4YTMB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-biphenyl-3-yl-2-(trifluoromethyl)benzamide
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 60
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ytmB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ytmB01
1PDXA 3NVWA 1FO4A 1I7HA 3AV8A 4YSZB 3ETRA 2HTME 2LEKA 5GXGB 5C3JB 2JQRB 1QOGA 1NYQA 1ZP0B 1FFUA 5AUIA 1F0ZA 1XO3A 4C7ZA 1VLBA 4YXDB 3AH7A 1N5WA 1OFFA 1WXQA 1E9MA 2MJDA 5EE3A 3SFEB 2H88B 4YSXB 1J7AA 1FRRA 1SF0A 1XLPA 2DWQA 1IUEA 1WRIA 2WP9B 2KAJA 1YQ4B 3AE2B 3HRDD 2Q5WD 3NS1A 1PUTA 4JWSC 3W5VB 2AX5A 2MJ3A 2B76B 1DOIA 1RM6C 1N60A 1YQ3B 4HRSA 1L6UA 2BS2B 3B9JA 4ITKA 3NVYA 1A70A 1TKYA 4YTPB 2BT6A 2OHFA 3WCQA 2JX5A 5C2TB 3ZYYX 1OQRA 1YJJA 3LB8C 1N62A 3PO0A 1E6EB 1FRDA 4C80A 4ZHPA 1J7CA 1OQQA 3AB5A 1QLBB 3FAHA 5EE0A 3VRAB 2M19A 2PVOD 1ZUD2 1NEKB 3P4PB 3VR9B 1QOAA 2E3TA 3NVZA 4N58A 3SR6A 4YSYB 3AEDB 2K9XA 2MJEA 1SIJA 1VDVA 2BS3B 2PKOA 3DWGC 3AN1A 3P4RB 1R7SA 3L4PA 1SB3C 4FXCA 3W9CB 2W3SA 1TKEA 1JWBD 3NRZA 2KMMA 4WQMA 1KRHA 5MPOA 3HUIA 3AE6B 1N63A 3NVVA 3AEFB 2CU3A 3AEBB 3ABVB 1TJEA 2QIEB 1XLQA 1B9RA 3CIRB 2WDQB 1L5PA 2Y5CA 3DWMA 3P63A 1JRPA 1WGKA 2DBYA 3VRBB 2MH7A 2WDVB 1JW9D 2ACZB 3P4QB 2W54A 2WS3B 4US8A 1JALA 1FIQA 1UWMA 2L52A 1J7BA 1NI3A 1V8CA 2BS4B 1ZXIA 3B2GA 2WQYB 2W55A 1N61A 2G1EA 1DOYA 3AECB 3EUB2 1KFYB 2EKIA 2H89B 2W3RA 1FXAA 1QT9A 2L83A 3KWLA 1V97A 2CJNA 1DOXA 1GAQB 1FM0D 5H8YE 1JQ4A 2FBWB 1XLOA 1VJKA 3P1MA 4JWUC 3AEEB 1XLNA 5EE9A 3W5UB 3AE4B 3BIID 2PVGC 5G5HA 3CWIA 1WWTA 4WWMA 3AEGB 2M56B 5G5GA 1FMAD 1GPXA 2K22A 1NENB 3P4SB 1RFKA 3B2FA 4ZOHC 1GT8A 1E7PB 2K5PA 2QJLA 1TKGA 3SFDB 4YTMB 3LXFA 4JX1C 3AE5B 4N6EB 4US9A 1GTEA 4KX6B 1RWSA 3AE9B 1N5XA 4N59A 1CZPA 2WU5B 2CJOA 4P6VF 5H92C 1JWAD 3HVZA 4HROA 1H7WA 2WU2B 3RPFC 1PFDA 3AE8B 2WLBA 1RYJA 1H7XA 4USAA 1ZOYB 1AWDA 5AUKA 4ZHOA 4A9AA 4IDIA 1DGJA 1GTHA 1YJIA 1JROA 3FC4A 4LTUA 1T3QA 5EE1A 1QF6A 1TYGB 1E0ZA 4YTNB 3AE7B 3AEAB 1ROEA 1KF6B 2WDRB 1AYFA 1L6VA 3AE1B 4YT0B 3AM9A 1WYGA 1L0VB 1CJEA 1NVID 1QOBA 1QOFA 1FFVA 2N0SB 3AE3B 4C7YA 3CF4A 3AMZA 3VR8B 1E10A 1NYRA 1EWYC 2PIAA 1FXIA
chains in the Genus database with same CATH superfamily
1JWMD 2KZRA 2LEKA 2WX0A 4I6NB 3ZXRA 3Q3FA 1WXQA 2D07B 1M94A 2KK8A 1I4PA 3PRMB 1XEEA 1RM6C 1YN3A 2KX0A 2WXJA 5TR5A 3MC8A 1J8CA 4K3CA 3KVFB 2FIFA 1WXSA 4LDTD 1E6EB 1J7CA 5D2MB 1QLBB 1TTNA 3P2BA 2QCZA 2NBVB 4HCNB 2OEDA 5G55A 3L4PA 1ESFA 1I4GA 4W9IA 4KVGB 4E3CA 2K25A 5MPOA 2QEJC 2DZKA 3ZNZB 3A1QB 4JE3B 5FKAC 5TSSA 5E6NA 1I4XA 1EU4A 3EC8A 4P1BC 4NJ7A 1WGYA 4KZCA 3N20C 1XLNA 4K1RB 4RF1A 3BIID 5DPSA 3D32A 2MBQA 2M8SA 2K22A 4ZOHC 4YTMB 3H7PA 4GDLA 1E8ZA 2FIDA 4DDID 4CO7A 2ZW1A 3AE8B 1IBXA 2KANA 4NZLB 2ICIA 2N7EA 1MVKA 3HIZA 1DGJA 4JLCA 2Z8LA 5AZFA 3HM3A 4DQOC 2MLBA 1QKZA 1FXTB 3RFZB 4YT0B 1I42A 1IPGA 1N63A 3UGBB 3DWMA 1JW9D 4J3OD 2D11A 4M02A 2WXHA 3DDCB 1HQRD 2DZMA 1QOGA 1JMLA 2KJHB 2G3QB 3PGEA 2N7DA 2LXAA 2MJDA 4OHJA 1J7AA 4CYEA 2FCNA 3RD2A 2KFKB 3TEYA 2XNAC 2KWVB 3ALBA 2ZJDA 3FAHA 4OVUA 5EE0A 2PE6B 4C4VA 4IKGA 2M19A 2KTRB 3A9KB 3NVZA 3AEDB 3R66C 1YJ1A 1S1QB 3DPDA 2PTLA 1JWBD 3APDA 3QIJA 1D3ZA 3IVFA 1FEHA 2CR5A 2WXQA 2WYQA 3ABVB 2RD0A 1WXMA 3JVZX 3VHTC 4ANVA 3HVDA 1GB1A 2IDYA 4BAXA 4MEMA 2OJWA 2NTTA 3AI5A 1UGMA 4GLSC 1MJDA 4HWIB 2WX1A 3TIXA 3KWLA 2K1FA 1R4NB 5AEKB 5EDSA 2UWQA 2K6DB 2EMTA 2KXJA 2KLCA 3IXSA 4L2YA 4BKSA 2WU5B 4MSMB 1C4AA 1LXDA 2I1JA 3PZ8A 2LVQA 3ZIMA 1HEZE 2DNFA 1TYGB 3IBEA 1KF6B 1SXTA 3C8YA 3PZDA 3FILA 3A1QA 1VRAB 2DENB 3ZGZA 2N0SB 3AMZA 2KOXA 3W1SA 1I35A 1IBXB 1VZ8A 2G9HD 4XDCA 2JU6X 4DXGA 4C7ZA 5LXHA 4M01A 1T5XD 1YQBA 2NMQA 4H2AA 1ZGUB 5CX3A 1SEBD 1FRRA 2KAJA 3T8MA 2WP9B 1ET9A 1SSNA 3W1YA 2GBKA 2O6VB 1DOIA 1V1PA 1N60A 2LGXA 2N4FA 2HTHA 4GGQA 2MX2A 1WY8A 1YN4A 1WE7A 2DYMA 3DHHC 2V4IB 2XK5B 3QQ8B 5BYSA 2MJEA 3X0WA 5HHDG 2KACA 2BB6A 3I9V1 3AU5A 4ZRPA 3TSSA 4AOFA 3IG3A 2KO3A 4MGZE 5LNK1 1QILA 3EGRA 3AEBB 4CQNA 4K7SA 1P98A 2ZPYA 4BKSD 1HTQA 3P4QB 3DVGX 2Z0EB 1JWSD 1GC7A 2B3AA 5BO4B 2G1EA 3FKYA 3GE3C 3IAM1 4NNJB 3RNFC 1FM0D 5H8YE 4AUQC 4RM9A 2KX3A 3IAS1 2KKCA 1PGXA 4ARCA 3V60A 1TKGA 4DXFA 4JX1C 3H9DA 4KSLC 3L08A 5JXVA 1YJIA 4LTUA 3NZ3A 3GZNB 3KQ4A 1KLGD 1YIWA 3AEAB 2D3BA 1AYFA 2YVCA 1TS2A 3ML9A 1RAXA 2L0TA 3L16A 4S17A 2IYDB 1VLBA 2WDTB 4HJKA 1N5WA 4HLEA 2O6VA 2FAZA 3HRDD 3APFA 4DWFA 4W9LA 2M17A 4J6IA 1WI0A 3PPAA 4ITKA 4PS3A 2ZW0A 2OHFA 3K9OB 2L05A 1V6EA 4F1SA 1ZW7A 4KIKA 3RZFA 1WYWB 3GOEA 4N58A 1QOAA 1Q1OA 1SIJA 3FILB 3VUXA 3ZNHB 2AL3A 2BYVE 3E9SA 1SB3C 3RNGC 4ZRKA 2XEWA 5J17A 1CK1A 3PHXB 2WS3B 5HG2A 1XD3B 2HD5B 1J7BA 1WMHB 5D94A 3MJWA 3U2SC 2TSSA 3UINB 2V1YA 1EM7A 2WGSA 5BYRA 1DOXA 1VJKA 1WX7A 1FCLA 2X38A 1P9DU 2M56B 3Q6BA 2RMMA 4M0WA 1TBEA 1P3QU 4WJOA 4IWOA 1WE6A 3KH0A 4A9AA 4ARIA 1Q10A 3QC8B 2MW5A 3RCZA 1QOBA 2V9HA 3UI3A 4EZJA 3A9KA 2INCC 1PDXA 4HKZE 1E8YA 5I4DA 4EEWA 1K50A 5C1ZA 4W9JA 3VDZA 5AUIA 1ZP0B 4RGNA 1C76A 4FULA 3HM6X 3A33B 3RI7C 2GRIA 3UQAA 1STEA 3NS1A 4PS7A 1PUTA 3IT6B 4FBJB 2BS2B 2Y3AA 3NVYA 3I57A 3VR9B 3Q8EA 4FJZA 4PK1A 2L8JA 1D5XC 2GBMA 2MEKA 3H7SA 2ZNVC 4GDKB 3NRZA 3ZJVA 2QILA 2KC1A 1WF9A 2W82A 1FNUA 2JRHA 3P63A 1JRPA 4LCDE 3IHPC 2IGGA 2XK5A 1JALA 4GOCA 2D2QA 4G50A 2L0FA 4A3OA 5JHAA 3PLUA 3WAPA 3RN9C 5IN7A 1ACCA 2LGIA 1E8WA 3TBLD 4JIOU 1V86A 5DPWA 2J42A 2ZCCA 2KTFA 2NS5A 1E7UA 1FMAD 2BKFA 1I4RA 3B2FA 3PREA 4K3BA 1PQSA 2LFIA 4NAWA 5H92C 1MPEA 4GN1A 3ZW3A 1LFDA 2DLBA 4QAYA 2INDC 2IO1B 5CTRC 3LYYA 3AM9A 3ZJTA 4BKGA 5JZEB 3L17A 5C3JB 1NYQA 1C79A 3KYDD 3W1SC 2NPTB 2L00B 2RGFA 3C19A 4ACFA 1ZDVA 3AH7A 1FNVA 4L23A 1KOTA 1SF0A 2AQ3B 4DHJD 1WJ4A 2LXCA 2AX5A 3ZVVA 4Q2JA 2WXNA 1N6ZA 2WXIA 2BBCA 3KUZA 2YLMA 4BZAA 2NTSA 4XWWA 1UWXA 1K52A 2NR2A 4B0EA 3GS2A 3V05A 2IGDA 4XGAB 2PMVA 4ANWA 1YOVB 5HI1A 2QIEB 1TJEA 5JHBA 2WDQB 1L5PA 1V1OA 2BYEA 3MHZA 2J52A 3PVLA 4KV2A 2QC8A 2ZPNA 2GOWA 3C0RB 2W55A 3OWEB 1HZ6A 2NCNA 1XQQA 3VH3B 3X23A 1FXAA 5E6JA 3Q8CA 4M8NA 4P1CC 1EWCA 5EE9A 1K53A 5BMIA 4JGHB 2GB1A 4FJYA 2ZVOA 4NQLB 3LXFA 2KC2A 3SU8X 5LXIB 3AULA 3M3JA 1L7YA 3MFGA 3TEWA 4II3B 3S2AA 4WJPA 4XYCA 2LUEA 1FCCC 3L13A 4LNNA 3AE1B 4AP4C 2Y5PA 3Q8FA 1NVID 2VRRB 1C3TA 3SEBA 1L0YB 3BY4B 5D7GA 3H7PB 4FJVB 1F2RI 1Q0WB 4REZA 4KGSA 2K39A 2WXRA 4KSKC 3N32A 4PYZA 3ZLZA 1WJNA 3ECIA 3N3KB 3W5VB 4ZYSA 1WSPA 2MJ3A 2FE8A 2JSVX 3DVNU 2D5GA 2M4NA 2PLPA 1OQRA 2IY0B 4IWQA 2WWZA 1WMHA 1SJHD 3VUYA 1GB4A 2JYEA 2BKRB 3QHTA 3MC9A 2SEBD 2N9LA 2E3TA 1YD8U 4YSYB 3UIPB 1ISNA 4EUTA 4IC7B 3JW0X 2CU3A 2KD0A 1XLQA 1VZ6A 3Q8BA 2K8CA 2YEPF 2Y5CA 2WXGA 5CHFA 4MH0E 4PYUA 4IG7B 3RNCC 3TUOA 4WIPA 3KWVA 1F52A 1ZXIA 4MGYE 4WURA 2CHXA 3OAWA 4IM3A 4M00A 3AECB 4OZCA 4W9CA 2CU1A 2H89B 4HK2A 1GAQB 1UGJA 1JQ4A 1JRUA 3P1MA 4JWUC 2RDHA 4E74A 2PVGC 1P7FA 1VZ7A 2AQ2B 3ZDTA 1E7PB 1V5TA 4LLGM 2O2VB 4N6EB 1GTEA 3AE9B 3PZ7A 2WU2B 1HZ5A 4RGTA 3OJ4B 4BOZB 4NPNA 2NBWB 2JY6A 2LRUA 2EMSA 2AEHA 4WH4A 2LHEA 1QOFA 2OJRA 3Q2AC 2QHOA 3JYUA 1EWYC 3T9LA 1GG3A 4FLHA 3ETRA 4IWPA 1F0ZA 4HDOA 4K7WA 3H1UA 2IO2B 4BBNF 2K8HA 4ASWC 2Z0DB 5CHWA 2DYBA 2G4DB 1YX6B 4GU2A 1YQ3B 2GBRA 4RH6A 3N1YC 2BT6A 2JX5A 4JL9A 1YJJA 4JQWC 4NAWB 1WGGA 2BGFA 3Q14C 4C80A 3AB5A 3RNAC 2INNE 1TS3A 1Z2MA 3VQIA 3BK1A 3ZRCA 2GBJA 2KQSA 5DPTA 2K3UA 5D6JB 3W2DA 3A4SC 1NI2A 4B0MA 1KRHA 2KN4A 3ZJUA 1WZ0A 2MBEA 3UIOB 3AXCA 4MSQB 3URYA 2WDVB 2W54A 1WGHA 2JZZA 2L52A 1F9JA 2FUG1 2FCMA 2LVPA 3U52E 5E6OA 2V3SA 4O1NA 1TT5B 4C00A 2C9WB 1S3SG 3RT3B 1XT9B 3T3NA 1NDDA 4B9KA 2DHZA 1WH3A 4WWOA 1BMLC 1VR9A 3P4SB 4MACA 2LWPA 2C7NB 2QJLA 2O6VD 1KLUD 4B6WA 3NY5A 3RPFC 1EF5A 1PFDA 3VXWA 4USAA 1V5OA 4KKJA 5AUKA 2V4LA 4ZHOA 1J0GA 3LJ3A 1MG4A 2BF8B 3NZSA 4WWNA 2WXFA 1OGWA 1L6VA 1Y56A 3SHQA 2KDIA 4KZ0A 3O13A 3PRZA 3CF4A 3VR8B 1NYRA 1UD7A 1H4RA 3EA6A 2LGYA 2IZVB 1TS5A 1KH0A 3CSTA 2MWSB 2QDFA 1SGHA 3OG5A 3A9JB 4YL8A 3Q3MC 1UF0A 3RNEC 2VZKD 2MCNB 4KIKB 2RR9A 4YTPB 2J0KA 3RZWC 4X57B 3J9CA 1NEKB 3P4PB 5IO9A 2MP2B 3PV1A 1VDVA 1OTRB 2CKHB 4XWTA 1CMXB 4FXCA 3W9CB 4S0RA 4KDLB 4W9DA 3U7DA 5KHQA 1E8XA 2V3NA 1P0RA 3RUIB 4HPLB 1UNSA 1I4QA 2MH7A 1YN5A 1SIFA 2CS4A 4I6PA 4TSSA 2N9EB 4M0WB 3BINA 1SE9A 2FNJB 5G2NA 1RRBA 2L83A 4W9FA 3L0WB 1SJED 1XLOA 2M0AA 3U4EG 1T0RC 4XC2A 2IPKD 2AYOB 1ET6A 1WGRA 1SE3A 3DBLI 5FK9C 4RGMA 3ZKJC 1T3QA 2BYFA 1QZEA 4A3PA 2PW9A 3VVWB 3KYCD 1LM8B 4ZYNA 3AE3B 2J7QB 5JH5C 1KM7A 3ZUNA 1I7HA 4II2B 3DVNV 1EO6A 4RM8A 4BVUC 1HA5A 4TMAB 1EF1A 4F8CB 4A6QA 3V62A 5DCNA 1G6JA 3ONSA 4A90A 1GOZA 4FADA 2JYTA 4YSXB 3TCAA 2AQ1B 3AE2B 2B76B 4HVBA 2LMCA 2KJRA 1A70A 4HCPB 4URKA 3LB8C 1N62A 3APCA 4WWPA 3BVMA 2ZEQA 3PO0A 1OQQA 1TZOA 2RDBC 4TV3A 4D2KA 3QWZB 3DWGC 1FPYA 1R7SA 4N9F4 4KGRA 4NY0A 2D3CA 2KWDA 2ON8A 2KMMA 4WQMA 5T8IA 1IGCA 1IP9A 4NAMA 4LNKA 1WRDB 3AEFB 1B9RA 1V81A 3V6CB 1TY0A 2ONQA 1MHHE 1OEYA 4OZAA 2C60A 4A20A 2EELA 3B2GA 3EECA 2AWTA 1OEYJ 4HXDA 2A4ZA 2CJNA 4OVZA 2LJ5A 1D5ZC 2KHWB 3U8ZA 1LO5D 2BW2A 3HHMA 3KW5B 3P42A 4ANXA 3GZNI 4LDTB 3BYYB 2I1KA 2MSED 2ZCBA 2GMIC 3GP7A 2N1VA 1V2YA 2CJOA 1CQVA 3ZDMC 4K7UA 4CHKA 3PHWB 3N1XC 2M0XA 3CSFA 2Y5BB 2GI9A 2IY1B 2I2YA 1CJEA 2YEPB 1FFVA 2V0GA 3MJ5A 4XX5A 2MHJA 3A4RA 1XCQL 4MT5A 2JWUA 3DBLB 3ZXVA 1FO4A 3EFCA 3AV8A 4MGKE 5AZGA 2JRIB 2PEAA 3DHGC 2JXXA 4LJPB 2IO0B 4DHZE 1Z5SB 1FFUA 1XO3A 4IM2A 4FHKA 3N9YC 2LGSA 2CHWA 3ENEA 4IW0A 3SFEB 3RMKC 3QJZA 2GLSA 4HRSA 4C4VB 1TKYA 3WCQA 4BOSC 1E7VA 3NUHB 4BBNC 1IGDA 2LJIA 1X1MA 3R3MA 2PVOD 4W9KA 3KLSX 3ZRFA 1F1HA 3SD5A 4YWGG 2LGDA 3VTUA 2LZ6A 4G3XB 1UBQA 1TKEA 2L76A 1ZDXA 4HPMB 1IYFA 2MP2A 2KLGA 2L32A 3M63B 5HFYA 4I6LB 4E71A 4R3DA 2BS4B 4DHZB 3VH4B 4DXAB 3VTWA 4XDDA 4DDGD 1UH6A 1V97A 1MI0A 2J0MA 4RCOA 2KNBA 4TQ0A 2JT4B 3AE4B 4GIVA 1UZXB 2KTRA 3T3OA 2W9NA 1T0YA 4PT5A 2K5PA 4IUMB 4N59A 4KX6B 1N5XA 4LNOA 4EOYA 2K6QA 1GUAB 2JUOA 2MA9B 1AWDA 1V1PB 2KFKA 3JSVA 1JROA 3Q3OC 3DVGY 1Y8RC 3NS8A 1PGAA 3KUDB 1WJUA 4WAFA 2LI5A 1D5MC 1HXYD 4LJOB 4AJWA 3VFKA 4TQ1A 3GB1A 3VUWA 4LNIA 4DBGA 2C7HA 5GXGB 1C77A 1FD6A 3NOBA 2QSDA 1PYWD 2DWQA 1XLPA 1I4HA 3DBHB 2Q5WD 2JXTA 4WJQA 1R4MI 3RULA 1F2RC 1L6UA 4LK0M 1E90A 4EFOA 3M95A 2L1AA 1GC6A 3QAQA 3BVZA 4ZHPA 4ZDVA 2LRWA 3VRAB 1ZUD2 1V9JA 3PT2B 4IM0A 1NBFC 3P4RB 2Z59B 3BYTB 5D3DA 4HPPA 4FA6A 3QCAA 3ZNID 1WX8A 1A5RA 1C1YB 4KGTA 2LD9A 3CIRB 3NHEB 2IJ0A 3E56A 3R8BA 1ZKHA 1DOYA 4HKQA 1TS4A 3NZUA 3TMPB 2AL6A 2WXOA 3GE8C 3L10B 3DQVA 2MRPA 3ZTDA 4PS8A 4MGIE 1BT0A 1ENFA 2KMCA 4ICUA 3AEEB 3W5UB 3WALA 1WWTA 5G5GA 1GPXA 1RFKA 1GT8A 3DBSA 4US9A 2KMAA 1RWSA 4P6VF 2LUMA 2KYWA 1JWAD 1ZPSA 2JZ3B 2WLBA 1ZOYB 1BUIC 4OVVA 1C4PA 2L3ZA 1D6EC 4TKNA 1WZ3A 5DPRA 4ICVA 2MBBB 2KJ6A 3EFUA 4G11A 5L83A 5J2RA 4WQOB 1WJ6A 1MHXA 4EKUA 3NVWA 1V49A 3ZO5B 4ZRIA 2JQRB 2MBOA 2O2VA 2DX5B 1K51A 2HJ8A 2C5LC 3O65B 2LASA 4NJCA 2PE9A 2REXA 2H88B 3R7RA 4TUUA 1WRIA 1C4CA 1JWUD 3H8HA 4JWSC 1SBBB 2NBUA 1RLFA 3BZDB 4GSWA 2LVOA 3ZYYX 1JCKB 2A5UA 1FRDA 5CHVC 1YX5B 3Q3JA 4P16A 1F77A 4FN2A 3DBHI 2K9XA 3CF6E 3SR6A 4GXBA 4RNAA 5IAAC 2PKOA 3AN1A 5GMVA 1T0SC 3N1ZC 1T0QC 2J4XA 5BMGA 1B1ZA 5BYQA 3ZNGC 2D3AA 4MM3B 4A55A 2WHIA 2R2OA 4MM3A 2OOBB 2HE7A 3RYTA 4HEA1 3EUB2 1QT9A 2BVCA 2FBWB 2WXKA 3B1LX 1HE8A 3QARA 4RFBA 3WANA 5L95C 4F7ZA 1VCBA 4WAAA 4WWMA 3AEGB 1LGRA 1NENB 1P1AA 5G5HA 5J18A 3SFDB 3AE5B 2PPHA 1WXVA 1PGBA 1H7WA 2NVUI 3VAWA 4W9GA 3H6NA 1H7XA 1WGDA 4G0NB 2G4SA 2VH2A 1GTHA 4MDKE 3M62B 4EZLA 1UUPA 4EE2A 3QK0A 1TZ1A 1ROEA 1XF5L 2M1MA 4C7YA 1J19A 2KDFB 5LLIA 2PIAA 2HJ1A 3PSEB 5IA7A 3VTVA 1AN8A 2KQ7A 1LQBA 3MC0B 4WJNA 5FR3A 3ZTCA 3TL5A 2I38A 3PRPB 2FCQA 1L4ZB 4IOIE 1YQ4B 5BMHA 4UDUC 2BWES 2E6XA 4NJ6A 2KN5A 5C2TB 1TGZB 1WM3A 4BFRA 3U7ZA 2SAKA 2FUHB 5C23A 1R4NI 1YMHE 2BS3B 3WIMA 5FR6A 1QQRA 1EU3A 4XZ4A 1WX9A 2BQQA 2KWCA 3I5JC 2WNMA 1KTKA 3MTNB 4W9HA 2G45B 2DBYA 2IGHA 4RF0A 2X8XX 3BVGA 3TEXA 1L4DB 3R2IA 1FIQA 1UWMA 2DYOA 1OQYA 3EHVA 3Q8AA 2WQYB 2JPHA 2PJHA 2HDEA 2BYTA 1KFYB 4HJGE 4B95A 2ZVNA 1BXTA 1ZXHA 2N7JA 2LHDA 1M4VA 4L1BA 3RNBC 2N9XA 4GDLB 2DAJA 2KT7A 3AU4A 2NPTA 3HVZA 4HROA 2J53A 1H8CA 1TIFA 2ASQA 4MH8A 3NJTA 4IDIA 1UELA 3V3XA 2BWFA 1E5WA 4YTNB 5HKHA 3AE7B 4LNFA 2WDRB 1GJZA 2D10A 4OZBA 2DZJA 4FHJA 1WYGA 5IOIA 3Q3NC 3DBRI 1AW7A 2KFJA 2MBHA 3PS6A 1WIAA 2BPSA 2JF5A 4YSZB 1D4BA 2HTME 2JVCA 3SDLC 4GDKA 3DOWA 4YXDB 2MQJA 3DHIC 1OFFA 2L7RA 5EE3A 1E9MA 1XXGA 1FNWA 3DCGA 2KDBA 1KJTA 3JSVB 4AJYB 1L0XB 4GMVA 4JPSA 2EKEC 2N1WA 1GNUA 4ZRJA 2BTEA 1TY2A 5KHOA 4MELA 1WFYA 2KDEB 4HDQA 1DYQA 4C56C 4K81A 3L54A 5IKCM 3BK2A 2VZKB 1MG8A 3KUCB 3NG0A 3HUIA 3AE6B 3NVVA 4NQKE 2KVRA 3WAMA 3OJ3A 1WGKA 3VRBB 2ACZB 4RMAA 2RPVA 4EZKA 1NI3A 1V8CA 1C9FA 3K9PB 1N61A 1RFAA 4A8XC 4MJSB 2W3RA 2WXLA 5D3IB 2CHZA 1VD2A 3A9JA 2IO3B 4ZRQA 1AARA 1WXAA 1WR6E 1V80A 1RYJA 5AZHA 4BKTA 2XN9C 3I3TB 4GB9A 4M8MA 1QF6A 2R2QA 2DAFA 4AQ7A 2D3GA 2RPQA 2R61A 4DHJB 2UU7A 1T6BX 1L0VB 1XCTL 3IT4B 1SE2A 1FXIA 2KDMA 3UF8A 4KDIC 3PLVA 3CMMB 3Q69A 2RDGA 3I63C 4AWJA 1IUEA 3DBRB 5IP4D 1K8RB 2QMTA 3B9JA 2JWZA 4P7IA 4W9EA 3B08A 3TJPA 2UYZB 1ZE3D 2KWUB 3OLMD 1SE4A 3QA8A 4DK5A 1P7EA 1U4AA 2WXPA 2JZPA 2W3SA 4XE0A 3MP9A 2J0JA 4RGOS 1L2NA 2DZIA 3N30A 1UBIA 2RSUA 2VH1A 4KKIA 4US8A 3MHSD 1R4MB 2N9KA 3V6EB 3IFWB 3QX1A 1YNTE 2V3PA 3BWUD 2EKIA 3V61A 3WAOA 3ZQ4A 1WM2A 3WA0A 3LDZE 3B0AA 4AS1A 2FCSA 2WXMA 3CWIA 3PTFC 5E6PA 3R2TA 1C78A 3U30A 1MFWA 1E0ZA 4ANUA 1CZPA 2K8BA 1HTOA 2INPE 2IBIB 3UQBA 1Q5WB 3ML8A 2KQ4X 1KLVA 2C7MB 4OW0A 4MJSA 3R7QA 2BB5A 3TEZA 3FC4A 2N9PC 5EE1A 1WR1A 2ZNVB 2XBBC 2K0PA 1EUVB 3HK0A 1E10A 2ZZPB 2GBNA 2KVZA
chains in the Genus database with same CATH topology
1PDXA 3NVWA 1JWMD 4HKZE 5I4DA 1K50A 2LEKA 3EA6A 2JQRB 5AUIA 1ZP0B 4RGNA 1C76A 1TS5A 1KH0A 1K51A 1WXQA 2GRIA 4NJCA 2H88B 1STEA 1WRIA 1C4CA 1JWUD 3NS1A 1I4PA 3H8HA 4JWSC 1PUTA 1SBBB 1XEEA 3IT6B 1RM6C 1YN3A 2WXJA 2BS2B 2VZKD 2Y3AA 3BZDB 3NVYA 4YTPB 3I57A 3ZYYX 1JCKB 3J9CA 1E6EB 1FRDA 1J7CA 1QLBB 4P16A 1F77A 1NEKB 3P4PB 3VR9B 3Q8EA 3SR6A 2K9XA 4RNAA 1VDVA 2OEDA 1D5XC 2PKOA 3AN1A 4XWTA 2MEKA 3L4PA 1ESFA 1I4GA 4FXCA 3W9CB 4GDKB 3NRZA 3ZJVA 2QILA 5MPOA 2J4XA 2QEJC 5BMGA 1B1ZA 5BYQA 2W82A 2V3NA 1FNUA 1UNSA 3P63A 1JRPA 1I4QA 2MH7A 1YN5A 4MM3B 4A55A 4TSSA 2IGGA 4JE3B 5FKAC 5TSSA 1JALA 4HEA1 1I4XA 1EU4A 3EUB2 1ACCA 2LGIA 1QT9A 2L83A 2FBWB 1SJED 2WXKA 1XLOA 1XLNA 4RFBA 4RF1A 2M0AA 2J42A 3U4EG 3BIID 4WWMA 3AEGB 1FMAD 2K22A 1I4RA 1NENB 2IPKD 3B2FA 4ZOHC 5G5HA 3SFDB 4YTMB 3AE5B 2LFIA 5H92C 1ET6A 1PGBA 1H7WA 1SE3A 1MPEA 2ZW1A 3AE8B 1IBXA 1H7XA 4NZLB 5FK9C 4RGMA 2ICIA 1MVKA 2DLBA 1DGJA 1GTHA 1T3QA 1UUPA 2Z8LA 2PW9A 4EE2A 4DQOC 1ROEA 1QKZA 3LYYA 4YT0B 3AM9A 3RFZB 3ZJTA 1XF5L 4C7YA 3AE3B 1N63A 3DWMA 2PIAA 1JW9D 1I7HA 4J3OD 2WXHA 1AN8A 1HA5A 1HQRD 5C3JB 3MC0B 1QOGA 1NYQA 1JMLA 1C79A 4TMAB 5FR3A 4A6QA 1ZDVA 3AH7A 4A90A 4OHJA 2I38A 1FNVA 2MJDA 1GOZA 4L23A 2JYTA 4YSXB 1J7AA 1SF0A 1L4ZB 2AQ3B 4IOIE 2AQ1B 1YQ4B 3AE2B 2AX5A 2B76B 5BMHA 4UDUC 2LMCA 3TEYA 2E6XA 2XNAC 4Q2JA 1A70A 2WXNA 5C2TB 2WXIA 3LB8C 1N62A 3BVMA 3PO0A 2BBCA 1OQQA 3FAHA 5EE0A 3U7ZA 2SAKA 1TZOA 4IKGA 2M19A 2NTSA 4XWWA 4D2KA 1UWXA 3NVZA 3AEDB 1K52A 1YMHE 4B0EA 2BS3B 3DWGC 3GS2A 3V05A 1R7SA 2IGDA 2PTLA 4KGRA 1JWBD 1QQRA 2PMVA 1EU3A 2KWDA 2ON8A 2KMMA 4WQMA 5T8IA 1IGCA 4NAMA 1FEHA 3AEFB 2WXQA 5HI1A 2QIEB 3ABVB 1TJEA 2WNMA 1B9RA 2WDQB 1TY0A 2ONQA 1L5PA 1KTKA 1V1OA 3MHZA 1MHHE 2DBYA 2IGHA 4RF0A 3HVDA 2J52A 2IDYA 1GB1A 3BVGA 4OZAA 3TEXA 1L4DB 3R2IA 1FIQA 2NTTA 1UWMA 2DYOA 2EELA 3B2GA 3Q8AA 4GLSC 2WQYB 2W55A 3OWEB 1HZ6A 2HDEA 2BYTA 1KFYB 4HJGE 1BXTA 1FXAA 1ZXHA 3KWLA 5E6JA 3Q8CA 2CJNA 4OVZA 2N7JA 2LHDA 1EWCA 5EE9A 1D5ZC 1K53A 5BMIA 1M4VA 1LO5D 2BW2A 4L1BA 3P42A 4GDLB 2GB1A 3BYYB 3IXSA 4L2YA 3LXFA 3GP7A 2CJOA 2WU5B 1CQVA 3HVZA 4HROA 1C4AA 2J53A 3MFGA 3TEWA 3PZ8A 4MH8A 4IDIA 3V3XA 1FCCC 1HEZE 1TYGB 4YTNB 3AE7B 1KF6B 2WDRB 1SXTA 3C8YA 2GI9A 3AE1B 3FILA 4OZBA 2Y5PA 1WYGA 1VRAB 3Q8FA 1CJEA 1NVID 2YEPB 2I2YA 3ZGZA 1FFVA 2N0SB 2V0GA 1AW7A 3AMZA 3MJ5A 1XCQL 4MT5A 2JWUA 3W1SA 1FO4A 1IBXB 3AV8A 4YSZB 1VZ8A 2G9HD 4XDCA 3SEBA 1D4BA 2HTME 2JU6X 1L0YB 4DXGA 1FFUA 1XO3A 5D7GA 4C7ZA 3N9YC 1F2RI 1T5XD 4REZA 2NMQA 4YXDB 4H2AA 4KGSA 2WXRA 1OFFA 5EE3A 1E9MA 1SEBD 3SFEB 1XXGA 1FNWA 1FRRA 2KAJA 2WP9B 1ET9A 1SSNA 3W5VB 4ZYSA 1WSPA 2MJ3A 2FE8A 1DOIA 1L0XB 1N60A 1V1PA 4HRSA 2JSVX 4JPSA 2D5GA 1TKYA 3WCQA 3NUHB 2PLPA 1OQRA 2BTEA 1IGDA 1TY2A 1SJHD 1GB4A 1YN4A 2JYEA 2LJIA 2DYMA 2PVOD 1DYQA 2N9LA 2SEBD 2V4IB 3KLSX 2E3TA 4YSYB 4C56C 2MJEA 5BYSA 4YWGG 5HHDG 2KACA 2BB6A 3I9V1 4ZRPA 3TSSA 1TKEA 3BK2A 2VZKB 5LNK1 1QILA 3AE6B 3HUIA 3NVVA 3EGRA 1ZDXA 2CU3A 3AEBB 1XLQA 1VZ6A 3Q8BA 4CQNA 2YEPF 2Y5CA 2WXGA 1WGKA 3VRBB 2ACZB 3P4QB 3TUOA 2L32A 2RPVA 5HFYA 4WIPA 3KWVA 1NI3A 1JWSD 1V8CA 1C9FA 4R3DA 2BS4B 1ZXIA 4WURA 1N61A 2G1EA 3AECB 4OZCA 4A8XC 2H89B 3IAM1 2W3RA 4XDDA 2WXLA 5D3IB 1V97A 1GAQB 1FM0D 1MI0A 1UGJA 5H8YE 4RCOA 1JQ4A 3P1MA 4TQ0A 4JWUC 3AE4B 2RDHA 4ZRQA 2PVGC 3IAS1 1P7FA 1PGXA 4ARCA 1VZ7A 2AQ2B 4PT5A 3T3OA 1E7PB 2K5PA 1TKGA 4LLGM 4JX1C 4DXFA 4N6EB 1GTEA 4KX6B 4N59A 3AE9B 1N5XA 3PZ7A 2WU2B 1HZ5A 5JXVA 1RYJA 4RGTA 1AWDA 1V1PB 1YJIA 2XN9C 1JROA 4LTUA 1QF6A 3NZ3A 1PGAA 3KQ4A 1KLGD 4WAFA 3AEAB 4AQ7A 1AYFA 1D5MC 2R61A 1TS2A 1HXYD 1T6BX 1L0VB 1XCTL 2LHEA 4WH4A 1QOFA 3IT4B 1SE2A 1EWYC 1FXIA 2KDMA 3ETRA 4TQ1A 3GB1A 5GXGB 1F0ZA 1C77A 1FD6A 1VLBA 2QSDA 1N5WA 1PYWD 2DWQA 3Q69A 1XLPA 2RDGA 1I4HA 3HRDD 1IUEA 2Q5WD 2JXTA 1YQ3B 1F2RC 1L6UA 2QMTA 3B9JA 4LK0M 4ITKA 4RH6A 2BT6A 2ZW0A 2OHFA 2JX5A 1YJJA 4NAWB 2L1AA 3BVZA 4C80A 4ZHPA 3AB5A 2INNE 1ZE3D 3VRAB 1SE4A 1ZUD2 4N58A 1QOAA 1TS3A 3VQIA 1SIJA 3BK1A 1P7EA 3FILB 3P4RB 3E9SA 2WXPA 1SB3C 2JZPA 2K3UA 2W3SA 3BYTB 4XE0A 5D3DA 3W2DA 3MP9A 4RGOS 4B0MA 1KRHA 2KN4A 3ZJUA 1CK1A 4KGTA 3CIRB 4KKIA 3URYA 4US8A 2WDVB 2W54A 2WS3B 5HG2A 2N9KA 2IJ0A 2L52A 1J7BA 3E56A 3R8BA 1YNTE 3U2SC 2TSSA 2FUG1 2V3PA 3BWUD 1DOYA 4HKQA 1TS4A 2EKIA 3U52E 3ZQ4A 1EM7A 2WXOA 5BYRA 1DOXA 4O1NA 1ENFA 1VJKA 3AEEB 3W5UB 3T3NA 1FCLA 4AS1A 2X38A 2WXMA 1WWTA 3CWIA 2M56B 5G5GA 1GPXA 1BMLC 1VR9A 3R2TA 2RMMA 3P4SB 1RFKA 4M0WA 4MACA 1C78A 1GT8A 2QJLA 1KLUD 4US9A 1E0ZA 1RWSA 4P6VF 1CZPA 2LUMA 3RPFC 1JWAD 1ZPSA 1PFDA 2INPE 2KQ4X 2WLBA 4USAA 4OW0A 1ZOYB 1BUIC 4KKJA 5AUKA 4ZHOA 4A9AA 1C4PA 4ARIA 2BB5A 3TEZA 3FC4A 1D6EC 5EE1A 1Q10A 2WXFA 1L6VA 1Y56A 2K0PA 3O13A 1QOBA 3UI3A 1MHXA 1E10A 3CF4A 3VR8B 1NYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDX A;  3NVW A;  1FO4 A;  1I7H A;  3AV8 A;  4YSZ B;  3ETR A;  2HTM E;  2LEK A;  5GXG B;  5C3J B;  2JQR B;  1QOG A;  1NYQ A;  1ZP0 B;  1FFU A;  5AUI A;  1F0Z A;  1XO3 A;  4C7Z A;  1VLB A;  4YXD B;  3AH7 A;  1N5W A;  1OFF A;  1WXQ A;  1E9M A;  2MJD A;  5EE3 A;  3SFE B;  2H88 B;  4YSX B;  1J7A A;  1FRR A;  1SF0 A;  1XLP A;  2DWQ A;  1IUE A;  1WRI A;  2WP9 B;  2KAJ A;  1YQ4 B;  3AE2 B;  3HRD D;  2Q5W D;  3NS1 A;  1PUT A;  4JWS C;  3W5V B;  2AX5 A;  2MJ3 A;  2B76 B;  1DOI A;  1RM6 C;  1N60 A;  1YQ3 B;  4HRS A;  1L6U A;  2BS2 B;  3B9J A;  4ITK A;  3NVY A;  1A70 A;  1TKY A;  4YTP B;  2BT6 A;  2OHF A;  3WCQ A;  2JX5 A;  5C2T B;  3ZYY X;  1OQR A;  1YJJ A;  3LB8 C;  1N62 A;  3PO0 A;  1E6E B;  1FRD A;  4C80 A;  4ZHP A;  1J7C A;  1OQQ A;  3AB5 A;  1QLB B;  3FAH A;  5EE0 A;  3VRA B;  2M19 A;  2PVO D;  1ZUD 2;  1NEK B;  3P4P B;  3VR9 B;  1QOA A;  2E3T A;  3NVZ A;  4N58 A;  3SR6 A;  4YSY B;  3AED B;  2K9X A;  2MJE A;  1SIJ A;  1VDV A;  2BS3 B;  2PKO A;  3DWG C;  3AN1 A;  3P4R B;  1R7S A;  3L4P A;  1SB3 C;  4FXC A;  3W9C B;  2W3S A;  1TKE A;  1JWB D;  3NRZ A;  2KMM A;  4WQM A;  1KRH A;  5MPO A;  3HUI A;  3AE6 B;  1N63 A;  3NVV A;  3AEF B;  2CU3 A;  3AEB B;  3ABV B;  1TJE A;  2QIE B;  1XLQ A;  1B9R A;  3CIR B;  2WDQ B;  1L5P A;  2Y5C A;  3DWM A;  3P63 A;  1JRP A;  1WGK A;  2DBY A;  3VRB B;  2MH7 A;  2WDV B;  1JW9 D;  2ACZ B;  3P4Q B;  2W54 A;  2WS3 B;  4US8 A;  1JAL A;  1FIQ A;  1UWM A;  2L52 A;  1J7B A;  1NI3 A;  1V8C A;  2BS4 B;  1ZXI A;  3B2G A;  2WQY B;  2W55 A;  1N61 A;  2G1E A;  1DOY A;  3AEC B;  3EUB 2;  1KFY B;  2EKI A;  2H89 B;  2W3R A;  1FXA A;  1QT9 A;  2L83 A;  3KWL A;  1V97 A;  2CJN A;  1DOX A;  1GAQ B;  1FM0 D;  5H8Y E;  1JQ4 A;  2FBW B;  1XLO A;  1VJK A;  3P1M A;  4JWU C;  3AEE B;  1XLN A;  5EE9 A;  3W5U B;  3AE4 B;  3BII D;  2PVG C;  5G5H A;  3CWI A;  1WWT A;  4WWM A;  3AEG B;  2M56 B;  5G5G A;  1FMA D;  1GPX A;  2K22 A;  1NEN B;  3P4S B;  1RFK A;  3B2F A;  4ZOH C;  1GT8 A;  1E7P B;  2K5P A;  2QJL A;  1TKG A;  3SFD B;  4YTM B;  3LXF A;  4JX1 C;  3AE5 B;  4N6E B;  4US9 A;  1GTE A;  4KX6 B;  1RWS A;  3AE9 B;  1N5X A;  4N59 A;  1CZP A;  2WU5 B;  2CJO A;  4P6V F;  5H92 C;  1JWA D;  3HVZ A;  4HRO A;  1H7W A;  2WU2 B;  3RPF C;  1PFD A;  3AE8 B;  2WLB A;  1RYJ A;  1H7X A;  4USA A;  1ZOY B;  1AWD A;  5AUK A;  4ZHO A;  4A9A A;  4IDI A;  1DGJ A;  1GTH A;  1YJI A;  1JRO A;  3FC4 A;  4LTU A;  1T3Q A;  5EE1 A;  1QF6 A;  1TYG B;  1E0Z A;  4YTN B;  3AE7 B;  3AEA B;  1ROE A;  1KF6 B;  2WDR B;  1AYF A;  1L6V A;  3AE1 B;  4YT0 B;  3AM9 A;  1WYG A;  1L0V B;  1CJE A;  1NVI D;  1QOB A;  1QOF A;  1FFV A;  2N0S B;  3AE3 B;  4C7Y A;  3CF4 A;  3AMZ A;  3VR8 B;  1E10 A;  1NYR A;  1EWY C;  2PIA A;  1FXI A; 
#chains in the Genus database with same CATH topology
 1JWM D;  2KZR A;  2LEK A;  2WX0 A;  4I6N B;  3ZXR A;  3Q3F A;  1WXQ A;  2D07 B;  1M94 A;  2KK8 A;  1I4P A;  3PRM B;  1XEE A;  1RM6 C;  1YN3 A;  2KX0 A;  2WXJ A;  5TR5 A;  3MC8 A;  1J8C A;  4K3C A;  3KVF B;  2FIF A;  1WXS A;  4LDT D;  1E6E B;  1J7C A;  5D2M B;  1QLB B;  1TTN A;  3P2B A;  2QCZ A;  2NBV B;  4HCN B;  2OED A;  5G55 A;  3L4P A;  1ESF A;  1I4G A;  4W9I A;  4KVG B;  4E3C A;  2K25 A;  5MPO A;  2QEJ C;  2DZK A;  3ZNZ B;  3A1Q B;  4JE3 B;  5FKA C;  5TSS A;  5E6N A;  1I4X A;  1EU4 A;  3EC8 A;  4P1B C;  4NJ7 A;  1WGY A;  4KZC A;  3N20 C;  1XLN A;  4K1R B;  4RF1 A;  3BII D;  5DPS A;  3D32 A;  2MBQ A;  2M8S A;  2K22 A;  4ZOH C;  4YTM B;  3H7P A;  4GDL A;  1E8Z A;  2FID A;  4DDI D;  4CO7 A;  2ZW1 A;  3AE8 B;  1IBX A;  2KAN A;  4NZL B;  2ICI A;  2N7E A;  1MVK A;  3HIZ A;  1DGJ A;  4JLC A;  2Z8L A;  5AZF A;  3HM3 A;  4DQO C;  2MLB A;  1QKZ A;  1FXT B;  3RFZ B;  4YT0 B;  1I42 A;  1IPG A;  1N63 A;  3UGB B;  3DWM A;  1JW9 D;  4J3O D;  2D11 A;  4M02 A;  2WXH A;  3DDC B;  1HQR D;  2DZM A;  1QOG A;  1JML A;  2KJH B;  2G3Q B;  3PGE A;  2N7D A;  2LXA A;  2MJD A;  4OHJ A;  1J7A A;  4CYE A;  2FCN A;  3RD2 A;  2KFK B;  3TEY A;  2XNA C;  2KWV B;  3ALB A;  2ZJD A;  3FAH A;  4OVU A;  5EE0 A;  2PE6 B;  4C4V A;  4IKG A;  2M19 A;  2KTR B;  3A9K B;  3NVZ A;  3AED B;  3R66 C;  1YJ1 A;  1S1Q B;  3DPD A;  2PTL A;  1JWB D;  3APD A;  3QIJ A;  1D3Z A;  3IVF A;  1FEH A;  2CR5 A;  2WXQ A;  2WYQ A;  3ABV B;  2RD0 A;  1WXM A;  3JVZ X;  3VHT C;  4ANV A;  3HVD A;  1GB1 A;  2IDY A;  4BAX A;  4MEM A;  2OJW A;  2NTT A;  3AI5 A;  1UGM A;  4GLS C;  1MJD A;  4HWI B;  2WX1 A;  3TIX A;  3KWL A;  2K1F A;  1R4N B;  5AEK B;  5EDS A;  2UWQ A;  2K6D B;  2EMT A;  2KXJ A;  2KLC A;  3IXS A;  4L2Y A;  4BKS A;  2WU5 B;  4MSM B;  1C4A A;  1LXD A;  2I1J A;  3PZ8 A;  2LVQ A;  3ZIM A;  1HEZ E;  2DNF A;  1TYG B;  3IBE A;  1KF6 B;  1SXT A;  3C8Y A;  3PZD A;  3FIL A;  3A1Q A;  1VRA B;  2DEN B;  3ZGZ A;  2N0S B;  3AMZ A;  2KOX A;  3W1S A;  1I35 A;  1IBX B;  1VZ8 A;  2G9H D;  4XDC A;  2JU6 X;  4DXG A;  4C7Z A;  5LXH A;  4M01 A;  1T5X D;  1YQB A;  2NMQ A;  4H2A A;  1ZGU B;  5CX3 A;  1SEB D;  1FRR A;  2KAJ A;  3T8M A;  2WP9 B;  1ET9 A;  1SSN A;  3W1Y A;  2GBK A;  2O6V B;  1DOI A;  1V1P A;  1N60 A;  2LGX A;  2N4F A;  2HTH A;  4GGQ A;  2MX2 A;  1WY8 A;  1YN4 A;  1WE7 A;  2DYM A;  3DHH C;  2V4I B;  2XK5 B;  3QQ8 B;  5BYS A;  2MJE A;  3X0W A;  5HHD G;  2KAC A;  2BB6 A;  3I9V 1;  3AU5 A;  4ZRP A;  3TSS A;  4AOF A;  3IG3 A;  2KO3 A;  4MGZ E;  5LNK 1;  1QIL A;  3EGR A;  3AEB B;  4CQN A;  4K7S A;  1P98 A;  2ZPY A;  4BKS D;  1HTQ A;  3P4Q B;  3DVG X;  2Z0E B;  1JWS D;  1GC7 A;  2B3A A;  5BO4 B;  2G1E A;  3FKY A;  3GE3 C;  3IAM 1;  4NNJ B;  3RNF C;  1FM0 D;  5H8Y E;  4AUQ C;  4RM9 A;  2KX3 A;  3IAS 1;  2KKC A;  1PGX A;  4ARC A;  3V60 A;  1TKG A;  4DXF A;  4JX1 C;  3H9D A;  4KSL C;  3L08 A;  5JXV A;  1YJI A;  4LTU A;  3NZ3 A;  3GZN B;  3KQ4 A;  1KLG D;  1YIW A;  3AEA B;  2D3B A;  1AYF A;  2YVC A;  1TS2 A;  3ML9 A;  1RAX A;  2L0T A;  3L16 A;  4S17 A;  2IYD B;  1VLB A;  2WDT B;  4HJK A;  1N5W A;  4HLE A;  2O6V A;  2FAZ A;  3HRD D;  3APF A;  4DWF A;  4W9L A;  2M17 A;  4J6I A;  1WI0 A;  3PPA A;  4ITK A;  4PS3 A;  2ZW0 A;  2OHF A;  3K9O B;  2L05 A;  1V6E A;  4F1S A;  1ZW7 A;  4KIK A;  3RZF A;  1WYW B;  3GOE A;  4N58 A;  1QOA A;  1Q1O A;  1SIJ A;  3FIL B;  3VUX A;  3ZNH B;  2AL3 A;  2BYV E;  3E9S A;  1SB3 C;  3RNG C;  4ZRK A;  2XEW A;  5J17 A;  1CK1 A;  3PHX B;  2WS3 B;  5HG2 A;  1XD3 B;  2HD5 B;  1J7B A;  1WMH B;  5D94 A;  3MJW A;  3U2S C;  2TSS A;  3UIN B;  2V1Y A;  1EM7 A;  2WGS A;  5BYR A;  1DOX A;  1VJK A;  1WX7 A;  1FCL A;  2X38 A;  1P9D U;  2M56 B;  3Q6B A;  2RMM A;  4M0W A;  1TBE A;  1P3Q U;  4WJO A;  4IWO A;  1WE6 A;  3KH0 A;  4A9A A;  4ARI A;  1Q10 A;  3QC8 B;  2MW5 A;  3RCZ A;  1QOB A;  2V9H A;  3UI3 A;  4EZJ A;  3A9K A;  2INC C;  1PDX A;  4HKZ E;  1E8Y A;  5I4D A;  4EEW A;  1K50 A;  5C1Z A;  4W9J A;  3VDZ A;  5AUI A;  1ZP0 B;  4RGN A;  1C76 A;  4FUL A;  3HM6 X;  3A33 B;  3RI7 C;  2GRI A;  3UQA A;  1STE A;  3NS1 A;  4PS7 A;  1PUT A;  3IT6 B;  4FBJ B;  2BS2 B;  2Y3A A;  3NVY A;  3I57 A;  3VR9 B;  3Q8E A;  4FJZ A;  4PK1 A;  2L8J A;  1D5X C;  2GBM A;  2MEK A;  3H7S A;  2ZNV C;  4GDK B;  3NRZ A;  3ZJV A;  2QIL A;  2KC1 A;  1WF9 A;  2W82 A;  1FNU A;  2JRH A;  3P63 A;  1JRP A;  4LCD E;  3IHP C;  2IGG A;  2XK5 A;  1JAL A;  4GOC A;  2D2Q A;  4G50 A;  2L0F A;  4A3O A;  5JHA A;  3PLU A;  3WAP A;  3RN9 C;  5IN7 A;  1ACC A;  2LGI A;  1E8W A;  3TBL D;  4JIO U;  1V86 A;  5DPW A;  2J42 A;  2ZCC A;  2KTF A;  2NS5 A;  1E7U A;  1FMA D;  2BKF A;  1I4R A;  3B2F A;  3PRE A;  4K3B A;  1PQS A;  2LFI A;  4NAW A;  5H92 C;  1MPE A;  4GN1 A;  3ZW3 A;  1LFD A;  2DLB A;  4QAY A;  2IND C;  2IO1 B;  5CTR C;  3LYY A;  3AM9 A;  3ZJT A;  4BKG A;  5JZE B;  3L17 A;  5C3J B;  1NYQ A;  1C79 A;  3KYD D;  3W1S C;  2NPT B;  2L00 B;  2RGF A;  3C19 A;  4ACF A;  1ZDV A;  3AH7 A;  1FNV A;  4L23 A;  1KOT A;  1SF0 A;  2AQ3 B;  4DHJ D;  1WJ4 A;  2LXC A;  2AX5 A;  3ZVV A;  4Q2J A;  2WXN A;  1N6Z A;  2WXI A;  2BBC A;  3KUZ A;  2YLM A;  4BZA A;  2NTS A;  4XWW A;  1UWX A;  1K52 A;  2NR2 A;  4B0E A;  3GS2 A;  3V05 A;  2IGD A;  4XGA B;  2PMV A;  4ANW A;  1YOV B;  5HI1 A;  2QIE B;  1TJE A;  5JHB A;  2WDQ B;  1L5P A;  1V1O A;  2BYE A;  3MHZ A;  2J52 A;  3PVL A;  4KV2 A;  2QC8 A;  2ZPN A;  2GOW A;  3C0R B;  2W55 A;  3OWE B;  1HZ6 A;  2NCN A;  1XQQ A;  3VH3 B;  3X23 A;  1FXA A;  5E6J A;  3Q8C A;  4M8N A;  4P1C C;  1EWC A;  5EE9 A;  1K53 A;  5BMI A;  4JGH B;  2GB1 A;  4FJY A;  2ZVO A;  4NQL B;  3LXF A;  2KC2 A;  3SU8 X;  5LXI B;  3AUL A;  3M3J A;  1L7Y A;  3MFG A;  3TEW A;  4II3 B;  3S2A A;  4WJP A;  4XYC A;  2LUE A;  1FCC C;  3L13 A;  4LNN A;  3AE1 B;  4AP4 C;  2Y5P A;  3Q8F A;  1NVI D;  2VRR B;  1C3T A;  3SEB A;  1L0Y B;  3BY4 B;  5D7G A;  3H7P B;  4FJV B;  1F2R I;  1Q0W B;  4REZ A;  4KGS A;  2K39 A;  2WXR A;  4KSK C;  3N32 A;  4PYZ A;  3ZLZ A;  1WJN A;  3ECI A;  3N3K B;  3W5V B;  4ZYS A;  1WSP A;  2MJ3 A;  2FE8 A;  2JSV X;  3DVN U;  2D5G A;  2M4N A;  2PLP A;  1OQR A;  2IY0 B;  4IWQ A;  2WWZ A;  1WMH A;  1SJH D;  3VUY A;  1GB4 A;  2JYE A;  2BKR B;  3QHT A;  3MC9 A;  2SEB D;  2N9L A;  2E3T A;  1YD8 U;  4YSY B;  3UIP B;  1ISN A;  4EUT A;  4IC7 B;  3JW0 X;  2CU3 A;  2KD0 A;  1XLQ A;  1VZ6 A;  3Q8B A;  2K8C A;  2YEP F;  2Y5C A;  2WXG A;  5CHF A;  4MH0 E;  4PYU A;  4IG7 B;  3RNC C;  3TUO A;  4WIP A;  3KWV A;  1F52 A;  1ZXI A;  4MGY E;  4WUR A;  2CHX A;  3OAW A;  4IM3 A;  4M00 A;  3AEC B;  4OZC A;  4W9C A;  2CU1 A;  2H89 B;  4HK2 A;  1GAQ B;  1UGJ A;  1JQ4 A;  1JRU A;  3P1M A;  4JWU C;  2RDH A;  4E74 A;  2PVG C;  1P7F A;  1VZ7 A;  2AQ2 B;  3ZDT A;  1E7P B;  1V5T A;  4LLG M;  2O2V B;  4N6E B;  1GTE A;  3AE9 B;  3PZ7 A;  2WU2 B;  1HZ5 A;  4RGT A;  3OJ4 B;  4BOZ B;  4NPN A;  2NBW B;  2JY6 A;  2LRU A;  2EMS A;  2AEH A;  4WH4 A;  2LHE A;  1QOF A;  2OJR A;  3Q2A C;  2QHO A;  3JYU A;  1EWY C;  3T9L A;  1GG3 A;  4FLH A;  3ETR A;  4IWP A;  1F0Z A;  4HDO A;  4K7W A;  3H1U A;  2IO2 B;  4BBN F;  2K8H A;  4ASW C;  2Z0D B;  5CHW A;  2DYB A;  2G4D B;  1YX6 B;  4GU2 A;  1YQ3 B;  2GBR A;  4RH6 A;  3N1Y C;  2BT6 A;  2JX5 A;  4JL9 A;  1YJJ A;  4JQW C;  4NAW B;  1WGG A;  2BGF A;  3Q14 C;  4C80 A;  3AB5 A;  3RNA C;  2INN E;  1TS3 A;  1Z2M A;  3VQI A;  3BK1 A;  3ZRC A;  2GBJ A;  2KQS A;  5DPT A;  2K3U A;  5D6J B;  3W2D A;  3A4S C;  1NI2 A;  4B0M A;  1KRH A;  2KN4 A;  3ZJU A;  1WZ0 A;  2MBE A;  3UIO B;  3AXC A;  4MSQ B;  3URY A;  2WDV B;  2W54 A;  1WGH A;  2JZZ A;  2L52 A;  1F9J A;  2FUG 1;  2FCM A;  2LVP A;  3U52 E;  5E6O A;  2V3S A;  4O1N A;  1TT5 B;  4C00 A;  2C9W B;  1S3S G;  3RT3 B;  1XT9 B;  3T3N A;  1NDD A;  4B9K A;  2DHZ A;  1WH3 A;  4WWO A;  1BML C;  1VR9 A;  3P4S B;  4MAC A;  2LWP A;  2C7N B;  2QJL A;  2O6V D;  1KLU D;  4B6W A;  3NY5 A;  3RPF C;  1EF5 A;  1PFD A;  3VXW A;  4USA A;  1V5O A;  4KKJ A;  5AUK A;  2V4L A;  4ZHO A;  1J0G A;  3LJ3 A;  1MG4 A;  2BF8 B;  3NZS A;  4WWN A;  2WXF A;  1OGW A;  1L6V A;  1Y56 A;  3SHQ A;  2KDI A;  4KZ0 A;  3O13 A;  3PRZ A;  3CF4 A;  3VR8 B;  1NYR A;  1UD7 A;  1H4R A;  3EA6 A;  2LGY A;  2IZV B;  1TS5 A;  1KH0 A;  3CST A;  2MWS B;  2QDF A;  1SGH A;  3OG5 A;  3A9J B;  4YL8 A;  3Q3M C;  1UF0 A;  3RNE C;  2VZK D;  2MCN B;  4KIK B;  2RR9 A;  4YTP B;  2J0K A;  3RZW C;  4X57 B;  3J9C A;  1NEK B;  3P4P B;  5IO9 A;  2MP2 B;  3PV1 A;  1VDV A;  1OTR B;  2CKH B;  4XWT A;  1CMX B;  4FXC A;  3W9C B;  4S0R A;  4KDL B;  4W9D A;  3U7D A;  5KHQ A;  1E8X A;  2V3N A;  1P0R A;  3RUI B;  4HPL B;  1UNS A;  1I4Q A;  2MH7 A;  1YN5 A;  1SIF A;  2CS4 A;  4I6P A;  4TSS A;  2N9E B;  4M0W B;  3BIN A;  1SE9 A;  2FNJ B;  5G2N A;  1RRB A;  2L83 A;  4W9F A;  3L0W B;  1SJE D;  1XLO A;  2M0A A;  3U4E G;  1T0R C;  4XC2 A;  2IPK D;  2AYO B;  1ET6 A;  1WGR A;  1SE3 A;  3DBL I;  5FK9 C;  4RGM A;  3ZKJ C;  1T3Q A;  2BYF A;  1QZE A;  4A3P A;  2PW9 A;  3VVW B;  3KYC D;  1LM8 B;  4ZYN A;  3AE3 B;  2J7Q B;  5JH5 C;  1KM7 A;  3ZUN A;  1I7H A;  4II2 B;  3DVN V;  1EO6 A;  4RM8 A;  4BVU C;  1HA5 A;  4TMA B;  1EF1 A;  4F8C B;  4A6Q A;  3V62 A;  5DCN A;  1G6J A;  3ONS A;  4A90 A;  1GOZ A;  4FAD A;  2JYT A;  4YSX B;  3TCA A;  2AQ1 B;  3AE2 B;  2B76 B;  4HVB A;  2LMC A;  2KJR A;  1A70 A;  4HCP B;  4URK A;  3LB8 C;  1N62 A;  3APC A;  4WWP A;  3BVM A;  2ZEQ A;  3PO0 A;  1OQQ A;  1TZO A;  2RDB C;  4TV3 A;  4D2K A;  3QWZ B;  3DWG C;  1FPY A;  1R7S A;  4N9F 4;  4KGR A;  4NY0 A;  2D3C A;  2KWD A;  2ON8 A;  2KMM A;  4WQM A;  5T8I A;  1IGC A;  1IP9 A;  4NAM A;  4LNK A;  1WRD B;  3AEF B;  1B9R A;  1V81 A;  3V6C B;  1TY0 A;  2ONQ A;  1MHH E;  1OEY A;  4OZA A;  2C60 A;  4A20 A;  2EEL A;  3B2G A;  3EEC A;  2AWT A;  1OEY J;  4HXD A;  2A4Z A;  2CJN A;  4OVZ A;  2LJ5 A;  1D5Z C;  2KHW B;  3U8Z A;  1LO5 D;  2BW2 A;  3HHM A;  3KW5 B;  3P42 A;  4ANX A;  3GZN I;  4LDT B;  3BYY B;  2I1K A;  2MSE D;  2ZCB A;  2GMI C;  3GP7 A;  2N1V A;  1V2Y A;  2CJO A;  1CQV A;  3ZDM C;  4K7U A;  4CHK A;  3PHW B;  3N1X C;  2M0X A;  3CSF A;  2Y5B B;  2GI9 A;  2IY1 B;  2I2Y A;  1CJE A;  2YEP B;  1FFV A;  2V0G A;  3MJ5 A;  4XX5 A;  2MHJ A;  3A4R A;  1XCQ L;  4MT5 A;  2JWU A;  3DBL B;  3ZXV A;  1FO4 A;  3EFC A;  3AV8 A;  4MGK E;  5AZG A;  2JRI B;  2PEA A;  3DHG C;  2JXX A;  4LJP B;  2IO0 B;  4DHZ E;  1Z5S B;  1FFU A;  1XO3 A;  4IM2 A;  4FHK A;  3N9Y C;  2LGS A;  2CHW A;  3ENE A;  4IW0 A;  3SFE B;  3RMK C;  3QJZ A;  2GLS A;  4HRS A;  4C4V B;  1TKY A;  3WCQ A;  4BOS C;  1E7V A;  3NUH B;  4BBN C;  1IGD A;  2LJI A;  1X1M A;  3R3M A;  2PVO D;  4W9K A;  3KLS X;  3ZRF A;  1F1H A;  3SD5 A;  4YWG G;  2LGD A;  3VTU A;  2LZ6 A;  4G3X B;  1UBQ A;  1TKE A;  2L76 A;  1ZDX A;  4HPM B;  1IYF A;  2MP2 A;  2KLG A;  2L32 A;  3M63 B;  5HFY A;  4I6L B;  4E71 A;  4R3D A;  2BS4 B;  4DHZ B;  3VH4 B;  4DXA B;  3VTW A;  4XDD A;  4DDG D;  1UH6 A;  1V97 A;  1MI0 A;  2J0M A;  4RCO A;  2KNB A;  4TQ0 A;  2JT4 B;  3AE4 B;  4GIV A;  1UZX B;  2KTR A;  3T3O A;  2W9N A;  1T0Y A;  4PT5 A;  2K5P A;  4IUM B;  4N59 A;  4KX6 B;  1N5X A;  4LNO A;  4EOY A;  2K6Q A;  1GUA B;  2JUO A;  2MA9 B;  1AWD A;  1V1P B;  2KFK A;  3JSV A;  1JRO A;  3Q3O C;  3DVG Y;  1Y8R C;  3NS8 A;  1PGA A;  3KUD B;  1WJU A;  4WAF A;  2LI5 A;  1D5M C;  1HXY D;  4LJO B;  4AJW A;  3VFK A;  4TQ1 A;  3GB1 A;  3VUW A;  4LNI A;  4DBG A;  2C7H A;  5GXG B;  1C77 A;  1FD6 A;  3NOB A;  2QSD A;  1PYW D;  2DWQ A;  1XLP A;  1I4H A;  3DBH B;  2Q5W D;  2JXT A;  4WJQ A;  1R4M I;  3RUL A;  1F2R C;  1L6U A;  4LK0 M;  1E90 A;  4EFO A;  3M95 A;  2L1A A;  1GC6 A;  3QAQ A;  3BVZ A;  4ZHP A;  4ZDV A;  2LRW A;  3VRA B;  1ZUD 2;  1V9J A;  3PT2 B;  4IM0 A;  1NBF C;  3P4R B;  2Z59 B;  3BYT B;  5D3D A;  4HPP A;  4FA6 A;  3QCA A;  3ZNI D;  1WX8 A;  1A5R A;  1C1Y B;  4KGT A;  2LD9 A;  3CIR B;  3NHE B;  2IJ0 A;  3E56 A;  3R8B A;  1ZKH A;  1DOY A;  4HKQ A;  1TS4 A;  3NZU A;  3TMP B;  2AL6 A;  2WXO A;  3GE8 C;  3L10 B;  3DQV A;  2MRP A;  3ZTD A;  4PS8 A;  4MGI E;  1BT0 A;  1ENF A;  2KMC A;  4ICU A;  3AEE B;  3W5U B;  3WAL A;  1WWT A;  5G5G A;  1GPX A;  1RFK A;  1GT8 A;  3DBS A;  4US9 A;  2KMA A;  1RWS A;  4P6V F;  2LUM A;  2KYW A;  1JWA D;  1ZPS A;  2JZ3 B;  2WLB A;  1ZOY B;  1BUI C;  4OVV A;  1C4P A;  2L3Z A;  1D6E C;  4TKN A;  1WZ3 A;  5DPR A;  4ICV A;  2MBB B;  2KJ6 A;  3EFU A;  4G11 A;  5L83 A;  5J2R A;  4WQO B;  1WJ6 A;  1MHX A;  4EKU A;  3NVW A;  1V49 A;  3ZO5 B;  4ZRI A;  2JQR B;  2MBO A;  2O2V A;  2DX5 B;  1K51 A;  2HJ8 A;  2C5L C;  3O65 B;  2LAS A;  4NJC A;  2PE9 A;  2REX A;  2H88 B;  3R7R A;  4TUU A;  1WRI A;  1C4C A;  1JWU D;  3H8H A;  4JWS C;  1SBB B;  2NBU A;  1RLF A;  3BZD B;  4GSW A;  2LVO A;  3ZYY X;  1JCK B;  2A5U A;  1FRD A;  5CHV C;  1YX5 B;  3Q3J A;  4P16 A;  1F77 A;  4FN2 A;  3DBH I;  2K9X A;  3CF6 E;  3SR6 A;  4GXB A;  4RNA A;  5IAA C;  2PKO A;  3AN1 A;  5GMV A;  1T0S C;  3N1Z C;  1T0Q C;  2J4X A;  5BMG A;  1B1Z A;  5BYQ A;  3ZNG C;  2D3A A;  4MM3 B;  4A55 A;  2WHI A;  2R2O A;  4MM3 A;  2OOB B;  2HE7 A;  3RYT A;  4HEA 1;  3EUB 2;  1QT9 A;  2BVC A;  2FBW B;  2WXK A;  3B1L X;  1HE8 A;  3QAR A;  4RFB A;  3WAN A;  5L95 C;  4F7Z A;  1VCB A;  4WAA A;  4WWM A;  3AEG B;  1LGR A;  1NEN B;  1P1A A;  5G5H A;  5J18 A;  3SFD B;  3AE5 B;  2PPH A;  1WXV A;  1PGB A;  1H7W A;  2NVU I;  3VAW A;  4W9G A;  3H6N A;  1H7X A;  1WGD A;  4G0N B;  2G4S A;  2VH2 A;  1GTH A;  4MDK E;  3M62 B;  4EZL A;  1UUP A;  4EE2 A;  3QK0 A;  1TZ1 A;  1ROE A;  1XF5 L;  2M1M A;  4C7Y A;  1J19 A;  2KDF B;  5LLI A;  2PIA A;  2HJ1 A;  3PSE B;  5IA7 A;  3VTV A;  1AN8 A;  2KQ7 A;  1LQB A;  3MC0 B;  4WJN A;  5FR3 A;  3ZTC A;  3TL5 A;  2I38 A;  3PRP B;  2FCQ A;  1L4Z B;  4IOI E;  1YQ4 B;  5BMH A;  4UDU C;  2BWE S;  2E6X A;  4NJ6 A;  2KN5 A;  5C2T B;  1TGZ B;  1WM3 A;  4BFR A;  3U7Z A;  2SAK A;  2FUH B;  5C23 A;  1R4N I;  1YMH E;  2BS3 B;  3WIM A;  5FR6 A;  1QQR A;  1EU3 A;  4XZ4 A;  1WX9 A;  2BQQ A;  2KWC A;  3I5J C;  2WNM A;  1KTK A;  3MTN B;  4W9H A;  2G45 B;  2DBY A;  2IGH A;  4RF0 A;  2X8X X;  3BVG A;  3TEX A;  1L4D B;  3R2I A;  1FIQ A;  1UWM A;  2DYO A;  1OQY A;  3EHV A;  3Q8A A;  2WQY B;  2JPH A;  2PJH A;  2HDE A;  2BYT A;  1KFY B;  4HJG E;  4B95 A;  2ZVN A;  1BXT A;  1ZXH A;  2N7J A;  2LHD A;  1M4V A;  4L1B A;  3RNB C;  2N9X A;  4GDL B;  2DAJ A;  2KT7 A;  3AU4 A;  2NPT A;  3HVZ A;  4HRO A;  2J53 A;  1H8C A;  1TIF A;  2ASQ A;  4MH8 A;  3NJT A;  4IDI A;  1UEL A;  3V3X A;  2BWF A;  1E5W A;  4YTN B;  5HKH A;  3AE7 B;  4LNF A;  2WDR B;  1GJZ A;  2D10 A;  4OZB A;  2DZJ A;  4FHJ A;  1WYG A;  5IOI A;  3Q3N C;  3DBR I;  1AW7 A;  2KFJ A;  2MBH A;  3PS6 A;  1WIA A;  2BPS A;  2JF5 A;  4YSZ B;  1D4B A;  2HTM E;  2JVC A;  3SDL C;  4GDK A;  3DOW A;  4YXD B;  2MQJ A;  3DHI C;  1OFF A;  2L7R A;  5EE3 A;  1E9M A;  1XXG A;  1FNW A;  3DCG A;  2KDB A;  1KJT A;  3JSV B;  4AJY B;  1L0X B;  4GMV A;  4JPS A;  2EKE C;  2N1W A;  1GNU A;  4ZRJ A;  2BTE A;  1TY2 A;  5KHO A;  4MEL A;  1WFY A;  2KDE B;  4HDQ A;  1DYQ A;  4C56 C;  4K81 A;  3L54 A;  5IKC M;  3BK2 A;  2VZK B;  1MG8 A;  3KUC B;  3NG0 A;  3HUI A;  3AE6 B;  3NVV A;  4NQK E;  2KVR A;  3WAM A;  3OJ3 A;  1WGK A;  3VRB B;  2ACZ B;  4RMA A;  2RPV A;  4EZK A;  1NI3 A;  1V8C A;  1C9F A;  3K9P B;  1N61 A;  1RFA A;  4A8X C;  4MJS B;  2W3R A;  2WXL A;  5D3I B;  2CHZ A;  1VD2 A;  3A9J A;  2IO3 B;  4ZRQ A;  1AAR A;  1WXA A;  1WR6 E;  1V80 A;  1RYJ A;  5AZH A;  4BKT A;  2XN9 C;  3I3T B;  4GB9 A;  4M8M A;  1QF6 A;  2R2Q A;  2DAF A;  4AQ7 A;  2D3G A;  2RPQ A;  2R61 A;  4DHJ B;  2UU7 A;  1T6B X;  1L0V B;  1XCT L;  3IT4 B;  1SE2 A;  1FXI A;  2KDM A;  3UF8 A;  4KDI C;  3PLV A;  3CMM B;  3Q69 A;  2RDG A;  3I63 C;  4AWJ A;  1IUE A;  3DBR B;  5IP4 D;  1K8R B;  2QMT A;  3B9J A;  2JWZ A;  4P7I A;  4W9E A;  3B08 A;  3TJP A;  2UYZ B;  1ZE3 D;  2KWU B;  3OLM D;  1SE4 A;  3QA8 A;  4DK5 A;  1P7E A;  1U4A A;  2WXP A;  2JZP A;  2W3S A;  4XE0 A;  3MP9 A;  2J0J A;  4RGO S;  1L2N A;  2DZI A;  3N30 A;  1UBI A;  2RSU A;  2VH1 A;  4KKI A;  4US8 A;  3MHS D;  1R4M B;  2N9K A;  3V6E B;  3IFW B;  3QX1 A;  1YNT E;  2V3P A;  3BWU D;  2EKI A;  3V61 A;  3WAO A;  3ZQ4 A;  1WM2 A;  3WA0 A;  3LDZ E;  3B0A A;  4AS1 A;  2FCS A;  2WXM A;  3CWI A;  3PTF C;  5E6P A;  3R2T A;  1C78 A;  3U30 A;  1MFW A;  1E0Z A;  4ANU A;  1CZP A;  2K8B A;  1HTO A;  2INP E;  2IBI B;  3UQB A;  1Q5W B;  3ML8 A;  2KQ4 X;  1KLV A;  2C7M B;  4OW0 A;  4MJS A;  3R7Q A;  2BB5 A;  3TEZ A;  3FC4 A;  2N9P C;  5EE1 A;  1WR1 A;  2ZNV B;  2XBB C;  2K0P A;  1EUV B;  3HK0 A;  1E10 A;  2ZZP B;  2GBN A;  2KVZ A; 
#chains in the Genus database with same CATH homology
 1PDX A;  3NVW A;  1JWM D;  4HKZ E;  5I4D A;  1K50 A;  2LEK A;  3EA6 A;  2JQR B;  5AUI A;  1ZP0 B;  4RGN A;  1C76 A;  1TS5 A;  1KH0 A;  1K51 A;  1WXQ A;  2GRI A;  4NJC A;  2H88 B;  1STE A;  1WRI A;  1C4C A;  1JWU D;  3NS1 A;  1I4P A;  3H8H A;  4JWS C;  1PUT A;  1SBB B;  1XEE A;  3IT6 B;  1RM6 C;  1YN3 A;  2WXJ A;  2BS2 B;  2VZK D;  2Y3A A;  3BZD B;  3NVY A;  4YTP B;  3I57 A;  3ZYY X;  1JCK B;  3J9C A;  1E6E B;  1FRD A;  1J7C A;  1QLB B;  4P16 A;  1F77 A;  1NEK B;  3P4P B;  3VR9 B;  3Q8E A;  3SR6 A;  2K9X A;  4RNA A;  1VDV A;  2OED A;  1D5X C;  2PKO A;  3AN1 A;  4XWT A;  2MEK A;  3L4P A;  1ESF A;  1I4G A;  4FXC A;  3W9C B;  4GDK B;  3NRZ A;  3ZJV A;  2QIL A;  5MPO A;  2J4X A;  2QEJ C;  5BMG A;  1B1Z A;  5BYQ A;  2W82 A;  2V3N A;  1FNU A;  1UNS A;  3P63 A;  1JRP A;  1I4Q A;  2MH7 A;  1YN5 A;  4MM3 B;  4A55 A;  4TSS A;  2IGG A;  4JE3 B;  5FKA C;  5TSS A;  1JAL A;  4HEA 1;  1I4X A;  1EU4 A;  3EUB 2;  1ACC A;  2LGI A;  1QT9 A;  2L83 A;  2FBW B;  1SJE D;  2WXK A;  1XLO A;  1XLN A;  4RFB A;  4RF1 A;  2M0A A;  2J42 A;  3U4E G;  3BII D;  4WWM A;  3AEG B;  1FMA D;  2K22 A;  1I4R A;  1NEN B;  2IPK D;  3B2F A;  4ZOH C;  5G5H A;  3SFD B;  4YTM B;  3AE5 B;  2LFI A;  5H92 C;  1ET6 A;  1PGB A;  1H7W A;  1SE3 A;  1MPE A;  2ZW1 A;  3AE8 B;  1IBX A;  1H7X A;  4NZL B;  5FK9 C;  4RGM A;  2ICI A;  1MVK A;  2DLB A;  1DGJ A;  1GTH A;  1T3Q A;  1UUP A;  2Z8L A;  2PW9 A;  4EE2 A;  4DQO C;  1ROE A;  1QKZ A;  3LYY A;  4YT0 B;  3AM9 A;  3RFZ B;  3ZJT A;  1XF5 L;  4C7Y A;  3AE3 B;  1N63 A;  3DWM A;  2PIA A;  1JW9 D;  1I7H A;  4J3O D;  2WXH A;  1AN8 A;  1HA5 A;  1HQR D;  5C3J B;  3MC0 B;  1QOG A;  1NYQ A;  1JML A;  1C79 A;  4TMA B;  5FR3 A;  4A6Q A;  1ZDV A;  3AH7 A;  4A90 A;  4OHJ A;  2I38 A;  1FNV A;  2MJD A;  1GOZ A;  4L23 A;  2JYT A;  4YSX B;  1J7A A;  1SF0 A;  1L4Z B;  2AQ3 B;  4IOI E;  2AQ1 B;  1YQ4 B;  3AE2 B;  2AX5 A;  2B76 B;  5BMH A;  4UDU C;  2LMC A;  3TEY A;  2E6X A;  2XNA C;  4Q2J A;  1A70 A;  2WXN A;  5C2T B;  2WXI A;  3LB8 C;  1N62 A;  3BVM A;  3PO0 A;  2BBC A;  1OQQ A;  3FAH A;  5EE0 A;  3U7Z A;  2SAK A;  1TZO A;  4IKG A;  2M19 A;  2NTS A;  4XWW A;  4D2K A;  1UWX A;  3NVZ A;  3AED B;  1K52 A;  1YMH E;  4B0E A;  2BS3 B;  3DWG C;  3GS2 A;  3V05 A;  1R7S A;  2IGD A;  2PTL A;  4KGR A;  1JWB D;  1QQR A;  2PMV A;  1EU3 A;  2KWD A;  2ON8 A;  2KMM A;  4WQM A;  5T8I A;  1IGC A;  4NAM A;  1FEH A;  3AEF B;  2WXQ A;  5HI1 A;  2QIE B;  3ABV B;  1TJE A;  2WNM A;  1B9R A;  2WDQ B;  1TY0 A;  2ONQ A;  1L5P A;  1KTK A;  1V1O A;  3MHZ A;  1MHH E;  2DBY A;  2IGH A;  4RF0 A;  3HVD A;  2J52 A;  2IDY A;  1GB1 A;  3BVG A;  4OZA A;  3TEX A;  1L4D B;  3R2I A;  1FIQ A;  2NTT A;  1UWM A;  2DYO A;  2EEL A;  3B2G A;  3Q8A A;  4GLS C;  2WQY B;  2W55 A;  3OWE B;  1HZ6 A;  2HDE A;  2BYT A;  1KFY B;  4HJG E;  1BXT A;  1FXA A;  1ZXH A;  3KWL A;  5E6J A;  3Q8C A;  2CJN A;  4OVZ A;  2N7J A;  2LHD A;  1EWC A;  5EE9 A;  1D5Z C;  1K53 A;  5BMI A;  1M4V A;  1LO5 D;  2BW2 A;  4L1B A;  3P42 A;  4GDL B;  2GB1 A;  3BYY B;  3IXS A;  4L2Y A;  3LXF A;  3GP7 A;  2CJO A;  2WU5 B;  1CQV A;  3HVZ A;  4HRO A;  1C4A A;  2J53 A;  3MFG A;  3TEW A;  3PZ8 A;  4MH8 A;  4IDI A;  3V3X A;  1FCC C;  1HEZ E;  1TYG B;  4YTN B;  3AE7 B;  1KF6 B;  2WDR B;  1SXT A;  3C8Y A;  2GI9 A;  3AE1 B;  3FIL A;  4OZB A;  2Y5P A;  1WYG A;  1VRA B;  3Q8F A;  1CJE A;  1NVI D;  2YEP B;  2I2Y A;  3ZGZ A;  1FFV A;  2N0S B;  2V0G A;  1AW7 A;  3AMZ A;  3MJ5 A;  1XCQ L;  4MT5 A;  2JWU A;  3W1S A;  1FO4 A;  1IBX B;  3AV8 A;  4YSZ B;  1VZ8 A;  2G9H D;  4XDC A;  3SEB A;  1D4B A;  2HTM E;  2JU6 X;  1L0Y B;  4DXG A;  1FFU A;  1XO3 A;  5D7G A;  4C7Z A;  3N9Y C;  1F2R I;  1T5X D;  4REZ A;  2NMQ A;  4YXD B;  4H2A A;  4KGS A;  2WXR A;  1OFF A;  5EE3 A;  1E9M A;  1SEB D;  3SFE B;  1XXG A;  1FNW A;  1FRR A;  2KAJ A;  2WP9 B;  1ET9 A;  1SSN A;  3W5V B;  4ZYS A;  1WSP A;  2MJ3 A;  2FE8 A;  1DOI A;  1L0X B;  1N60 A;  1V1P A;  4HRS A;  2JSV X;  4JPS A;  2D5G A;  1TKY A;  3WCQ A;  3NUH B;  2PLP A;  1OQR A;  2BTE A;  1IGD A;  1TY2 A;  1SJH D;  1GB4 A;  1YN4 A;  2JYE A;  2LJI A;  2DYM A;  2PVO D;  1DYQ A;  2N9L A;  2SEB D;  2V4I B;  3KLS X;  2E3T A;  4YSY B;  4C56 C;  2MJE A;  5BYS A;  4YWG G;  5HHD G;  2KAC A;  2BB6 A;  3I9V 1;  4ZRP A;  3TSS A;  1TKE A;  3BK2 A;  2VZK B;  5LNK 1;  1QIL A;  3AE6 B;  3HUI A;  3NVV A;  3EGR A;  1ZDX A;  2CU3 A;  3AEB B;  1XLQ A;  1VZ6 A;  3Q8B A;  4CQN A;  2YEP F;  2Y5C A;  2WXG A;  1WGK A;  3VRB B;  2ACZ B;  3P4Q B;  3TUO A;  2L32 A;  2RPV A;  5HFY A;  4WIP A;  3KWV A;  1NI3 A;  1JWS D;  1V8C A;  1C9F A;  4R3D A;  2BS4 B;  1ZXI A;  4WUR A;  1N61 A;  2G1E A;  3AEC B;  4OZC A;  4A8X C;  2H89 B;  3IAM 1;  2W3R A;  4XDD A;  2WXL A;  5D3I B;  1V97 A;  1GAQ B;  1FM0 D;  1MI0 A;  1UGJ A;  5H8Y E;  4RCO A;  1JQ4 A;  3P1M A;  4TQ0 A;  4JWU C;  3AE4 B;  2RDH A;  4ZRQ A;  2PVG C;  3IAS 1;  1P7F A;  1PGX A;  4ARC A;  1VZ7 A;  2AQ2 B;  4PT5 A;  3T3O A;  1E7P B;  2K5P A;  1TKG A;  4LLG M;  4JX1 C;  4DXF A;  4N6E B;  1GTE A;  4KX6 B;  4N59 A;  3AE9 B;  1N5X A;  3PZ7 A;  2WU2 B;  1HZ5 A;  5JXV A;  1RYJ A;  4RGT A;  1AWD A;  1V1P B;  1YJI A;  2XN9 C;  1JRO A;  4LTU A;  1QF6 A;  3NZ3 A;  1PGA A;  3KQ4 A;  1KLG D;  4WAF A;  3AEA B;  4AQ7 A;  1AYF A;  1D5M C;  2R61 A;  1TS2 A;  1HXY D;  1T6B X;  1L0V B;  1XCT L;  2LHE A;  4WH4 A;  1QOF A;  3IT4 B;  1SE2 A;  1EWY C;  1FXI A;  2KDM A;  3ETR A;  4TQ1 A;  3GB1 A;  5GXG B;  1F0Z A;  1C77 A;  1FD6 A;  1VLB A;  2QSD A;  1N5W A;  1PYW D;  2DWQ A;  3Q69 A;  1XLP A;  2RDG A;  1I4H A;  3HRD D;  1IUE A;  2Q5W D;  2JXT A;  1YQ3 B;  1F2R C;  1L6U A;  2QMT A;  3B9J A;  4LK0 M;  4ITK A;  4RH6 A;  2BT6 A;  2ZW0 A;  2OHF A;  2JX5 A;  1YJJ A;  4NAW B;  2L1A A;  3BVZ A;  4C80 A;  4ZHP A;  3AB5 A;  2INN E;  1ZE3 D;  3VRA B;  1SE4 A;  1ZUD 2;  4N58 A;  1QOA A;  1TS3 A;  3VQI A;  1SIJ A;  3BK1 A;  1P7E A;  3FIL B;  3P4R B;  3E9S A;  2WXP A;  1SB3 C;  2JZP A;  2K3U A;  2W3S A;  3BYT B;  4XE0 A;  5D3D A;  3W2D A;  3MP9 A;  4RGO S;  4B0M A;  1KRH A;  2KN4 A;  3ZJU A;  1CK1 A;  4KGT A;  3CIR B;  4KKI A;  3URY A;  4US8 A;  2WDV B;  2W54 A;  2WS3 B;  5HG2 A;  2N9K A;  2IJ0 A;  2L52 A;  1J7B A;  3E56 A;  3R8B A;  1YNT E;  3U2S C;  2TSS A;  2FUG 1;  2V3P A;  3BWU D;  1DOY A;  4HKQ A;  1TS4 A;  2EKI A;  3U52 E;  3ZQ4 A;  1EM7 A;  2WXO A;  5BYR A;  1DOX A;  4O1N A;  1ENF A;  1VJK A;  3AEE B;  3W5U B;  3T3N A;  1FCL A;  4AS1 A;  2X38 A;  2WXM A;  1WWT A;  3CWI A;  2M56 B;  5G5G A;  1GPX A;  1BML C;  1VR9 A;  3R2T A;  2RMM A;  3P4S B;  1RFK A;  4M0W A;  4MAC A;  1C78 A;  1GT8 A;  2QJL A;  1KLU D;  4US9 A;  1E0Z A;  1RWS A;  4P6V F;  1CZP A;  2LUM A;  3RPF C;  1JWA D;  1ZPS A;  1PFD A;  2INP E;  2KQ4 X;  2WLB A;  4USA A;  4OW0 A;  1ZOY B;  1BUI C;  4KKJ A;  5AUK A;  4ZHO A;  4A9A A;  1C4P A;  4ARI A;  2BB5 A;  3TEZ A;  3FC4 A;  1D6E C;  5EE1 A;  1Q10 A;  2WXF A;  1L6V A;  1Y56 A;  2K0P A;  3O13 A;  1QOB A;  3UI3 A;  1MHX A;  1E10 A;  3CF4 A;  3VR8 B;  1NYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...