4YTNA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title New Insights into the Design of Inhibitors Targeted for Parasitic Anaerobic Energy Metabolism
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 217
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ytnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ytnA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ytnA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ytnA04
4OPTA 5GRTA 2YLSA 1BKWA 2R0PA 3C96A 1LPFA 2RABA 2CVJA 1LVLA 2WQYA 2YR5A 4RG4A 3G5QA 4P9SA 3L8KA 4K22A 3M0OA 2AR8A 4K5SA 2Q7VA 3NGCX 5U1OA 3UP4A 1EBDA 5KXJA 2APGA 3B6DA 4OPLA 2GV8A 1F8RA 4EMJA 3R9UA 3C4AA 4LU6A 4XWZA 4UDRA 1VG9A 3UOZA 3EPTA 5FS7A 1N1PA 1FCDA 2BXRA 2GB0A 1Y56A 3BNMA 4I58A 4BJZA 2Y6RA 5FS6A 2VOUA 1P2EA 1ZDLA 2E5VA 1P2HA 3QJ4A 4U8MA 4EQWA 3UOXA 3RP7A 4PABA 1GEUA 2X3NA 2RGJA 3GWFA 3AE3A 1K4QA 3C4NA 3NN0X 2UZZA 2XFUA 4C3YA 4Z25A 3AEBA 4H50A 5BVAA 3KVEA 4PAAA 3DJGX 1B5QA 1ZOVA 3DJDA 3GWDA 1KSSA 1NENA 2XVHA 2IVEA 1S2YA 3VRDB 5KWFA 2WPCA 3V3OA 1GNDA 2E1MA 2VQ7A 2WESA 1GESA 2BS2A 1FEAA 1GXFA 3CPJG 4H4WA 3CGEA 4HB9A 1IUXA 1E1KA 3NG7X 2C75A 2VRMA 4H2PA 1GTEA 2TMDA 2BXSA 4TLZA 3V76A 1N4VA 2I0ZA 1PBEA 1F3PA 3K7TA 4B69A 2V60A 3KD9A 3KU9A 2DKIA 1DJQA 3ZYXA 5HXIA 3B3RA 3QSEA 2NPXA 2B7SA 3FIMB 3LZXA 5EB5A 1E1MA 3IWAA 3GYXA 1BZLA 3CNSA 1CJ2A 3BI2A 3VQRA 1YQ3A 3K30A 4J33A 3VR9A 2B7RA 2XCGA 1GRAA 1VRQB 2RGOA 1PBDA 4J2WA 4JN9A 2WHDA 1Q9IA 3NT6A 4A7AA 3PS9A 4IVMB 4OCGA 1L9CA 4DSHA 2EQ6A 3K7MX 1KNRA 4YKFA 2JB3A 2R0GA 2C73A 1Q1RA 5JCNA 3ICTA 4JQ9A 3URHA 3DK9A 1PS9A 2XDOA 1RP0A 3Q6JA 3DGZA 1F8WA 4ZN0A 1K0IA 1GRBA 4WCTA 3AEFA 4UP3A 2X50A 1DXLA 3LOVA 4X9NA 4BURA 2GVCA 3F8RA 4A6NB 5BULA 1SEZA 3CNTA 1K0JA 3P4RA 3OC4A 1ONFA 2BS3A 1H7WA 4B1BA 1RSGA 4J57A 5JCKA 1JRXA 1QLBA 1NHRA 1D7LA 3E1TA 4A5LA 1PDHA 3AE8A 2A8XA 2GMJA 2C72A 2OAMA 3UKHA 2QA2A 2GEWA 3CNJA 4O5QA 4EM4A 2Q0KA 3GYIA 3H8IA 1MXTA 5ER0A 1PJ5A 3CN8A 1OJDA 2R46A 4B63A 4D03A 1F6MA 3KLJA 3K7QX 3UKAA 1KSUA 3UTHA 3VRAA 1O94A 4IA5A 2Z5YA 4H4VA 3GDPA 2B9WA 2JB2A 2VVLG 3AEGA 1NHPA 3DH9A 3SUCA 2AQJA 4B64A 2VZ2A 3NYEA 1CC2A 2VVMA 3UTEA 2H88A 2BC1A 1AOGA 3NK2X 4Y4LA 1B8SA 2JK6A 2BK5A 1JEHA 2CULA 3SGLA 2R4JA 2V3BA 3FG2P 2GR0A 4YKGA 4U8NA 1GRFA 2BABA 4H4RA 2FJAA 3AE4A 2Q0LA 2WEUA 4RG3A 4C5OA 5KOXA 3CIRA 1PJ7A 4RSLA 5DBJA 4Z2RA 1PBFA 1PBCA 3LXDA 3D8XA 3JSKA 3AE6A 2YM1A 1ZOYA 3SM8A 2BK4A 4NEVA 5JCLA 3I3LA 4TM4A 5HYMA 3AYLA 2NVKX 1S3EA 3M12A 4JY2A 4U8LA 1JNRA 1S3BA 2YR4A 4A65A 4D04A 3AE2A 2X8HA 2FJBA 3UKFA 4U8KA 3P4QA 1YQZA 3VRBA 2YG6A 4U2LA 3NK1X 1H82A 4H4SA 4NZHA 5L46A 2BA9A 2C3DA 4IVOB 2Z5XA 1TDOA 1BF3A 2QCUA 1GRGA 3DA1A 4YTNA 2XVFA 1PBBA 3O0HA 1OJTA 1PHHA 4I59A 4IA6A 4GF7A 1ZX9A 2ZZCA 2BCGG 1BGNA 1IUSA 3KKJA 3V3NA 3BHKA 2WU2A 5KVHA 1PXAA 3DJEA 1IUVA 2PYXA 4CY6A 1GRTA 2YVJA 1L9DA 3EAOA 4EIPA 3CGCA 4ZCDA 4H7UA 4ADWA 3ALMA 4H4YA 4TM3A 3AWIA 3NTDA 1CJCA 5HHFA 5CKUA 4N9XA 2OLNA 2WOWA 1L9EA 1Z6LA 1GPEA 4JDRA 1LQUA 4Z26A 1JRYA 2TPRA 4YSXA 3GMCA 5BRTA 2YAUA 1XPQA 2A89A 2OLOA 2WU5A 3QSSA 2E4GA 4H2QA 3UP5A 1O95A 2C66A 3IC9A 1IUTA 3QSMA 4Y4MA 3UOYA 1DOCA 2BK3A 4AP3A 4BK3A 5JCIA 2X8CA 2ACZA 4KX6A 3OZ2A 1M64A 4B68A 1CJ3A 2WPFA 4H4TA 4OPCA 2CDUA 3SFDA 3DJJA 3LADA 2JKCA 1GALA 1CHUA 2YG3A 3I6DA 4A9WA 4X4JA 4Z44A 5FS9A 2BYBA 2FJEA 4LA1A 4O5UA 2BCPA 3UTGA 3P1WA 1LTXR 2GAGB 4U8OA 5IQ1A 1ZP0A 3BI5A 4JY3A 2WBAA 3AB1A 1XDIA 2WP9A 2WP5A 4FDCB 4FK1C 4B66A 3D1CA 1XHCA 2XLPA 4YTPA 1NHQA 1XANA 3ZDNA 4H4QA 2WDVA 2J3NA 3DGHA 1OJ9A 2YLZA 3IHGA 4JNAA 4TM1A 1GT8A 2V61A 2VQBA 3H4KA 2OALA 3FMWA 1MOKA 3LB8A 3AD8B 4OPDA 2XFNA 1GREA 4CBQA 3KA7A 3QVPA 4BK2A 1FOHA 1E1NA 3ATRA 4X9MA 3AEAA 2C65A 2GR3A 1H84A 3UCLA 4DNAA 1H86A 1OJAA 1B37A 4NTCA 2XFQA 1GTHA 4BK1A 4TM0A 4Z43A 3UKQA 1MO9A 4AOXA 4HA6A 4YSYA 2BC0A 5J7XA 1EL9A 2WDRA 2ZZBA 1H83A 1UKVG 4J34A 1YKJA 1Y56B 3UKKA 2XVEA 1YQ4A 4C74A 3GRSA 2GMHA 1DNCA 4NTEA 5CQFA 2BS4A 2X8GA 1CF3A 3BI4A 2W0HA 1E39A 2WP6A 2IIDA 3CPIG 2YG5A 2YM2A 1E7PA 3G5SA 4JNQA 4REKA 4U8IA 2ARDA 1PJ6A 4YSHA 1EL7A 1FL2A 2AAQA 3G5RA 4J31A 4EQXA 2JB1A 5U25A 1Q1WA 2XVJA 2DKHA 1TDKA 1CL0A 1DJNA 1E6EA 4UDQA 2XFOA 2F5ZA 1GOSA 4GCMA 4APNA 2GR2A 5LV9A 5C2TA 4EQSA 1KFYA 2EQ8A 4UDPA 2C64A 3II4A 5KRQA 4BJYA 5C3JA 5KOWA 3COXA 3NYCA 3P4PA 4OPGA 5IPYA 5EOWA 3NKSA 1GETA 3QFBA 4GR1A 4H4XA 4ICYA 2GQFA 5IQ4A 2GRTA 3GMBA 3FBSA 4U8PA 3HZLA 2WPEA 4J36A 4OPIA 3REDA 3L1RA 4ZCCA 1M6IA 4OPUA 4H2NA 2C7GA 1HYUA 3NN6X 3AEEA 3NYFA 4YSZA 1H6VA 3CPHG 1TDNA 3GD3A 4WX1A 4A6NA 2A87A 1N4WA 4CY8A 4ECHA 2ZBWA 3AXBA 1NG3A 3AECA 2QA1A 3AD9B 4K7ZA 2LFCA 4H4PA 1JU2A 3KPFA 3CTYA 1JNZA 3NIXA 2B76A 3ALJA 1Y0PA 3AE1A 2YR6A 3UTFA 4B65A 1KNPA 1QJDA 2R4EA 1QO8A 2B9YA 1NHSA 3UOVA 1W4XA 3NHOX 1D4CA 2X99A 1IUUA 3SQPA 3UKLA 1TRBA 4Z24A 2GH5A 3S5WA 4NTDA 1VG0A 4K5RA 4AT2A 4U8JA 1ZMDA 3AYJA 2WDQA 5GSNA 2OA1A 1GSNA 2YLWA 4XWRA 4EMIA 3BNUA 1YY5A 3IF9A 4YWOA 4Z2UA 3GQKA 1D7YA 2YG4A 3CGBA 1E1LA 3P9UA 4CRTA 3EF6A 4GUVA 1S2QA 2RGHA 2EQ9A 5FMHA 2CFYA 4BV6A 4K8DA 2XYOA 1NAAA 4YTMA 2WETA 3AEDA 3QVRA 1IUWA 1ZKQA 1K0LA 3RHAA 4EM3A 2HQMA 4A99A 4EQRA 4KPRA 1O5WA 1LQTA 3DK4A 3IHMA 4U2SA 4USRA 1EL8A 3VR8A 3NNEA 4EIQA 1DOEA 1JOAA 1X31B 1TYTA 2YLXA 1FECA 2R45A 4A79A 3BHFA 3ABVA 3ICRA 3QFAA 5BUKA 1BGJA 1ELIA 4GRTA 2FBWA 4H2RA 1CC4A 3AE9A 1VQWA 1B4VA 1VDCA 2BACA 3SFEA 1V59A 1TDEA 3ISHA 4AOSA 1LV0A 5TR3A 5J60A 1NG4A 2ZZ0A 2PHHA 4B67A 4YXDA 3LZWA 2XVIA 3DMEA 4H4UA 5HY5A 2C76A 4TLXA 1ZY8A 2XLTA 5M0ZA 2GR1A 3FPZA 1F8SA 2XLUA 2YVGA 1H7XA 3H8LA 2IVDA 3NLCA 2R9ZA 3AE7A 4FX9A 3GSIA 3CGDA 3PVCA 3WE0A 2VVLA 1JRZA 5U63A 2YLTA 1KF6A 4CNKA 4DSGA 3EANA 4USQA 3GDNA 1D5TA 4FK1A 4K2XA 5KVIA 1LJ1A 1REOA 5FS8A 2V3AA 4M52A 4Z2TA 1NEKA 2FJDA 1PN0A 3NTAA 1D4DA 4MJWA 1FEBA 3Q9TA 1PXBA 1KDGA 3ALLA 3LJPA 5M10A 4C3XA 2YVFA 4EMWA 2V6OA 2Q6UA 2VRLA 1ZMCA 5JCMA 2GAHB 1TYPA 4AP1A 2GQWA 4NEWA 3GD4A 3M13A 1CBOA 4GDEA 1DOBA 2YLRA 4E0VA 3RP6A 3GQHA 1GV4A 3T37A 2XLSA 3AYIA 2B9XA 2XFPA 3F8DA 3AE5A 3DK8A 4IV9A 3S61A 1TDFA 2XLRA 2V5ZA 2YWLA 4U2TA 4XXGA 2GF3A 1NPXA 3ATQA 3NRNA 3AD7B 4YT0A 4CCQA 3UKPA 1ZK7A 1RYIA 2JBVA 4GDPA 1CJ4A 2YQUA 5EB4A 1GERA 1N4UA 4CCRA 4J56A 2YG7A 3PO7A 4OVIA 3NK0X 2EQ7A 1COYA 3ADAB 2WS3A 3RP8A 2H89A 3CNPA 2C70A 1L0VA 1EL5A 3CNDA 1H81A 2C67A 4AT0A 3ITJA 1NDAA 2C3CA 2JAEA 4CNJA 4LIIA 3P4SA 2QAEA 3NH3X 2O9ZA 4Y4NA 4C77A 1IJHA 1DODA 4DGKA 2R0CA 3GRTA 1GRHA 3F8PA 3RNMA 1PXCA 4H4ZA 2WOIA 1D4EA 1CC6A 2Y6QA 1BWCA 5EBKA 3ICSA 3GYJA 1OJCA 2WOVA
chains in the Genus database with same CATH superfamily
4NUUA 5CA0E 4X1KE 4OPTA 5GRTA 4DR5T 1T98A 4Z90A 2YLSA 1BKWA 3O1HA 1WYBA 1W0BA 4UELA 3TLUA 1RUC4 1D0YA 5LXTE 5FVKA 4IDOA 2Z6EA 2KNDA 5U1OA 3BK9A 2XZEA 4UV9B 2GV8A 2BVLA 4CI1B 4X1YE 3C4AA 4LU6A 4UDRA 3RKGA 3F57A 2VB6A 3BNMA 4I58A 2Y6RA 4M1PA 3OTOT 1G8XA 2VOUA 2WAUA 2E5VA 3QJ4A 4QKNA 1W0AA 2DHRA 1GEUA 3AE3A 1UX5A 2RP4A 4Z25A 1XWMA 2BDEA 3E0ZA 4UEMA 4PAAA 2V1DB 5BVAA 3DJDA 5KWFA 5DJQC 2RPAA 4UF0A 3KV5A 2WESA 2HH7A 2JPFA 2YK0A 3CGEA 1HCIA 4HWFA 5AQUB 1PO14 1GTEA 2W00A 4B69A 4C90A 3B3RA 3QSEA 2B7SA 4FI5A 3CQCB 4UV8B 3IWAA 3GYXA 3N9MA 4H9NC 3VQRA 4CQIA 1XHZA 3LSVA 1VRQB 4EZ4A 2RGOA 4DVDA 1RUH4 5FL0A 2WHDA 1Q9IA 3T2ZA 1L9CA 5AQOB 3K7MX 1KNRA 3DJBA 2LRLA 1F8WA 3T0KA 1GRBA 1R094 4DV3T 4WCTA 3AEFA 4UP3A 4Q4Y4 2X50A 1DXLA 3F8RA 4GAVA 1K0JA 2ODVA 5FKYA 2KZ7B 2N9DA 3OC4A 1OEDA 2XQ4A 5JTGA 4H9QC 1RSGA 1VOMA 2W61A 1D7LA 2WMNA 4A5LA 1PDHA 2LE8A 2WM9A 2QA2A 1AR84 5AQRB 3KPKA 1OJDA 1I94T 3RYHE 4K0UA 1O94A 1Y01A 1CUNA 3ZMZB 2X9HA 2Z5YA 3GDPA 3UU4A 2B9WA 3AEGA 1CC2A 2H88A 2QRXA 2JMHA 1AOGA 3NK2X 4NWZA 1B8SA 3K3OA 4WBNE 5CJ5A 1GRFA 1ASJ4 4HFCA 2Q0LA 2R044 4A98A 3V5SA 4NPPA 3CIRA 4YJ2E 2PG8A 1PBFA 4J2CA 3JSKA 1HX8A 1ZOYA 2XQ5A 2BK4A 3SM8A 4LF8T 1UK5A 3I3LA 4TM4A 1BEV4 1S3EA 3M12A 4A65A 1JNRA 1S3BA 2YR4A 5JDHA 3AE2A 3SS1A 2X8HA 2FJBA 3KV4A 5EK2A 2YU2A 5JDMA 2Q9QA 2UUCT 4B6XA 1H82A 4WW0A 4NZHA 3EABA 2LSYA 4IVOB 3P50A 3UUXB 4EIWA 1PBBA 1OJTA 1PHHA 3JADA 2CM0A 2WMOA 4ISSA 1IUSA 3V3NA 3BHKA 4IDZA 3OPCA 5DQWA 2XHEB 2XSBA 3FI7A 1GRTA 1L9DA 4NUVA 4LF5T 1LRZA 1ZV4X 2ZM0A 3ALMA 2VKOA 4E7SA 3AWIA 2LSJA 1K5MD 5LG4A 4N9XA 1OEDB 2XAGB 1Z6LA 4JDRA 1D0ZA 3GMCA 1IBKT 2R6GF 2WSSV 1XPQA 3IC9A 2BG9E 3ZJ1A 3UOYA 3O1JA 1DOCA 4QXCB 2HWB4 3UFGA 4BK3A 5JCIA 4JI8T 2ACZA 3OZ2A 3PUVF 2WPFA 3CQXC 4H4TA 4OPCA 3SFDA 1E1HB 2UXDT 4X4JA 5FS9A 3ANWA 2FJEA 4PJLA 2MYSA 2BCPA 3P1WA 2V7IA 2WP5A 4YFSA 4B66A 4BJMA 3UQ7A 5JQGE 2XLPA 5IYZE 4JNAA 5HXHA 1D0XA 1GT8A 5ABEA 3H4KA 2NR4A 3RKOA 1MOKA 2XFNA 5J0ZA 3KA7A 4A56A 4BK2A 1S35A 4TWFA 5M4YA 5KMQA 3ATRA 4QH1A 1OEDC 3Q5EA 1H84A 4WNKA 2J47A 1H86A 4HFDA 1U4QA 4NTCA 1GTHA 3UKQA 5FYMA 4YSYA 4KI0F 2ODUA 2ZZBA 2IW5B 2A2FX 4Z8XA 2XVEA 4C74A 4ZI2D 3GRSA 3IA3A 4DV5T 3C98B 4CI3B 1MMDA 1E39A 3CPIG 2YG5A 3A8YC 3L3PA 5AQSB 2N2NA 4J31A 2W2UA 4XBFB 4TWHA 1H8TD 3AA7B 1DJNA 1RVF4 3H37A 3T14A 2F5ZA 1GOSA 3EUHA 5C2TA 2EQ8A 3FZMB 5C3JA 5KOWA 3PUSA 2C4CA 4PNIA 3COXA 3N2OA 5LA6E 1HS7A 3P4PA 1NCQD 3HYXA 4JI6T 3HZLA 5HEJA 2WPEA 4ZZCA 4J36A 5DABA 3RPUA 4OPUA 2C7GA 2R074 3NN6X 3UULA 3NYFA 4YSZA 1BR4A 3OBVE 3L8RA 1TDNA 4WX1A 4ANJA 1N4WA 4IE7A 3PTRB 1JNZA 3NIXA 2B76A 3H3AA 2WWUA 3AE1A 3UTFA 1QJDA 1WLXA 5LGUB 3OYZA 1W4XA 5L4HA 2IHR1 3J9X1 2LJLA 2GH5A 4NTDA 2UUBT 1VG0A 4K5RA 3DP7A 4DV4T 2DNXA 2L8KA 2OA1A 3QK6A 3T2KA 2KSRA 4ZI2C 2W66A 5FNVE 4DR6T 2PFVA 2MTQA 4GUVA 1YKEB 1S2QA 1WCRA 4IDNA 2CFYA 1IZNB 4IT4A 4YTMA 2WETA 3QVRA 1ZKQA 2DWGA 1K0LA 4EM3A 2HQMA 4KPRA 5FXVA 3U78A 1LQTA 4USRA 2XSAA 4EIQA 4EXTA 2D2SA 1M7KA 1FECA 2R45A 2YLXA 2M6BA 1N34T 2C0SA 1ELIA 2DWKA 1CC4A 3AE9A 1VQWA 2H7VC 2X67A 2PYLA 2HWC4 1RUE4 1IJ6A 3NZPA 3ISHA 1TDEA 3TLSA 2X9YA 1LV0A 5LCYA 5J60A 2F4VT 2ZZ0A 5L3EB 4WZXA 1XMQT 2XVIA 5HY5A 2C76A 1XNRT 1ZY8A 4TLXA 4O4HE 2J1DG 5JRCB 5KMGP 3JBG4 2UU9T 4FX9A 3PVCA 2YLTA 1D5TA 2BG9A 2BKPA 3N9LA 1RMU4 4Z2TA 1VCSA 5AFUL 4PDWD 1FEBA 1HG5A 3ALLA 3NRXA 5M10A 1ZKEA 2VRLA 1ZMCA 5LJNA 1TYPA 3GD4A 3CQGB 3JC6D 3AYIA 3F8DA 3S61A 2A72A 4DV0T 1NPXA 3AD7B 1ZK7A 2JBVA 2DCFA 3ZC1A 2YQUA 1GERA 4WYVA 4G6GA 4OVIA 1NAFA 3RP8A 2H89A 3CNPA 1L0VA 4FJOA 2E9XD 3ETUA 3P4SA 4IE6A 1H7CA 2LLYA 4X1IE 1IJHA 4HWIB 1GRHA 4GK0E 2M6IA 2V8SV 2E9XB 1D4EA 2Y6QA 4U2ZA 5EBKA 2WOVA 5LYJE 2CPTA 2KT9A 5AQJB 1HXS4 3QB5A 1LPFA 4JV5T 4DNDA 2WQYA 1LVLA 3G5QA 3W15B 2P9BA 4MHCA 4ZS2A 4TX5A 3VU7H 2XQ8A 3N9NA 5KXJA 2C5IT 4P09A 4DMVA 4OPLA 1FMVA 4EMJA 3R9UA 2XM1A 3BQIA 4LF4T 4UIGA 2J4GA 1VG9A 4IREA 2UUAT 1N1PA 2BXRA 2GB0A 2X51A 1ZDLA 3JC6C 4PABA 2X3NA 4GKJT 3L39A 3C4NA 3NN0X 4C3YA 1XDPA 3GN5A 3LDQB 3TKLB 3AEBA 3DJGX 1ZOVA 1IAPA 1KSSA 1NENA 2WPCA 3J8F4 2E1MA 3CPJG 4H4WA 2D0TA 4IE0A 3UT5E 2YU1A 1E1KA 2C75A 2E9XC 2TMDA 2BXSA 4XAXB 1N4VA 5HWXA 3MXZA 1RUF4 3B57A 2DKIA 3ZYXA 3I9WA 4QWNB 3LZXA 2CXFA 5HAXA 3M3ZB 3LFMA 1VRBA 4F6RC 5KDMC 3RIUA 3CNSA 1CJ2A 3RQWA 4J33A 2VKJA 1PBDA 4LFBT 3VHLA 5FXZA 3NT6A 4CXWA 2W67A 4CXYA 4OCGA 5HEGA 2EQ6A 2YINA 5ABHA 2C73A 2OV9A 5AQIB 4JQ9A 2V5DA 3RIFA 5BMVE 5LJMA 3K3QC 4ZEYA 3LBXB 3R6NA 3TLWA 5FMNA 4X9NA 3ONLC 4A6NB 5AQNB 3PJAA 3CNTA 4LFCT 3ZYKA 3P4RA 4J57A 5JCKA 1US7B 1JRXA 4AQFC 1QLBA 4YLHA 3KVAA 3Q5WA 2A8XA 3OKQA 2C72A 3UKHA 2LSIA 2GEWA 3CNJA 1VBD4 3H8IA 1PJ5A 2R46A 1F6MA 3KLJA 3RQUA 3PUGA 2QYWA 1V9DA 2SPCA 1B7TA 2XAQB 2JQQA 5LMUT 2NWBA 3ETVA 2AQJA 3NYEA 2QGSA 2VVMA 5J2TE 4HTEA 4Q4X4 3LJCA 2MOZA 2XQ3A 2R4JA 2X5ID 4U8NA 2BABA 5LP6E 4DIDB 2V6YA 4RG3A 2A3DA 3PUYF 5L3BB 4OYJA 4C5OA 1PJ7A 5DBJA 3HYVA 1GQEA 1PBCA 2DL1A 2YM1A 2G0UA 2VL8A 2LHNA 4JY2A 4D04A 1XMOT 3EI0A 5E0OA 2CWYA 1OWAA 2ZM6T 3VRBA 4U2LA 3NK1X 1YKHB 4H4SA 2K3WA 5JR9B 1YD8G 4YTNA 4I59A 2KXPB 1SUMB 3BQLA 3FZFB 4OYKA 3KKJA 2WY2A 3PUXF 5KVHA 2EX3A 1PXAA 1T72A 3DJEA 1NA1D 3C4XA 3T31A 4NXNT 2C5KT 4OFZA 5LHHB 3CGCA 1D1AA 4H9PC 2B1EA 2JQ9A 5HEHA 4ADWA 1WRDA 4A5XA 4TV8E 3AVRA 3PURA 1L9EA 2BVMA 1JRYA 2TPRA 2YAUA 4L9IA 5CA1E 2A89A 3QSSA 4ZI7E 3ZN0B 1O95A 2C66A 1IUTA 3QSMA 4Y4MA 2BK3A 2CA5A 4JUYA 1HRV4 3T8OA 1CJ3A 4GAPA 2CDUA 3DJJA 2XQYA 4HFHA 2JKCA 1CHUA 2CHOA 2DI4A 2IAKA 3HKBE 4Q4V4 4O5UA 3UTGA 1LTXR 2GAGB 5JR9C 3AAIA 4U8OA 3BI5A 5JREA 4O4IE 3FXEB 1XDIA 4FK1C 3C4ZA 4DUZT 1XHCA 5ETWA 4II2A 2V6YB 3ZDNA 4PK5A 2V61A 3ZCJA 3TLTA 2VQBA 3R84B 1T7SA 3RC8A 3FMWA 4EOZB 1MQTD 3AAAB 1PIV4 4PJJA 4X9MA 2RS54 4OK0A 4RHV4 3FBZA 1OJAA 4GYRA 3UUBA 5FY1A 4Z43A 1MIWA 1MO9A 2BC0A 3GA8A 4H63V 2WDRA 4IL4A 3ONXA 4J34A 4U31A 4ZOLE 2XQ9A 2GMHA 1DNCA 3H3MA 2BS4A 2X8GA 2IIDA 2YM2A 3G5SA 1E7PA 4REKA 2ARDA 1PJ6A 2XAHB 4H9SE 4HEAA 3AXJA 3SZFA 2CXLA 4UF0B 2HPLA 5L4EA 4PK4A 5LV9A 4CZZB 4JI1T 4HWHA 3SY4A 2BKOA 3II4A 5KRQA 3AA1B 4OX9T 5AQQB 5IPYA 4QH5A 3NKSA 1UX4A 2V7JA 5IQ4A 3C50A 3L1RA 1YXRA 1HYUA 5AQMB 3AEEA 2ES0A 3GD3A 4CI2B 2A87A 3LG7A 3AXBA 3KBUA 4Q4W4 2R064 2H3RA 4K7ZA 4H4PA 1JU2A 3KPFA 4GK5E 2R7FA 4KHZF 4BAYB 4EB6E 2YR6A 1KNPA 3CMLA 5DQVA 1QSDA 3AB3B 1MIYA 1D4CA 3UKLA 4KBMB 4AT2A 2NW8A 3FB2A 5IWAT 5L3DB 3AYJA 1VBB4 5LNKA 4XWRA 3MK7C 4EMIA 2LSKA 4Z2UA 1D7YA 1E1LA 4AKGA 3P9UA 4CRTA 3EF6A 2RGHA 4DR4T 1AR94 2N1GA 3KFWX 2XYOA 4JLEA 1IUWA 3RHAA 5FY7A 3HA4A 4UR9A 4L0RA 1O5WA 3IHMA 2UXNB 2CLYB 1JOAA 1N36T 1X31B 1HF8A 4QH4A 3BHFA 1Z7S4 3BQKA 2FBWA 3NWIA 4H2RA 1B4VA 2BACA 4DBRA 1V59A 4AOSA 3O4XE 4KP3C 5CB4E 4H4UA 2D5UA 4O4JE 1F8SA 1FMWA 5JH7E 2Q9QD 4MFRA 1PO24 4TZ4C 4DSGA 3EANA 4USQA 3M65A 4K2XA 3ZJ2A 2VL0A 1UCUA 1LJ1A 4X20E 5HXEA 3JAEA 5FS8A 2V3AA 1W9RA 2Q9QB 1D4DA 1J5WA 3Q9TA 2LKHA 3ZMSB 4DBQA 2YVFA 2Q6UA 2JIWA 1O3XA 2GQWA 4NEWA 2KLQA 1CBOA 2YLRA 2CLYC 4E0VA 3GQHA 2B9XA 2XFPA 3DK8A 1KK7A 2PW9A 4ZXLA 4CCQA 5CFBA 1R084 1IJ5A 4AQYT 5LBMA 3KDSE 1N4UA 2I6HA 2W0GA 5LOVE 4HN9A 3RYCE 3CVRA 3OJAA 3J7Yq 2EQ7A 1COYA 5HXCA 2IC9A 4X5TA 4P1NA 3CNDA 4TNVA 2C67A 1NDAA 2JAEA 4CNJA 3AAEB 4LIIA 2O9ZA 4Y4NA 1D4M4 1HNZT 5C8YE 3GRTA 4EV6A 5ADXL 2Y6XA 2LRKA 2XQ6A 2AE9A 5JDQA 1BWCA 3GYJA 1XNQT 2Q9QC 4H9RC 3N9OA 4QX7B 5FXXA 3AA6B 3ANWB 5J2UE 2RABA 3EAMA 2CVJA 2I0MA 2K48A 3L8KA 3M0OA 4KMCA 4K5SA 3O1IA 3NGCX 2VURA 3UP4A 2LEHA 2X0YA 2EHOA 3B6DA 4XWZA 4X66T 3UOZA 3EPTA 4QHOA 1Y56A 4BJZA 5FS6A 5KMRA 1P2EA 2XQAA 3T2YA 3NZQA 3RP7A 1HRI4 2RGJA 3NVOA 4ILAA 3GWFA 2RS14 1J5ET 3ZCIA 2NTXA 1ZEEA 3KVEA 4WBOA 3GWDA 1ZHCA 3LK2B 4DMWA 2XVHA 2IVEA 1S2YA 3V3OA 3N2KE 1GESA 1GXFA 3UUNA 3Q5XA 4HB9A 4KHPT 2QVAA 3NG7X 2I0ZA 3KD9A 3C4WA 1DJQA 1G73A 2NPXA 3K8PC 3FIMB 2K24A 2V7MA 2X9WA 4OHFA 3BI2A 3HKDE 3IEEA 3K30A 2XCGA 1HR0T 2PY5A 4J2WA 2VK9A 4JN9A 4A7AA 2Y8DA 4IVMB 4DSHA 4YKFA 5CGMA 2JB3A 4EEDA 5LB7B 2R0GA 3Q6JA 2D0UA 3MA9A 2AXDS 3I1AA 3Q2MA 4NNJA 3PU8A 4B3MT 1BR1A 3LOVA 1BR0A 4BURA 3WI3A 2GVCA 1S94A 1SEZA 1X9BA 3T1HT 2VKDA 4O2BE 5LG3A 1FJGT 4H9OC 4UVBB 4ASKA 4EGWA 5IUXA 1POV0 3AE8A 4TNWA 3QC9A 3E08A 4LFAT 2OAMA 3VKHA 3GYIA 1WR0A 3GWHA 3IF8B 4JYAT 3CN8A 1MIVA 1AR64 4B63A 1KSUA 3VRAA 5ABFA 2VQET 4H4VA 3S4UA 3IBPA 4PFOA 2IMLA 4NIQA 1NHPA 2PLV4 4B64A 2VZ2A 2BC1A 4Y4LA 1Y64B 3JAFA 4PJNA 2BK5A 1UUSA 1JEHA 2JK6A 2CULA 3SGLA 2V3BA 5KMSA 4JEUB 2IIUA 4H4RA 1N33T 2WEUA 4LMLA 2KINB 3K1SA 4QXHB 2MBGA 5KOXA 4Z2RA 3ZMVB 3LXDA 3D8XA 3AE6A 3ZEFB 3CMMA 5KMPA 3AYLA 5H6RB 4U8LA 2IC6A 4I0UA 4U8KA 3P4QA 3RI5A 1VBA4 2YG6A 4LF7T 1MMNA 3C51A 5L46A 2IDOB 3PU3A 3JD74 2BA9A 2C3DA 3DTOA 2ACXA 2Z5XA 1TDOA 1GRGA 3O0HA 2HPJA 4IA6A 4GF7A 1ZX9A 4U2YA 2ZZCA 2BCGG 2X66A 2V6XA 2BG9B 1WR6A 2WU2A 3FZLB 2PYXA 2YVJA 3UU5A 1AL24 4ZCDA 4H7UA 4H4YA 4IGUA 3FHNA 5HHFA 5CKUA 2OLNA 4X65T 3HI2A 4Z26A 4YSXA 4X62T 4IDPA 4IHJE 2E4GA 4H2QA 1KEYA 3UP5A 2W62A 4G6HA 3P7IA 2XUEA 5H6QB 4N78D 5HEOA 4P0BA 3UUMA 5L47A 2CHNA 5J1GA 4G74A 2CWOA 1SHZC 4B68A 4UXNB 3MJXA 3LADA 2YG3A 5FL1A 3I6DA 4A9WA 4Z44A 1OEDE 4AXPA 3ONJA 5IQ1A 1ZP0A 4JY3A 4LMKA 2WBAA 3SZ0A 3RC3A 2E2AA 4HFVA 4TWDA 4FDCB 3ZPOA 1RUI4 3L09A 4YTPA 2E8IA 2BG9C 1NHQA 1XANA 2LM2A 4H4QA 2WDVA 2J3NA 4TM1A 5KNLA 1PVC4 1XI1A 2JQKA 3RRCA 2OALA 3LB8A 3AD8B 4OPDA 2V7LA 3QVPA 4CBQA 4HWCA 1FOHA 2WZHA 5F8PA 3AEAA 3UCLA 4DNAA 3MZKB 2XJ7A 3AVSA 4BK1A 4TM0A 1SA0E 2XM2A 4AOXA 5J7XA 3N9PA 4ZS3A 1UKVG 2YDSA 4NTEA 2NP9A 1CF3A 4KUMB 3BI4A 2WP6A 1U5PA 4JI4T 4V1Av 2AAQA 3GN5B 3E22E 5AQLB 1MMAA 2JB1A 5U25A 1Q1WA 2OLTA 2DKHA 4GIWA 3VKGA 2JJ9A 2V5CA 2XFOA 1HTJF 1QUUA 4U7YA 1KFYA 2RA1A 3CX8B 4UDPA 2RS34 2C64A 3A5XA 1D1CA 1LVKA 4OPGA 2BRAA 3LK3B 2I59A 1GETA 4ICYA 5F5WA 3ZMUB 2GQFA 4AI6A 2GRTA 3GMBA 3REDA 2BBJA 4A97A 2E5LT 4ZCCA 1UGOA 1M6IA 5KX5E 1VBE4 1H6VA 3QB5K 2L9QA 3CPHG 4CY8A 2ZBWA 2D9DA 2LKGA 2YDRA 2QA1A 2CBIA 2LFCA 3CKDA 2KWIB 1Y0PA 3ALJA 3ZYLA 2HHHT 2R4EA 3EVYA 1QO8A 1NHSA 3UOVA 3NHOX 5IHYA 3S5WA 5HCJA 1WYCA 5L3FB 1GSNA 4DR2T 4I43B 1AR74 3BNUA 1YY5A 2YG4A 3CGBA 3TLVA 3UU6A 4AKIA 2EQ9A 5FVLA 4BV6A 4K8DA 2UXBT 1EZ3A 5JDNA 3AEDA 2RM24 2X9XA 4A99A 2H7OA 2XY8B 4U2SA 3VR8A 1Z0PA 2VWAA 1DOEA 3RIUC 1TYTA 2W63A 3QFAA 4I4TE 3F31A 5BR8T 4DR1T 4DUYT 3SFEA 3ZYMA 1AJ3A 1NG4A 2PHHA 4L5GA 3LZWA 1XZYA 4ILUA 3DMEA 1J1JA 2X0HA 2RR14 2WZIA 3D0TA 3RRWA 2GR1A 2BRYA 1HG2A 2YVGA 1WFDA 4XZCA 3PUAA 3H8LA 2R9ZA 3AE7A 3GSIA 5HYAA 1W09A 1JRZA 5U63A 1KF6A 4CNKA 3GDNA 5KVIA 3F2EA 3I9YA 4M52A 2FJDA 3NTAA 4U33A 2K5BB 2X68A 4MJWA 4C3XA 2V6OA 2ZM2A 2MPKA 2XAJB 5AQHB 5JCMA 1DOBA 4CN4A 2FUPA 2NOXA 3KV9A 3RP6A 3SYIA 2XLSA 1TDFA 2XLRA 3ZLIA 2V5ZA 4U2TA 2IUBA 2GF3A 4II3A 3N2GE 5JVDE 5AQKB 4UVAB 4GDPA 1CJ4A 5EB4A 3C64A 3CPZA 4J56A 3PO7A 3ADAB 2PYJA 3B13A 2C70A 1EL5A 1H81A 4AT0A 1XHXA 3RLFF 2QAEA 3NH3X 1FIOA 4JI5T 1DODA 4DGKA 4ISTA 2R0CA 3MKDA 5FY0A 1PXCA 2NTYA 5HWYA 4EYUA 1CC6A 2MAWA 5L2LA 5BULA 3ICSA 1RUD4 5A1LA 3PV0F 2XASB 4TN7B 2R0PA 2GK9A 3C96A 1HX1B 5FXWA 2YR5A 4RG4A 4P9SA 4K22A 2AR8A 2Q7VA 3SXIA 3QNUA 4ILBA 4JBWF 5ABGA 1EBDA 3FZHB 4IIJE 2APGA 3NRYA 4BA9A 1F8RA 5LGTB 4Z91A 2A9UA 4H63H 5FS7A 3SZWA 1FCDA 4PAGA 3RIAA 2LM9A 1P2HA 4U8MA 2V26A 4EQWA 3UOXA 3LK42 5LMNT 1HNXT 5AQVB 3KV6A 4AIUA 1K4QA 2UZZA 3NKZA 3K3NA 1I6ZA 2XFUA 4H50A 1COV4 2HN1A 1B5QA 2VVSA 3VRDB 4AKHA 1GNDA 2CCQA 3ZN1B 3PUQA 2VQ7A 2PZSA 2BS2A 1FEAA 3GMIA 3CX7B 1KNZA 1IUXA 1UURA 2VRMA 4H2PA 4TLZA 3RYFE 3V76A 2ZMAA 1PBEA 1F3PA 3K7TA 2V60A 3KU9A 5HXIA 2LOSA 5EB5A 2UXXB 3AXJB 4LMJA 1E1MA 1BZLA 1OXZA 5LBQB 1YQ3A 3X1DA 3VR9A 2B7RA 1MNEA 2XQ7A 2LOPA 3ZT5A 1GRAA 1EV14 3A7MA 1VBC4 1XDOA 2DLRA 4DV7T 3PS9A 4P0AA 5HXSA 1HNWT 4DV1T 4EEBA 3NBXX 1Q1RA 5JCNA 4F8HA 3ICTA 3URHA 4X64T 1PS9A 2XDOA 2JRKA 1RP0A 3DK9A 1IBLT 3DGZA 2LHRA 4GYSA 4ZN0A 1K0IA 4HGAA 4JI7T 3FZKB 4C91A 4COFA 5LGNB 2NW9A 3PUZF 4I50E 1ONFA 2BS3A 1H7WA 1MNDA 4B1BA 1MMGA 4U72A 2QA7A 1X79A 4TV9E 4DR7T 2CXDA 4JEHB 4O2AE 1NHRA 4HKAA 3E1TA 2PBIA 2GMJA 4EM4A 4O5QA 2Q0KA 1MXTA 5EK3A 2L3LA 5ER0A 4D03A 3K7QX 3UKAA 3UTHA 2BKNA 3ZMTB 4JI2T 4IA5A 5HEUA 4IE5A 1EAH4 2JB2A 2VVLG 2XPKA 2CMRA 3DH9A 3SUCA 4PFPA 3UTEA 3RF1A 1DU2A 4EZHA 3RX6A 2WB5A 4ZZBA 5HCMA 3FG2P 4PK6A 2GR0A 4YKGA 3UQ4A 2FJAA 3AE4A 3ZKRA 2J62A 5JDLA 4HWDA 4ZI3D 1YW0A 5JRCA 3AA0B 4RSLA 4HFEA 4E7ZA 3ZSTA 4AKLA 4NEVA 5JCLA 3SRZA 3V5UA 5HYMA 2VVNA 2NVKX 3EHZA 5GONE 3N5LA 3UKFA 3N9QA 1YQZA 2ZM8A 2CBJA 2KMFA 4GKKT 3RHWA 4EAHA 3QOFA 5HXRA 2QCUA 1BF3A 3DA1A 2XVFA 3RYIE 2VASA 3PJAJ 1BR2A 1BGNA 4AISA 4ZHQE 4CN1A 4O4LE 2K9AA 5LHGB 1LVFA 1IUVA 5EZYE 4CY6A 3KBTA 3EAOA 4EIPA 4MLKA 5JDGA 3G06A 4TM3A 2JMKA 3NTDA 1CJCA 5L3CB 2WOWA 3ZSSA 3KVBA 3ZC0A 1GPEA 3UU8A 1LQUA 2Y48B 3SOLA 5BRTA 4DR3T 2RMU4 2X0LB 4U3CA 2OLOA 2WU5A 2W4XA 4B3RT 5F3JA 3UTKA 4AP3A 2X8CA 4ZI3C 4KX6A 2E9XA 3U3IA 4AQGA 3HR0A 1M64A 2OA5A 4BJNA 1OOPD 3UFEA 1GALA 3Q9DA 3T1YT 2BYBA 4LA1A 4GB34 2XTLA 4UVCB 1FEWA 1HFAA 3AB1A 3FXDB 2WP9A 3D1CA 2YN6A 3IHGA 3DGHA 1OJ9A 2YLZA 1RHI4 4O8SA 2EHOD 1GREA 3UU3A 5AQFB 2BZBA 5JDFA 4AKRB 1E1NA 2C65A 2GR3A 3P8CD 4ILCA 5AQPB 3B5MA 1B37A 2XFQA 2EHOB 4YHHT 4HA6A 2JQHA 1EL9A 1H83A 4DV2T 4AQFA 1YKJA 1Y56B 3UKKA 1YQ4A 2M67A 5CQFA 2W0HA 4YJ3E 3I0QA 4JNQA 4U8IA 3WAKA 4YSHA 4HFIA 4YHJA 1EL7A 1FL2A 3G5RA 4TUYE 4EQXA 3PDYA 2CEAA 1RUG4 2XVJA 1TDKA 3EDVA 1CL0A 4PW8A 1E6EA 3CK6A 4U74A 1M62A 4UDQA 3RGLA 2PJQA 4IE4A 4GCMA 2KWHA 4B3TT 2YEVC 4APNA 2GR2A 4G9KA 4EQSA 4Q25A 2BBHA 4BJYA 1RUJ4 2C5JA 3NYCA 2CRBA 3I0OA 5EOWA 4H4XA 3MACA 3QFBA 4GR1A 1Z8UA 3PUWF 4NXMT 4JI3T 3FBSA 4U8PA 3LBXA 4OPIA 3ZT6A 4YY3T 4CN6A 4H2NA 4A6NA 3P4WA 4ECHA 3O9XA 5TAOA 5AQGB 1NG3A 3AECA 3AD9B 4G2AA 2EHOC 3CTYA 1VRH4 4B65A 2B9YA 3WAJA 2X99A 1IUUA 3SQPA 1TRBA 4Z24A 4MALA 4U8JA 2XAFB 2VQFT 1ZMDA 2WDQA 5GSNA 4G63A 4IL9A 2YLWA 1N32T 1D1BA 4YWOA 3IF9A 3GQKA 1IBMT 3CWZB 4G73A 3SZCA 4IDQA 2NW7A 5LHIB 5FMHA 3PE0A 4U7IA 3ZT7A 1NAAA 2WBLA 4EQRA 4K0KT 3DK4A 1EL8A 1SE7A 3NNEA 2YKSA 4CXXA 5ABFB 4LF6T 3QUJA 3IHRA 4A79A 3Q5DA 3ICRA 3ABVA 5BUKA 1BGJA 4GRTA 4HFBA 4DV6T 4QXBB 2UXCT 4EYYR 4B3ST 1VDCA 2LT3A 4I55E 4DO0A 5TR3A 3HKEE 4B67A 4YXDA 3SX6A 5M0ZA 2XLTA 4MBQA 3RH3A 3FPZA 2YOEA 2XLUA 1H7XA 2IVDA 4PJMA 5AQTB 3NLCA 2PTFA 5JR9A 1LKXA 3CGDA 3WE0A 2VVLA 1E2AA 4FK1A 4GOUA 2WCAA 1REOA 3JCFA 2WWVA 1NEKA 1PN0A 5EK4A 4LF9T 1R8IA 1PXBA 1KDGA 2V7KA 3HL6A 3LJPA 4EMWA 3KINB 3CX6B 2GAHB 4AP1A 3M13A 4GDEA 1T8BA 2CE7A 3OYXA 1NWMX 1GV4A 3T37A 4ERRA 4IV9A 3AE5A 3HKCE 2YWLA 3SWHA 4ADZA 3EDUA 4XXGA 3ATQA 3NRNA 4QX8B 4YT0A 5L3GB 3OVUA 4JI0T 3UKPA 1VCTA 1RYIA 5FP3A 3HYWA 4HE8A 4CCRA 2YDQA 2YG7A 3ESLA 3NK0X 2WS3A 2VKHA 3FBLA 3ITJA 2C3CA 4C77A 2HN2A 2ZLYA 3F8PA 3RNMA 2LSGA 4H4ZA 2WOIA 1OJCA
chains in the Genus database with same CATH topology
4OPTA 5GRTA 2YLSA 1BKWA 2R0PA 3C96A 1LPFA 2RABA 2CVJA 1LVLA 2WQYA 2YR5A 4RG4A 3G5QA 4P9SA 3L8KA 4K22A 3M0OA 2AR8A 4K5SA 2Q7VA 3NGCX 3SXIA 5U1OA 3UP4A 1EBDA 5KXJA 2APGA 3B6DA 4OPLA 2GV8A 1F8RA 4EMJA 3R9UA 3C4AA 4LU6A 4XWZA 4UDRA 1VG9A 3UOZA 3EPTA 5FS7A 1N1PA 1FCDA 2BXRA 2GB0A 3SZWA 1Y56A 3BNMA 4I58A 4BJZA 2Y6RA 5FS6A 5KMRA 2VOUA 1P2EA 1ZDLA 2E5VA 1P2HA 3QJ4A 4U8MA 4EQWA 3T2YA 3UOXA 3RP7A 4PABA 1GEUA 2X3NA 2RGJA 3GWFA 3AE3A 1K4QA 3C4NA 3NN0X 2UZZA 2XFUA 4C3YA 4Z25A 3AEBA 4H50A 5BVAA 3KVEA 4PAAA 3DJGX 1B5QA 1ZOVA 3DJDA 3GWDA 1KSSA 1NENA 2XVHA 2IVEA 1S2YA 3VRDB 5KWFA 2WPCA 3V3OA 1GNDA 2E1MA 2VQ7A 2WESA 1GESA 2BS2A 1FEAA 1GXFA 3CPJG 4H4WA 3CGEA 4HB9A 1IUXA 1E1KA 3NG7X 2C75A 2VRMA 4H2PA 1GTEA 2TMDA 2BXSA 4TLZA 3V76A 1N4VA 2I0ZA 1PBEA 1F3PA 3K7TA 4B69A 2V60A 3KD9A 3KU9A 2DKIA 1DJQA 3ZYXA 5HXIA 3B3RA 3QSEA 2NPXA 2B7SA 3FIMB 3LZXA 5EB5A 1E1MA 3IWAA 3GYXA 1BZLA 3CNSA 1CJ2A 3BI2A 3VQRA 1YQ3A 3K30A 4J33A 3VR9A 2B7RA 2XCGA 1GRAA 1VRQB 2RGOA 1PBDA 4J2WA 4JN9A 2WHDA 1Q9IA 3NT6A 4A7AA 3PS9A 3T2ZA 4IVMB 4OCGA 1L9CA 4DSHA 2EQ6A 3K7MX 1KNRA 4YKFA 2JB3A 2R0GA 2C73A 1Q1RA 5JCNA 3ICTA 4JQ9A 3URHA 3DK9A 1PS9A 2XDOA 1RP0A 3Q6JA 3DGZA 1F8WA 3T0KA 4ZN0A 1K0IA 1GRBA 4WCTA 3AEFA 4UP3A 2X50A 1DXLA 3LOVA 4NNJA 4X9NA 4BURA 2GVCA 3F8RA 4A6NB 5BULA 4GAVA 1SEZA 3CNTA 1K0JA 3P4RA 3OC4A 1ONFA 2BS3A 1H7WA 4B1BA 1RSGA 4J57A 5JCKA 1JRXA 1QLBA 1NHRA 1D7LA 3E1TA 4A5LA 1PDHA 3AE8A 2A8XA 2GMJA 2C72A 2OAMA 3UKHA 2QA2A 2GEWA 3CNJA 4O5QA 4EM4A 2Q0KA 3GYIA 3H8IA 1MXTA 5ER0A 1PJ5A 3CN8A 3KPKA 1OJDA 2R46A 4B63A 4D03A 1F6MA 3KLJA 3K7QX 3UKAA 1KSUA 3UTHA 3VRAA 1O94A 4IA5A 2Z5YA 4H4VA 3GDPA 2B9WA 2JB2A 2VVLG 3AEGA 1NHPA 3DH9A 3SUCA 2AQJA 4B64A 2VZ2A 3NYEA 1CC2A 2VVMA 3UTEA 2H88A 2BC1A 1AOGA 3NK2X 4NWZA 4Y4LA 1B8SA 2JK6A 2BK5A 1JEHA 2CULA 3SGLA 2R4JA 2V3BA 3FG2P 5KMSA 2GR0A 4YKGA 4U8NA 1GRFA 2BABA 4H4RA 2FJAA 3AE4A 2Q0LA 2WEUA 4RG3A 4C5OA 5KOXA 3CIRA 1PJ7A 4RSLA 5DBJA 4Z2RA 3HYVA 1PBFA 1PBCA 3LXDA 3D8XA 3JSKA 3AE6A 2YM1A 1ZOYA 3SM8A 2BK4A 4NEVA 5JCLA 3I3LA 3CMMA 4TM4A 5HYMA 5KMPA 3AYLA 2NVKX 1S3EA 3M12A 4JY2A 4U8LA 1JNRA 1S3BA 2YR4A 4A65A 4D04A 3AE2A 2X8HA 2FJBA 3UKFA 4U8KA 3P4QA 1YQZA 3VRBA 2YG6A 4U2LA 3NK1X 1H82A 4H4SA 4NZHA 5L46A 2BA9A 2C3DA 4IVOB 2Z5XA 1TDOA 1BF3A 2QCUA 1GRGA 3DA1A 4YTNA 2XVFA 1PBBA 3O0HA 1OJTA 1PHHA 4I59A 4IA6A 4GF7A 1ZX9A 2ZZCA 2BCGG 1BGNA 1IUSA 3KKJA 3V3NA 3BHKA 2WU2A 5KVHA 1PXAA 3DJEA 1IUVA 3T31A 2PYXA 4CY6A 1GRTA 2YVJA 1L9DA 3EAOA 4EIPA 3CGCA 4ZCDA 4H7UA 4ADWA 3ALMA 4H4YA 4TM3A 3AWIA 3NTDA 1CJCA 5HHFA 5CKUA 4N9XA 2OLNA 2WOWA 1L9EA 1Z6LA 1GPEA 4JDRA 1LQUA 4Z26A 1JRYA 2TPRA 4YSXA 3GMCA 5BRTA 2YAUA 1XPQA 2A89A 2OLOA 2WU5A 3QSSA 2E4GA 4H2QA 3UP5A 1O95A 2C66A 3IC9A 1IUTA 4G6HA 3QSMA 4Y4MA 3UOYA 1DOCA 2BK3A 4AP3A 4BK3A 5JCIA 2X8CA 2ACZA 4KX6A 3OZ2A 4G74A 1M64A 4B68A 1CJ3A 2WPFA 4GAPA 4H4TA 4OPCA 2CDUA 3SFDA 3DJJA 3LADA 2JKCA 1GALA 1CHUA 2YG3A 3I6DA 4A9WA 4X4JA 4Z44A 5FS9A 2BYBA 2FJEA 4LA1A 4O5UA 2BCPA 3UTGA 3P1WA 1LTXR 2GAGB 4U8OA 5IQ1A 1ZP0A 3BI5A 4JY3A 2WBAA 3AB1A 3SZ0A 1XDIA 2WP9A 2WP5A 4FDCB 4FK1C 4B66A 3D1CA 1XHCA 4II2A 2XLPA 4YTPA 1NHQA 1XANA 3ZDNA 4H4QA 2WDVA 2J3NA 3DGHA 1OJ9A 2YLZA 3IHGA 4JNAA 4TM1A 1GT8A 5KNLA 2V61A 2VQBA 3H4KA 2OALA 3FMWA 1MOKA 3LB8A 3AD8B 4OPDA 2XFNA 1GREA 4CBQA 3KA7A 3QVPA 4BK2A 1FOHA 1E1NA 5KMQA 3ATRA 4X9MA 3AEAA 2C65A 2GR3A 1H84A 3UCLA 4DNAA 1H86A 1OJAA 1B37A 4NTCA 2XFQA 1GTHA 4BK1A 4TM0A 4Z43A 3UKQA 1MO9A 4AOXA 4HA6A 4YSYA 2BC0A 5J7XA 1EL9A 2WDRA 2ZZBA 1H83A 1UKVG 4J34A 1YKJA 1Y56B 3UKKA 2XVEA 1YQ4A 4C74A 3GRSA 2GMHA 1DNCA 4NTEA 5CQFA 2BS4A 2X8GA 1CF3A 3BI4A 2W0HA 1E39A 2WP6A 2IIDA 3CPIG 2YG5A 2YM2A 1E7PA 3G5SA 4JNQA 4REKA 4U8IA 2ARDA 1PJ6A 4YSHA 1EL7A 1FL2A 2AAQA 3G5RA 4J31A 4EQXA 2JB1A 5U25A 1Q1WA 2XVJA 3SZFA 2DKHA 1TDKA 1CL0A 1DJNA 1E6EA 4UDQA 2XFOA 3T14A 2F5ZA 1GOSA 4GCMA 4APNA 2GR2A 5LV9A 5C2TA 4G9KA 4EQSA 1KFYA 2EQ8A 4UDPA 2C64A 3SY4A 3II4A 5KRQA 4BJYA 5C3JA 5KOWA 2C4CA 3COXA 3NYCA 3P4PA 4OPGA 2BRAA 5IPYA 5EOWA 3NKSA 1GETA 3QFBA 4GR1A 4H4XA 4ICYA 2GQFA 5IQ4A 3HYXA 2GRTA 3GMBA 3FBSA 4U8PA 3HZLA 2WPEA 4J36A 4OPIA 3REDA 3L1RA 4ZCCA 1M6IA 4OPUA 4H2NA 2C7GA 1HYUA 3NN6X 3AEEA 3NYFA 4YSZA 1H6VA 3CPHG 1TDNA 3GD3A 4WX1A 4A6NA 2A87A 1N4WA 4CY8A 4ECHA 2ZBWA 3AXBA 1NG3A 3AECA 2QA1A 3AD9B 4K7ZA 2LFCA 4H4PA 1JU2A 3KPFA 3CTYA 1JNZA 3NIXA 2B76A 3ALJA 1Y0PA 3AE1A 2YR6A 3UTFA 4B65A 1KNPA 1QJDA 2R4EA 1QO8A 2B9YA 1NHSA 3UOVA 1W4XA 3NHOX 1D4CA 2X99A 1IUUA 3SQPA 3UKLA 1TRBA 4Z24A 2GH5A 3S5WA 4NTDA 1VG0A 4K5RA 4AT2A 4U8JA 1ZMDA 3AYJA 2WDQA 5GSNA 2OA1A 1GSNA 3T2KA 2YLWA 4XWRA 4EMIA 3BNUA 1YY5A 3IF9A 4YWOA 4Z2UA 3GQKA 1D7YA 2YG4A 3CGBA 1E1LA 3P9UA 4G73A 4CRTA 3EF6A 4GUVA 3SZCA 1S2QA 2RGHA 2EQ9A 5FMHA 2CFYA 4BV6A 4K8DA 2XYOA 1NAAA 4YTMA 2WETA 3AEDA 3QVRA 1IUWA 1ZKQA 1K0LA 3RHAA 4EM3A 2HQMA 4A99A 4EQRA 4KPRA 1O5WA 1LQTA 3DK4A 3IHMA 4U2SA 4USRA 1EL8A 3VR8A 3NNEA 4EIQA 1DOEA 1JOAA 1X31B 1TYTA 2YLXA 1FECA 2R45A 4A79A 3BHFA 3ABVA 3ICRA 3QFAA 5BUKA 1BGJA 1ELIA 4GRTA 2FBWA 4H2RA 1CC4A 3AE9A 1VQWA 1B4VA 1VDCA 2BACA 3SFEA 1V59A 1TDEA 3ISHA 4AOSA 1LV0A 5TR3A 5J60A 1NG4A 2ZZ0A 2PHHA 4B67A 4YXDA 3LZWA 2XVIA 3DMEA 4H4UA 5HY5A 2C76A 3SX6A 4TLXA 1ZY8A 2XLTA 5M0ZA 2GR1A 3FPZA 2BRYA 1F8SA 2XLUA 2YVGA 1H7XA 3H8LA 2IVDA 3NLCA 2R9ZA 3AE7A 4FX9A 3GSIA 3CGDA 3PVCA 3WE0A 2VVLA 1JRZA 5U63A 2YLTA 1KF6A 4CNKA 4DSGA 3EANA 4USQA 3GDNA 1D5TA 4FK1A 4K2XA 5KVIA 1LJ1A 1REOA 5FS8A 2V3AA 4M52A 4Z2TA 1NEKA 2FJDA 1PN0A 3NTAA 1D4DA 4MJWA 1FEBA 3Q9TA 1PXBA 1KDGA 3ALLA 3LJPA 5M10A 4C3XA 2YVFA 4EMWA 2V6OA 2Q6UA 2VRLA 1ZMCA 5JCMA 2GAHB 1TYPA 4AP1A 2GQWA 4NEWA 3GD4A 3M13A 1CBOA 4GDEA 1DOBA 2YLRA 4E0VA 3RP6A 3SYIA 1GV4A 3T37A 2XLSA 3AYIA 2B9XA 2XFPA 3F8DA 3AE5A 3DK8A 4IV9A 3S61A 1TDFA 2XLRA 2V5ZA 2YWLA 4U2TA 4XXGA 2GF3A 4II3A 1NPXA 3ATQA 3NRNA 3AD7B 4YT0A 4CCQA 3UKPA 1ZK7A 1RYIA 2JBVA 4GDPA 1CJ4A 3HYWA 2YQUA 5EB4A 1GERA 1N4UA 4G6GA 4CCRA 4J56A 2YG7A 3PO7A 4OVIA 3NK0X 2EQ7A 1COYA 3ADAB 2WS3A 3RP8A 2H89A 3CNPA 2C70A 1L0VA 1EL5A 3CNDA 1H81A 2C67A 4AT0A 3ITJA 1NDAA 2C3CA 2JAEA 4CNJA 4LIIA 3P4SA 2QAEA 3NH3X 2O9ZA 4Y4NA 4C77A 1IJHA 1DODA 4DGKA 2R0CA 3GRTA 1GRHA 3GQHA 3F8PA 3RNMA 1PXCA 4H4ZA 2WOIA 1D4EA 1CC6A 2Y6QA 1BWCA 5EBKA 3ICSA 3GYJA 1OJCA 2WOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPT A;  5GRT A;  2YLS A;  1BKW A;  2R0P A;  3C96 A;  1LPF A;  2RAB A;  2CVJ A;  1LVL A;  2WQY A;  2YR5 A;  4RG4 A;  3G5Q A;  4P9S A;  3L8K A;  4K22 A;  3M0O A;  2AR8 A;  4K5S A;  2Q7V A;  3NGC X;  5U1O A;  3UP4 A;  1EBD A;  5KXJ A;  2APG A;  3B6D A;  4OPL A;  2GV8 A;  1F8R A;  4EMJ A;  3R9U A;  3C4A A;  4LU6 A;  4XWZ A;  4UDR A;  1VG9 A;  3UOZ A;  3EPT A;  5FS7 A;  1N1P A;  1FCD A;  2BXR A;  2GB0 A;  1Y56 A;  3BNM A;  4I58 A;  4BJZ A;  2Y6R A;  5FS6 A;  2VOU A;  1P2E A;  1ZDL A;  2E5V A;  1P2H A;  3QJ4 A;  4U8M A;  4EQW A;  3UOX A;  3RP7 A;  4PAB A;  1GEU A;  2X3N A;  2RGJ A;  3GWF A;  3AE3 A;  1K4Q A;  3C4N A;  3NN0 X;  2UZZ A;  2XFU A;  4C3Y A;  4Z25 A;  3AEB A;  4H50 A;  5BVA A;  3KVE A;  4PAA A;  3DJG X;  1B5Q A;  1ZOV A;  3DJD A;  3GWD A;  1KSS A;  1NEN A;  2XVH A;  2IVE A;  1S2Y A;  3VRD B;  5KWF A;  2WPC A;  3V3O A;  1GND A;  2E1M A;  2VQ7 A;  2WES A;  1GES A;  2BS2 A;  1FEA A;  1GXF A;  3CPJ G;  4H4W A;  3CGE A;  4HB9 A;  1IUX A;  1E1K A;  3NG7 X;  2C75 A;  2VRM A;  4H2P A;  1GTE A;  2TMD A;  2BXS A;  4TLZ A;  3V76 A;  1N4V A;  2I0Z A;  1PBE A;  1F3P A;  3K7T A;  4B69 A;  2V60 A;  3KD9 A;  3KU9 A;  2DKI A;  1DJQ A;  3ZYX A;  5HXI A;  3B3R A;  3QSE A;  2NPX A;  2B7S A;  3FIM B;  3LZX A;  5EB5 A;  1E1M A;  3IWA A;  3GYX A;  1BZL A;  3CNS A;  1CJ2 A;  3BI2 A;  3VQR A;  1YQ3 A;  3K30 A;  4J33 A;  3VR9 A;  2B7R A;  2XCG A;  1GRA A;  1VRQ B;  2RGO A;  1PBD A;  4J2W A;  4JN9 A;  2WHD A;  1Q9I A;  3NT6 A;  4A7A A;  3PS9 A;  4IVM B;  4OCG A;  1L9C A;  4DSH A;  2EQ6 A;  3K7M X;  1KNR A;  4YKF A;  2JB3 A;  2R0G A;  2C73 A;  1Q1R A;  5JCN A;  3ICT A;  4JQ9 A;  3URH A;  3DK9 A;  1PS9 A;  2XDO A;  1RP0 A;  3Q6J A;  3DGZ A;  1F8W A;  4ZN0 A;  1K0I A;  1GRB A;  4WCT A;  3AEF A;  4UP3 A;  2X50 A;  1DXL A;  3LOV A;  4X9N A;  4BUR A;  2GVC A;  3F8R A;  4A6N B;  5BUL A;  1SEZ A;  3CNT A;  1K0J A;  3P4R A;  3OC4 A;  1ONF A;  2BS3 A;  1H7W A;  4B1B A;  1RSG A;  4J57 A;  5JCK A;  1JRX A;  1QLB A;  1NHR A;  1D7L A;  3E1T A;  4A5L A;  1PDH A;  3AE8 A;  2A8X A;  2GMJ A;  2C72 A;  2OAM A;  3UKH A;  2QA2 A;  2GEW A;  3CNJ A;  4O5Q A;  4EM4 A;  2Q0K A;  3GYI A;  3H8I A;  1MXT A;  5ER0 A;  1PJ5 A;  3CN8 A;  1OJD A;  2R46 A;  4B63 A;  4D03 A;  1F6M A;  3KLJ A;  3K7Q X;  3UKA A;  1KSU A;  3UTH A;  3VRA A;  1O94 A;  4IA5 A;  2Z5Y A;  4H4V A;  3GDP A;  2B9W A;  2JB2 A;  2VVL G;  3AEG A;  1NHP A;  3DH9 A;  3SUC A;  2AQJ A;  4B64 A;  2VZ2 A;  3NYE A;  1CC2 A;  2VVM A;  3UTE A;  2H88 A;  2BC1 A;  1AOG A;  3NK2 X;  4Y4L A;  1B8S A;  2JK6 A;  2BK5 A;  1JEH A;  2CUL A;  3SGL A;  2R4J A;  2V3B A;  3FG2 P;  2GR0 A;  4YKG A;  4U8N A;  1GRF A;  2BAB A;  4H4R A;  2FJA A;  3AE4 A;  2Q0L A;  2WEU A;  4RG3 A;  4C5O A;  5KOX A;  3CIR A;  1PJ7 A;  4RSL A;  5DBJ A;  4Z2R A;  1PBF A;  1PBC A;  3LXD A;  3D8X A;  3JSK A;  3AE6 A;  2YM1 A;  1ZOY A;  3SM8 A;  2BK4 A;  4NEV A;  5JCL A;  3I3L A;  4TM4 A;  5HYM A;  3AYL A;  2NVK X;  1S3E A;  3M12 A;  4JY2 A;  4U8L A;  1JNR A;  1S3B A;  2YR4 A;  4A65 A;  4D04 A;  3AE2 A;  2X8H A;  2FJB A;  3UKF A;  4U8K A;  3P4Q A;  1YQZ A;  3VRB A;  2YG6 A;  4U2L A;  3NK1 X;  1H82 A;  4H4S A;  4NZH A;  5L46 A;  2BA9 A;  2C3D A;  4IVO B;  2Z5X A;  1TDO A;  1BF3 A;  2QCU A;  1GRG A;  3DA1 A;  4YTN A;  2XVF A;  1PBB A;  3O0H A;  1OJT A;  1PHH A;  4I59 A;  4IA6 A;  4GF7 A;  1ZX9 A;  2ZZC A;  2BCG G;  1BGN A;  1IUS A;  3KKJ A;  3V3N A;  3BHK A;  2WU2 A;  5KVH A;  1PXA A;  3DJE A;  1IUV A;  2PYX A;  4CY6 A;  1GRT A;  2YVJ A;  1L9D A;  3EAO A;  4EIP A;  3CGC A;  4ZCD A;  4H7U A;  4ADW A;  3ALM A;  4H4Y A;  4TM3 A;  3AWI A;  3NTD A;  1CJC A;  5HHF A;  5CKU A;  4N9X A;  2OLN A;  2WOW A;  1L9E A;  1Z6L A;  1GPE A;  4JDR A;  1LQU A;  4Z26 A;  1JRY A;  2TPR A;  4YSX A;  3GMC A;  5BRT A;  2YAU A;  1XPQ A;  2A89 A;  2OLO A;  2WU5 A;  3QSS A;  2E4G A;  4H2Q A;  3UP5 A;  1O95 A;  2C66 A;  3IC9 A;  1IUT A;  3QSM A;  4Y4M A;  3UOY A;  1DOC A;  2BK3 A;  4AP3 A;  4BK3 A;  5JCI A;  2X8C A;  2ACZ A;  4KX6 A;  3OZ2 A;  1M64 A;  4B68 A;  1CJ3 A;  2WPF A;  4H4T A;  4OPC A;  2CDU A;  3SFD A;  3DJJ A;  3LAD A;  2JKC A;  1GAL A;  1CHU A;  2YG3 A;  3I6D A;  4A9W A;  4X4J A;  4Z44 A;  5FS9 A;  2BYB A;  2FJE A;  4LA1 A;  4O5U A;  2BCP A;  3UTG A;  3P1W A;  1LTX R;  2GAG B;  4U8O A;  5IQ1 A;  1ZP0 A;  3BI5 A;  4JY3 A;  2WBA A;  3AB1 A;  1XDI A;  2WP9 A;  2WP5 A;  4FDC B;  4FK1 C;  4B66 A;  3D1C A;  1XHC A;  2XLP A;  4YTP A;  1NHQ A;  1XAN A;  3ZDN A;  4H4Q A;  2WDV A;  2J3N A;  3DGH A;  1OJ9 A;  2YLZ A;  3IHG A;  4JNA A;  4TM1 A;  1GT8 A;  2V61 A;  2VQB A;  3H4K A;  2OAL A;  3FMW A;  1MOK A;  3LB8 A;  3AD8 B;  4OPD A;  2XFN A;  1GRE A;  4CBQ A;  3KA7 A;  3QVP A;  4BK2 A;  1FOH A;  1E1N A;  3ATR A;  4X9M A;  3AEA A;  2C65 A;  2GR3 A;  1H84 A;  3UCL A;  4DNA A;  1H86 A;  1OJA A;  1B37 A;  4NTC A;  2XFQ A;  1GTH A;  4BK1 A;  4TM0 A;  4Z43 A;  3UKQ A;  1MO9 A;  4AOX A;  4HA6 A;  4YSY A;  2BC0 A;  5J7X A;  1EL9 A;  2WDR A;  2ZZB A;  1H83 A;  1UKV G;  4J34 A;  1YKJ A;  1Y56 B;  3UKK A;  2XVE A;  1YQ4 A;  4C74 A;  3GRS A;  2GMH A;  1DNC A;  4NTE A;  5CQF A;  2BS4 A;  2X8G A;  1CF3 A;  3BI4 A;  2W0H A;  1E39 A;  2WP6 A;  2IID A;  3CPI G;  2YG5 A;  2YM2 A;  1E7P A;  3G5S A;  4JNQ A;  4REK A;  4U8I A;  2ARD A;  1PJ6 A;  4YSH A;  1EL7 A;  1FL2 A;  2AAQ A;  3G5R A;  4J31 A;  4EQX A;  2JB1 A;  5U25 A;  1Q1W A;  2XVJ A;  2DKH A;  1TDK A;  1CL0 A;  1DJN A;  1E6E A;  4UDQ A;  2XFO A;  2F5Z A;  1GOS A;  4GCM A;  4APN A;  2GR2 A;  5LV9 A;  5C2T A;  4EQS A;  1KFY A;  2EQ8 A;  4UDP A;  2C64 A;  3II4 A;  5KRQ A;  4BJY A;  5C3J A;  5KOW A;  3COX A;  3NYC A;  3P4P A;  4OPG A;  5IPY A;  5EOW A;  3NKS A;  1GET A;  3QFB A;  4GR1 A;  4H4X A;  4ICY A;  2GQF A;  5IQ4 A;  2GRT A;  3GMB A;  3FBS A;  4U8P A;  3HZL A;  2WPE A;  4J36 A;  4OPI A;  3RED A;  3L1R A;  4ZCC A;  1M6I A;  4OPU A;  4H2N A;  2C7G A;  1HYU A;  3NN6 X;  3AEE A;  3NYF A;  4YSZ A;  1H6V A;  3CPH G;  1TDN A;  3GD3 A;  4WX1 A;  4A6N A;  2A87 A;  1N4W A;  4CY8 A;  4ECH A;  2ZBW A;  3AXB A;  1NG3 A;  3AEC A;  2QA1 A;  3AD9 B;  4K7Z A;  2LFC A;  4H4P A;  1JU2 A;  3KPF A;  3CTY A;  1JNZ A;  3NIX A;  2B76 A;  3ALJ A;  1Y0P A;  3AE1 A;  2YR6 A;  3UTF A;  4B65 A;  1KNP A;  1QJD A;  2R4E A;  1QO8 A;  2B9Y A;  1NHS A;  3UOV A;  1W4X A;  3NHO X;  1D4C A;  2X99 A;  1IUU A;  3SQP A;  3UKL A;  1TRB A;  4Z24 A;  2GH5 A;  3S5W A;  4NTD A;  1VG0 A;  4K5R A;  4AT2 A;  4U8J A;  1ZMD A;  3AYJ A;  2WDQ A;  5GSN A;  2OA1 A;  1GSN A;  2YLW A;  4XWR A;  4EMI A;  3BNU A;  1YY5 A;  3IF9 A;  4YWO A;  4Z2U A;  3GQK A;  1D7Y A;  2YG4 A;  3CGB A;  1E1L A;  3P9U A;  4CRT A;  3EF6 A;  4GUV A;  1S2Q A;  2RGH A;  2EQ9 A;  5FMH A;  2CFY A;  4BV6 A;  4K8D A;  2XYO A;  1NAA A;  4YTM A;  2WET A;  3AED A;  3QVR A;  1IUW A;  1ZKQ A;  1K0L A;  3RHA A;  4EM3 A;  2HQM A;  4A99 A;  4EQR A;  4KPR A;  1O5W A;  1LQT A;  3DK4 A;  3IHM A;  4U2S A;  4USR A;  1EL8 A;  3VR8 A;  3NNE A;  4EIQ A;  1DOE A;  1JOA A;  1X31 B;  1TYT A;  2YLX A;  1FEC A;  2R45 A;  4A79 A;  3BHF A;  3ABV A;  3ICR A;  3QFA A;  5BUK A;  1BGJ A;  1ELI A;  4GRT A;  2FBW A;  4H2R A;  1CC4 A;  3AE9 A;  1VQW A;  1B4V A;  1VDC A;  2BAC A;  3SFE A;  1V59 A;  1TDE A;  3ISH A;  4AOS A;  1LV0 A;  5TR3 A;  5J60 A;  1NG4 A;  2ZZ0 A;  2PHH A;  4B67 A;  4YXD A;  3LZW A;  2XVI A;  3DME A;  4H4U A;  5HY5 A;  2C76 A;  4TLX A;  1ZY8 A;  2XLT A;  5M0Z A;  2GR1 A;  3FPZ A;  1F8S A;  2XLU A;  2YVG A;  1H7X A;  3H8L A;  2IVD A;  3NLC A;  2R9Z A;  3AE7 A;  4FX9 A;  3GSI A;  3CGD A;  3PVC A;  3WE0 A;  2VVL A;  1JRZ A;  5U63 A;  2YLT A;  1KF6 A;  4CNK A;  4DSG A;  3EAN A;  4USQ A;  3GDN A;  1D5T A;  4FK1 A;  4K2X A;  5KVI A;  1LJ1 A;  1REO A;  5FS8 A;  2V3A A;  4M52 A;  4Z2T A;  1NEK A;  2FJD A;  1PN0 A;  3NTA A;  1D4D A;  4MJW A;  1FEB A;  3Q9T A;  1PXB A;  1KDG A;  3ALL A;  3LJP A;  5M10 A;  4C3X A;  2YVF A;  4EMW A;  2V6O A;  2Q6U A;  2VRL A;  1ZMC A;  5JCM A;  2GAH B;  1TYP A;  4AP1 A;  2GQW A;  4NEW A;  3GD4 A;  3M13 A;  1CBO A;  4GDE A;  1DOB A;  2YLR A;  4E0V A;  3RP6 A;  3GQH A;  1GV4 A;  3T37 A;  2XLS A;  3AYI A;  2B9X A;  2XFP A;  3F8D A;  3AE5 A;  3DK8 A;  4IV9 A;  3S61 A;  1TDF A;  2XLR A;  2V5Z A;  2YWL A;  4U2T A;  4XXG A;  2GF3 A;  1NPX A;  3ATQ A;  3NRN A;  3AD7 B;  4YT0 A;  4CCQ A;  3UKP A;  1ZK7 A;  1RYI A;  2JBV A;  4GDP A;  1CJ4 A;  2YQU A;  5EB4 A;  1GER A;  1N4U A;  4CCR A;  4J56 A;  2YG7 A;  3PO7 A;  4OVI A;  3NK0 X;  2EQ7 A;  1COY A;  3ADA B;  2WS3 A;  3RP8 A;  2H89 A;  3CNP A;  2C70 A;  1L0V A;  1EL5 A;  3CND A;  1H81 A;  2C67 A;  4AT0 A;  3ITJ A;  1NDA A;  2C3C A;  2JAE A;  4CNJ A;  4LII A;  3P4S A;  2QAE A;  3NH3 X;  2O9Z A;  4Y4N A;  4C77 A;  1IJH A;  1DOD A;  4DGK A;  2R0C A;  3GRT A;  1GRH A;  3F8P A;  3RNM A;  1PXC A;  4H4Z A;  2WOI A;  1D4E A;  1CC6 A;  2Y6Q A;  1BWC A;  5EBK A;  3ICS A;  3GYJ A;  1OJC A;  2WOV A; 
#chains in the Genus database with same CATH topology
 4NUU A;  5CA0 E;  4X1K E;  4OPT A;  5GRT A;  4DR5 T;  1T98 A;  4Z90 A;  2YLS A;  1BKW A;  3O1H A;  1WYB A;  1W0B A;  4UEL A;  3TLU A;  1RUC 4;  1D0Y A;  5LXT E;  5FVK A;  4IDO A;  2Z6E A;  2KND A;  5U1O A;  3BK9 A;  2XZE A;  4UV9 B;  2GV8 A;  2BVL A;  4CI1 B;  4X1Y E;  3C4A A;  4LU6 A;  4UDR A;  3RKG A;  3F57 A;  2VB6 A;  3BNM A;  4I58 A;  2Y6R A;  4M1P A;  3OTO T;  1G8X A;  2VOU A;  2WAU A;  2E5V A;  3QJ4 A;  4QKN A;  1W0A A;  2DHR A;  1GEU A;  3AE3 A;  1UX5 A;  2RP4 A;  4Z25 A;  1XWM A;  2BDE A;  3E0Z A;  4UEM A;  4PAA A;  2V1D B;  5BVA A;  3DJD A;  5KWF A;  5DJQ C;  2RPA A;  4UF0 A;  3KV5 A;  2WES A;  2HH7 A;  2JPF A;  2YK0 A;  3CGE A;  1HCI A;  4HWF A;  5AQU B;  1PO1 4;  1GTE A;  2W00 A;  4B69 A;  4C90 A;  3B3R A;  3QSE A;  2B7S A;  4FI5 A;  3CQC B;  4UV8 B;  3IWA A;  3GYX A;  3N9M A;  4H9N C;  3VQR A;  4CQI A;  1XHZ A;  3LSV A;  1VRQ B;  4EZ4 A;  2RGO A;  4DVD A;  1RUH 4;  5FL0 A;  2WHD A;  1Q9I A;  3T2Z A;  1L9C A;  5AQO B;  3K7M X;  1KNR A;  3DJB A;  2LRL A;  1F8W A;  3T0K A;  1GRB A;  1R09 4;  4DV3 T;  4WCT A;  3AEF A;  4UP3 A;  4Q4Y 4;  2X50 A;  1DXL A;  3F8R A;  4GAV A;  1K0J A;  2ODV A;  5FKY A;  2KZ7 B;  2N9D A;  3OC4 A;  1OED A;  2XQ4 A;  5JTG A;  4H9Q C;  1RSG A;  1VOM A;  2W61 A;  1D7L A;  2WMN A;  4A5L A;  1PDH A;  2LE8 A;  2WM9 A;  2QA2 A;  1AR8 4;  5AQR B;  3KPK A;  1OJD A;  1I94 T;  3RYH E;  4K0U A;  1O94 A;  1Y01 A;  1CUN A;  3ZMZ B;  2X9H A;  2Z5Y A;  3GDP A;  3UU4 A;  2B9W A;  3AEG A;  1CC2 A;  2H88 A;  2QRX A;  2JMH A;  1AOG A;  3NK2 X;  4NWZ A;  1B8S A;  3K3O A;  4WBN E;  5CJ5 A;  1GRF A;  1ASJ 4;  4HFC A;  2Q0L A;  2R04 4;  4A98 A;  3V5S A;  4NPP A;  3CIR A;  4YJ2 E;  2PG8 A;  1PBF A;  4J2C A;  3JSK A;  1HX8 A;  1ZOY A;  2XQ5 A;  2BK4 A;  3SM8 A;  4LF8 T;  1UK5 A;  3I3L A;  4TM4 A;  1BEV 4;  1S3E A;  3M12 A;  4A65 A;  1JNR A;  1S3B A;  2YR4 A;  5JDH A;  3AE2 A;  3SS1 A;  2X8H A;  2FJB A;  3KV4 A;  5EK2 A;  2YU2 A;  5JDM A;  2Q9Q A;  2UUC T;  4B6X A;  1H82 A;  4WW0 A;  4NZH A;  3EAB A;  2LSY A;  4IVO B;  3P50 A;  3UUX B;  4EIW A;  1PBB A;  1OJT A;  1PHH A;  3JAD A;  2CM0 A;  2WMO A;  4ISS A;  1IUS A;  3V3N A;  3BHK A;  4IDZ A;  3OPC A;  5DQW A;  2XHE B;  2XSB A;  3FI7 A;  1GRT A;  1L9D A;  4NUV A;  4LF5 T;  1LRZ A;  1ZV4 X;  2ZM0 A;  3ALM A;  2VKO A;  4E7S A;  3AWI A;  2LSJ A;  1K5M D;  5LG4 A;  4N9X A;  1OED B;  2XAG B;  1Z6L A;  4JDR A;  1D0Z A;  3GMC A;  1IBK T;  2R6G F;  2WSS V;  1XPQ A;  3IC9 A;  2BG9 E;  3ZJ1 A;  3UOY A;  3O1J A;  1DOC A;  4QXC B;  2HWB 4;  3UFG A;  4BK3 A;  5JCI A;  4JI8 T;  2ACZ A;  3OZ2 A;  3PUV F;  2WPF A;  3CQX C;  4H4T A;  4OPC A;  3SFD A;  1E1H B;  2UXD T;  4X4J A;  5FS9 A;  3ANW A;  2FJE A;  4PJL A;  2MYS A;  2BCP A;  3P1W A;  2V7I A;  2WP5 A;  4YFS A;  4B66 A;  4BJM A;  3UQ7 A;  5JQG E;  2XLP A;  5IYZ E;  4JNA A;  5HXH A;  1D0X A;  1GT8 A;  5ABE A;  3H4K A;  2NR4 A;  3RKO A;  1MOK A;  2XFN A;  5J0Z A;  3KA7 A;  4A56 A;  4BK2 A;  1S35 A;  4TWF A;  5M4Y A;  5KMQ A;  3ATR A;  4QH1 A;  1OED C;  3Q5E A;  1H84 A;  4WNK A;  2J47 A;  1H86 A;  4HFD A;  1U4Q A;  4NTC A;  1GTH A;  3UKQ A;  5FYM A;  4YSY A;  4KI0 F;  2ODU A;  2ZZB A;  2IW5 B;  2A2F X;  4Z8X A;  2XVE A;  4C74 A;  4ZI2 D;  3GRS A;  3IA3 A;  4DV5 T;  3C98 B;  4CI3 B;  1MMD A;  1E39 A;  3CPI G;  2YG5 A;  3A8Y C;  3L3P A;  5AQS B;  2N2N A;  4J31 A;  2W2U A;  4XBF B;  4TWH A;  1H8T D;  3AA7 B;  1DJN A;  1RVF 4;  3H37 A;  3T14 A;  2F5Z A;  1GOS A;  3EUH A;  5C2T A;  2EQ8 A;  3FZM B;  5C3J A;  5KOW A;  3PUS A;  2C4C A;  4PNI A;  3COX A;  3N2O A;  5LA6 E;  1HS7 A;  3P4P A;  1NCQ D;  3HYX A;  4JI6 T;  3HZL A;  5HEJ A;  2WPE A;  4ZZC A;  4J36 A;  5DAB A;  3RPU A;  4OPU A;  2C7G A;  2R07 4;  3NN6 X;  3UUL A;  3NYF A;  4YSZ A;  1BR4 A;  3OBV E;  3L8R A;  1TDN A;  4WX1 A;  4ANJ A;  1N4W A;  4IE7 A;  3PTR B;  1JNZ A;  3NIX A;  2B76 A;  3H3A A;  2WWU A;  3AE1 A;  3UTF A;  1QJD A;  1WLX A;  5LGU B;  3OYZ A;  1W4X A;  5L4H A;  2IHR 1;  3J9X 1;  2LJL A;  2GH5 A;  4NTD A;  2UUB T;  1VG0 A;  4K5R A;  3DP7 A;  4DV4 T;  2DNX A;  2L8K A;  2OA1 A;  3QK6 A;  3T2K A;  2KSR A;  4ZI2 C;  2W66 A;  5FNV E;  4DR6 T;  2PFV A;  2MTQ A;  4GUV A;  1YKE B;  1S2Q A;  1WCR A;  4IDN A;  2CFY A;  1IZN B;  4IT4 A;  4YTM A;  2WET A;  3QVR A;  1ZKQ A;  2DWG A;  1K0L A;  4EM3 A;  2HQM A;  4KPR A;  5FXV A;  3U78 A;  1LQT A;  4USR A;  2XSA A;  4EIQ A;  4EXT A;  2D2S A;  1M7K A;  1FEC A;  2R45 A;  2YLX A;  2M6B A;  1N34 T;  2C0S A;  1ELI A;  2DWK A;  1CC4 A;  3AE9 A;  1VQW A;  2H7V C;  2X67 A;  2PYL A;  2HWC 4;  1RUE 4;  1IJ6 A;  3NZP A;  3ISH A;  1TDE A;  3TLS A;  2X9Y A;  1LV0 A;  5LCY A;  5J60 A;  2F4V T;  2ZZ0 A;  5L3E B;  4WZX A;  1XMQ T;  2XVI A;  5HY5 A;  2C76 A;  1XNR T;  1ZY8 A;  4TLX A;  4O4H E;  2J1D G;  5JRC B;  5KMG P;  3JBG 4;  2UU9 T;  4FX9 A;  3PVC A;  2YLT A;  1D5T A;  2BG9 A;  2BKP A;  3N9L A;  1RMU 4;  4Z2T A;  1VCS A;  5AFU L;  4PDW D;  1FEB A;  1HG5 A;  3ALL A;  3NRX A;  5M10 A;  1ZKE A;  2VRL A;  1ZMC A;  5LJN A;  1TYP A;  3GD4 A;  3CQG B;  3JC6 D;  3AYI A;  3F8D A;  3S61 A;  2A72 A;  4DV0 T;  1NPX A;  3AD7 B;  1ZK7 A;  2JBV A;  2DCF A;  3ZC1 A;  2YQU A;  1GER A;  4WYV A;  4G6G A;  4OVI A;  1NAF A;  3RP8 A;  2H89 A;  3CNP A;  1L0V A;  4FJO A;  2E9X D;  3ETU A;  3P4S A;  4IE6 A;  1H7C A;  2LLY A;  4X1I E;  1IJH A;  4HWI B;  1GRH A;  4GK0 E;  2M6I A;  2V8S V;  2E9X B;  1D4E A;  2Y6Q A;  4U2Z A;  5EBK A;  2WOV A;  5LYJ E;  2CPT A;  2KT9 A;  5AQJ B;  1HXS 4;  3QB5 A;  1LPF A;  4JV5 T;  4DND A;  2WQY A;  1LVL A;  3G5Q A;  3W15 B;  2P9B A;  4MHC A;  4ZS2 A;  4TX5 A;  3VU7 H;  2XQ8 A;  3N9N A;  5KXJ A;  2C5I T;  4P09 A;  4DMV A;  4OPL A;  1FMV A;  4EMJ A;  3R9U A;  2XM1 A;  3BQI A;  4LF4 T;  4UIG A;  2J4G A;  1VG9 A;  4IRE A;  2UUA T;  1N1P A;  2BXR A;  2GB0 A;  2X51 A;  1ZDL A;  3JC6 C;  4PAB A;  2X3N A;  4GKJ T;  3L39 A;  3C4N A;  3NN0 X;  4C3Y A;  1XDP A;  3GN5 A;  3LDQ B;  3TKL B;  3AEB A;  3DJG X;  1ZOV A;  1IAP A;  1KSS A;  1NEN A;  2WPC A;  3J8F 4;  2E1M A;  3CPJ G;  4H4W A;  2D0T A;  4IE0 A;  3UT5 E;  2YU1 A;  1E1K A;  2C75 A;  2E9X C;  2TMD A;  2BXS A;  4XAX B;  1N4V A;  5HWX A;  3MXZ A;  1RUF 4;  3B57 A;  2DKI A;  3ZYX A;  3I9W A;  4QWN B;  3LZX A;  2CXF A;  5HAX A;  3M3Z B;  3LFM A;  1VRB A;  4F6R C;  5KDM C;  3RIU A;  3CNS A;  1CJ2 A;  3RQW A;  4J33 A;  2VKJ A;  1PBD A;  4LFB T;  3VHL A;  5FXZ A;  3NT6 A;  4CXW A;  2W67 A;  4CXY A;  4OCG A;  5HEG A;  2EQ6 A;  2YIN A;  5ABH A;  2C73 A;  2OV9 A;  5AQI B;  4JQ9 A;  2V5D A;  3RIF A;  5BMV E;  5LJM A;  3K3Q C;  4ZEY A;  3LBX B;  3R6N A;  3TLW A;  5FMN A;  4X9N A;  3ONL C;  4A6N B;  5AQN B;  3PJA A;  3CNT A;  4LFC T;  3ZYK A;  3P4R A;  4J57 A;  5JCK A;  1US7 B;  1JRX A;  4AQF C;  1QLB A;  4YLH A;  3KVA A;  3Q5W A;  2A8X A;  3OKQ A;  2C72 A;  3UKH A;  2LSI A;  2GEW A;  3CNJ A;  1VBD 4;  3H8I A;  1PJ5 A;  2R46 A;  1F6M A;  3KLJ A;  3RQU A;  3PUG A;  2QYW A;  1V9D A;  2SPC A;  1B7T A;  2XAQ B;  2JQQ A;  5LMU T;  2NWB A;  3ETV A;  2AQJ A;  3NYE A;  2QGS A;  2VVM A;  5J2T E;  4HTE A;  4Q4X 4;  3LJC A;  2MOZ A;  2XQ3 A;  2R4J A;  2X5I D;  4U8N A;  2BAB A;  5LP6 E;  4DID B;  2V6Y A;  4RG3 A;  2A3D A;  3PUY F;  5L3B B;  4OYJ A;  4C5O A;  1PJ7 A;  5DBJ A;  3HYV A;  1GQE A;  1PBC A;  2DL1 A;  2YM1 A;  2G0U A;  2VL8 A;  2LHN A;  4JY2 A;  4D04 A;  1XMO T;  3EI0 A;  5E0O A;  2CWY A;  1OWA A;  2ZM6 T;  3VRB A;  4U2L A;  3NK1 X;  1YKH B;  4H4S A;  2K3W A;  5JR9 B;  1YD8 G;  4YTN A;  4I59 A;  2KXP B;  1SUM B;  3BQL A;  3FZF B;  4OYK A;  3KKJ A;  2WY2 A;  3PUX F;  5KVH A;  2EX3 A;  1PXA A;  1T72 A;  3DJE A;  1NA1 D;  3C4X A;  3T31 A;  4NXN T;  2C5K T;  4OFZ A;  5LHH B;  3CGC A;  1D1A A;  4H9P C;  2B1E A;  2JQ9 A;  5HEH A;  4ADW A;  1WRD A;  4A5X A;  4TV8 E;  3AVR A;  3PUR A;  1L9E A;  2BVM A;  1JRY A;  2TPR A;  2YAU A;  4L9I A;  5CA1 E;  2A89 A;  3QSS A;  4ZI7 E;  3ZN0 B;  1O95 A;  2C66 A;  1IUT A;  3QSM A;  4Y4M A;  2BK3 A;  2CA5 A;  4JUY A;  1HRV 4;  3T8O A;  1CJ3 A;  4GAP A;  2CDU A;  3DJJ A;  2XQY A;  4HFH A;  2JKC A;  1CHU A;  2CHO A;  2DI4 A;  2IAK A;  3HKB E;  4Q4V 4;  4O5U A;  3UTG A;  1LTX R;  2GAG B;  5JR9 C;  3AAI A;  4U8O A;  3BI5 A;  5JRE A;  4O4I E;  3FXE B;  1XDI A;  4FK1 C;  3C4Z A;  4DUZ T;  1XHC A;  5ETW A;  4II2 A;  2V6Y B;  3ZDN A;  4PK5 A;  2V61 A;  3ZCJ A;  3TLT A;  2VQB A;  3R84 B;  1T7S A;  3RC8 A;  3FMW A;  4EOZ B;  1MQT D;  3AAA B;  1PIV 4;  4PJJ A;  4X9M A;  2RS5 4;  4OK0 A;  4RHV 4;  3FBZ A;  1OJA A;  4GYR A;  3UUB A;  5FY1 A;  4Z43 A;  1MIW A;  1MO9 A;  2BC0 A;  3GA8 A;  4H63 V;  2WDR A;  4IL4 A;  3ONX A;  4J34 A;  4U31 A;  4ZOL E;  2XQ9 A;  2GMH A;  1DNC A;  3H3M A;  2BS4 A;  2X8G A;  2IID A;  2YM2 A;  3G5S A;  1E7P A;  4REK A;  2ARD A;  1PJ6 A;  2XAH B;  4H9S E;  4HEA A;  3AXJ A;  3SZF A;  2CXL A;  4UF0 B;  2HPL A;  5L4E A;  4PK4 A;  5LV9 A;  4CZZ B;  4JI1 T;  4HWH A;  3SY4 A;  2BKO A;  3II4 A;  5KRQ A;  3AA1 B;  4OX9 T;  5AQQ B;  5IPY A;  4QH5 A;  3NKS A;  1UX4 A;  2V7J A;  5IQ4 A;  3C50 A;  3L1R A;  1YXR A;  1HYU A;  5AQM B;  3AEE A;  2ES0 A;  3GD3 A;  4CI2 B;  2A87 A;  3LG7 A;  3AXB A;  3KBU A;  4Q4W 4;  2R06 4;  2H3R A;  4K7Z A;  4H4P A;  1JU2 A;  3KPF A;  4GK5 E;  2R7F A;  4KHZ F;  4BAY B;  4EB6 E;  2YR6 A;  1KNP A;  3CML A;  5DQV A;  1QSD A;  3AB3 B;  1MIY A;  1D4C A;  3UKL A;  4KBM B;  4AT2 A;  2NW8 A;  3FB2 A;  5IWA T;  5L3D B;  3AYJ A;  1VBB 4;  5LNK A;  4XWR A;  3MK7 C;  4EMI A;  2LSK A;  4Z2U A;  1D7Y A;  1E1L A;  4AKG A;  3P9U A;  4CRT A;  3EF6 A;  2RGH A;  4DR4 T;  1AR9 4;  2N1G A;  3KFW X;  2XYO A;  4JLE A;  1IUW A;  3RHA A;  5FY7 A;  3HA4 A;  4UR9 A;  4L0R A;  1O5W A;  3IHM A;  2UXN B;  2CLY B;  1JOA A;  1N36 T;  1X31 B;  1HF8 A;  4QH4 A;  3BHF A;  1Z7S 4;  3BQK A;  2FBW A;  3NWI A;  4H2R A;  1B4V A;  2BAC A;  4DBR A;  1V59 A;  4AOS A;  3O4X E;  4KP3 C;  5CB4 E;  4H4U A;  2D5U A;  4O4J E;  1F8S A;  1FMW A;  5JH7 E;  2Q9Q D;  4MFR A;  1PO2 4;  4TZ4 C;  4DSG A;  3EAN A;  4USQ A;  3M65 A;  4K2X A;  3ZJ2 A;  2VL0 A;  1UCU A;  1LJ1 A;  4X20 E;  5HXE A;  3JAE A;  5FS8 A;  2V3A A;  1W9R A;  2Q9Q B;  1D4D A;  1J5W A;  3Q9T A;  2LKH A;  3ZMS B;  4DBQ A;  2YVF A;  2Q6U A;  2JIW A;  1O3X A;  2GQW A;  4NEW A;  2KLQ A;  1CBO A;  2YLR A;  2CLY C;  4E0V A;  3GQH A;  2B9X A;  2XFP A;  3DK8 A;  1KK7 A;  2PW9 A;  4ZXL A;  4CCQ A;  5CFB A;  1R08 4;  1IJ5 A;  4AQY T;  5LBM A;  3KDS E;  1N4U A;  2I6H A;  2W0G A;  5LOV E;  4HN9 A;  3RYC E;  3CVR A;  3OJA A;  3J7Y q;  2EQ7 A;  1COY A;  5HXC A;  2IC9 A;  4X5T A;  4P1N A;  3CND A;  4TNV A;  2C67 A;  1NDA A;  2JAE A;  4CNJ A;  3AAE B;  4LII A;  2O9Z A;  4Y4N A;  1D4M 4;  1HNZ T;  5C8Y E;  3GRT A;  4EV6 A;  5ADX L;  2Y6X A;  2LRK A;  2XQ6 A;  2AE9 A;  5JDQ A;  1BWC A;  3GYJ A;  1XNQ T;  2Q9Q C;  4H9R C;  3N9O A;  4QX7 B;  5FXX A;  3AA6 B;  3ANW B;  5J2U E;  2RAB A;  3EAM A;  2CVJ A;  2I0M A;  2K48 A;  3L8K A;  3M0O A;  4KMC A;  4K5S A;  3O1I A;  3NGC X;  2VUR A;  3UP4 A;  2LEH A;  2X0Y A;  2EHO A;  3B6D A;  4XWZ A;  4X66 T;  3UOZ A;  3EPT A;  4QHO A;  1Y56 A;  4BJZ A;  5FS6 A;  5KMR A;  1P2E A;  2XQA A;  3T2Y A;  3NZQ A;  3RP7 A;  1HRI 4;  2RGJ A;  3NVO A;  4ILA A;  3GWF A;  2RS1 4;  1J5E T;  3ZCI A;  2NTX A;  1ZEE A;  3KVE A;  4WBO A;  3GWD A;  1ZHC A;  3LK2 B;  4DMW A;  2XVH A;  2IVE A;  1S2Y A;  3V3O A;  3N2K E;  1GES A;  1GXF A;  3UUN A;  3Q5X A;  4HB9 A;  4KHP T;  2QVA A;  3NG7 X;  2I0Z A;  3KD9 A;  3C4W A;  1DJQ A;  1G73 A;  2NPX A;  3K8P C;  3FIM B;  2K24 A;  2V7M A;  2X9W A;  4OHF A;  3BI2 A;  3HKD E;  3IEE A;  3K30 A;  2XCG A;  1HR0 T;  2PY5 A;  4J2W A;  2VK9 A;  4JN9 A;  4A7A A;  2Y8D A;  4IVM B;  4DSH A;  4YKF A;  5CGM A;  2JB3 A;  4EED A;  5LB7 B;  2R0G A;  3Q6J A;  2D0U A;  3MA9 A;  2AXD S;  3I1A A;  3Q2M A;  4NNJ A;  3PU8 A;  4B3M T;  1BR1 A;  3LOV A;  1BR0 A;  4BUR A;  3WI3 A;  2GVC A;  1S94 A;  1SEZ A;  1X9B A;  3T1H T;  2VKD A;  4O2B E;  5LG3 A;  1FJG T;  4H9O C;  4UVB B;  4ASK A;  4EGW A;  5IUX A;  1POV 0;  3AE8 A;  4TNW A;  3QC9 A;  3E08 A;  4LFA T;  2OAM A;  3VKH A;  3GYI A;  1WR0 A;  3GWH A;  3IF8 B;  4JYA T;  3CN8 A;  1MIV A;  1AR6 4;  4B63 A;  1KSU A;  3VRA A;  5ABF A;  2VQE T;  4H4V A;  3S4U A;  3IBP A;  4PFO A;  2IML A;  4NIQ A;  1NHP A;  2PLV 4;  4B64 A;  2VZ2 A;  2BC1 A;  4Y4L A;  1Y64 B;  3JAF A;  4PJN A;  2BK5 A;  1UUS A;  1JEH A;  2JK6 A;  2CUL A;  3SGL A;  2V3B A;  5KMS A;  4JEU B;  2IIU A;  4H4R A;  1N33 T;  2WEU A;  4LML A;  2KIN B;  3K1S A;  4QXH B;  2MBG A;  5KOX A;  4Z2R A;  3ZMV B;  3LXD A;  3D8X A;  3AE6 A;  3ZEF B;  3CMM A;  5KMP A;  3AYL A;  5H6R B;  4U8L A;  2IC6 A;  4I0U A;  4U8K A;  3P4Q A;  3RI5 A;  1VBA 4;  2YG6 A;  4LF7 T;  1MMN A;  3C51 A;  5L46 A;  2IDO B;  3PU3 A;  3JD7 4;  2BA9 A;  2C3D A;  3DTO A;  2ACX A;  2Z5X A;  1TDO A;  1GRG A;  3O0H A;  2HPJ A;  4IA6 A;  4GF7 A;  1ZX9 A;  4U2Y A;  2ZZC A;  2BCG G;  2X66 A;  2V6X A;  2BG9 B;  1WR6 A;  2WU2 A;  3FZL B;  2PYX A;  2YVJ A;  3UU5 A;  1AL2 4;  4ZCD A;  4H7U A;  4H4Y A;  4IGU A;  3FHN A;  5HHF A;  5CKU A;  2OLN A;  4X65 T;  3HI2 A;  4Z26 A;  4YSX A;  4X62 T;  4IDP A;  4IHJ E;  2E4G A;  4H2Q A;  1KEY A;  3UP5 A;  2W62 A;  4G6H A;  3P7I A;  2XUE A;  5H6Q B;  4N78 D;  5HEO A;  4P0B A;  3UUM A;  5L47 A;  2CHN A;  5J1G A;  4G74 A;  2CWO A;  1SHZ C;  4B68 A;  4UXN B;  3MJX A;  3LAD A;  2YG3 A;  5FL1 A;  3I6D A;  4A9W A;  4Z44 A;  1OED E;  4AXP A;  3ONJ A;  5IQ1 A;  1ZP0 A;  4JY3 A;  4LMK A;  2WBA A;  3SZ0 A;  3RC3 A;  2E2A A;  4HFV A;  4TWD A;  4FDC B;  3ZPO A;  1RUI 4;  3L09 A;  4YTP A;  2E8I A;  2BG9 C;  1NHQ A;  1XAN A;  2LM2 A;  4H4Q A;  2WDV A;  2J3N A;  4TM1 A;  5KNL A;  1PVC 4;  1XI1 A;  2JQK A;  3RRC A;  2OAL A;  3LB8 A;  3AD8 B;  4OPD A;  2V7L A;  3QVP A;  4CBQ A;  4HWC A;  1FOH A;  2WZH A;  5F8P A;  3AEA A;  3UCL A;  4DNA A;  3MZK B;  2XJ7 A;  3AVS A;  4BK1 A;  4TM0 A;  1SA0 E;  2XM2 A;  4AOX A;  5J7X A;  3N9P A;  4ZS3 A;  1UKV G;  2YDS A;  4NTE A;  2NP9 A;  1CF3 A;  4KUM B;  3BI4 A;  2WP6 A;  1U5P A;  4JI4 T;  4V1A v;  2AAQ A;  3GN5 B;  3E22 E;  5AQL B;  1MMA A;  2JB1 A;  5U25 A;  1Q1W A;  2OLT A;  2DKH A;  4GIW A;  3VKG A;  2JJ9 A;  2V5C A;  2XFO A;  1HTJ F;  1QUU A;  4U7Y A;  1KFY A;  2RA1 A;  3CX8 B;  4UDP A;  2RS3 4;  2C64 A;  3A5X A;  1D1C A;  1LVK A;  4OPG A;  2BRA A;  3LK3 B;  2I59 A;  1GET A;  4ICY A;  5F5W A;  3ZMU B;  2GQF A;  4AI6 A;  2GRT A;  3GMB A;  3RED A;  2BBJ A;  4A97 A;  2E5L T;  4ZCC A;  1UGO A;  1M6I A;  5KX5 E;  1VBE 4;  1H6V A;  3QB5 K;  2L9Q A;  3CPH G;  4CY8 A;  2ZBW A;  2D9D A;  2LKG A;  2YDR A;  2QA1 A;  2CBI A;  2LFC A;  3CKD A;  2KWI B;  1Y0P A;  3ALJ A;  3ZYL A;  2HHH T;  2R4E A;  3EVY A;  1QO8 A;  1NHS A;  3UOV A;  3NHO X;  5IHY A;  3S5W A;  5HCJ A;  1WYC A;  5L3F B;  1GSN A;  4DR2 T;  4I43 B;  1AR7 4;  3BNU A;  1YY5 A;  2YG4 A;  3CGB A;  3TLV A;  3UU6 A;  4AKI A;  2EQ9 A;  5FVL A;  4BV6 A;  4K8D A;  2UXB T;  1EZ3 A;  5JDN A;  3AED A;  2RM2 4;  2X9X A;  4A99 A;  2H7O A;  2XY8 B;  4U2S A;  3VR8 A;  1Z0P A;  2VWA A;  1DOE A;  3RIU C;  1TYT A;  2W63 A;  3QFA A;  4I4T E;  3F31 A;  5BR8 T;  4DR1 T;  4DUY T;  3SFE A;  3ZYM A;  1AJ3 A;  1NG4 A;  2PHH A;  4L5G A;  3LZW A;  1XZY A;  4ILU A;  3DME A;  1J1J A;  2X0H A;  2RR1 4;  2WZI A;  3D0T A;  3RRW A;  2GR1 A;  2BRY A;  1HG2 A;  2YVG A;  1WFD A;  4XZC A;  3PUA A;  3H8L A;  2R9Z A;  3AE7 A;  3GSI A;  5HYA A;  1W09 A;  1JRZ A;  5U63 A;  1KF6 A;  4CNK A;  3GDN A;  5KVI A;  3F2E A;  3I9Y A;  4M52 A;  2FJD A;  3NTA A;  4U33 A;  2K5B B;  2X68 A;  4MJW A;  4C3X A;  2V6O A;  2ZM2 A;  2MPK A;  2XAJ B;  5AQH B;  5JCM A;  1DOB A;  4CN4 A;  2FUP A;  2NOX A;  3KV9 A;  3RP6 A;  3SYI A;  2XLS A;  1TDF A;  2XLR A;  3ZLI A;  2V5Z A;  4U2T A;  2IUB A;  2GF3 A;  4II3 A;  3N2G E;  5JVD E;  5AQK B;  4UVA B;  4GDP A;  1CJ4 A;  5EB4 A;  3C64 A;  3CPZ A;  4J56 A;  3PO7 A;  3ADA B;  2PYJ A;  3B13 A;  2C70 A;  1EL5 A;  1H81 A;  4AT0 A;  1XHX A;  3RLF F;  2QAE A;  3NH3 X;  1FIO A;  4JI5 T;  1DOD A;  4DGK A;  4IST A;  2R0C A;  3MKD A;  5FY0 A;  1PXC A;  2NTY A;  5HWY A;  4EYU A;  1CC6 A;  2MAW A;  5L2L A;  5BUL A;  3ICS A;  1RUD 4;  5A1L A;  3PV0 F;  2XAS B;  4TN7 B;  2R0P A;  2GK9 A;  3C96 A;  1HX1 B;  5FXW A;  2YR5 A;  4RG4 A;  4P9S A;  4K22 A;  2AR8 A;  2Q7V A;  3SXI A;  3QNU A;  4ILB A;  4JBW F;  5ABG A;  1EBD A;  3FZH B;  4IIJ E;  2APG A;  3NRY A;  4BA9 A;  1F8R A;  5LGT B;  4Z91 A;  2A9U A;  4H63 H;  5FS7 A;  3SZW A;  1FCD A;  4PAG A;  3RIA A;  2LM9 A;  1P2H A;  4U8M A;  2V26 A;  4EQW A;  3UOX A;  3LK4 2;  5LMN T;  1HNX T;  5AQV B;  3KV6 A;  4AIU A;  1K4Q A;  2UZZ A;  3NKZ A;  3K3N A;  1I6Z A;  2XFU A;  4H50 A;  1COV 4;  2HN1 A;  1B5Q A;  2VVS A;  3VRD B;  4AKH A;  1GND A;  2CCQ A;  3ZN1 B;  3PUQ A;  2VQ7 A;  2PZS A;  2BS2 A;  1FEA A;  3GMI A;  3CX7 B;  1KNZ A;  1IUX A;  1UUR A;  2VRM A;  4H2P A;  4TLZ A;  3RYF E;  3V76 A;  2ZMA A;  1PBE A;  1F3P A;  3K7T A;  2V60 A;  3KU9 A;  5HXI A;  2LOS A;  5EB5 A;  2UXX B;  3AXJ B;  4LMJ A;  1E1M A;  1BZL A;  1OXZ A;  5LBQ B;  1YQ3 A;  3X1D A;  3VR9 A;  2B7R A;  1MNE A;  2XQ7 A;  2LOP A;  3ZT5 A;  1GRA A;  1EV1 4;  3A7M A;  1VBC 4;  1XDO A;  2DLR A;  4DV7 T;  3PS9 A;  4P0A A;  5HXS A;  1HNW T;  4DV1 T;  4EEB A;  3NBX X;  1Q1R A;  5JCN A;  4F8H A;  3ICT A;  3URH A;  4X64 T;  1PS9 A;  2XDO A;  2JRK A;  1RP0 A;  3DK9 A;  1IBL T;  3DGZ A;  2LHR A;  4GYS A;  4ZN0 A;  1K0I A;  4HGA A;  4JI7 T;  3FZK B;  4C91 A;  4COF A;  5LGN B;  2NW9 A;  3PUZ F;  4I50 E;  1ONF A;  2BS3 A;  1H7W A;  1MND A;  4B1B A;  1MMG A;  4U72 A;  2QA7 A;  1X79 A;  4TV9 E;  4DR7 T;  2CXD A;  4JEH B;  4O2A E;  1NHR A;  4HKA A;  3E1T A;  2PBI A;  2GMJ A;  4EM4 A;  4O5Q A;  2Q0K A;  1MXT A;  5EK3 A;  2L3L A;  5ER0 A;  4D03 A;  3K7Q X;  3UKA A;  3UTH A;  2BKN A;  3ZMT B;  4JI2 T;  4IA5 A;  5HEU A;  4IE5 A;  1EAH 4;  2JB2 A;  2VVL G;  2XPK A;  2CMR A;  3DH9 A;  3SUC A;  4PFP A;  3UTE A;  3RF1 A;  1DU2 A;  4EZH A;  3RX6 A;  2WB5 A;  4ZZB A;  5HCM A;  3FG2 P;  4PK6 A;  2GR0 A;  4YKG A;  3UQ4 A;  2FJA A;  3AE4 A;  3ZKR A;  2J62 A;  5JDL A;  4HWD A;  4ZI3 D;  1YW0 A;  5JRC A;  3AA0 B;  4RSL A;  4HFE A;  4E7Z A;  3ZST A;  4AKL A;  4NEV A;  5JCL A;  3SRZ A;  3V5U A;  5HYM A;  2VVN A;  2NVK X;  3EHZ A;  5GON E;  3N5L A;  3UKF A;  3N9Q A;  1YQZ A;  2ZM8 A;  2CBJ A;  2KMF A;  4GKK T;  3RHW A;  4EAH A;  3QOF A;  5HXR A;  2QCU A;  1BF3 A;  3DA1 A;  2XVF A;  3RYI E;  2VAS A;  3PJA J;  1BR2 A;  1BGN A;  4AIS A;  4ZHQ E;  4CN1 A;  4O4L E;  2K9A A;  5LHG B;  1LVF A;  1IUV A;  5EZY E;  4CY6 A;  3KBT A;  3EAO A;  4EIP A;  4MLK A;  5JDG A;  3G06 A;  4TM3 A;  2JMK A;  3NTD A;  1CJC A;  5L3C B;  2WOW A;  3ZSS A;  3KVB A;  3ZC0 A;  1GPE A;  3UU8 A;  1LQU A;  2Y48 B;  3SOL A;  5BRT A;  4DR3 T;  2RMU 4;  2X0L B;  4U3C A;  2OLO A;  2WU5 A;  2W4X A;  4B3R T;  5F3J A;  3UTK A;  4AP3 A;  2X8C A;  4ZI3 C;  4KX6 A;  2E9X A;  3U3I A;  4AQG A;  3HR0 A;  1M64 A;  2OA5 A;  4BJN A;  1OOP D;  3UFE A;  1GAL A;  3Q9D A;  3T1Y T;  2BYB A;  4LA1 A;  4GB3 4;  2XTL A;  4UVC B;  1FEW A;  1HFA A;  3AB1 A;  3FXD B;  2WP9 A;  3D1C A;  2YN6 A;  3IHG A;  3DGH A;  1OJ9 A;  2YLZ A;  1RHI 4;  4O8S A;  2EHO D;  1GRE A;  3UU3 A;  5AQF B;  2BZB A;  5JDF A;  4AKR B;  1E1N A;  2C65 A;  2GR3 A;  3P8C D;  4ILC A;  5AQP B;  3B5M A;  1B37 A;  2XFQ A;  2EHO B;  4YHH T;  4HA6 A;  2JQH A;  1EL9 A;  1H83 A;  4DV2 T;  4AQF A;  1YKJ A;  1Y56 B;  3UKK A;  1YQ4 A;  2M67 A;  5CQF A;  2W0H A;  4YJ3 E;  3I0Q A;  4JNQ A;  4U8I A;  3WAK A;  4YSH A;  4HFI A;  4YHJ A;  1EL7 A;  1FL2 A;  3G5R A;  4TUY E;  4EQX A;  3PDY A;  2CEA A;  1RUG 4;  2XVJ A;  1TDK A;  3EDV A;  1CL0 A;  4PW8 A;  1E6E A;  3CK6 A;  4U74 A;  1M62 A;  4UDQ A;  3RGL A;  2PJQ A;  4IE4 A;  4GCM A;  2KWH A;  4B3T T;  2YEV C;  4APN A;  2GR2 A;  4G9K A;  4EQS A;  4Q25 A;  2BBH A;  4BJY A;  1RUJ 4;  2C5J A;  3NYC A;  2CRB A;  3I0O A;  5EOW A;  4H4X A;  3MAC A;  3QFB A;  4GR1 A;  1Z8U A;  3PUW F;  4NXM T;  4JI3 T;  3FBS A;  4U8P A;  3LBX A;  4OPI A;  3ZT6 A;  4YY3 T;  4CN6 A;  4H2N A;  4A6N A;  3P4W A;  4ECH A;  3O9X A;  5TAO A;  5AQG B;  1NG3 A;  3AEC A;  3AD9 B;  4G2A A;  2EHO C;  3CTY A;  1VRH 4;  4B65 A;  2B9Y A;  3WAJ A;  2X99 A;  1IUU A;  3SQP A;  1TRB A;  4Z24 A;  4MAL A;  4U8J A;  2XAF B;  2VQF T;  1ZMD A;  2WDQ A;  5GSN A;  4G63 A;  4IL9 A;  2YLW A;  1N32 T;  1D1B A;  4YWO A;  3IF9 A;  3GQK A;  1IBM T;  3CWZ B;  4G73 A;  3SZC A;  4IDQ A;  2NW7 A;  5LHI B;  5FMH A;  3PE0 A;  4U7I A;  3ZT7 A;  1NAA A;  2WBL A;  4EQR A;  4K0K T;  3DK4 A;  1EL8 A;  1SE7 A;  3NNE A;  2YKS A;  4CXX A;  5ABF B;  4LF6 T;  3QUJ A;  3IHR A;  4A79 A;  3Q5D A;  3ICR A;  3ABV A;  5BUK A;  1BGJ A;  4GRT A;  4HFB A;  4DV6 T;  4QXB B;  2UXC T;  4EYY R;  4B3S T;  1VDC A;  2LT3 A;  4I55 E;  4DO0 A;  5TR3 A;  3HKE E;  4B67 A;  4YXD A;  3SX6 A;  5M0Z A;  2XLT A;  4MBQ A;  3RH3 A;  3FPZ A;  2YOE A;  2XLU A;  1H7X A;  2IVD A;  4PJM A;  5AQT B;  3NLC A;  2PTF A;  5JR9 A;  1LKX A;  3CGD A;  3WE0 A;  2VVL A;  1E2A A;  4FK1 A;  4GOU A;  2WCA A;  1REO A;  3JCF A;  2WWV A;  1NEK A;  1PN0 A;  5EK4 A;  4LF9 T;  1R8I A;  1PXB A;  1KDG A;  2V7K A;  3HL6 A;  3LJP A;  4EMW A;  3KIN B;  3CX6 B;  2GAH B;  4AP1 A;  3M13 A;  4GDE A;  1T8B A;  2CE7 A;  3OYX A;  1NWM X;  1GV4 A;  3T37 A;  4ERR A;  4IV9 A;  3AE5 A;  3HKC E;  2YWL A;  3SWH A;  4ADZ A;  3EDU A;  4XXG A;  3ATQ A;  3NRN A;  4QX8 B;  4YT0 A;  5L3G B;  3OVU A;  4JI0 T;  3UKP A;  1VCT A;  1RYI A;  5FP3 A;  3HYW A;  4HE8 A;  4CCR A;  2YDQ A;  2YG7 A;  3ESL A;  3NK0 X;  2WS3 A;  2VKH A;  3FBL A;  3ITJ A;  2C3C A;  4C77 A;  2HN2 A;  2ZLY A;  3F8P A;  3RNM A;  2LSG A;  4H4Z A;  2WOI A;  1OJC A; 
#chains in the Genus database with same CATH homology
 4OPT A;  5GRT A;  2YLS A;  1BKW A;  2R0P A;  3C96 A;  1LPF A;  2RAB A;  2CVJ A;  1LVL A;  2WQY A;  2YR5 A;  4RG4 A;  3G5Q A;  4P9S A;  3L8K A;  4K22 A;  3M0O A;  2AR8 A;  4K5S A;  2Q7V A;  3NGC X;  3SXI A;  5U1O A;  3UP4 A;  1EBD A;  5KXJ A;  2APG A;  3B6D A;  4OPL A;  2GV8 A;  1F8R A;  4EMJ A;  3R9U A;  3C4A A;  4LU6 A;  4XWZ A;  4UDR A;  1VG9 A;  3UOZ A;  3EPT A;  5FS7 A;  1N1P A;  1FCD A;  2BXR A;  2GB0 A;  3SZW A;  1Y56 A;  3BNM A;  4I58 A;  4BJZ A;  2Y6R A;  5FS6 A;  5KMR A;  2VOU A;  1P2E A;  1ZDL A;  2E5V A;  1P2H A;  3QJ4 A;  4U8M A;  4EQW A;  3T2Y A;  3UOX A;  3RP7 A;  4PAB A;  1GEU A;  2X3N A;  2RGJ A;  3GWF A;  3AE3 A;  1K4Q A;  3C4N A;  3NN0 X;  2UZZ A;  2XFU A;  4C3Y A;  4Z25 A;  3AEB A;  4H50 A;  5BVA A;  3KVE A;  4PAA A;  3DJG X;  1B5Q A;  1ZOV A;  3DJD A;  3GWD A;  1KSS A;  1NEN A;  2XVH A;  2IVE A;  1S2Y A;  3VRD B;  5KWF A;  2WPC A;  3V3O A;  1GND A;  2E1M A;  2VQ7 A;  2WES A;  1GES A;  2BS2 A;  1FEA A;  1GXF A;  3CPJ G;  4H4W A;  3CGE A;  4HB9 A;  1IUX A;  1E1K A;  3NG7 X;  2C75 A;  2VRM A;  4H2P A;  1GTE A;  2TMD A;  2BXS A;  4TLZ A;  3V76 A;  1N4V A;  2I0Z A;  1PBE A;  1F3P A;  3K7T A;  4B69 A;  2V60 A;  3KD9 A;  3KU9 A;  2DKI A;  1DJQ A;  3ZYX A;  5HXI A;  3B3R A;  3QSE A;  2NPX A;  2B7S A;  3FIM B;  3LZX A;  5EB5 A;  1E1M A;  3IWA A;  3GYX A;  1BZL A;  3CNS A;  1CJ2 A;  3BI2 A;  3VQR A;  1YQ3 A;  3K30 A;  4J33 A;  3VR9 A;  2B7R A;  2XCG A;  1GRA A;  1VRQ B;  2RGO A;  1PBD A;  4J2W A;  4JN9 A;  2WHD A;  1Q9I A;  3NT6 A;  4A7A A;  3PS9 A;  3T2Z A;  4IVM B;  4OCG A;  1L9C A;  4DSH A;  2EQ6 A;  3K7M X;  1KNR A;  4YKF A;  2JB3 A;  2R0G A;  2C73 A;  1Q1R A;  5JCN A;  3ICT A;  4JQ9 A;  3URH A;  3DK9 A;  1PS9 A;  2XDO A;  1RP0 A;  3Q6J A;  3DGZ A;  1F8W A;  3T0K A;  4ZN0 A;  1K0I A;  1GRB A;  4WCT A;  3AEF A;  4UP3 A;  2X50 A;  1DXL A;  3LOV A;  4NNJ A;  4X9N A;  4BUR A;  2GVC A;  3F8R A;  4A6N B;  5BUL A;  4GAV A;  1SEZ A;  3CNT A;  1K0J A;  3P4R A;  3OC4 A;  1ONF A;  2BS3 A;  1H7W A;  4B1B A;  1RSG A;  4J57 A;  5JCK A;  1JRX A;  1QLB A;  1NHR A;  1D7L A;  3E1T A;  4A5L A;  1PDH A;  3AE8 A;  2A8X A;  2GMJ A;  2C72 A;  2OAM A;  3UKH A;  2QA2 A;  2GEW A;  3CNJ A;  4O5Q A;  4EM4 A;  2Q0K A;  3GYI A;  3H8I A;  1MXT A;  5ER0 A;  1PJ5 A;  3CN8 A;  3KPK A;  1OJD A;  2R46 A;  4B63 A;  4D03 A;  1F6M A;  3KLJ A;  3K7Q X;  3UKA A;  1KSU A;  3UTH A;  3VRA A;  1O94 A;  4IA5 A;  2Z5Y A;  4H4V A;  3GDP A;  2B9W A;  2JB2 A;  2VVL G;  3AEG A;  1NHP A;  3DH9 A;  3SUC A;  2AQJ A;  4B64 A;  2VZ2 A;  3NYE A;  1CC2 A;  2VVM A;  3UTE A;  2H88 A;  2BC1 A;  1AOG A;  3NK2 X;  4NWZ A;  4Y4L A;  1B8S A;  2JK6 A;  2BK5 A;  1JEH A;  2CUL A;  3SGL A;  2R4J A;  2V3B A;  3FG2 P;  5KMS A;  2GR0 A;  4YKG A;  4U8N A;  1GRF A;  2BAB A;  4H4R A;  2FJA A;  3AE4 A;  2Q0L A;  2WEU A;  4RG3 A;  4C5O A;  5KOX A;  3CIR A;  1PJ7 A;  4RSL A;  5DBJ A;  4Z2R A;  3HYV A;  1PBF A;  1PBC A;  3LXD A;  3D8X A;  3JSK A;  3AE6 A;  2YM1 A;  1ZOY A;  3SM8 A;  2BK4 A;  4NEV A;  5JCL A;  3I3L A;  3CMM A;  4TM4 A;  5HYM A;  5KMP A;  3AYL A;  2NVK X;  1S3E A;  3M12 A;  4JY2 A;  4U8L A;  1JNR A;  1S3B A;  2YR4 A;  4A65 A;  4D04 A;  3AE2 A;  2X8H A;  2FJB A;  3UKF A;  4U8K A;  3P4Q A;  1YQZ A;  3VRB A;  2YG6 A;  4U2L A;  3NK1 X;  1H82 A;  4H4S A;  4NZH A;  5L46 A;  2BA9 A;  2C3D A;  4IVO B;  2Z5X A;  1TDO A;  1BF3 A;  2QCU A;  1GRG A;  3DA1 A;  4YTN A;  2XVF A;  1PBB A;  3O0H A;  1OJT A;  1PHH A;  4I59 A;  4IA6 A;  4GF7 A;  1ZX9 A;  2ZZC A;  2BCG G;  1BGN A;  1IUS A;  3KKJ A;  3V3N A;  3BHK A;  2WU2 A;  5KVH A;  1PXA A;  3DJE A;  1IUV A;  3T31 A;  2PYX A;  4CY6 A;  1GRT A;  2YVJ A;  1L9D A;  3EAO A;  4EIP A;  3CGC A;  4ZCD A;  4H7U A;  4ADW A;  3ALM A;  4H4Y A;  4TM3 A;  3AWI A;  3NTD A;  1CJC A;  5HHF A;  5CKU A;  4N9X A;  2OLN A;  2WOW A;  1L9E A;  1Z6L A;  1GPE A;  4JDR A;  1LQU A;  4Z26 A;  1JRY A;  2TPR A;  4YSX A;  3GMC A;  5BRT A;  2YAU A;  1XPQ A;  2A89 A;  2OLO A;  2WU5 A;  3QSS A;  2E4G A;  4H2Q A;  3UP5 A;  1O95 A;  2C66 A;  3IC9 A;  1IUT A;  4G6H A;  3QSM A;  4Y4M A;  3UOY A;  1DOC A;  2BK3 A;  4AP3 A;  4BK3 A;  5JCI A;  2X8C A;  2ACZ A;  4KX6 A;  3OZ2 A;  4G74 A;  1M64 A;  4B68 A;  1CJ3 A;  2WPF A;  4GAP A;  4H4T A;  4OPC A;  2CDU A;  3SFD A;  3DJJ A;  3LAD A;  2JKC A;  1GAL A;  1CHU A;  2YG3 A;  3I6D A;  4A9W A;  4X4J A;  4Z44 A;  5FS9 A;  2BYB A;  2FJE A;  4LA1 A;  4O5U A;  2BCP A;  3UTG A;  3P1W A;  1LTX R;  2GAG B;  4U8O A;  5IQ1 A;  1ZP0 A;  3BI5 A;  4JY3 A;  2WBA A;  3AB1 A;  3SZ0 A;  1XDI A;  2WP9 A;  2WP5 A;  4FDC B;  4FK1 C;  4B66 A;  3D1C A;  1XHC A;  4II2 A;  2XLP A;  4YTP A;  1NHQ A;  1XAN A;  3ZDN A;  4H4Q A;  2WDV A;  2J3N A;  3DGH A;  1OJ9 A;  2YLZ A;  3IHG A;  4JNA A;  4TM1 A;  1GT8 A;  5KNL A;  2V61 A;  2VQB A;  3H4K A;  2OAL A;  3FMW A;  1MOK A;  3LB8 A;  3AD8 B;  4OPD A;  2XFN A;  1GRE A;  4CBQ A;  3KA7 A;  3QVP A;  4BK2 A;  1FOH A;  1E1N A;  5KMQ A;  3ATR A;  4X9M A;  3AEA A;  2C65 A;  2GR3 A;  1H84 A;  3UCL A;  4DNA A;  1H86 A;  1OJA A;  1B37 A;  4NTC A;  2XFQ A;  1GTH A;  4BK1 A;  4TM0 A;  4Z43 A;  3UKQ A;  1MO9 A;  4AOX A;  4HA6 A;  4YSY A;  2BC0 A;  5J7X A;  1EL9 A;  2WDR A;  2ZZB A;  1H83 A;  1UKV G;  4J34 A;  1YKJ A;  1Y56 B;  3UKK A;  2XVE A;  1YQ4 A;  4C74 A;  3GRS A;  2GMH A;  1DNC A;  4NTE A;  5CQF A;  2BS4 A;  2X8G A;  1CF3 A;  3BI4 A;  2W0H A;  1E39 A;  2WP6 A;  2IID A;  3CPI G;  2YG5 A;  2YM2 A;  1E7P A;  3G5S A;  4JNQ A;  4REK A;  4U8I A;  2ARD A;  1PJ6 A;  4YSH A;  1EL7 A;  1FL2 A;  2AAQ A;  3G5R A;  4J31 A;  4EQX A;  2JB1 A;  5U25 A;  1Q1W A;  2XVJ A;  3SZF A;  2DKH A;  1TDK A;  1CL0 A;  1DJN A;  1E6E A;  4UDQ A;  2XFO A;  3T14 A;  2F5Z A;  1GOS A;  4GCM A;  4APN A;  2GR2 A;  5LV9 A;  5C2T A;  4G9K A;  4EQS A;  1KFY A;  2EQ8 A;  4UDP A;  2C64 A;  3SY4 A;  3II4 A;  5KRQ A;  4BJY A;  5C3J A;  5KOW A;  2C4C A;  3COX A;  3NYC A;  3P4P A;  4OPG A;  2BRA A;  5IPY A;  5EOW A;  3NKS A;  1GET A;  3QFB A;  4GR1 A;  4H4X A;  4ICY A;  2GQF A;  5IQ4 A;  3HYX A;  2GRT A;  3GMB A;  3FBS A;  4U8P A;  3HZL A;  2WPE A;  4J36 A;  4OPI A;  3RED A;  3L1R A;  4ZCC A;  1M6I A;  4OPU A;  4H2N A;  2C7G A;  1HYU A;  3NN6 X;  3AEE A;  3NYF A;  4YSZ A;  1H6V A;  3CPH G;  1TDN A;  3GD3 A;  4WX1 A;  4A6N A;  2A87 A;  1N4W A;  4CY8 A;  4ECH A;  2ZBW A;  3AXB A;  1NG3 A;  3AEC A;  2QA1 A;  3AD9 B;  4K7Z A;  2LFC A;  4H4P A;  1JU2 A;  3KPF A;  3CTY A;  1JNZ A;  3NIX A;  2B76 A;  3ALJ A;  1Y0P A;  3AE1 A;  2YR6 A;  3UTF A;  4B65 A;  1KNP A;  1QJD A;  2R4E A;  1QO8 A;  2B9Y A;  1NHS A;  3UOV A;  1W4X A;  3NHO X;  1D4C A;  2X99 A;  1IUU A;  3SQP A;  3UKL A;  1TRB A;  4Z24 A;  2GH5 A;  3S5W A;  4NTD A;  1VG0 A;  4K5R A;  4AT2 A;  4U8J A;  1ZMD A;  3AYJ A;  2WDQ A;  5GSN A;  2OA1 A;  1GSN A;  3T2K A;  2YLW A;  4XWR A;  4EMI A;  3BNU A;  1YY5 A;  3IF9 A;  4YWO A;  4Z2U A;  3GQK A;  1D7Y A;  2YG4 A;  3CGB A;  1E1L A;  3P9U A;  4G73 A;  4CRT A;  3EF6 A;  4GUV A;  3SZC A;  1S2Q A;  2RGH A;  2EQ9 A;  5FMH A;  2CFY A;  4BV6 A;  4K8D A;  2XYO A;  1NAA A;  4YTM A;  2WET A;  3AED A;  3QVR A;  1IUW A;  1ZKQ A;  1K0L A;  3RHA A;  4EM3 A;  2HQM A;  4A99 A;  4EQR A;  4KPR A;  1O5W A;  1LQT A;  3DK4 A;  3IHM A;  4U2S A;  4USR A;  1EL8 A;  3VR8 A;  3NNE A;  4EIQ A;  1DOE A;  1JOA A;  1X31 B;  1TYT A;  2YLX A;  1FEC A;  2R45 A;  4A79 A;  3BHF A;  3ABV A;  3ICR A;  3QFA A;  5BUK A;  1BGJ A;  1ELI A;  4GRT A;  2FBW A;  4H2R A;  1CC4 A;  3AE9 A;  1VQW A;  1B4V A;  1VDC A;  2BAC A;  3SFE A;  1V59 A;  1TDE A;  3ISH A;  4AOS A;  1LV0 A;  5TR3 A;  5J60 A;  1NG4 A;  2ZZ0 A;  2PHH A;  4B67 A;  4YXD A;  3LZW A;  2XVI A;  3DME A;  4H4U A;  5HY5 A;  2C76 A;  3SX6 A;  4TLX A;  1ZY8 A;  2XLT A;  5M0Z A;  2GR1 A;  3FPZ A;  2BRY A;  1F8S A;  2XLU A;  2YVG A;  1H7X A;  3H8L A;  2IVD A;  3NLC A;  2R9Z A;  3AE7 A;  4FX9 A;  3GSI A;  3CGD A;  3PVC A;  3WE0 A;  2VVL A;  1JRZ A;  5U63 A;  2YLT A;  1KF6 A;  4CNK A;  4DSG A;  3EAN A;  4USQ A;  3GDN A;  1D5T A;  4FK1 A;  4K2X A;  5KVI A;  1LJ1 A;  1REO A;  5FS8 A;  2V3A A;  4M52 A;  4Z2T A;  1NEK A;  2FJD A;  1PN0 A;  3NTA A;  1D4D A;  4MJW A;  1FEB A;  3Q9T A;  1PXB A;  1KDG A;  3ALL A;  3LJP A;  5M10 A;  4C3X A;  2YVF A;  4EMW A;  2V6O A;  2Q6U A;  2VRL A;  1ZMC A;  5JCM A;  2GAH B;  1TYP A;  4AP1 A;  2GQW A;  4NEW A;  3GD4 A;  3M13 A;  1CBO A;  4GDE A;  1DOB A;  2YLR A;  4E0V A;  3RP6 A;  3SYI A;  1GV4 A;  3T37 A;  2XLS A;  3AYI A;  2B9X A;  2XFP A;  3F8D A;  3AE5 A;  3DK8 A;  4IV9 A;  3S61 A;  1TDF A;  2XLR A;  2V5Z A;  2YWL A;  4U2T A;  4XXG A;  2GF3 A;  4II3 A;  1NPX A;  3ATQ A;  3NRN A;  3AD7 B;  4YT0 A;  4CCQ A;  3UKP A;  1ZK7 A;  1RYI A;  2JBV A;  4GDP A;  1CJ4 A;  3HYW A;  2YQU A;  5EB4 A;  1GER A;  1N4U A;  4G6G A;  4CCR A;  4J56 A;  2YG7 A;  3PO7 A;  4OVI A;  3NK0 X;  2EQ7 A;  1COY A;  3ADA B;  2WS3 A;  3RP8 A;  2H89 A;  3CNP A;  2C70 A;  1L0V A;  1EL5 A;  3CND A;  1H81 A;  2C67 A;  4AT0 A;  3ITJ A;  1NDA A;  2C3C A;  2JAE A;  4CNJ A;  4LII A;  3P4S A;  2QAE A;  3NH3 X;  2O9Z A;  4Y4N A;  4C77 A;  1IJH A;  1DOD A;  4DGK A;  2R0C A;  3GRT A;  1GRH A;  3GQH A;  3F8P A;  3RNM A;  1PXC A;  4H4Z A;  2WOI A;  1D4E A;  1CC6 A;  2Y6Q A;  1BWC A;  5EBK A;  3ICS A;  3GYJ A;  1OJC A;  2WOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...