2R61A 3AULA 4MGZE 2JX5A 4JLCA 2RD0A 2X8XX 4BKSA 2WXHA 5FK9C 1SIFA 2FIDA 2G3QB 1VLBA 2G45B 2IO1B 4IUMB 1WY8A 3ZJTA 2BW2A 1GNUA 1H7WA 4HCNB 2BKRB 3NS8A 2FUG1 3IXSA 2BBCA 3N1ZC 3P42A 4RFBA 2AX5A 2GBRA 3SR6A 1L6UA 3P1MA 4W9EA 3UINB 4M8MA 2BTEA 1G6JA 3RYTA 4II3B 2Z0DB 3PHXB 5FKAC 1NYRA 1OQQA 4II2B 4GN1A 2WXIA 4P1BC 5CHWA 2L7RA 3K9OB 2HDEA 2PE6B 4M0WB 2KQ4X 2RDHA 4ZYSA 2VH2A 1L4ZB 2G4SA 2JXTA 2CKHB 1QILA 2QCZA 2JWUA 2AWTA 4L23A 2BYVE 3DPDA 1E8YA 1JWUD 4NAWA 3Q14C 3BZDB 1WM3A 4KVGB 3LJ3A 2WNMA 4IKGA 4XWWA 1PGXA 1CJEA 2EMSA 1TGZB 4DHZB 3ZJUA 2D3GA 4OZAA 1FNWA 3RCZA 4EZKA 1YJIA 4C00A 2L76A 3HRDD 3QC8B 3VAWA 4TMAB 2ACZB 1TZOA 3NVYA 2VH1A 2MBEA 2YEPF 2C7MB 2FE8A 1E8ZA 4UDUC 3VR8B 1UUPA 2V3PA 1QKZA 1E10A 1WX7A 2PVGC 4IOIE 4NNJB 1HA5A 5C1ZA 4EOYA 3VRAB 1WMHB 1KOTA 5DCNA 1WFYA 1N62A 3SEBA 2KTFA 3ZNGC 3VFKA 3Q3NC 3TSSA 4CYEA 4F8CB 2MJ3A 1J0GA 1UWXA 1D5XC 1ZDVA 1Z5SB 1JW9D 4ZYNA 3TEWA 1P1AA 3V61A 1V1PA 4E71A 4RGOS 1GAQB 3RN9C 2QDFA 5AZHA 4MSMB 1ZXHA 5HHDG 1V8CA 5IAAC 4EEWA 1QZEA 3ALBA 2IGDA 2OOBB 2HJ8A 2NPTB 5G5GA 1OQRA 4J6IA 2RR9A 3ZXVA 3W1YA 3KUZA 2V3NA 4BFRA 3ZLZA 3VUYA 4JL9A 2PKOA 1C4CA 4GU2A 4GXBA 2B76B 4HCPB 2LMCA 2WXKA 1TTNA 2JY6A 5GXGB 1GUAB 2OJRA 4DQOC 4PYUA 1RFAA 1IYFA 1F9JA 3AE9B 2IGGA 3CSTA 2CR5A 1XT9B 1E7VA 5EE0A 4JWSC 1N60A 5IP4D 2JRIB 3U2SC 3QCAA 1NBFC 2QMTA 5BYRA 3RULA 3A9JB 2E6XA 2N9KA 3VUXA 1YQ3B 2DAJA 2PE9A 2WGSA 1GC6A 3J9CA 3S2AA 4W9DA 2EKEC 2L32A 5CTRC 3M95A 4IDIA 2MBQA 2Z8LA 4YL8A 5L83A 1IPGA 1VZ7A 1GTHA 1SJED 2ZZPB 1V5OA 2WDVB 4TQ1A 1SF0A 3DOWA 3RMKC 2LJIA 4N59A 3VUWA 3ZYYX 4DWFA 1WR1A 1TYGB 4KGRA 3PVLA 5JHBA 3W1SC 5IN7A 4OW0A 4FBJB 3A9KB 3NJTA 2KMAA 3BK2A 4KIKA 3DVNU 2JU6X 1E9MA 2MLBA 1AWDA 1XLNA 3ZDTA 4W9HA 3L4PA 3ZRFA 1XD3B 3H6NA 1SGHA 2BYFA 2PW9A 3OJ3A 2PTLA 3B08A 2DWQA 3VH4B 1FNVA 4DHZE 3R7RA 1H7XA 4JQWC 1TKYA 2WXPA 4WQMA 2MBHA 1OQYA 4ITKA 1VRAB 4B95A 4EE2A 4BBNF 3QQ8B 4AUQC 1KM7A 2NTSA 3QWZB 4KX6B 1C3TA 2G4DB 2D11A 1STEA 2LVPA 3RPFC 3MC0B 2J7QB 1L2NA 4IM2A 4YXDB 1BUIC 3JSVB 1FM0D 1NDDA 2M4NA 5LXIB 3R2TA 1IBXA 4GOCA 1V2YA 4PT5A 2J4XA 3EECA 1WYGA 2K39A 1YN3A 3RI7C 3JVZX 1HXYD 2M17A 4A90A 1J7BA 2KX3A 3AB5A 3FILA 1L0YB 1PGAA 3L10B 2PLPA 4MM3B 5L95C 2NTTA 2I1KA 1WX8A 1MJDA 2MA9B 4I6NB 3AI5A 1P98A 3GS2A 3PV1A 4L1BA 3Q8FA 1BXTA 4ANUA 3AEDB 3V60A 2KJRA 1F1HA 4P7IA 3OJ4B 4ZRIA 3H7PB 1YQBA 1PFDA 4LDTB 4DDGD 3IG3A 2RMMA 1JCKB 3OWEB 2C5LC 3N9YC 4FLHA 2TSSA 1H8CA 1ESFA 3DDCB 3N3KB 2CHXA 4RGTA 3IVFA 5BO4B 2FBWB 1WXQA 3ZDMC 2LZ6A 2C7HA 2AQ2B 4ICUA 3FAHA 1ZDXA 2ZW1A 4J3OD 1GTEA 1JMLA 4P16A 2WWZA 2M0AA 1RLFA 2KFKB 2KDFB 1Q0WB 3CWIA 4HXDA 4HJGE 3P4SB 2KZRA 1D5ZC 1XLOA 2ICIA 4YTMB 1GG3A 1ZKHA 4URKA 1T0SC 2NVUI 5AUIA 3W5UB 1YX6B 1MVKA 4ANVA 1F2RC 3DHHC 3V3XA 1FXTB 2MP2B 4ACFA 3LXFA 3AE5B 3BY4B 4XC2A 1T6BX 1WGGA 4MH0E 4WIPA 1FRDA 2WX0A 4OHJA 3R3MA 1WZ0A 2Q5WD 1EF1A 3GE8C 3DBRI 1FRRA 1ET9A 4KZCA 3T3OA 3R66C 4K3CA 4S17A 1E7UA 2IY0B 4GDLB 4ZRKA 2KDBA 2KTRA 3KWVA 2BS3B 2IZVB 4K81A 4MEMA 3ENEA 3BYTB 4KSKC 4HWIB 1X1MA 2XK5A 4NJCA 5JH5C 1PYWD 1V5TA 2BVCA 4WH4A 5CHFA 3MC9A 2RDBC 2N9PC 4TSSA 2LHEA 1WYWB 2KC1A 4K7SA 3U7ZA 3AV8A 3U4EG 3EFCA 1RAXA 1S3SG 4RF0A 3TMPB 2KDEB 3HUIA 2GOWA 2CHWA 1K53A 2D3BA 2O6VB 1PDXA 2KLCA 1GPXA 5J2RA 1MG8A 3URYA 4A55A 2WXRA 3HIZA 4G0NB 3UF8A 4LNFA 3WANA 5BYSA 1GOZA 3AEBB 3NHEB 2ZPNA 2BS2B 4FA6A 3EHVA 3BIID 3SHQA 2V3SA 3FKYA 4MJSB 2UU7A 3BVMA 4WAFA 2J0JA 2KO3A 3TUOA 2CJOA 3ZNHB 1Z2MA 1SE3A 1V1OA 3B2FA 2BQQA 1C78A 5HFYA 5H8YE 1WGDA 4BKGA 4C7YA 2JZPA 5EE3A 2BPSA 1VCBA 1QT9A 1HZ5A 2WXNA 2D3CA 2BWES 1NEKB 3R8BA 2BT6A 2Z0EB 1WGYA 3ZTCA 3I9V1 4HLEA 1V86A 3Q8EA 3WA0A 2MWSB 3DBSA 5DPSA 2NMQA 1QF6A 1WRDB 2IO0B 4AJYB 4ZRPA 4MELA 3IT6B 4XX5A 2KANA 2WXGA 3JYUA 3OLMD 3RUIB 5JXVA 4EZJA 2K0PA 3KQ4A 4TV3A 4B6WA 3W2DA 1KJTA 2LEKA 3DBRB 4FJVB 4KKIA 5H92C 3O65B 3ONSA 3IHPC 3QARA 2BS4B 2NCNA 1DOXA 1C77A 1GT8A 1Q5WB 1WM2A 5J17A 2WXQA 4MSQB 3H1UA 2K22A 1Y56A 3WCQA 3VTWA 4AOFA 1FCLA 2N7EA 1UGMA 1Q1OA 3Q8AA 3L08A 1L0XB 2MRPA 3PZDA 4QAYA 2MJEA 3L16A 3Q3FA 1WJUA 1XXGA 1TZ1A 4HEA1 3KUCB 3AE8B 1FXAA 1NENB 4BOSC 4DDID 3ML8A 3UQBA 2DAFA 2KMCA 4JPSA 4KGSA 4C4VB 4MDKE 3MP9A 4REZA 1BT0A 2LJ5A 2K5PA 4ZOHC 2KQ7A 2KKCA 2ON8A 2JXXA 2UYZB 4C56C 4HKZE 3ZIMA 3BYYB 1DOIA 4O1NA 1WGHA 3X23A 4L2YA 2VZKD 3IAM1 3VXWA 1KH0A 1K50A 3PRPB 1FCCC 2LWPA 2NBUA 5G2NA 4HVBA 2FCNA 3V05A 2WXMA 3KYCD 2L0FA 3HK0A 2GMIC 5E6PA 4EUTA 2DYMA 2QILA 4H2AA 1F77A 3LB8C 1A5RA 3UIPB 1NI3A 3B0AA 1C9FA 4N6EB 3PS6A 3SFDB 4YSYB 4M02A 3X0WA 2JSVX 1VJKA 1L0VB 1V1PB 4GB9A 4OZBA 3A33B 1P7FA 3AXCA 2KN4A 1RRBA 4GGQA 3N1YC 5HG2A 3TEXA 5MPOA 3M63B 2N9LA 4M0WA 3AE7B 4P6VF 3RZFA 2JZZA 2ASQA 1XLQA 2FCMA 1QLBB 1D3ZA 3APCA 4OZCA 4ANWA 3NRZA 2FCSA 2IO2B 3AECB 1P7EA 2OEDA 3KW5B 4KGTA 1GC7A 4N58A 2IY1B 3DVGY 2QJLA 4CO7A 4PYZA 4BVUC 2LRWA 5EDSA 3TJPA 2KOXA 4OVVA 3PRMB 2HJ1A 2CJNA 3KUDB 4K7WA 3SFEB 1EF5A 1TY2A 4DXGA 1SB3C 2MBBB 3H7SA 4EZLA 2JVCA 4M8NA 1HE8A 4Q2JA 2BYEA 1WF9A 2NS5A 1K8RB 4E74A 1UWMA 4NQKE 2IPKD 1C1YB 2AEHA 4TUUA 1E8XA 2W3RA 3KWLA 1B1ZA 4WWNA 4MGKE 1T0QC 2DZIA 4LJOB 3T8MA 1L5PA 3MC8A 3NZUA 2WDTB 1I42A 4MGYE 2AL6A 4BOZB 3AEEB 1UH6A 2FAZA 2KWDA 3C19A 4GSWA 1ZXIA 2CS4A 3TL5A 1ENFA 1UNSA 4HDOA 4NZLB 4JX1C 5IOIA 2PVOD 3APFA 1E8WA 1QOFA 2W9NA 3N1XC 2CU1A 4MGIE 2V0GA 4US8A 4AWJA 3NG0A 2I2YA 2Y3AA 1TS5A 3IFWB 4FJZA 3L54A 4IM3A 3E56A 1FXIA 1N6ZA 1LM8B 2ONQA 3PZ7A 4RCOA 1HEZE 1KLUD 2KX0A 3KLSX 1MPEA 5DPTA 4ANXA 5E6JA 4ARCA 5TR5A 3TBLD 5JZEB 1I4PA 4MT5A 3DWGC 2L1AA 3Q2AC 2EMTA 1M4VA 2KWVB 4AP4C 4RH6A 1E90A 4F1SA 1WGRA 3CSFA 4TKNA 1JRPA 5BYQA 2L8JA 2N7JA 2ZPYA 2V1YA 2N7DA 3A1QA 2SEBD 1LQBA 3NY5A 2NBWB 1YMHE 4JGHB 3B9JA 1WXAA 5AZGA 2LVQA 1GB4A 5D6JB 3EA6A 4R3DA 5CX3A 1FFUA 3N20C 2DBYA 4LTUA 2AQ1B 4PK1A 5C2TB 4GMVA 3I63C 1L7YA 4HJKA 1DYQA 3AEFB 1MG4A 3A4SC 5AZFA 4WJQA 1HTOA 2LXAA 4NPNA 2GBMA 5EE9A 4A3OA 3UQAA 2RDGA 4IWOA 2DLBA 1OGWA 2N9EB 4YWGG 1JWAD 1V6EA 2BYTA 2D10A 3AH7A 3ZXRA 3QAQA 2KC2A 2V4IB 3CMMB 3A9KA 3ABVB 2BGFA 3ZGZA 3NVZA 4RF1A 1NI2A 5AUKA 2MCNB 2WYQA 2O2VA 4XE0A 3ZUNA 2YLMA 3H8HA 1ROEA 1RM6C 3QK0A 2KXJA 2WXLA 1UZXB 3WAPA 2B3AA 2GBJA 4W9JA 1QOGA 4E3CA 2ZW0A 2DYBA 5LNK1 2RPQA 1D4BA 4DHJD 4HRSA 5TSSA 2Y5BB 2LGYA 2LRUA 2AQ3B 4G11A 2DNFA 1ZGUB 3V62A 3W9CB 3UI3A 1YOVB 3TEZA 3HM3A 3I5JC 2JF5A 3L17A 3WAMA 4ZRQA 1A70A 3NZSA 3CF6E 3BVZA 3DBHI 1SE2A 3VVWB 3DHGC 1N63A 3VTUA 4A9AA 1E5WA 2KFJA 2J42A 2MW5A 2IO3B 5T8IA 3SD5A 2M19A 4MH8A 2H88B 4PS3A 2IGHA 1UBQA 4WJPA 3IT4B 1LO5D 2JT4B 3ECIA 3I57A 4LNNA 2EKIA 2ZNVC 3ML9A 1E6EB 3V6EB 1CMXB 5KHQA 4W9LA 3RNAC 4ZHOA 2KTRB 2KWUB 4BZAA 1JWMD 3AEAB 3PHWB 3C0RB 4LK0M 1I4QA 4GDKB 2XK5B 2LGSA 2KACA 1V9JA 3N32A 1WIAA 1SSNA 5D2MB 1QQRA 2HD5B 2KT7A 1I35A 3NUHB 2ZVOA 2KVRA 4C80A 1OTRB 3C8YA 4NJ7A 4YT0B 1OEYA 3QA8A 5FR6A 2KLGA 4B0EA 2INPE 1ZUD2 1HZ6A 2LGXA 4FULA 2KFKA 1B9RA 3MHZA 4I6PA 1YD8U 2DZMA 4WJNA 1MFWA 2FCQA 3DCGA 1FEHA 1SIJA 3APDA 4ZDVA 3TEYA 4B0MA 1VDVA 2LUEA 4S0RA 1TJEA 3BWUD 2L52A 2J52A 3ZQ4A 1F2RI 2IBIB 1ACCA 3QJZA 2AYOB 1TIFA 1YX5B 2PIAA 2K8HA 2LFIA 2MBOA 1JWBD 2D2QA 2D5GA 3Q69A 2AL3A 4WWPA 1EWCA 4LCDE 4KSLC 4DBGA 2G1EA 3AM9A 1SBBB 2V4LA 1VR9A 3PGEA 2OHFA 4A6QA 2I38A 3I3TB 2KYWA 3DVGX 1MI0A 1D5MC 3BINA 3VQIA 1N61A 4IC7B 1JROA 4IWQA 3AU5A 2KWCA 5CHVC 3VRBB 3DBHB 4W9IA 1VD2A 1RFKA 1TT5B 1SXTA 1I4XA 3ZNZB 3W5VB 3CIRB 2GB1A 1Q10A 1FD6A 1F52A 2WU5B 1JRUA 4K1RB 4LNKA 4WAAA 3ZNID 1QOBA 1YIWA 3BVGA 1TKEA 5EE1A 2ZJDA 4WWMA 1FMAD 5G55A 2IDYA 3PRZA 2J0KA 4A3PA 1XLPA 4FADA 3DBLB 1C4AA 1EM7A 2PJHA 3L0WB 5HI1A 4GLSC 1JWSD 2SAKA 2RSUA 2BKFA 3RT3B 5C3JB 2R2OA 2H89B 3RNEC 2G9HD 2W55A 2FIFA 5AEKB 1AYFA 4PS7A 5G5HA 3KVFB 4IWPA 3PT2B 4ZHPA 1IGCA 2V9HA 1WRIA 4C7ZA 5DPWA 4G50A 2JZ3B 2ZNVB 4HK2A 2VRRB 1AW7A 3NOBA 5C23A 5I4DA 2KMMA 4NAWB 3TIXA 4K3BA 2GBNA 1K51A 1TBEA 2IJ0A 3VHTC 1CZPA 4XZ4A 2K8BA 4GIVA 2WXOA 2CU3A 1TS2A 2FUHB 1QOAA 3PLUA 2J0MA 2N1VA 4DXFA 3GP7A 1C76A 3UGBB 4D2KA 1T0RC 2BWFA 4WJOA 1XQQA 3ZKJC 2JUOA 3EFUA 3Q8CA 1AN8A 1C79A 1FNUA 4NJ6A 4YTNB 4ASWC 4USAA 3Q8BA 2XEWA 4NQLB 2WS3B 2N0SB 1RYJA 1XO3A 2LGIA 4YTPB 3IAS1 1FIQA 2KVZA 1WXSA 2BF8B 5IO9A 1ZW7A 2LUMA 5BMHA 3P4QB 3GZNI 3MJ5A 3R7QA 1WR6E 1KLGD 2M56B 4HPLB 2X38A 3PLVA 4C4VA 3MJWA 2L00B 1IGDA 4W9KA 3U30A 1ZE3D 2Y5CA 1VZ6A 4A8XC 1P3QU 1ZPSA 3GE3C 1V81A 5KHOA 1KFYB 3AE4B 2QC8A 2W3SA 2K25A 1I7HA 1L6VA 1GJZA 4ZRJA 2GI9A 3RNGC 2MSED 3M62B 3EGRA 1DGJA 1V80A 3HVDA 1FFVA 4AS1A 3MHSD 1E7PB 3MFGA 4JE3B 1SE4A 5J18A 4M00A 3VR9B 2MX2A 3A4RA 2LHDA 3R2IA 4FXCA 3VTVA 1S1QB 1C4PA 4IM0A 1WJ6A 3SU8X 2K6DB 2C7NB 2WX1A 4FN2A 5D3IB 1SEBD 3GOEA 5BMGA 3WAOA 5E6NA 5JHAA 3NZ3A 1P0RA 4AQ7A 4NY0A 3P4PB 3KYDD 1F0ZA 1WWTA 4BKTA 4CQNA 5FR3A 1DOYA 3QX1A 2D07B 1LFDA 1MHXA 3NS1A 1H4RA 1KRHA 2W82A 2BB5A 1U4AA 2MHJA 1EO6A 3LYYA 1WMHA 4LJPB 3SDLC 3ZO5B 4HPMB 2HE7A 3NVWA 3Q3OC 4LDTD 4ARIA 3U52E 1WJNA 1LGRA 1YJJA 2A5UA 2DZJA 5BMIA 4KKJA 2ZVNA 2OJWA 2L0TA 2DYOA 4JWUC 4XDCA 3RNBC 2QSDA 1Y8RC 1UELA 2WDRB 2XNAC 2PMVA 1T0YA 2KHWB 2NPTA 4KIKB 4OVZA 5D3DA 4W9FA 3AEGB 2QEJC 3ZRCA 3ZW3A 3A1QB 3T3NA 3OG5A 4W9CA 4WURA 1I4RA 3D32A 3GZNB 3ETRA 3Q6BA 4I6LB 4NAMA 2INCC 2R2QA 2DENB 2LASA 1EU3A 2K3UA 2GRIA 3M3JA 3AE1B 2JRHA 2VZKB 1HTQA 2ZEQA 2FNJB 2PPHA 3PTFC 3KH0A
chains in the Genus database with same CATH topology
2WLBA 2YEPF 1NEKB 1E6EB 3R8BA 2FE8A 4UDUC 2BT6A 3VR8B 1UUPA 4ZHOA 4HKQA 3B2GA 2V3PA 1JWMD 1QKZA 3I9V1 1IBXB 1E10A 3AEAB 2QIEB 2PVGC 1YN5A 4IOIE 3Q8EA 1HA5A 4LK0M 1I4QA 4GDKB 3VRAB 1L4DB 2KACA 4HROA 1SSNA 2NMQA 1N62A 1QF6A 1QQRA 3SEBA 1J7CA 3FILB 4ZRPA 3NVVA 3IT6B 3NUHB 2WXGA 1N5XA 4C80A 5JXVA 1CQVA 3TSSA 2K0PA 3KQ4A 2MJ3A 1NYQA 3C8YA 4YSXB 3W2DA 1IUEA 1UWXA 1D5XC 1ZDVA 2LEKA 1JW9D 3AMZA 3TEWA 2WXFA 1D6EC 4KKIA 4YT0B 5H92C 1V1PA 4RGOS 1GAQB 4B0EA 2JYEA 2MEKA 2BS4B 1DOXA 2INPE 1C77A 1GT8A 1EWYC 1ZUD2 1HZ6A 1TS4A 2WXQA 1ZXHA 1I4GA 2K22A 1Y56A 5HHDG 3WCQA 1V8CA 1FCLA 1B9RA 1R7SA 2IGDA 1YNTE 3MHZA 3Q8AA 4RGMA 5G5GA 1OQRA 1L0XB 2MJEA 1FEHA 1SIJA 3TEYA 4B0MA 1T3QA 1VDVA 2V3NA 1XXGA 1TJEA 3BWUD 4HEA1 2PKOA 2L52A 2J52A 3ZQ4A 3AE8B 1FXAA 1F2RI 1V97A 1C4CA 1NENB 1ACCA 1N5WA 2RPVA 2B76B 3PO0A 2JYTA 1HQRD 2LMCA 2WXKA 2KAJA 1SJHD 4KGSA 4JPSA 3MP9A 3RFZB 4REZA 5GXGB 2PIAA 4DQOC 2LFIA 1JWBD 2K5PA 2D5GA 3Q69A 4ZOHC 2ON8A 1EWCA 3AE9B 1NVID 2G1EA 3AM9A 1SBBB 2IGGA 4C56C 4HKZE 1XCTL 2L83A 1VR9A 4A6QA 2OHFA 5EE0A 2I38A 3BYYB 1DOIA 1N60A 4JWSC 4O1NA 3U2SC 1CK1A 3O13A 5BYRA 2QMTA 4L2YA 2VZKD 3IAM1 1KH0A 1MI0A 1D5MC 3VQIA 1N61A 2E6XA 2N9KA 2MJDA 3EUB2 1K50A 1JROA 1FCCC 1YQ3B 1OFFA 2W54A 3VRBB 3DWMA 3J9CA 3V05A 1RFKA 2L32A 2WXMA 4RGNA 1SXTA 2JQRB 4IDIA 1I4XA 2DYMA 2QILA 4H2AA 1MHHE 1F77A 3LB8C 2Z8LA 1NI3A 3ZJVA 3W5VB 1C9FA 4N6EB 3CIRB 1KTKA 1E0ZA 1VZ7A 3SFDB 2GB1A 1Q10A 1GTHA 4YSYB 1SJED 1FD6A 2WU5B 2WDVB 2JSVX 3AN1A 4TQ1A 1VJKA 1L0VB 1WSPA 4TQ0A 1QOBA 1SF0A 1V1PB 1T5XD 4OZBA 3BVGA 1TKGA 1P7FA 1TKEA 1I4HA 1WGKA 5EE1A 2LJIA 2KN4A 2WXJA 4N59A 4WWMA 3ZYYX 2INNE 1FMAD 2IDYA 1TYGB 4KGRA 5HG2A 2WP9B 3TEXA 5MPOA 1J7AA 1XEEA 1XLPA 2N9LA 2XN9C 2Y5PA 4M0WA 1FO4A 1XF5L 1GB1A 4OW0A 3AE7B 1K52A 4P6VF 1C4AA 1EM7A 1XLQA 5HI1A 3BK2A 1JWSD 4GLSC 2JU6X 1E9MA 2SAKA 3P4RB 1QLBB 1AWDA 1ZOYB 1XLNA 5C3JB 4OZCA 2H89B 3L4PA 3NRZA 2G9HD 3AECB 4MACA 1P7EA 2OEDA 2W55A 2PW9A 1AYFA 4KGTA 2PTLA 4N58A 2DWQA 1FNVA 5G5HA 2QJLA 1H7XA 1YQ4B 3AE6B 2BB6A 4ZHPA 1TKYA 1IGCA 2WXPA 1WRIA 4WQMA 2CJNA 2WQYB 3SFEB 4C7ZA 4ITKA 1TY2A 1VRAB 4EE2A 3AE3B 2NTSA 4DXGA 1SB3C 4KX6B 3FC4A 1RWSA 1AW7A 5I4DA 1KF6B 1STEA 2KMMA 3RPFC 1TY0A 3MC0B 4Q2JA 1PUTA 4NAWB 4YSZB 4YXDB 1BUIC 1FM0D 1K51A 2IJ0A 3P63A 1CZPA 3R2TA 1IBXA 4PT5A 2J53A 2WXOA 1UWMA 3CF4A 2J4XA 2CU3A 1TS2A 1WYGA 1YN3A 2IPKD 2KDMA 3E9SA 1XCQL 1HXYD 1QOAA 2WU2B 4A90A 1J7BA 1ZP0B 3AB5A 4DXFA 2W3RA 3GP7A 1C76A 1B1ZA 3KWLA 3FILA 1L0YB 4D2KA 1PGAA 2PLPA 4MM3B 4RNAA 2NTTA 1ET6A 1L5PA 4LLGM 2MH7A 3GS2A 3Q8CA 4L1BA 3Q8FA 1BXTA 1UGJA 1AN8A 1C79A 1FNUA 4US9A 3AEEB 4YTNB 3AEDB 1PGBA 2KWDA 4USAA 1ZXIA 3W1SA 3Q8BA 1ENFA 4XDDA 1UNSA 3PZ8A 2WS3B 5D7GA 4NZLB 4JX1C 2N0SB 2PVOD 1RYJA 1XO3A 2LGIA 1PFDA 1QOFA 3HVZA 4YTPB 3IAS1 1FIQA 1YN4A 2V0GA 4US8A 2LUMA 2RMMA 5BMHA 1JCKB 3P4QB 3MJ5A 3OWEB 2I2YA 3N9YC 2Y3AA 1TS5A 2HTME 2TSSA 1KLGD 1ESFA 2M56B 3E56A 1FXIA 1TS3A 2X38A 4RGTA 2ONQA 3PZ7A 2FBWB 1WXQA 2E3TA 2YEPB 1IGDA 2AQ2B 4RCOA 2K9XA 3FAHA 1ZDXA 2ZW1A 4J3OD 1HEZE 1GTEA 4XWTA 1JMLA 4P16A 1KLUD 1ZE3D 1MPEA 3KLSX 2M0AA 1VZ6A 2Y5CA 5E6JA 4ARCA 2WDQB 4A8XC 3CWIA 1ZPSA 4HJGE 1I4PA 4MT5A 1KFYB 3AE4B 3DWGC 3P4SB 1VZ8A 2L1AA 1M4VA 4RH6A 1D5ZC 2W3SA 1XLOA 2ICIA 4YTMB 1EU4A 1I7HA 1L6VA 3AE2B 5AUIA 1JRPA 5BYQA 2GI9A 2N7JA 1JALA 3W5UB 3EGRA 1DGJA 1MVKA 2SEBD 3HVDA 1FFVA 4AS1A 1F2RC 1YMHE 2EELA 1E7PB 3V3XA 1JQ4A 3B9JA 3MFGA 4JE3B 1SE4A 3GB1A 1BMLC 3LXFA 3AE5B 3BK1A 1GB4A 2R61A 1T6BX 3VR9B 2JX5A 3EA6A 4WIPA 4R3DA 2LHDA 1FRDA 2WXHA 3R2IA 5FK9C 4FXCA 4OHJA 1FFUA 2DBYA 2Q5WD 2AQ1B 4LTUA 5C2TB 1C4PA 1FRRA 1ET9A 5D3IB 1DYQA 5BMGA 1SEBD 3AEFB 3NZ3A 3T3OA 4AQ7A 3P4PB 1VLBA 1F0ZA 5EE9A 1WWTA 4CQNA 3ZJTA 4GDLB 5FR3A 1DOYA 2RDGA 2DLBA 2BW2A 3KWVA 2BS3B 1H7WA 1MHXA 4YWGG 1JWAD 3NS1A 1KRHA 2W82A 2BB5A 3BYTB 2BYTA 3AH7A 2FUG1 3LYYA 4NJCA 2V4IB 3IXSA 2BBCA 1PYWD 3P42A 4RFBA 3ABVB 2AX5A 4WH4A 3SR6A 3NVZA 4RF1A 3ZGZA 1L6UA 3P1MA 5AUKA 4TSSA 4XE0A 2LHEA 3NVWA 3H8HA 3U7ZA 2BTEA 1ROEA 3AV8A 1RM6C 4ARIA 3U52E 2WXLA 1YJJA 5FKAC 1NYRA 3U4EG 1OQQA 4RF0A 1QOGA 2WXIA 2ZW0A 5BMIA 3HUIA 4KKJA 5LNK1 1K53A 1D4BA 4HRSA 1PDXA 2HDEA 5TSSA 2DYOA 4JWUC 4XDCA 2AQ3B 2QSDA 2KQ4X 1GPXA 2WDRB 2XNAC 2RDHA 4ZYSA 2PMVA 1L4ZB 3URYA 2JXTA 2WXRA 3W9CB 3UI3A 1QILA 4A55A 2JWUA 5BYSA 3TEZA 1GOZA 4OVZA 3AEBB 5D3DA 4L23A 3AEGB 2QEJC 2BS2B 1JWUD 3BIID 4ZRQA 1A70A 3BZDB 3T3NA 4WURA 1I4RA 2WNMA 3ETRA 3BVZA 4NAMA 1SE2A 4IKGA 3BVMA 4XWWA 4WAFA 1N63A 1PGXA 2CJOA 3TUOA 4A9AA 1CJEA 1SE3A 2J42A 3ZJUA 1EU3A 1V1OA 3B2FA 5T8IA 4OZAA 2K3UA 2M19A 5HFYA 1C78A 1FNWA 2H88B 4MH8A 5H8YE 2GRIA 4C7YA 2JZPA 3AE1B 2IGHA 1YJIA 5EE3A 3IT4B 1LO5D 2VZKB 3HRDD 3I57A 1QT9A 1HZ5A 4TMAB 2WXNA 2ACZB 1TZOA 3NVYA 2EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBY A;  2Q5W D;  2WU2 B;  2WLB A;  4LTU A;  3VRB B;  1NEK B;  1J7B A;  1E6E B;  3DWM A;  5C2T B;  1ZP0 B;  1FRR A;  3AB5 A;  2BT6 A;  3VR8 B;  4ZHO A;  2W3R A;  1RFK A;  3B2G A;  3AEF B;  3KWL A;  2JQR B;  1E10 A;  3AEA B;  2QIE B;  3P4P B;  1VLB A;  4IDI A;  2PVG C;  1F0Z A;  5EE9 A;  1WWT A;  3LB8 C;  1DOY A;  3VRA B;  1NI3 A;  1L5P A;  3W5V B;  2BS3 B;  1H7W A;  4N6E B;  3CIR B;  4HRO A;  1E0Z A;  1QF6 A;  1JWA D;  3SFD B;  1N62 A;  3NS1 A;  1GTH A;  4YSY B;  1KRH A;  2WU5 B;  2WDV B;  3AN1 A;  1J7C A;  1VJK A;  1L0V B;  2MH7 A;  1QOB A;  1SF0 A;  3AH7 A;  3NVV A;  1N5X A;  4C80 A;  4US9 A;  3AEE B;  4YTN B;  3AED B;  1TKG A;  1WGK A;  1TKE A;  2MJ3 A;  1NYQ A;  5EE1 A;  4YSX B;  3ABV B;  1IUE A;  2AX5 A;  2LEK A;  4N59 A;  4WWM A;  4USA A;  1ZXI A;  3NVZ A;  3SR6 A;  1L6U A;  1JW9 D;  3AMZ A;  1FMA D;  3P1M A;  2EKI A;  5AUK A;  1TYG B;  4YT0 B;  5H92 C;  2WS3 B;  3NVW A;  2WP9 B;  5MPO A;  4JX1 C;  1GAQ B;  1J7A A;  1XLP A;  2N0S B;  1ROE A;  1RYJ A;  1RM6 C;  1XO3 A;  1PFD A;  2BS4 B;  2PVO D;  3AV8 A;  1FO4 A;  1DOX A;  1QOF A;  3HVZ A;  1YJJ A;  1GT8 A;  4YTP B;  1EWY C;  1NYR A;  3AE7 B;  1OQQ A;  1ZUD 2;  1FIQ A;  4P6V F;  1QOG A;  3HUI A;  4US8 A;  2K22 A;  1XLQ A;  3P4Q B;  3WCQ A;  1V8C A;  1E9M A;  4HRS A;  2HTM E;  1PDX A;  3P4R B;  2W54 A;  1QLB B;  1AWD A;  1ZOY B;  1R7S A;  1XLN A;  2M56 B;  1B9R A;  5C3J B;  1FXI A;  4JWU C;  2H89 B;  5G5G A;  3L4P A;  1OQR A;  3NRZ A;  2FBW B;  1WXQ A;  2WDR B;  2E3T A;  2MJE A;  3AEC B;  1GPX A;  1SIJ A;  2W55 A;  2K9X A;  1AYF A;  3FAH A;  1T3Q A;  1VDV A;  4N58 A;  3W9C B;  2DWQ A;  1GTE A;  1TJE A;  5G5H A;  2QJL A;  2PKO A;  2Y5C A;  2L52 A;  1H7X A;  3AE8 B;  3AEB B;  2WDQ B;  3ZYY X;  1YQ4 B;  3AE6 B;  1FXA A;  1V97 A;  3CWI A;  1NEN B;  4ZHP A;  3AEG B;  1N5W A;  1TKY A;  4WQM A;  1WRI A;  2BS2 B;  1KFY B;  3AE4 B;  3DWG C;  2CJN A;  3P4S B;  2B76 B;  2WQY B;  3SFE B;  3PO0 A;  3BII D;  2KAJ A;  4C7Z A;  4ITK A;  1A70 A;  2W3S A;  1XLO A;  5GXG B;  4YTM B;  1I7H A;  2PIA A;  1L6V A;  3ETR A;  3AE2 B;  3AE3 B;  5AUI A;  1JRP A;  1JWB D;  4KX6 B;  1SB3 C;  2K5P A;  3FC4 A;  4ZOH C;  1JAL A;  1N63 A;  3W5U B;  1RWS A;  2CJO A;  3AE9 B;  1NVI D;  1CJE A;  1KF6 B;  2G1E A;  4A9A A;  1DGJ A;  3AM9 A;  2KMM A;  3RPF C;  1FFV A;  1PUT A;  3B2F A;  2L83 A;  4YSZ B;  2M19 A;  2OHF A;  4YXD B;  5EE0 A;  2H88 B;  5H8Y E;  1E7P B;  4JWS C;  1DOI A;  1N60 A;  1FM0 D;  3B9J A;  4C7Y A;  1JQ4 A;  3AE1 B;  3P63 A;  1CZP A;  1QOA A;  1YJI A;  3LXF A;  5EE3 A;  3AE5 B;  1N61 A;  3VR9 B;  2JX5 A;  1UWM A;  3CF4 A;  3HRD D;  2MJD A;  3EUB 2;  2CU3 A;  1JRO A;  1FRD A;  1QT9 A;  1WYG A;  2ACZ B;  1YQ3 B;  3NVY A;  4FXC A;  1FFU A;  1OFF A; 
#chains in the Genus database with same CATH topology
 2WLB A;  4K7U A;  2IND C;  4M01 A;  4HKQ A;  3A9J A;  3B2G A;  1IBX B;  2QIE B;  4AJW A;  3H9D A;  1YN5 A;  2K1F A;  4LNO A;  1LXD A;  2NBV B;  2DZK A;  1L4D B;  3DVN V;  4HRO A;  1WE6 A;  4KV2 A;  1J7C A;  3FIL B;  4HDQ A;  2O2V B;  3NVV A;  1WZ3 A;  1N5X A;  1WX9 A;  1CQV A;  3MTN B;  1NYQ A;  4YSX B;  1WJ4 A;  5DPR A;  1IUE A;  2LI5 A;  3AMZ A;  1OEY J;  2WXF A;  1D6E C;  1YJ1 A;  5IKC M;  2YVC A;  2JYE A;  2MEK A;  3RD2 A;  1EWY C;  1TS4 A;  1I4G A;  2O6V D;  4CHK A;  1R7S A;  1YNT E;  4RGM A;  1M94 A;  3QIJ A;  1T3Q A;  5LXH A;  1FPY A;  2M0X A;  1WXV A;  4FHJ A;  1V49 A;  1KLV A;  1V97 A;  1N5W A;  3QHT A;  2RPV A;  3PO0 A;  2JYT A;  1HQR D;  2KAJ A;  1SJH D;  4XYC A;  3RFZ B;  1SE9 A;  2A4Z A;  1NVI D;  3TCA A;  1UD7 A;  4BKS D;  1XCT L;  2QHO A;  2L83 A;  2LXC A;  2LGD A;  1UF0 A;  1CK1 A;  1WXM A;  3O13 A;  1ISN A;  2L3Z A;  3LDZ E;  2RGF A;  2MJD A;  3EUB 2;  3JSV A;  1WE7 A;  1OFF A;  2W54 A;  4RMA A;  2K8C A;  3DWM A;  4RM8 A;  2KD0 A;  1PQS A;  3K9P B;  4RGN A;  2JQR B;  2KDI A;  4G3X B;  3RZW C;  2KNB A;  1MHH E;  1R4N I;  2GLS A;  3AU4 A;  3ZJV A;  1KTK A;  1E0Z A;  4WWO A;  3AN1 A;  4TQ0 A;  2D3A A;  1WSP A;  4MM3 A;  2LD9 A;  1T5X D;  3V6C B;  1TKG A;  3WAL A;  2L05 A;  1WGK A;  1I4H A;  5E6O A;  2JWZ A;  2WXJ A;  2INN E;  1WI0 A;  2WP9 B;  1R4M I;  2JPH A;  3UIO B;  1J7A A;  1XEE A;  2XN9 C;  2Y5P A;  1FO4 A;  1P9D U;  2HTH A;  4OVU A;  1XF5 L;  1GB1 A;  5D94 A;  1K52 A;  2M8S A;  2XBB C;  4IG7 B;  3DBL I;  3OAW A;  2KJH B;  3H7P A;  1UBI A;  3P4R B;  4LNI A;  1ZOY B;  2KN5 A;  2C60 A;  3PSE B;  4MAC A;  3DQV A;  2CHZ A;  3DHI C;  5GMV A;  4DK5 A;  2C9W B;  1YQ4 B;  3AE6 B;  2BB6 A;  3ZTD A;  2LVO A;  2WQY B;  4HPP A;  4DXA B;  3U8Z A;  2UWQ A;  3JW0 X;  3AE3 B;  1WH3 A;  4FJY A;  3PRE A;  3FC4 A;  2N1W A;  4W9G A;  2NR2 A;  4BAX A;  4RM9 A;  1RWS A;  1J8C A;  1KF6 B;  4X57 B;  2ZCB A;  1TY0 A;  5IA7 A;  1PUT A;  4YSZ B;  3Q3M C;  1EUV B;  3L13 A;  3P63 A;  4PS8 A;  2MQJ A;  4KDL B;  4EKU A;  2J53 A;  3CF4 A;  2KDM A;  3E9S A;  4GDK A;  3VDZ A;  1XCQ L;  3PPA A;  2WU2 B;  2MP2 A;  2M1M A;  3RNC C;  1ZP0 B;  3RNF C;  3U7D A;  4RNA A;  1AAR A;  1ET6 A;  4JIO U;  3ZVV A;  4LLG M;  5LLI A;  2MH7 A;  4GDL A;  1UGJ A;  2GBK A;  4US9 A;  2PEA A;  1PGB A;  4F7Z A;  3W1S A;  4WQO B;  4XDD A;  4N9F 4;  3N30 A;  3PZ8 A;  4IW0 A;  4KZ0 A;  4EFO A;  5D7G A;  3B1L X;  1R4N B;  3HVZ A;  2I1J A;  4A20 A;  1YN4 A;  4KDI C;  4B9K A;  2IYD B;  4BBN C;  2HTM E;  2KQS A;  4DHJ B;  2K6Q A;  2Z59 B;  3HM6 X;  1TS3 A;  2KK8 A;  2DHZ A;  3P2B A;  2DX5 B;  2E3T A;  2YEP B;  1IP9 A;  2K9X A;  4XGA B;  2O6V A;  2KJ6 A;  4XWT A;  1R4M B;  2N9X A;  3HHM A;  4FHK A;  2WDQ B;  3VH3 B;  2WHI A;  1VZ8 A;  3EC8 A;  1EU4 A;  3WIM A;  3AE2 B;  2ZCC A;  3T9L A;  5HKH A;  3Q3J A;  4P1C C;  1JAL A;  2N4F A;  3IBE A;  2REX A;  1J19 A;  4MJS A;  2EEL A;  1JQ4 A;  4ICV A;  3GB1 A;  1BML C;  3BK1 A;  2R61 A;  3AUL A;  4MGZ E;  2JX5 A;  4JLC A;  2RD0 A;  2X8X X;  4BKS A;  2WXH A;  5FK9 C;  1SIF A;  2FID A;  2G3Q B;  1VLB A;  2G45 B;  2IO1 B;  4IUM B;  1WY8 A;  3ZJT A;  2BW2 A;  1GNU A;  1H7W A;  4HCN B;  2BKR B;  3NS8 A;  2FUG 1;  3IXS A;  2BBC A;  3N1Z C;  3P42 A;  4RFB A;  2AX5 A;  2GBR A;  3SR6 A;  1L6U A;  3P1M A;  4W9E A;  3UIN B;  4M8M A;  2BTE A;  1G6J A;  3RYT A;  4II3 B;  2Z0D B;  3PHX B;  5FKA C;  1NYR A;  1OQQ A;  4II2 B;  4GN1 A;  2WXI A;  4P1B C;  5CHW A;  2L7R A;  3K9O B;  2HDE A;  2PE6 B;  4M0W B;  2KQ4 X;  2RDH A;  4ZYS A;  2VH2 A;  1L4Z B;  2G4S A;  2JXT A;  2CKH B;  1QIL A;  2QCZ A;  2JWU A;  2AWT A;  4L23 A;  2BYV E;  3DPD A;  1E8Y A;  1JWU D;  4NAW A;  3Q14 C;  3BZD B;  1WM3 A;  4KVG B;  3LJ3 A;  2WNM A;  4IKG A;  4XWW A;  1PGX A;  1CJE A;  2EMS A;  1TGZ B;  4DHZ B;  3ZJU A;  2D3G A;  4OZA A;  1FNW A;  3RCZ A;  4EZK A;  1YJI A;  4C00 A;  2L76 A;  3HRD D;  3QC8 B;  3VAW A;  4TMA B;  2ACZ B;  1TZO A;  3NVY A;  2VH1 A;  2MBE A;  2YEP F;  2C7M B;  2FE8 A;  1E8Z A;  4UDU C;  3VR8 B;  1UUP A;  2V3P A;  1QKZ A;  1E10 A;  1WX7 A;  2PVG C;  4IOI E;  4NNJ B;  1HA5 A;  5C1Z A;  4EOY A;  3VRA B;  1WMH B;  1KOT A;  5DCN A;  1WFY A;  1N62 A;  3SEB A;  2KTF A;  3ZNG C;  3VFK A;  3Q3N C;  3TSS A;  4CYE A;  4F8C B;  2MJ3 A;  1J0G A;  1UWX A;  1D5X C;  1ZDV A;  1Z5S B;  1JW9 D;  4ZYN A;  3TEW A;  1P1A A;  3V61 A;  1V1P A;  4E71 A;  4RGO S;  1GAQ B;  3RN9 C;  2QDF A;  5AZH A;  4MSM B;  1ZXH A;  5HHD G;  1V8C A;  5IAA C;  4EEW A;  1QZE A;  3ALB A;  2IGD A;  2OOB B;  2HJ8 A;  2NPT B;  5G5G A;  1OQR A;  4J6I A;  2RR9 A;  3ZXV A;  3W1Y A;  3KUZ A;  2V3N A;  4BFR A;  3ZLZ A;  3VUY A;  4JL9 A;  2PKO A;  1C4C A;  4GU2 A;  4GXB A;  2B76 B;  4HCP B;  2LMC A;  2WXK A;  1TTN A;  2JY6 A;  5GXG B;  1GUA B;  2OJR A;  4DQO C;  4PYU A;  1RFA A;  1IYF A;  1F9J A;  3AE9 B;  2IGG A;  3CST A;  2CR5 A;  1XT9 B;  1E7V A;  5EE0 A;  4JWS C;  1N60 A;  5IP4 D;  2JRI B;  3U2S C;  3QCA A;  1NBF C;  2QMT A;  5BYR A;  3RUL A;  3A9J B;  2E6X A;  2N9K A;  3VUX A;  1YQ3 B;  2DAJ A;  2PE9 A;  2WGS A;  1GC6 A;  3J9C A;  3S2A A;  4W9D A;  2EKE C;  2L32 A;  5CTR C;  3M95 A;  4IDI A;  2MBQ A;  2Z8L A;  4YL8 A;  5L83 A;  1IPG A;  1VZ7 A;  1GTH A;  1SJE D;  2ZZP B;  1V5O A;  2WDV B;  4TQ1 A;  1SF0 A;  3DOW A;  3RMK C;  2LJI A;  4N59 A;  3VUW A;  3ZYY X;  4DWF A;  1WR1 A;  1TYG B;  4KGR A;  3PVL A;  5JHB A;  3W1S C;  5IN7 A;  4OW0 A;  4FBJ B;  3A9K B;  3NJT A;  2KMA A;  3BK2 A;  4KIK A;  3DVN U;  2JU6 X;  1E9M A;  2MLB A;  1AWD A;  1XLN A;  3ZDT A;  4W9H A;  3L4P A;  3ZRF A;  1XD3 B;  3H6N A;  1SGH A;  2BYF A;  2PW9 A;  3OJ3 A;  2PTL A;  3B08 A;  2DWQ A;  3VH4 B;  1FNV A;  4DHZ E;  3R7R A;  1H7X A;  4JQW C;  1TKY A;  2WXP A;  4WQM A;  2MBH A;  1OQY A;  4ITK A;  1VRA B;  4B95 A;  4EE2 A;  4BBN F;  3QQ8 B;  4AUQ C;  1KM7 A;  2NTS A;  3QWZ B;  4KX6 B;  1C3T A;  2G4D B;  2D11 A;  1STE A;  2LVP A;  3RPF C;  3MC0 B;  2J7Q B;  1L2N A;  4IM2 A;  4YXD B;  1BUI C;  3JSV B;  1FM0 D;  1NDD A;  2M4N A;  5LXI B;  3R2T A;  1IBX A;  4GOC A;  1V2Y A;  4PT5 A;  2J4X A;  3EEC A;  1WYG A;  2K39 A;  1YN3 A;  3RI7 C;  3JVZ X;  1HXY D;  2M17 A;  4A90 A;  1J7B A;  2KX3 A;  3AB5 A;  3FIL A;  1L0Y B;  1PGA A;  3L10 B;  2PLP A;  4MM3 B;  5L95 C;  2NTT A;  2I1K A;  1WX8 A;  1MJD A;  2MA9 B;  4I6N B;  3AI5 A;  1P98 A;  3GS2 A;  3PV1 A;  4L1B A;  3Q8F A;  1BXT A;  4ANU A;  3AED B;  3V60 A;  2KJR A;  1F1H A;  4P7I A;  3OJ4 B;  4ZRI A;  3H7P B;  1YQB A;  1PFD A;  4LDT B;  4DDG D;  3IG3 A;  2RMM A;  1JCK B;  3OWE B;  2C5L C;  3N9Y C;  4FLH A;  2TSS A;  1H8C A;  1ESF A;  3DDC B;  3N3K B;  2CHX A;  4RGT A;  3IVF A;  5BO4 B;  2FBW B;  1WXQ A;  3ZDM C;  2LZ6 A;  2C7H A;  2AQ2 B;  4ICU A;  3FAH A;  1ZDX A;  2ZW1 A;  4J3O D;  1GTE A;  1JML A;  4P16 A;  2WWZ A;  2M0A A;  1RLF A;  2KFK B;  2KDF B;  1Q0W B;  3CWI A;  4HXD A;  4HJG E;  3P4S B;  2KZR A;  1D5Z C;  1XLO A;  2ICI A;  4YTM B;  1GG3 A;  1ZKH A;  4URK A;  1T0S C;  2NVU I;  5AUI A;  3W5U B;  1YX6 B;  1MVK A;  4ANV A;  1F2R C;  3DHH C;  3V3X A;  1FXT B;  2MP2 B;  4ACF A;  3LXF A;  3AE5 B;  3BY4 B;  4XC2 A;  1T6B X;  1WGG A;  4MH0 E;  4WIP A;  1FRD A;  2WX0 A;  4OHJ A;  3R3M A;  1WZ0 A;  2Q5W D;  1EF1 A;  3GE8 C;  3DBR I;  1FRR A;  1ET9 A;  4KZC A;  3T3O A;  3R66 C;  4K3C A;  4S17 A;  1E7U A;  2IY0 B;  4GDL B;  4ZRK A;  2KDB A;  2KTR A;  3KWV A;  2BS3 B;  2IZV B;  4K81 A;  4MEM A;  3ENE A;  3BYT B;  4KSK C;  4HWI B;  1X1M A;  2XK5 A;  4NJC A;  5JH5 C;  1PYW D;  1V5T A;  2BVC A;  4WH4 A;  5CHF A;  3MC9 A;  2RDB C;  2N9P C;  4TSS A;  2LHE A;  1WYW B;  2KC1 A;  4K7S A;  3U7Z A;  3AV8 A;  3U4E G;  3EFC A;  1RAX A;  1S3S G;  4RF0 A;  3TMP B;  2KDE B;  3HUI A;  2GOW A;  2CHW A;  1K53 A;  2D3B A;  2O6V B;  1PDX A;  2KLC A;  1GPX A;  5J2R A;  1MG8 A;  3URY A;  4A55 A;  2WXR A;  3HIZ A;  4G0N B;  3UF8 A;  4LNF A;  3WAN A;  5BYS A;  1GOZ A;  3AEB B;  3NHE B;  2ZPN A;  2BS2 B;  4FA6 A;  3EHV A;  3BII D;  3SHQ A;  2V3S A;  3FKY A;  4MJS B;  2UU7 A;  3BVM A;  4WAF A;  2J0J A;  2KO3 A;  3TUO A;  2CJO A;  3ZNH B;  1Z2M A;  1SE3 A;  1V1O A;  3B2F A;  2BQQ A;  1C78 A;  5HFY A;  5H8Y E;  1WGD A;  4BKG A;  4C7Y A;  2JZP A;  5EE3 A;  2BPS A;  1VCB A;  1QT9 A;  1HZ5 A;  2WXN A;  2D3C A;  2BWE S;  1NEK B;  3R8B A;  2BT6 A;  2Z0E B;  1WGY A;  3ZTC A;  3I9V 1;  4HLE A;  1V86 A;  3Q8E A;  3WA0 A;  2MWS B;  3DBS A;  5DPS A;  2NMQ A;  1QF6 A;  1WRD B;  2IO0 B;  4AJY B;  4ZRP A;  4MEL A;  3IT6 B;  4XX5 A;  2KAN A;  2WXG A;  3JYU A;  3OLM D;  3RUI B;  5JXV A;  4EZJ A;  2K0P A;  3KQ4 A;  4TV3 A;  4B6W A;  3W2D A;  1KJT A;  2LEK A;  3DBR B;  4FJV B;  4KKI A;  5H92 C;  3O65 B;  3ONS A;  3IHP C;  3QAR A;  2BS4 B;  2NCN A;  1DOX A;  1C77 A;  1GT8 A;  1Q5W B;  1WM2 A;  5J17 A;  2WXQ A;  4MSQ B;  3H1U A;  2K22 A;  1Y56 A;  3WCQ A;  3VTW A;  4AOF A;  1FCL A;  2N7E A;  1UGM A;  1Q1O A;  3Q8A A;  3L08 A;  1L0X B;  2MRP A;  3PZD A;  4QAY A;  2MJE A;  3L16 A;  3Q3F A;  1WJU A;  1XXG A;  1TZ1 A;  4HEA 1;  3KUC B;  3AE8 B;  1FXA A;  1NEN B;  4BOS C;  4DDI D;  3ML8 A;  3UQB A;  2DAF A;  2KMC A;  4JPS A;  4KGS A;  4C4V B;  4MDK E;  3MP9 A;  4REZ A;  1BT0 A;  2LJ5 A;  2K5P A;  4ZOH C;  2KQ7 A;  2KKC A;  2ON8 A;  2JXX A;  2UYZ B;  4C56 C;  4HKZ E;  3ZIM A;  3BYY B;  1DOI A;  4O1N A;  1WGH A;  3X23 A;  4L2Y A;  2VZK D;  3IAM 1;  3VXW A;  1KH0 A;  1K50 A;  3PRP B;  1FCC C;  2LWP A;  2NBU A;  5G2N A;  4HVB A;  2FCN A;  3V05 A;  2WXM A;  3KYC D;  2L0F A;  3HK0 A;  2GMI C;  5E6P A;  4EUT A;  2DYM A;  2QIL A;  4H2A A;  1F77 A;  3LB8 C;  1A5R A;  3UIP B;  1NI3 A;  3B0A A;  1C9F A;  4N6E B;  3PS6 A;  3SFD B;  4YSY B;  4M02 A;  3X0W A;  2JSV X;  1VJK A;  1L0V B;  1V1P B;  4GB9 A;  4OZB A;  3A33 B;  1P7F A;  3AXC A;  2KN4 A;  1RRB A;  4GGQ A;  3N1Y C;  5HG2 A;  3TEX A;  5MPO A;  3M63 B;  2N9L A;  4M0W A;  3AE7 B;  4P6V F;  3RZF A;  2JZZ A;  2ASQ A;  1XLQ A;  2FCM A;  1QLB B;  1D3Z A;  3APC A;  4OZC A;  4ANW A;  3NRZ A;  2FCS A;  2IO2 B;  3AEC B;  1P7E A;  2OED A;  3KW5 B;  4KGT A;  1GC7 A;  4N58 A;  2IY1 B;  3DVG Y;  2QJL A;  4CO7 A;  4PYZ A;  4BVU C;  2LRW A;  5EDS A;  3TJP A;  2KOX A;  4OVV A;  3PRM B;  2HJ1 A;  2CJN A;  3KUD B;  4K7W A;  3SFE B;  1EF5 A;  1TY2 A;  4DXG A;  1SB3 C;  2MBB B;  3H7S A;  4EZL A;  2JVC A;  4M8N A;  1HE8 A;  4Q2J A;  2BYE A;  1WF9 A;  2NS5 A;  1K8R B;  4E74 A;  1UWM A;  4NQK E;  2IPK D;  1C1Y B;  2AEH A;  4TUU A;  1E8X A;  2W3R A;  3KWL A;  1B1Z A;  4WWN A;  4MGK E;  1T0Q C;  2DZI A;  4LJO B;  3T8M A;  1L5P A;  3MC8 A;  3NZU A;  2WDT B;  1I42 A;  4MGY E;  2AL6 A;  4BOZ B;  3AEE B;  1UH6 A;  2FAZ A;  2KWD A;  3C19 A;  4GSW A;  1ZXI A;  2CS4 A;  3TL5 A;  1ENF A;  1UNS A;  4HDO A;  4NZL B;  4JX1 C;  5IOI A;  2PVO D;  3APF A;  1E8W A;  1QOF A;  2W9N A;  3N1X C;  2CU1 A;  4MGI E;  2V0G A;  4US8 A;  4AWJ A;  3NG0 A;  2I2Y A;  2Y3A A;  1TS5 A;  3IFW B;  4FJZ A;  3L54 A;  4IM3 A;  3E56 A;  1FXI A;  1N6Z A;  1LM8 B;  2ONQ A;  3PZ7 A;  4RCO A;  1HEZ E;  1KLU D;  2KX0 A;  3KLS X;  1MPE A;  5DPT A;  4ANX A;  5E6J A;  4ARC A;  5TR5 A;  3TBL D;  5JZE B;  1I4P A;  4MT5 A;  3DWG C;  2L1A A;  3Q2A C;  2EMT A;  1M4V A;  2KWV B;  4AP4 C;  4RH6 A;  1E90 A;  4F1S A;  1WGR A;  3CSF A;  4TKN A;  1JRP A;  5BYQ A;  2L8J A;  2N7J A;  2ZPY A;  2V1Y A;  2N7D A;  3A1Q A;  2SEB D;  1LQB A;  3NY5 A;  2NBW B;  1YMH E;  4JGH B;  3B9J A;  1WXA A;  5AZG A;  2LVQ A;  1GB4 A;  5D6J B;  3EA6 A;  4R3D A;  5CX3 A;  1FFU A;  3N20 C;  2DBY A;  4LTU A;  2AQ1 B;  4PK1 A;  5C2T B;  4GMV A;  3I63 C;  1L7Y A;  4HJK A;  1DYQ A;  3AEF B;  1MG4 A;  3A4S C;  5AZF A;  4WJQ A;  1HTO A;  2LXA A;  4NPN A;  2GBM A;  5EE9 A;  4A3O A;  3UQA A;  2RDG A;  4IWO A;  2DLB A;  1OGW A;  2N9E B;  4YWG G;  1JWA D;  1V6E A;  2BYT A;  2D10 A;  3AH7 A;  3ZXR A;  3QAQ A;  2KC2 A;  2V4I B;  3CMM B;  3A9K A;  3ABV B;  2BGF A;  3ZGZ A;  3NVZ A;  4RF1 A;  1NI2 A;  5AUK A;  2MCN B;  2WYQ A;  2O2V A;  4XE0 A;  3ZUN A;  2YLM A;  3H8H A;  1ROE A;  1RM6 C;  3QK0 A;  2KXJ A;  2WXL A;  1UZX B;  3WAP A;  2B3A A;  2GBJ A;  4W9J A;  1QOG A;  4E3C A;  2ZW0 A;  2DYB A;  5LNK 1;  2RPQ A;  1D4B A;  4DHJ D;  4HRS A;  5TSS A;  2Y5B B;  2LGY A;  2LRU A;  2AQ3 B;  4G11 A;  2DNF A;  1ZGU B;  3V62 A;  3W9C B;  3UI3 A;  1YOV B;  3TEZ A;  3HM3 A;  3I5J C;  2JF5 A;  3L17 A;  3WAM A;  4ZRQ A;  1A70 A;  3NZS A;  3CF6 E;  3BVZ A;  3DBH I;  1SE2 A;  3VVW B;  3DHG C;  1N63 A;  3VTU A;  4A9A A;  1E5W A;  2KFJ A;  2J42 A;  2MW5 A;  2IO3 B;  5T8I A;  3SD5 A;  2M19 A;  4MH8 A;  2H88 B;  4PS3 A;  2IGH A;  1UBQ A;  4WJP A;  3IT4 B;  1LO5 D;  2JT4 B;  3ECI A;  3I57 A;  4LNN A;  2EKI A;  2ZNV C;  3ML9 A;  1E6E B;  3V6E B;  1CMX B;  5KHQ A;  4W9L A;  3RNA C;  4ZHO A;  2KTR B;  2KWU B;  4BZA A;  1JWM D;  3AEA B;  3PHW B;  3C0R B;  4LK0 M;  1I4Q A;  4GDK B;  2XK5 B;  2LGS A;  2KAC A;  1V9J A;  3N32 A;  1WIA A;  1SSN A;  5D2M B;  1QQR A;  2HD5 B;  2KT7 A;  1I35 A;  3NUH B;  2ZVO A;  2KVR A;  4C80 A;  1OTR B;  3C8Y A;  4NJ7 A;  4YT0 B;  1OEY A;  3QA8 A;  5FR6 A;  2KLG A;  4B0E A;  2INP E;  1ZUD 2;  1HZ6 A;  2LGX A;  4FUL A;  2KFK A;  1B9R A;  3MHZ A;  4I6P A;  1YD8 U;  2DZM A;  4WJN A;  1MFW A;  2FCQ A;  3DCG A;  1FEH A;  1SIJ A;  3APD A;  4ZDV A;  3TEY A;  4B0M A;  1VDV A;  2LUE A;  4S0R A;  1TJE A;  3BWU D;  2L52 A;  2J52 A;  3ZQ4 A;  1F2R I;  2IBI B;  1ACC A;  3QJZ A;  2AYO B;  1TIF A;  1YX5 B;  2PIA A;  2K8H A;  2LFI A;  2MBO A;  1JWB D;  2D2Q A;  2D5G A;  3Q69 A;  2AL3 A;  4WWP A;  1EWC A;  4LCD E;  4KSL C;  4DBG A;  2G1E A;  3AM9 A;  1SBB B;  2V4L A;  1VR9 A;  3PGE A;  2OHF A;  4A6Q A;  2I38 A;  3I3T B;  2KYW A;  3DVG X;  1MI0 A;  1D5M C;  3BIN A;  3VQI A;  1N61 A;  4IC7 B;  1JRO A;  4IWQ A;  3AU5 A;  2KWC A;  5CHV C;  3VRB B;  3DBH B;  4W9I A;  1VD2 A;  1RFK A;  1TT5 B;  1SXT A;  1I4X A;  3ZNZ B;  3W5V B;  3CIR B;  2GB1 A;  1Q10 A;  1FD6 A;  1F52 A;  2WU5 B;  1JRU A;  4K1R B;  4LNK A;  4WAA A;  3ZNI D;  1QOB A;  1YIW A;  3BVG A;  1TKE A;  5EE1 A;  2ZJD A;  4WWM A;  1FMA D;  5G55 A;  2IDY A;  3PRZ A;  2J0K A;  4A3P A;  1XLP A;  4FAD A;  3DBL B;  1C4A A;  1EM7 A;  2PJH A;  3L0W B;  5HI1 A;  4GLS C;  1JWS D;  2SAK A;  2RSU A;  2BKF A;  3RT3 B;  5C3J B;  2R2O A;  2H89 B;  3RNE C;  2G9H D;  2W55 A;  2FIF A;  5AEK B;  1AYF A;  4PS7 A;  5G5H A;  3KVF B;  4IWP A;  3PT2 B;  4ZHP A;  1IGC A;  2V9H A;  1WRI A;  4C7Z A;  5DPW A;  4G50 A;  2JZ3 B;  2ZNV B;  4HK2 A;  2VRR B;  1AW7 A;  3NOB A;  5C23 A;  5I4D A;  2KMM A;  4NAW B;  3TIX A;  4K3B A;  2GBN A;  1K51 A;  1TBE A;  2IJ0 A;  3VHT C;  1CZP A;  4XZ4 A;  2K8B A;  4GIV A;  2WXO A;  2CU3 A;  1TS2 A;  2FUH B;  1QOA A;  3PLU A;  2J0M A;  2N1V A;  4DXF A;  3GP7 A;  1C76 A;  3UGB B;  4D2K A;  1T0R C;  2BWF A;  4WJO A;  1XQQ A;  3ZKJ C;  2JUO A;  3EFU A;  3Q8C A;  1AN8 A;  1C79 A;  1FNU A;  4NJ6 A;  4YTN B;  4ASW C;  4USA A;  3Q8B A;  2XEW A;  4NQL B;  2WS3 B;  2N0S B;  1RYJ A;  1XO3 A;  2LGI A;  4YTP B;  3IAS 1;  1FIQ A;  2KVZ A;  1WXS A;  2BF8 B;  5IO9 A;  1ZW7 A;  2LUM A;  5BMH A;  3P4Q B;  3GZN I;  3MJ5 A;  3R7Q A;  1WR6 E;  1KLG D;  2M56 B;  4HPL B;  2X38 A;  3PLV A;  4C4V A;  3MJW A;  2L00 B;  1IGD A;  4W9K A;  3U30 A;  1ZE3 D;  2Y5C A;  1VZ6 A;  4A8X C;  1P3Q U;  1ZPS A;  3GE3 C;  1V81 A;  5KHO A;  1KFY B;  3AE4 B;  2QC8 A;  2W3S A;  2K25 A;  1I7H A;  1L6V A;  1GJZ A;  4ZRJ A;  2GI9 A;  3RNG C;  2MSE D;  3M62 B;  3EGR A;  1DGJ A;  1V80 A;  3HVD A;  1FFV A;  4AS1 A;  3MHS D;  1E7P B;  3MFG A;  4JE3 B;  1SE4 A;  5J18 A;  4M00 A;  3VR9 B;  2MX2 A;  3A4R A;  2LHD A;  3R2I A;  4FXC A;  3VTV A;  1S1Q B;  1C4P A;  4IM0 A;  1WJ6 A;  3SU8 X;  2K6D B;  2C7N B;  2WX1 A;  4FN2 A;  5D3I B;  1SEB D;  3GOE A;  5BMG A;  3WAO A;  5E6N A;  5JHA A;  3NZ3 A;  1P0R A;  4AQ7 A;  4NY0 A;  3P4P B;  3KYD D;  1F0Z A;  1WWT A;  4BKT A;  4CQN A;  5FR3 A;  1DOY A;  3QX1 A;  2D07 B;  1LFD A;  1MHX A;  3NS1 A;  1H4R A;  1KRH A;  2W82 A;  2BB5 A;  1U4A A;  2MHJ A;  1EO6 A;  3LYY A;  1WMH A;  4LJP B;  3SDL C;  3ZO5 B;  4HPM B;  2HE7 A;  3NVW A;  3Q3O C;  4LDT D;  4ARI A;  3U52 E;  1WJN A;  1LGR A;  1YJJ A;  2A5U A;  2DZJ A;  5BMI A;  4KKJ A;  2ZVN A;  2OJW A;  2L0T A;  2DYO A;  4JWU C;  4XDC A;  3RNB C;  2QSD A;  1Y8R C;  1UEL A;  2WDR B;  2XNA C;  2PMV A;  1T0Y A;  2KHW B;  2NPT A;  4KIK B;  4OVZ A;  5D3D A;  4W9F A;  3AEG B;  2QEJ C;  3ZRC A;  3ZW3 A;  3A1Q B;  3T3N A;  3OG5 A;  4W9C A;  4WUR A;  1I4R A;  3D32 A;  3GZN B;  3ETR A;  3Q6B A;  4I6L B;  4NAM A;  2INC C;  2R2Q A;  2DEN B;  2LAS A;  1EU3 A;  2K3U A;  2GRI A;  3M3J A;  3AE1 B;  2JRH A;  2VZK B;  1HTQ A;  2ZEQ A;  2FNJ B;  2PPH A;  3PTF C;  3KH0 A; 
#chains in the Genus database with same CATH homology
 2WLB A;  2YEP F;  1NEK B;  1E6E B;  3R8B A;  2FE8 A;  4UDU C;  2BT6 A;  3VR8 B;  1UUP A;  4ZHO A;  4HKQ A;  3B2G A;  2V3P A;  1JWM D;  1QKZ A;  3I9V 1;  1IBX B;  1E10 A;  3AEA B;  2QIE B;  2PVG C;  1YN5 A;  4IOI E;  3Q8E A;  1HA5 A;  4LK0 M;  1I4Q A;  4GDK B;  3VRA B;  1L4D B;  2KAC A;  4HRO A;  1SSN A;  2NMQ A;  1N62 A;  1QF6 A;  1QQR A;  3SEB A;  1J7C A;  3FIL B;  4ZRP A;  3NVV A;  3IT6 B;  3NUH B;  2WXG A;  1N5X A;  4C80 A;  5JXV A;  1CQV A;  3TSS A;  2K0P A;  3KQ4 A;  2MJ3 A;  1NYQ A;  3C8Y A;  4YSX B;  3W2D A;  1IUE A;  1UWX A;  1D5X C;  1ZDV A;  2LEK A;  1JW9 D;  3AMZ A;  3TEW A;  2WXF A;  1D6E C;  4KKI A;  4YT0 B;  5H92 C;  1V1P A;  4RGO S;  1GAQ B;  4B0E A;  2JYE A;  2MEK A;  2BS4 B;  1DOX A;  2INP E;  1C77 A;  1GT8 A;  1EWY C;  1ZUD 2;  1HZ6 A;  1TS4 A;  2WXQ A;  1ZXH A;  1I4G A;  2K22 A;  1Y56 A;  5HHD G;  3WCQ A;  1V8C A;  1FCL A;  1B9R A;  1R7S A;  2IGD A;  1YNT E;  3MHZ A;  3Q8A A;  4RGM A;  5G5G A;  1OQR A;  1L0X B;  2MJE A;  1FEH A;  1SIJ A;  3TEY A;  4B0M A;  1T3Q A;  1VDV A;  2V3N A;  1XXG A;  1TJE A;  3BWU D;  4HEA 1;  2PKO A;  2L52 A;  2J52 A;  3ZQ4 A;  3AE8 B;  1FXA A;  1F2R I;  1V97 A;  1C4C A;  1NEN B;  1ACC A;  1N5W A;  2RPV A;  2B76 B;  3PO0 A;  2JYT A;  1HQR D;  2LMC A;  2WXK A;  2KAJ A;  1SJH D;  4KGS A;  4JPS A;  3MP9 A;  3RFZ B;  4REZ A;  5GXG B;  2PIA A;  4DQO C;  2LFI A;  1JWB D;  2K5P A;  2D5G A;  3Q69 A;  4ZOH C;  2ON8 A;  1EWC A;  3AE9 B;  1NVI D;  2G1E A;  3AM9 A;  1SBB B;  2IGG A;  4C56 C;  4HKZ E;  1XCT L;  2L83 A;  1VR9 A;  4A6Q A;  2OHF A;  5EE0 A;  2I38 A;  3BYY B;  1DOI A;  1N60 A;  4JWS C;  4O1N A;  3U2S C;  1CK1 A;  3O13 A;  5BYR A;  2QMT A;  4L2Y A;  2VZK D;  3IAM 1;  1KH0 A;  1MI0 A;  1D5M C;  3VQI A;  1N61 A;  2E6X A;  2N9K A;  2MJD A;  3EUB 2;  1K50 A;  1JRO A;  1FCC C;  1YQ3 B;  1OFF A;  2W54 A;  3VRB B;  3DWM A;  3J9C A;  3V05 A;  1RFK A;  2L32 A;  2WXM A;  4RGN A;  1SXT A;  2JQR B;  4IDI A;  1I4X A;  2DYM A;  2QIL A;  4H2A A;  1MHH E;  1F77 A;  3LB8 C;  2Z8L A;  1NI3 A;  3ZJV A;  3W5V B;  1C9F A;  4N6E B;  3CIR B;  1KTK A;  1E0Z A;  1VZ7 A;  3SFD B;  2GB1 A;  1Q10 A;  1GTH A;  4YSY B;  1SJE D;  1FD6 A;  2WU5 B;  2WDV B;  2JSV X;  3AN1 A;  4TQ1 A;  1VJK A;  1L0V B;  1WSP A;  4TQ0 A;  1QOB A;  1SF0 A;  1V1P B;  1T5X D;  4OZB A;  3BVG A;  1TKG A;  1P7F A;  1TKE A;  1I4H A;  1WGK A;  5EE1 A;  2LJI A;  2KN4 A;  2WXJ A;  4N59 A;  4WWM A;  3ZYY X;  2INN E;  1FMA D;  2IDY A;  1TYG B;  4KGR A;  5HG2 A;  2WP9 B;  3TEX A;  5MPO A;  1J7A A;  1XEE A;  1XLP A;  2N9L A;  2XN9 C;  2Y5P A;  4M0W A;  1FO4 A;  1XF5 L;  1GB1 A;  4OW0 A;  3AE7 B;  1K52 A;  4P6V F;  1C4A A;  1EM7 A;  1XLQ A;  5HI1 A;  3BK2 A;  1JWS D;  4GLS C;  2JU6 X;  1E9M A;  2SAK A;  3P4R B;  1QLB B;  1AWD A;  1ZOY B;  1XLN A;  5C3J B;  4OZC A;  2H89 B;  3L4P A;  3NRZ A;  2G9H D;  3AEC B;  4MAC A;  1P7E A;  2OED A;  2W55 A;  2PW9 A;  1AYF A;  4KGT A;  2PTL A;  4N58 A;  2DWQ A;  1FNV A;  5G5H A;  2QJL A;  1H7X A;  1YQ4 B;  3AE6 B;  2BB6 A;  4ZHP A;  1TKY A;  1IGC A;  2WXP A;  1WRI A;  4WQM A;  2CJN A;  2WQY B;  3SFE B;  4C7Z A;  4ITK A;  1TY2 A;  1VRA B;  4EE2 A;  3AE3 B;  2NTS A;  4DXG A;  1SB3 C;  4KX6 B;  3FC4 A;  1RWS A;  1AW7 A;  5I4D A;  1KF6 B;  1STE A;  2KMM A;  3RPF C;  1TY0 A;  3MC0 B;  4Q2J A;  1PUT A;  4NAW B;  4YSZ B;  4YXD B;  1BUI C;  1FM0 D;  1K51 A;  2IJ0 A;  3P63 A;  1CZP A;  3R2T A;  1IBX A;  4PT5 A;  2J53 A;  2WXO A;  1UWM A;  3CF4 A;  2J4X A;  2CU3 A;  1TS2 A;  1WYG A;  1YN3 A;  2IPK D;  2KDM A;  3E9S A;  1XCQ L;  1HXY D;  1QOA A;  2WU2 B;  4A90 A;  1J7B A;  1ZP0 B;  3AB5 A;  4DXF A;  2W3R A;  3GP7 A;  1C76 A;  1B1Z A;  3KWL A;  3FIL A;  1L0Y B;  4D2K A;  1PGA A;  2PLP A;  4MM3 B;  4RNA A;  2NTT A;  1ET6 A;  1L5P A;  4LLG M;  2MH7 A;  3GS2 A;  3Q8C A;  4L1B A;  3Q8F A;  1BXT A;  1UGJ A;  1AN8 A;  1C79 A;  1FNU A;  4US9 A;  3AEE B;  4YTN B;  3AED B;  1PGB A;  2KWD A;  4USA A;  1ZXI A;  3W1S A;  3Q8B A;  1ENF A;  4XDD A;  1UNS A;  3PZ8 A;  2WS3 B;  5D7G A;  4NZL B;  4JX1 C;  2N0S B;  2PVO D;  1RYJ A;  1XO3 A;  2LGI A;  1PFD A;  1QOF A;  3HVZ A;  4YTP B;  3IAS 1;  1FIQ A;  1YN4 A;  2V0G A;  4US8 A;  2LUM A;  2RMM A;  5BMH A;  1JCK B;  3P4Q B;  3MJ5 A;  3OWE B;  2I2Y A;  3N9Y C;  2Y3A A;  1TS5 A;  2HTM E;  2TSS A;  1KLG D;  1ESF A;  2M56 B;  3E56 A;  1FXI A;  1TS3 A;  2X38 A;  4RGT A;  2ONQ A;  3PZ7 A;  2FBW B;  1WXQ A;  2E3T A;  2YEP B;  1IGD A;  2AQ2 B;  4RCO A;  2K9X A;  3FAH A;  1ZDX A;  2ZW1 A;  4J3O D;  1HEZ E;  1GTE A;  4XWT A;  1JML A;  4P16 A;  1KLU D;  1ZE3 D;  1MPE A;  3KLS X;  2M0A A;  1VZ6 A;  2Y5C A;  5E6J A;  4ARC A;  2WDQ B;  4A8X C;  3CWI A;  1ZPS A;  4HJG E;  1I4P A;  4MT5 A;  1KFY B;  3AE4 B;  3DWG C;  3P4S B;  1VZ8 A;  2L1A A;  1M4V A;  4RH6 A;  1D5Z C;  2W3S A;  1XLO A;  2ICI A;  4YTM B;  1EU4 A;  1I7H A;  1L6V A;  3AE2 B;  5AUI A;  1JRP A;  5BYQ A;  2GI9 A;  2N7J A;  1JAL A;  3W5U B;  3EGR A;  1DGJ A;  1MVK A;  2SEB D;  3HVD A;  1FFV A;  4AS1 A;  1F2R C;  1YMH E;  2EEL A;  1E7P B;  3V3X A;  1JQ4 A;  3B9J A;  3MFG A;  4JE3 B;  1SE4 A;  3GB1 A;  1BML C;  3LXF A;  3AE5 B;  3BK1 A;  1GB4 A;  2R61 A;  1T6B X;  3VR9 B;  2JX5 A;  3EA6 A;  4WIP A;  4R3D A;  2LHD A;  1FRD A;  2WXH A;  3R2I A;  5FK9 C;  4FXC A;  4OHJ A;  1FFU A;  2DBY A;  2Q5W D;  2AQ1 B;  4LTU A;  5C2T B;  1C4P A;  1FRR A;  1ET9 A;  5D3I B;  1DYQ A;  5BMG A;  1SEB D;  3AEF B;  3NZ3 A;  3T3O A;  4AQ7 A;  3P4P B;  1VLB A;  1F0Z A;  5EE9 A;  1WWT A;  4CQN A;  3ZJT A;  4GDL B;  5FR3 A;  1DOY A;  2RDG A;  2DLB A;  2BW2 A;  3KWV A;  2BS3 B;  1H7W A;  1MHX A;  4YWG G;  1JWA D;  3NS1 A;  1KRH A;  2W82 A;  2BB5 A;  3BYT B;  2BYT A;  3AH7 A;  2FUG 1;  3LYY A;  4NJC A;  2V4I B;  3IXS A;  2BBC A;  1PYW D;  3P42 A;  4RFB A;  3ABV B;  2AX5 A;  4WH4 A;  3SR6 A;  3NVZ A;  4RF1 A;  3ZGZ A;  1L6U A;  3P1M A;  5AUK A;  4TSS A;  4XE0 A;  2LHE A;  3NVW A;  3H8H A;  3U7Z A;  2BTE A;  1ROE A;  3AV8 A;  1RM6 C;  4ARI A;  3U52 E;  2WXL A;  1YJJ A;  5FKA C;  1NYR A;  3U4E G;  1OQQ A;  4RF0 A;  1QOG A;  2WXI A;  2ZW0 A;  5BMI A;  3HUI A;  4KKJ A;  5LNK 1;  1K53 A;  1D4B A;  4HRS A;  1PDX A;  2HDE A;  5TSS A;  2DYO A;  4JWU C;  4XDC A;  2AQ3 B;  2QSD A;  2KQ4 X;  1GPX A;  2WDR B;  2XNA C;  2RDH A;  4ZYS A;  2PMV A;  1L4Z B;  3URY A;  2JXT A;  2WXR A;  3W9C B;  3UI3 A;  1QIL A;  4A55 A;  2JWU A;  5BYS A;  3TEZ A;  1GOZ A;  4OVZ A;  3AEB B;  5D3D A;  4L23 A;  3AEG B;  2QEJ C;  2BS2 B;  1JWU D;  3BII D;  4ZRQ A;  1A70 A;  3BZD B;  3T3N A;  4WUR A;  1I4R A;  2WNM A;  3ETR A;  3BVZ A;  4NAM A;  1SE2 A;  4IKG A;  3BVM A;  4XWW A;  4WAF A;  1N63 A;  1PGX A;  2CJO A;  3TUO A;  4A9A A;  1CJE A;  1SE3 A;  2J42 A;  3ZJU A;  1EU3 A;  1V1O A;  3B2F A;  5T8I A;  4OZA A;  2K3U A;  2M19 A;  5HFY A;  1C78 A;  1FNW A;  2H88 B;  4MH8 A;  5H8Y E;  2GRI A;  4C7Y A;  2JZP A;  3AE1 B;  2IGH A;  1YJI A;  5EE3 A;  3IT4 B;  1LO5 D;  2VZK B;  3HRD D;  3I57 A;  1QT9 A;  1HZ5 A;  4TMA B;  2WXN A;  2ACZ B;  1TZO A;  3NVY A;  2EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...