4YTNA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
616
structure length
616
Chain Sequence
SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title New Insights into the Design of Inhibitors Targeted for Parasitic Anaerobic Energy Metabolism
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 217
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ytnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ytnA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ytnA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ytnA04
3M13A 1DNCA 5KVIA 1M6IA 1OJAA 1B4VA 4AP3A 5JCLA 1D4EA 1DJNA 4CBQA 2YAUA 4X4JA 2JK6A 2FJEA 1K0JA 2XVFA 1QJDA 1JOAA 2AQJA 2VOUA 5U63A 3GQKA 2X3NA 1BGJA 3FPZA 1KSSA 1D7YA 3GWFA 3AD9B 4GDEA 2B76A 2V6OA 4OPCA 5EB4A 2Q0KA 5IQ1A 2V61A 3V76A 2APGA 1CJ4A 1ZK7A 1IJHA 3WE0A 2EQ9A 4YSHA 4J36A 2YR5A 3G5QA 2C76A 3IC9A 4YT0A 1FEAA 3ICRA 3CNSA 3QVRA 3RHAA 4CRTA 1PXAA 2OLOA 1D4DA 4D03A 1N4VA 4OCGA 4DNAA 2YLRA 1LTXR 1H83A 2BC0A 2C65A 4EMJA 1BF3A 2C73A 1XDIA 2RGHA 1D7LA 2A8XA 2YR6A 1V59A 4B67A 4RSLA 3UKAA 1ELIA 4A99A 1ZKQA 3C96A 3KKJA 2B9XA 4J2WA 3C4NA 3K30A 2WHDA 4E0VA 1JNZA 2AR8A 3L1RA 3AD8B 3KLJA 1CBOA 3CPJG 1K0IA 3UP4A 2WP9A 1O5WA 3AE9A 2XLTA 4RG3A 4K2XA 3AEEA 2YG4A 4U8NA 1OJDA 2GR1A 4U8OA 1DJQA 4YXDA 3D8XA 1GT8A 1O95A 1GPEA 1NHSA 4O5QA 3UKQA 1CC2A 1PJ5A 4B66A 4ICYA 1TDOA 3BHFA 4ZCCA 2GV8A 2XDOA 1H84A 3EANA 3LOVA 4H4PA 2VVMA 3CGEA 2WEUA 2GMJA 2GB0A 4EIPA 2WOWA 2BC1A 1K0LA 2EQ7A 3CGDA 1BGNA 4TM3A 1FEBA 4M52A 1KF6A 4YTNA 3LB8A 1LVLA 2E1MA 2V3BA 2Q7VA 4Z26A 2TPRA 4Y4LA 1KNRA 2FBWA 2QAEA 3GWDA 3VRDB 2I0ZA 3GQHA 2O9ZA 4TM4A 1NHRA 4B65A 4K5SA 1NEKA 3AE2A 2OALA 3P4SA 4J56A 1F8RA 4YWOA 3P9UA 2BABA 3QJ4A 3URHA 3BNMA 1GERA 3DJGX 4H4RA 4U2TA 2JB1A 2AAQA 3ICTA 4EQWA 4GRTA 1Y56A 4LIIA 2BK5A 1P2HA 2YLZA 4NTDA 5GSNA 4H2QA 4FDCB 2BA9A 4X9NA 3M12A 4AOXA 2WBAA 2YVGA 1IUTA 3UOVA 2V3AA 4UDPA 4OPLA 4A6NB 4U8PA 3EAOA 1KDGA 2IIDA 3I6DA 4OPTA 3UTHA 3OZ2A 3QFBA 4YKGA 2XLRA 2VZ2A 1FCDA 1SEZA 4ECHA 3P4PA 2GAGB 2UZZA 4JQ9A 4BK1A 2WPFA 2C3DA 3B6DA 3LADA 4C5OA 5U1OA 3SFDA 4Y4MA 2EQ8A 3NYEA 2B7SA 2GVCA 1DODA 3QSEA 5FMHA 2X8GA 4C77A 3NYFA 2WU5A 4YKFA 1L0VA 2V60A 3V3NA 3C4AA 1TRBA 4BK2A 1YQZA 1X31B 4K8DA 5JCKA 4YTMA 1GXFA 1NG4A 4CCRA 4OPUA 3HZLA 1GESA 1NAAA 2XVEA 1NPXA 1E1KA 3CGCA 3KA7A 4GDPA 2CVJA 1GSNA 3AWIA 3GDNA 1YQ3A 1P2EA 2JAEA 1S2YA 3CPIG 4BURA 4DSGA 1H7WA 4FK1A 2JB2A 1H81A 2WPCA 5BRTA 5BVAA 1JEHA 4FK1C 2C67A 1IUUA 1CJCA 4Z44A 1LQTA 3GSIA 4EM4A 3VQRA 3QVPA 1NENA 5FS8A 5EB5A 2BK4A 2XFPA 4K22A 1IUSA 2DKIA 2XFUA 2C66A 1PN0A 2GQFA 4EM3A 2JB3A 1DOBA 1ZP0A 1KNPA 2Y6QA 1Q1WA 1LPFA 3AE6A 1LJ1A 3IF9A 1ZMDA 3FBSA 3G5SA 4GR1A 2GR3A 2CDUA 2RGOA 2YLXA 3T37A 4K5RA 2B9WA 2XFQA 1TDKA 3O0HA 3GDPA 2JKCA 1EL7A 3NK2X 2QA1A 4CNKA 1CJ3A 3II4A 3VRBA 3AE1A 1IUXA 3ITJA 4J34A 3SM8A 2DKHA 4H4YA 3DGHA 4U8JA 3AEDA 2WETA 2XVJA 2C72A 2Q6UA 1M64A 4XWRA 1XPQA 1DOCA 1E1MA 1K4QA 3KPFA 3AD7B 3NTDA 4UP3A 2R0GA 2YLWA 1PS9A 3GYIA 4H4UA 1H6VA 2W0HA 4U8LA 1EL8A 3UKLA 2CFYA 2VQ7A 3PS9A 2BS3A 1H86A 4GCMA 4H7UA 5J7XA 3ATQA 1Q1RA 1KFYA 1F6MA 1S3BA 4AT2A 1N1PA 3NTAA 4OPDA 1PHHA 1ZY8A 2YM2A 2GQWA 1PBFA 2WPEA 5KOXA 2BCGG 2BK3A 1OJTA 2WESA 1CF3A 5KRQA 2BS4A 5L46A 2ZBWA 2V5ZA 4EQXA 2WDRA 3GD3A 3QFAA 2GRTA 2C70A 1GRHA 3GRSA 2XFNA 1DOEA 4DGKA 1RP0A 1L9DA 4YSYA 5IQ4A 5ER0A 3REDA 2PYXA 1PJ6A 4A79A 4IVMB 4K7ZA 2Y6RA 2QA2A 2GMHA 4NZHA 1BZLA 3G5RA 3NIXA 4A7AA 1VG9A 2XVHA 5HHFA 3VR9A 1MO9A 3AE4A 3CPHG 1EL9A 2J3NA 3H8LA 1EBDA 4HB9A 5M10A 3GYXA 3NN0X 2XVIA 1IUVA 1JRYA 5IPYA 2YVFA 3AEBA 1F3PA 3UOZA 1GRAA 2ZZBA 2WP6A 2QCUA 2YG6A 4Z25A 1PBBA 3PVCA 4B69A 1PJ7A 4H2RA 1KSUA 1B8SA 1BWCA 4I59A 1E6EA 3DMEA 5EBKA 3CNJA 2FJAA 1REOA 2NVKX 4KPRA 4U8KA 5CQFA 1JU2A 3QSMA 3DGZA 1PDHA 2OAMA 4EIQA 5U25A 3P4RA 3UKKA 3F8PA 3NK1X 1YY5A 3NNEA 1Z6LA 3AE5A 4U8IA 2LFCA 1D4CA 4GUVA 3IWAA 5HYMA 2XCGA 4CNJA 1E7PA 3P1WA 3ALMA 3DJEA 3GD4A 4Y4NA 3CNTA 1S2QA 1FECA 3ICSA 5C2TA 3ALLA 3LXDA 2YWLA 4H4TA 4WX1A 5EOWA 3VRAA 1F8WA 4OPIA 1O94A 4UDRA 2X8HA 3IHGA 3DJDA 3UOYA 2B9YA 3ZDNA 3M0OA 4BV6A 1L9CA 1FOHA 4BJYA 1GTEA 2WOIA 3NN6X 4H4ZA 2B7RA 1GRTA 1PBCA 4C74A 2WDVA 1D5TA 1TDEA 2CULA 4H2NA 1YQ4A 3SUCA 1COYA 2WDQA 5GRTA 4A9WA 2WU2A 4YSZA 3BHKA 4NTEA 3SQPA 4J57A 4Z24A 1B5QA 2XLPA 3RP8A 4A6NA 4ADWA 4U2SA 3AB1A 2R4JA 1XANA 2YLTA 4U2LA 2X50A 2XLSA 2XLUA 3BNUA 1E1LA 2YLSA 2IVDA 4TM0A 3SFEA 1LV0A 3ZYXA 2RABA 2C64A 1PXCA 4TM1A 5KXJA 4PABA 2YQUA 1GREA 3Q9TA 2ARDA 3AYJA 4MJWA 2BCPA 3F8DA 3AE3A 2C75A 1JRXA 3LZXA 3FG2P 3UKHA 1L9EA 4B64A 2GAHB 5HY5A 3ATRA 2GR0A 4OVIA 4JN9A 1TYPA 2R0PA 3UKPA 4JNQA 3DK4A 4YSXA 4XXGA 3UKFA 4IVOB 2R45A 4A5LA 1DXLA 4EQRA 2FJDA 1N4WA 1VRQB 3CN8A 4I58A 4JY2A 4N9XA 1JRZA 3S5WA 2X99A 3NH3X 2NPXA 1GV4A 2GH5A 1GRGA 3UTEA 3AXBA 4D04A 4B68A 2F5ZA 4IA6A 3GMBA 5LV9A 3CTYA 4AOSA 2A87A 3CNPA 4DSHA 3RP7A 1B37A 4CY8A 5FS9A 2IVEA 2R9ZA 3H8IA 3NGCX 3Q6JA 4Z2RA 3BI5A 2RGJA 4TLZA 2WS3A 2YG5A 4HA6A 2PHHA 3RP6A 1EL5A 3E1TA 2Q0LA 3GMCA 3AYLA 1ONFA 5FS6A 5M0ZA 4IV9A 5BULA 2HQMA 3EF6A 3IHMA 3L8KA 3NHOX 4Z2TA 3KVEA 1Y0PA 3UTFA 4CCQA 1PBEA 1JNRA 4YTPA 4BJZA 3ABVA 4H2PA 1F8SA 1CJ2A 3NG7X 5JCNA 1Q9IA 3UP5A 1GRFA 2OA1A 2ZZCA 1H7XA 4TLXA 1XHCA 4X9MA 3ISHA 3KU9A 5DBJA 1CL0A 1VG0A 4USQA 4JDRA 4CY6A 3CGBA 4FX9A 4H4VA 1YKJA 2E4GA 5FS7A 1OJCA 3DK8A 2BYBA 4REKA 2XFOA 2VVLA 4APNA 4NEVA 3BI4A 2JBVA 1QO8A 3AEFA 2VVLG 2YG7A 4LA1A 4NEWA 3S61A 2WQYA 4UDQA 4USRA 1UKVG 5J60A 5KOWA 2R4EA 3VR8A 1NG3A 2BXSA 3AYIA 5KVHA 5JCMA 3AE7A 1S3EA 2C3CA 4H4XA 4LU6A 3UTGA 3H4KA 3V3OA 1GOSA 2ZZ0A 3P4QA 2WP5A 1HYUA 4AP1A 1LQUA 2VRMA 3DA1A 3ADAB 3DH9A 3UOXA 2GR2A 1TYTA 4H4SA 1CC4A 1TDFA 2YG3A 2VQBA 3CIRA 4O5UA 2XYOA 2H88A 1GETA 2A89A 3D1CA 4H4WA 1AOGA 1PXBA 2C7GA 4H4QA 5JCIA 3SGLA 4U8MA 3AECA 4GF7A 4H50A 3K7TA 4EMWA 3DJJA 2TMDA 2BS2A 2YR4A 3NYCA 3OC4A 2ACZA 4A65A 4IA5A 1ZOYA 1ZDLA 1QLBA 3GRTA 2YVJA 4PAAA 4EQSA 4OPGA 4B63A 1W4XA 1ZX9A 4AT0A 1BKWA 1GALA 1NHQA 3B3RA 3RNMA 3NRNA 3QSSA 4C3YA 1E39A 1Y56B 1IUWA 2H89A 1MXTA 1VQWA 1CHUA 3NLCA 1NHPA 4Z43A 3BI2A 2E5VA 4RG4A 1ZOVA 3LJPA 4JY3A 4J31A 4XWZA 4WCTA 3I3LA 1RYIA 3ALJA 3NKSA 5HXIA 2R0CA 3COXA 3UCLA 3CNDA 3AEGA 5TR3A 1NDAA 5CKUA 3AE8A 1GRBA 1GEUA 3LZWA 5KWFA 2Z5YA 3EPTA 4Z2UA 3NK0X 2OLNA 3K7MX 2GF3A 3GYJA 3R9UA 4C3XA 2FJBA 3FIMB 3F8RA 3K7QX 2X8CA 1GTHA 3JSKA 3NT6A 4P9SA 1PBDA 1VDCA 4ZCDA 2GEWA 3KD9A 3PO7A 2Z5XA 1E1NA 2EQ6A 1OJ9A 4J33A 1N4UA 2VRLA 4B1BA 4KX6A 1ZMCA 3AEAA 2R46A 4BK3A 1GNDA 1CC6A 3DK9A 4ZN0A 4JNAA 4NTCA 5C3JA 2YM1A 1RSGA 1H82A 1MOKA 2BXRA 3FMWA 5BUKA 2BACA 2WOVA 4EMIA 1FL2A 1TDNA
chains in the Genus database with same CATH superfamily
4ZZCA 5KVIA 1OJAA 4AP3A 2RA1A 2H7VC 5HEJA 3SZ0A 1D4EA 2VURA 1YKEB 2JK6A 2FJEA 1I94T 4RHV4 2JIWA 2AQJA 3GQKA 2CWYA 3LDQB 3AD9B 4COFA 5EB4A 2Q0KA 5KMGP 3V76A 4X5TA 1CJ4A 1ZK7A 2LJLA 3SY4A 2DL1A 4YSHA 2PG8A 2C76A 5KX5E 4IGUA 3IC9A 2BKOA 1FEAA 1KNZA 4CRTA 1N4VA 4OCGA 1BF3A 1XDIA 1D7LA 4IDQA 4X64T 2IC9A 2A9UA 3KKJA 2BG9B 2X51A 4E0VA 2AR8A 3AD8B 1ZKEA 2XAJB 1D0YA 3FXEB 3BQIA 1R094 2GK9A 4YXDA 2R064 5FYMA 1GT8A 3V5SA 4TWFA 3UKQA 3ZN0B 1PJ5A 4ICYA 2GV8A 3HYWA 5L47A 3WAJA 5AQOB 1RHI4 2WEUA 3NRYA 2GMJA 2LHNA 2Y8DA 2BC1A 3TKLB 1BGNA 1XZYA 3N2KE 4QWNB 4WW0A 4TN7B 1IZNB 1OEDE 3B13A 5CJ5A 3WI3A 4Z26A 2FBWA 4ZS2A 3GWDA 2X5ID 3VRDB 2XAQB 1FEWA 3QC9A 3OJAA 2OALA 2VL8A 4G9KA 2C4CA 3URHA 2BABA 4CXYA 3QJ4A 5AQHB 3F57A 3N9PA 3DJGX 4O4IE 1LRZA 2JB1A 5JDMA 4LIIA 2E5LT 1I6ZA 5ABFA 1RUD4 4UV9B 1RUE4 1XI1A 3ZC1A 2RPAA 1WFDA 4A6NB 5DQVA 3Q5XA 2OA5A 3QFBA 2VZ2A 3QB5A 3I9YA 2FUPA 2GAGB 1PO24 5J2TE 3B6DA 3LADA 2IDOB 2XQ9A 4LF6T 2EQ8A 5LBQB 1DODA 4H9QC 2VL0A 3NYFA 3UFGA 4EZHA 4NUVA 1IAPA 1OEDC 2W4XA 1HNXT 2J4GA 5LB7B 2D2SA 5FXVA 3ZJ2A 4HWHA 5JCKA 3RPUA 4BA9A 4P1NA 3J8F4 3T2KA 1NAAA 3KA7A 1YQ3A 1S2YA 2CXFA 2V1DB 2WPCA 3CWZB 2C67A 4ZI2C 1LQTA 2KINB 3GSIA 3JAEA 4EM4A 3QUJA 4OYKA 3I0OA 5FS8A 5EB5A 3D0TA 4DV4T 2C66A 3KV6A 3EABA 3CK6A 1XMQT 5CB4E 1ZMDA 1BR0A 3MKDA 2GR3A 2RGOA 3RC8A 4JI1T 3MZKB 2B9WA 1VRBA 1TDKA 2QA7A 2QA1A 1CJ3A 3VRBA 1IUXA 5EK3A 3B5MA 1HG5A 5TAOA 2E9XA 2Q6UA 3O4XE 3KPFA 3AD7B 3NTDA 2R0GA 2YLWA 1PS9A 4H4UA 1H6VA 2JQKA 3CVRA 4U8LA 3N2OA 5J7XA 3BQKA 1N34T 2ZLYA 2XSAA 2Y6XA 3MJXA 2YM2A 4U2ZA 3KV9A 4QX7B 2PJQA 2BS4A 3JADA 5HXHA 2XM1A 1T98A 3C4ZA 4EQXA 4TV8E 2KLQA 2C70A 4UVAB 1RP0A 4YSYA 5IQ4A 5ER0A 2XAFB 1D1AA 4IVMB 4K7ZA 1US7B 1BZLA 3NIXA 2NTXA 2JMHA 3VR9A 1EL9A 2J3NA 3H8LA 5L3EB 2MTQA 4X20E 3NN0X 3C50A 1N33T 4LFBT 2YVFA 1F3PA 2YG6A 3RF1A 4ILAA 2FJAA 2NVKX 5JR9A 1JU2A 3DGZA 4O8SA 3UQ7A 2XY8B 1DU2A 1SE7A 4B3TT 3KVBA 3AE5A 4UVCB 4TWHA 5FY1A 5HYMA 4CNJA 5L3DB 4PW8A 5AQMB 5JDHA 2ZMAA 1W9RA 1S2QA 3GD4A 3ALLA 4WX1A 4V1Av 4EOZB 5JDLA 4H4TA 3FXDB 3P50A 4IL9A 4OPIA 2X8HA 3IF8B 3M0OA 5BR8T 2RS14 3RQUA 2ES0A 4BJYA 2V26A 1GTEA 2XTLA 4H4ZA 5LGTB 1U5PA 2W62A 2XQ3A 2WDVA 4CN4A 4H2NA 4UVBB 3SUCA 5LCYA 4X62T 1VBD4 4J57A 1B5QA 2XLPA 3RP8A 2HN2A 1X9BA 2V7IA 3CMLA 1D0ZA 4O4LE 3ESLA 1E1LA 4PJLA 1LV0A 2RABA 1FMWA 2WY2A 2Z6EA 1PXCA 5FNVE 1E1HB 1GREA 2NP9A 4HN9A 2C75A 1MMAA 1U4QA 3RHWA 1L9EA 4ISSA 3SXIA 2GR0A 3UTKA 1LVFA 3Q9DA 2WZIA 1TYPA 2R0PA 4YSXA 3O1HA 4IVOB 1O3XA 4N9XA 3FBLA 5JVDE 2X99A 1HX8A 2UUCT 2PFVA 4B68A 3CTYA 3OKQA 4CY8A 2HWB4 2D9DA 2WMNA 3H8IA 3NGCX 4JBWF 2D0TA 3WAKA 1AR84 1EL5A 3C51A 1RUF4 2KZ7B 3DTOA 1ONFA 3GMCA 5FS6A 4IV9A 5M0ZA 4IT4A 3IHMA 2Q9QC 4CCQA 4BJZA 3OYXA 4H2PA 5AQRB 3ZN1B 2QRXA 2CLYB 2X9YA 5JDQA 3K8PC 4WYVA 4FX9A 3I0QA 3DK8A 2VVLA 4QHOA 2LSGA 3AEFA 2YG7A 2WQYA 5L3FB 2XQ5A 3HKBE 1UKVG 5KOWA 3C4WA 5KVHA 5JCMA 3AE7A 1S3EA 2C3CA 3V3OA 1RUI4 2RM24 4I50E 4BJNA 1T8BA 1LQUA 1RUG4 3HKEE 4YHHT 3DH9A 3UOXA 3CX8B 1CC4A 4ANJA 1TDFA 4LMKA 4PAGA 2H88A 2A89A 4H4QA 4P0AA 4U8MA 3K7TA 3DJJA 2YR4A 4HFEA 1S35A 2UXXB 4DR3T 1RUC4 2N2NA 4LF7T 2YU1A 1ZDLA 3GRTA 2BVLA 1NWMX 4GYSA 4EQSA 2RR14 4B63A 5JR9B 1ZX9A 1MIWA 1CUNA 2IHR1 1NHQA 3QSSA 3FB2A 4TZ4C 1E39A 1Y56B 1VQWA 1HFAA 5HCJA 2K3WA 4RG4A 4EGWA 3CX6B 2RP4A 3JBG4 3LBXB 4JY3A 2LM2A 3RYCE 4TNVA 3SYIA 3UCLA 4MHCA 3HI2A 1ASJ4 4Q4X4 5CKUA 3PE0A 3NK0X 2OLNA 3AVSA 4QXHB 3R9UA 2FJBA 2M67A 2YN6A 4HFVA 3L39A 2D5UA 2V7JA 3NT6A 4P9SA 5HYAA 3L09A 1PBDA 2GEWA 2IUBA 3KD9A 3UUMA 2Z5XA 1E1NA 2I6HA 2XHEB 4BK3A 1OXZA 3QK6A 4U74A 4K0KT 4H63H 4G63A 4CXWA 4HGAA 1RSGA 2WMOA 2LE8A 2X68A 3KFWX 3FMWA 1YW0A 3FZLB 3KBUA 2BKPA 5L3GB 4JI0T 1FL2A 1TDNA 1VBC4 3CKDA 1DNCA 2L9QA 3SS1A 3F2EA 2VVSA 5LJMA 1DJNA 4P09A 4OX9T 1K0JA 1IJ5A 2VOUA 4C90A 1Z8UA 2NTYA 3RIAA 1J5WA 2X3NA 5FP3A 3N2GE 3RLFF 4G6HA 2V61A 1VBB4 1IJHA 1AJ3A 3J7Yq 2YR5A 3G5QA 5IWAT 1W0BA 2C0SA 3QVRA 1PXAA 2HHHT 3AXJA 2YLRA 4H9NC 2C65A 3FZFB 2A8XA 4HFBA 4A99A 1ELIA 1ZKQA 3C96A 2CA5A 3ZMUB 3LFMA 3C4NA 3P8CD 1CBOA 4WBNE 5JH7E 1O5WA 4U8OA 1O95A 1GPEA 4OHFA 1TDOA 3BHFA 4ZCCA 1H84A 3EANA 1K5MD 4H4PA 1WYCA 4TWDA 2V6YA 3MXZA 4OK0A 1AR94 2P9BA 4I0UA 1K0LA 2ZM2A 3RYFE 3CGDA 2JRKA 4TM3A 1VBE4 1FEBA 4M52A 4X1IE 1KF6A 3LB8A 2NOXA 4U72A 1HNWT 1LVLA 4ZI3C 3X1DA 4DUZT 2TPRA 1NAFA 5AQQB 4B65A 2KMFA 4K5SA 3P4SA 2VQFT 3PTRB 4UELA 3ZYLA 4GAVA 2XJ7A 4CI2B 4H4RA 4U2TA 2K5BB 2AAQA 3ICTA 3QB5K 4EQWA 2LHRA 5IHYA 4GRTA 1G8XA 4NTDA 5GSNA 2NR4A 3AA7B 3IBPA 3OBVE 2WBAA 3H3MA 2N1GA 1WR0A 3ZMVB 4GK0E 3EAOA 2IC6A 3K3OA 3I6DA 2VKDA 5F3JA 4KHPT 1FCDA 1SEZA 4IREA 3UUNA 4ECHA 4BK1A 3EAMA 2WM9A 2V5CA 4HWFA 3K3NA 2CWOA 3LK3B 2X8GA 4U31A 3RQWA 2WU5A 4GYRA 4LF9T 2XQ4A 4O2BE 4L9IA 3C4AA 2PZSA 3GN5B 1NG4A 1HTJF 3T8OA 5LP6E 2J47A 4LF4T 4GDPA 3GDNA 2JAEA 1P2EA 4BURA 4PFPA 1H7WA 3PJAJ 2JB2A 5BRTA 4FK1C 2R074 3CQCB 1CJCA 1MMDA 3SZCA 3VQRA 2BK4A 1UGOA 4K22A 1IBLT 2XFUA 2RS34 2W66A 3RIUA 3NZPA 1PN0A 2GQFA 2JB3A 2G0UA 2W00A 2XAGB 2Y6QA 1MMNA 3IF9A 3G5SA 4GR1A 2YLXA 2CDUA 4K5RA 3ONJA 5J2UE 2XFQA 4PK6A 3T2YA 2EHOA 4CNKA 4J34A 3SM8A 3FBZA 4H4YA 3AB3B 3DGHA 3AEDA 3ETVA 4U8JA 5JRCA 1M64A 2V8SV 1K4QA 4UXNB 3GYIA 3UKLA 5M4YA 3ZPOA 2DWKA 2CFYA 2X9XA 2BS3A 1H86A 4NIQA 2VQ7A 2OLTA 3ATQA 1EZ3A 2IMLA 1ZEEA 4GCMA 1KFYA 1F6MA 1S3BA 5KMSA 4YLHA 2J62A 3NTAA 5CA1E 2CRBA 4OPDA 2ZM8A 2X9HA 2GQWA 2WPEA 1CF3A 4U7IA 2UXDT 2PYJA 5KRQA 1MIVA 2WBLA 2CXDA 2ZBWA 4IHJE 2V5ZA 5FL0A 3ZMSB 2W61A 2XPKA 3CQXC 4Q25A 3GD3A 1QUUA 2GRTA 3Q5WA 1XNQT 1GRHA 5JREA 1DOEA 3UULA 3REDA 2V6YB 5FMNA 2GMHA 5DJQC 3ONXA 2IW5B 2XVHA 1PIV4 5M10A 3AE4A 2CXLA 4QH5A 1IUVA 1B7TA 3AEBA 5L4EA 2W63A 2LLYA 2HN1A 1HCIA 2QCUA 1PJ7A 1KSUA 4EIWA 5J0ZA 3HYVA 4JI6T 3UU8A 3CNJA 3DMEA 4KPRA 5HEHA 4U8KA 5CQFA 3QSMA 2X66A 4EIQA 3F8PA 3NK1X 4AQFA 3A5XA 3NNEA 3RI5A 3UUBA 5LHGB 4U8IA 4GUVA 1AR64 2CPTA 2JJ9A 4F6RC 1E7PA 3DJEA 4DBQA 2YWLA 3VRAA 1F8WA 4BJMA 1O94A 4UDRA 3P4WA 3UOYA 3ZDNA 5LOVE 2LSIA 3H37A 4BV6A 2BVMA 3PUAA 3RYHE 2XQAA 4IDNA 3NN6X 2B7RA 3UU6A 1YQ4A 3O1IA 5H6RB 5GRTA 4A9WA 2HWC4 3BHKA 4Z24A 3HR0A 4NXNT 4U2SA 3AB1A 2XQ6A 2X50A 2XLUA 4EXTA 3UU3A 2NW9A 3IHRA 4WBOA 5KXJA 4PABA 2YQUA 4MJWA 4Z8XA 3HA4A 3F8DA 1H8TD 3AE3A 2XAHB 4AISA 2GAHB 3ETUA 3PU8A 4JN9A 3ZT5A 4JNQA 4AKGA 2UUAT 3UKFA 4DR6T 2NWBA 4A5LA 1DXLA 2FJDA 3UFEA 1N4WA 4PJMA 2MYSA 4A97A 2GH5A 5EZYE 1GRGA 3UTEA 3FZKB 4D04A 2F5ZA 4G74A 3OPCA 3GMBA 4GKKT 4AOSA 2HPLA 5KMPA 3CNPA 4DSHA 4CI1B 5FS9A 2LT3A 3UUXB 3CQGB 3BI5A 3F31A 2YG5A 1HS7A 4B3MT 2PHHA 3E1TA 3N9OA 2Q0LA 2Q9QA 4JUYA 2EHOB 5JQGE 3NHOX 4Z2TA 3L8KA 3KVEA 1PBEA 1JNRA 4ERRA 4HKAA 1CJ2A 1XDPA 4JI5T 3UP5A 2OA1A 5FXWA 4U3CA 4USQA 4CY6A 3CPZA 2E4GA 2XQ7A 3FHNA 4REKA 4FI5A 2XFOA 4APNA 3AAIA 4NEVA 3BI4A 1QO8A 4IE5A 1D0XA 4USRA 5J60A 2R4EA 2ODUA 4PNIA 3ZKRA 1E2AA 3H4KA 5KNLA 2ZZ0A 1HYUA 3M3ZB 1TYTA 4H4SA 4LMJA 3CIRA 4O5UA 1AOGA 1GETA 3Q5DA 1PXBA 2C7GA 1COV4 1J5ET 4X65T 1N32T 4H50A 3S4UA 4EMWA 5L3BB 2ACZA 3U3IA 3TLVA 4UEMA 4ZHQE 2YVJA 5CA0E 3B3RA 3GMIA 3RNMA 1RMU4 1OWAA 4Z43A 5ABFB 1ZOVA 3KV4A 3VKGA 2CMRA 4DV3T 1YKHB 4WCTA 4UIGA 1RYIA 3ALJA 5LNKA 3NKSA 3PUZF 2R0CA 3CNDA 3AEGA 5TR3A 3AE8A 1GRBA 5AQPB 5KWFA 4AXPA 2EHOD 4CXXA 2C5IT 1IJ6A 4HFCA 3JSKA 1VDCA 4PDWD 2EQ6A 2PLV4 4J33A 3ZC0A 4B1BA 2CCQA 2K24A 2K9AA 1CC6A 3R84B 4DV2T 4NTCA 4IE7A 4IDOA 1T72A 1H82A 4PJJA 2BXRA 4AKIA 2BACA 4LF5T 2PYLA 4Q4W4 3T2ZA 4EMIA 4G6GA 1HXS4 4AKLA 4O2AE 3J9X1 4NXMT 1UURA 3OYZA 2ODVA 5AQSB 2YINA 4CBQA 5KMRA 2WAUA 1MNEA 4X4JA 1VCTA 1FMVA 1JOAA 1WR6A 5FVLA 1XHXA 3AVRA 4AKHA 1BGJA 1SHZC 3FPZA 1D7YA 4XZCA 4OPCA 4IE0A 4ZOLE 2APGA 5FKYA 2KSRA 1WLXA 4ADZA 1IBKT 2EQ9A 2UXCT 3ZEFB 2X0YA 3CNSA 2BBHA 2ZM6T 4K0UA 4PJNA 4D03A 4DNAA 2E9XB 1H83A 4EMJA 5A1LA 2Q9QB 1QSDA 4Z91A 2CBJA 2UXBT 2V7LA 4B67A 4RSLA 1UX5A 2B9XA 5JDGA 3K30A 2WHDA 1JNZA 3L1RA 3CPJG 1K0IA 2WP9A 3VU7H 1R084 2CLYC 2LOPA 3AE9A 4RG3A 2YG4A 4U8NA 2GR1A 5HWXA 3D8XA 4IL4A 4O5QA 1MQTD 1CC2A 5F8PA 3GA8A 2XDOA 1YD8G 2CBIA 3Q5EA 4J2CA 2VVMA 2WSSV 2KXPB 4E7SA 1FIOA 3UU5A 4DV1T 2GB0A 4EIPA 5LYJE 2WOWA 3DP7A 5JDFA 2C5JA 3AAAB 3W15B 2CEAA 3C64A 2E1MA 4DMVA 2V3BA 4O4JE 2Q7VA 4Y4LA 1KNRA 3AA0B 2QAEA 4WNKA 2F4VT 4TM4A 1AR74 1T7SA 3ZJ1A 1HRV4 2X67A 1F8RA 4YWOA 3BNMA 1GERA 4U7YA 5JR9C 4JI7T 4LMLA 4DNDA 2CHOA 2DHRA 1P2HA 2YLZA 4JV5T 4XAXB 2BA9A 4X9NA 2YVGA 3UOVA 3LJCA 4GAPA 2V3AA 4UDPA 1Z0PA 5LG3A 4DR5T 3AAEB 2IIDA 2LSKA 3ZSSA 4OPTA 3UTHA 4YKGA 1PVC4 2XLRA 2E9XD 3P4PA 4E7ZA 5AQJB 4JQ9A 2Q9QD 4C5OA 5U1OA 3SFDA 2ACXA 4Y4MA 2B7SA 5IYZE 5IUXA 3RX6A 3QSEA 3V5UA 4YKFA 1FJGT 2DLRA 3V3NA 2KT9A 2VKOA 1TRBA 1YQZA 1X31B 1H7CA 4K8DA 4YTMA 1GXFA 5FY0A 3HZLA 2JPFA 1NPXA 1LKXA 2XVEA 2DWGA 1HX1B 1E1KA 3AWIA 3JC6D 4DSGA 1UX4A 4FK1A 3PUWF 4AIUA 1H81A 5BVAA 1JEHA 2PBIA 5CFBA 3LG7A 4Z44A 4KMCA 4LF8T 3K1SA 3RRWA 1MIYA 4H9SE 4YY3T 1NENA 2VKJA 2H3RA 2A72A 2NW7A 1IUSA 2DKIA 3NKZA 5FXZA 4HWIB 4DV6T 2L8KA 4EM3A 5ABEA 1DOBA 1ZP0A 1MNDA 1KNPA 5LG4A 1Q1WA 1LJ1A 2LKGA 4GK5E 3T37A 3P7IA 4A98A 1HF8A 3GDPA 2JQQA 1EL7A 3NK2X 3ITJA 2DKHA 2WETA 2C72A 1E1MA 1HG2A 4IIJE 3E0ZA 2SPCA 3PS9A 4GKJT 4EEBA 1Y64B 3K3QC 4DV0T 1VOMA 2E2AA 1PHHA 3RGLA 4DVDA 1ZY8A 5KOXA 1PBFA 3QNUA 2BCGG 1OJTA 2WESA 3T14A 2BDEA 5F5WA 4DMWA 4CZZB 3LK42 2WDRA 1G73A 3GRSA 2XFNA 3VHLA 2PYXA 1PJ6A 1KEYA 2Y6RA 2QA2A 4A7AA 4EB6E 3G5RA 3MK7C 1MMGA 4PK5A 1W09A 5HHFA 4TV9E 1MO9A 4ZEYA 4HB9A 3HYXA 5IPYA 2MBGA 3UOZA 3PVCA 4AQYT 4B69A 4H2RA 3EDVA 1BWCA 4JYAT 1E6EA 4I59A 5EBKA 5AQNB 2OV9A 1PDHA 4F8HA 5U25A 4ZS3A 3UKKA 3NBXX 1YY5A 3U78A 1D4CA 3IWAA 2R6GF 2I59A 1Z7S4 4Y4NA 2X0HA 4CI3B 3ALMA 3CNTA 3ICSA 3LXDA 1WYBA 2R7FA 2MOZA 2KWIB 3KBTA 4B6XA 3DJDA 3IHGA 2VQET 2B9YA 3EVYA 2L3LA 3PURA 1GRTA 3HKDE 4NUUA 2NW8A 4C74A 3RH3A 4B3RT 1TDEA 2CULA 4A6NA 1VBA4 4DR7T 3ZMZB 1OEDA 2R4JA 5LHHB 2YLTA 2YLSA 3ZYXA 3SFEA 2XSBA 2C64A 5ABHA 4TM1A 2CE7A 2ARDA 3ZYKA 3AYJA 2I0MA 2BG9E 5AQKB 4TUYE 4Z90A 4HE8A 2LRLA 3RRCA 1JRXA 3LZXA 3T1HT 3FG2P 2YU2A 2LRKA 4II2A 4OVIA 2YEVC 3L8RA 4A56A 3EI0A 3DK4A 4XXGA 4H9OC 4L0RA 5HCMA 4JI2T 1ZHCA 3NH3X 1GV4A 4A5XA 4JI8T 4LFAT 2DNXA 4KHZF 4HFDA 3B57A 3OTOT 2JMKA 3T1YT 1LVKA 2A87A 5L4HA 3ZYMA 4ZI3D 2IVEA 2R9ZA 2EX3A 3Q6JA 3CX7B 3AXJB 4TLZA 4QKNA 2KWHA 4L5GA 1NCQD 1RUH4 1BR1A 3MACA 3AYLA 4NWZA 5BULA 4IE4A 3E08A 4QXCB 3EF6A 2WZHA 4MLKA 5HWYA 4QXBB 4YTPA 4KUMB 1Q9IA 4PFOA 1H7XA 2BG9C 4TLXA 5JTGA 3A7MA 3KU9A 5DBJA 5GONE 2VKHA 2ZM0A 1OOPD 4KBMB 5FS7A 2VK9A 2R044 3KINB 2BYBA 4IE6A 2VVLG 2LKHA 4LA1A 3S61A 3KVAA 4ZI7E 2VB6A 3EHZA 5LA6E 2W0GA 1NG3A 3AYIA 1M62A 2WCAA 3UTGA 4H4XA 1KK7A 1GOSA 4N78D 3PUXF 4MFRA 3DA1A 3ADAB 2GR2A 3EDUA 2YG3A 2VQBA 5AQUB 2XYOA 3KPKA 4H4WA 3D1CA 5JCIA 3SGLA 3AECA 4GF7A 4QX8B 5DABA 1XWMA 1UK5A 2BS2A 4TX5A 2K48A 3OC4A 4IA5A 2DCFA 1QLBA 4UV8B 4PAAA 5HEOA 1W4XA 3I9WA 4DO0A 1GALA 3HKCE 4C3YA 2YDSA 1IUWA 2H89A 1NHPA 1Y01A 3BI2A 2E5VA 1UUSA 4AI6A 1XHZA 5HXSA 4EYYR 5AQFB 2Y48B 4QH1A 3HL6A 5HXIA 3COXA 1W0AA 3N5LA 5CGMA 2E8IA 3TLTA 4DR4T 2Z5YA 3EPTA 4Z2UA 3A8YC 2GF3A 3FIMB 3I1AA 3F8RA 5L3CB 4U33A 1GTHA 2LOSA 1OEDB 3PO7A 1OJ9A 4KI0F 1N4UA 1HNZT 2VRLA 4KX6A 1ZMCA 2R46A 4C91A 3DK9A 2KNDA 3LSVA 4TNWA 2YM1A 1MOKA 3SX6A 4Q4Y4 2WOVA 3IEEA 3M13A 4JLEA 1M6IA 5JCLA 1B4VA 4Q4V4 3PU3A 2BZBA 3GWHA 5HXEA 2VVNA 2YAUA 2XVFA 1QJDA 4BAYB 5U63A 2UXNB 1KSSA 3GWFA 4GDEA 2B76A 2V6OA 5IQ1A 4ILBA 3WE0A 4J36A 4I43B 1VCSA 4HWCA 2YK0A 2DI4A 4AKRB 3RIUC 4YT0A 4QH4A 3ICRA 3RHAA 2OLOA 1D4M4 3L3PA 2V6XA 1D4DA 1LTXR 2BC0A 3PUVF 4EZ4A 5JRCB 3CMMA 2C73A 2LSYA 4HFHA 2RGHA 2YR6A 2CHNA 1V59A 3TLUA 3UKAA 2EHOC 2HH7A 4J2WA 3PUQA 1X79A 4EEDA 3KLJA 3UP4A 4OYJA 3T0KA 4I4TE 4YJ3E 2XLTA 4AQGA 4K2XA 3AEEA 1OJDA 5FL1A 1DJQA 5C8YE 4UF0A 4U2YA 1NHSA 4II3A 4B66A 2LM9A 2HPJA 3LOVA 5AQTB 3CGEA 4OFZA 3M65A 2BBJA 4YHJA 1XDOA 2EQ7A 3KV5A 3SZFA 1AL24 4H9PC 4I55E 3UU4A 4YTNA 3ANWA 4GB34 4M1PA 5LGUB 3OVUA 4ZI2D 1EV14 3SWHA 4ISTA 3G06A 4IDZA 3NWIA 2I0ZA 3GQHA 3ZCIA 2UUBT 2O9ZA 1NHRA 3C98B 1NEKA 3AE2A 3N9LA 3RC3A 4DIDB 4J56A 5ABGA 3P9UA 4DR2T 3R6NA 3EUHA 3N9NA 5EK2A 1Y56A 2AXDS 2BK5A 4AQFC 4H2QA 4CQIA 4G2AA 4FDCB 2AE9A 3M12A 4AOXA 4P0BA 1IUTA 3ZT6A 1J1JA 3LBXA 2MPKA 3PUYF 4OPLA 4IDPA 4U8PA 3SRZA 3N9QA 1KDGA 4GIWA 3OZ2A 4KP3C 2UZZA 1M7KA 2WPFA 2C3DA 2RMU4 1HRI4 3NYEA 2YDRA 2GVCA 2X9WA 5FMHA 1WCRA 2XQYA 4C77A 3T31A 3ZT7A 5H6QB 1L0VA 2V60A 2V7MA 4BK2A 1S94A 4CCRA 1EAH4 4OPUA 1GESA 5LGNB 3CGCA 2J1DG 2CVJA 1GSNA 4H63V 3CPIG 4JEHB 5FXXA 3C4XA 2H7OA 2BRYA 1IUUA 2QVAA 5FVKA 5LJNA 4UR9A 3QVPA 3SOLA 2XFPA 5HXRA 4ASKA 2A2FX 3TLWA 4X1KE 3O9XA 3ZLIA 3RKOA 1LPFA 3AE6A 3FBSA 5J1GA 4ZXLA 4LFCT 3IA3A 4NPPA 3O0HA 2JKCA 5HAXA 3PUGA 1GQEA 5LMUT 5AQVB 3II4A 3AE1A 2QYWA 2XVJA 4XWRA 1XPQA 1DOCA 2E9XC 4JEUB 4UP3A 2W0HA 1EL8A 4WZXA 1PO14 4H7UA 1VRH4 1Q1RA 4AT2A 3UT5E 1YXRA 1N1PA 3RKGA 2A3DA 2YKSA 2BK3A 3SZWA 2VWAA 1D1CA 2XQ8A 3FZHB 4UF0B 3PUSA 5L46A 4NNJA 4CN1A 3QFAA 4DGKA 3JC6C 3NVOA 1L9DA 2PTFA 3PDYA 2XASB 4A79A 2D0UA 4NZHA 1VG9A 3MA9A 4O4HE 2WB5A 3CPHG 3GYXA 1EBDA 2XVIA 1JRYA 3ANWB 5HXCA 1GRAA 2JQ9A 2ZZBA 3RIFA 2WP6A 4Z25A 1PBBA 2WWUA 1B8SA 1REOA 3ZMTB 4EV6A 2OAMA 3P4RA 1Z6LA 4DV5T 2LFCA 3VKHA 2XCGA 3P1WA 3ONLC 1FECA 5EOWA 5C2TA 4JI4T 1BR4A 3KDSE 2C5KT 5KMQA 1L9CA 1FOHA 2WOIA 5LHIB 1PBCA 1D5TA 2UU9T 3Q2MA 1COYA 2WDQA 2WU2A 4YSZA 4NTEA 3SQPA 3PV0F 4DBRA 3AA1B 4ADWA 2YOEA 1XANA 4U2LA 2XLSA 5LMNT 3BNUA 2IVDA 5L2LA 4TM0A 5ETWA 1RUJ4 3Q9TA 2BCPA 5JDNA 3E22E 2PW9A 2RS54 3UKHA 4B64A 3GN5A 1UCUA 5HY5A 3ATRA 2IIUA 3UKPA 1POV0 2R45A 4EQRA 1VRQB 3CN8A 4I58A 4JY2A 3S5WA 1JRZA 2BRAA 5HEGA 2NPXA 4ILUA 3AXBA 4FJOA 1IBMT 3JAFA 4HTEA 4IA6A 5LV9A 5DQWA 1SUMB 3RP7A 1B37A 2XUEA 4HEAA 4DV7T 1ZV4X 4Z2RA 2VASA 2RGJA 2WS3A 4HA6A 1BR2A 3RP6A 5AQGB 3NRXA 4ZZBA 2HQMA 3N9MA 2XZEA 1Y0PA 2B1EA 3UTFA 3O1JA 4B3ST 3ABVA 4EYUA 1F8SA 3NG7X 5JCNA 2MAWA 3DJBA 2BG9A 2XM2A 1N36T 1GRFA 3ZSTA 2ZZCA 4X1YE 1XHCA 4X9MA 4PK4A 1V9DA 3ISHA 4YFSA 5FY7A 1CL0A 2IAKA 1VG0A 4JDRA 3CGBA 4H4VA 4YJ2E 1YKJA 1NA1D 1OJCA 4MBQA 3QOFA 2JBVA 1XNRT 4NEWA 3H3AA 4UDQA 3TLSA 3VR8A 2BXSA 2W67A 5ADXL 3ZCJA 4XBFB 5AQIB 4LU6A 3BK9A 2M6BA 2QGSA 3P4QA 2WP5A 2N9DA 4X66T 3NZQA 4AP1A 2VRMA 2V7KA 4G73A 1BEV4 1R8IA 2V5DA 2TMDA 2YDQA 3NYCA 4A65A 2W2UA 1ZOYA 4CN6A 5AQLB 1RVF4 2LSJA 4OPGA 4AT0A 5LBMA 1BKWA 3RYIE 3NRNA 1MXTA 1CHUA 3NLCA 5LXTE 3LK2B 4JI3T 2CM0A 2LEHA 1D1BA 3LJPA 1SA0E 4J31A 4DUYT 4XWZA 2PY5A 3I3LA 2M6IA 1XMOT 5AFUL 4H9RC 3BQLA 3AA6B 1HR0T 1NDAA 1GEUA 3LZWA 3JCFA 3K7MX 3GYJA 4C3XA 2WWVA 3K7QX 2X8CA 4DR1T 4ZCDA 1WRDA 3UQ4A 5BMVE 3JD74 2X0LB 3FI7A 3AEAA 5EK4A 3PJAA 4HFIA 5E0OA 1GNDA 2JQHA 4HWDA 4ZN0A 4JNAA 5KDMC 2BKNA 5HEUA 5C3JA 3FZMB 4ILCA 4MALA 5BUKA 4EAHA 4GOUA
chains in the Genus database with same CATH topology
3M13A 1DNCA 5KVIA 1M6IA 1OJAA 1B4VA 4AP3A 5JCLA 3SZ0A 1D4EA 1DJNA 4CBQA 5KMRA 2YAUA 4X4JA 2JK6A 2FJEA 1K0JA 2XVFA 1QJDA 1JOAA 2AQJA 2VOUA 5U63A 3GQKA 2X3NA 1BGJA 3FPZA 1KSSA 1D7YA 3GWFA 3AD9B 4GDEA 2B76A 2V6OA 4OPCA 5EB4A 2Q0KA 5IQ1A 4G6HA 2V61A 3V76A 2APGA 1CJ4A 1ZK7A 1IJHA 3WE0A 3SY4A 2EQ9A 4YSHA 4J36A 2YR5A 3G5QA 2C76A 3IC9A 4YT0A 1FEAA 3ICRA 3CNSA 3QVRA 3RHAA 4CRTA 1PXAA 2OLOA 1D4DA 4D03A 1N4VA 4OCGA 4DNAA 2YLRA 1LTXR 1H83A 2BC0A 2C65A 3CMMA 4EMJA 1BF3A 2C73A 1XDIA 2RGHA 1D7LA 2A8XA 2YR6A 1V59A 4B67A 4RSLA 3UKAA 1ELIA 4A99A 1ZKQA 3C96A 3KKJA 2B9XA 4J2WA 3C4NA 3K30A 2WHDA 4E0VA 1JNZA 2AR8A 3L1RA 3AD8B 3KLJA 1CBOA 3CPJG 1K0IA 3UP4A 3T0KA 2WP9A 1O5WA 3AE9A 2XLTA 4RG3A 4K2XA 3AEEA 2YG4A 4U8NA 1OJDA 2GR1A 4U8OA 1DJQA 4YXDA 3D8XA 1GT8A 1O95A 1GPEA 1NHSA 4O5QA 3UKQA 1CC2A 1PJ5A 4II3A 4ICYA 1TDOA 3BHFA 4ZCCA 2GV8A 2XDOA 4B66A 1H84A 3EANA 3LOVA 4H4PA 3HYWA 2VVMA 3CGEA 2WEUA 2GMJA 2GB0A 4EIPA 2WOWA 2BC1A 1K0LA 2EQ7A 3CGDA 1BGNA 4TM3A 3SZFA 1FEBA 4M52A 1KF6A 4YTNA 3LB8A 1LVLA 2E1MA 2V3BA 2Q7VA 4Z26A 2TPRA 4Y4LA 1KNRA 2FBWA 2QAEA 3GWDA 3VRDB 2I0ZA 3GQHA 2O9ZA 4TM4A 1NHRA 4B65A 4K5SA 1NEKA 3AE2A 2OALA 3P4SA 4G9KA 1F8RA 2C4CA 4J56A 4YWOA 3P9UA 2BABA 3QJ4A 3URHA 3BNMA 1GERA 4GAVA 3DJGX 4H4RA 4U2TA 2JB1A 2AAQA 3ICTA 4EQWA 4GRTA 1Y56A 4LIIA 2BK5A 1P2HA 2YLZA 4NTDA 5GSNA 4H2QA 4FDCB 2BA9A 4X9NA 3M12A 4AOXA 2WBAA 2YVGA 1IUTA 3UOVA 4GAPA 2V3AA 4UDPA 4OPLA 4A6NB 4U8PA 3EAOA 1KDGA 2IIDA 3I6DA 4OPTA 3UTHA 3OZ2A 3QFBA 4YKGA 2XLRA 2VZ2A 1FCDA 1SEZA 4ECHA 3P4PA 2GAGB 2UZZA 4JQ9A 4BK1A 2WPFA 2C3DA 3B6DA 3LADA 4C5OA 5U1OA 3SFDA 4Y4MA 2EQ8A 3NYEA 2B7SA 2GVCA 1DODA 3QSEA 5FMHA 2X8GA 4C77A 3NYFA 2WU5A 4YKFA 3T31A 1L0VA 2V60A 3V3NA 3C4AA 1TRBA 4BK2A 1YQZA 1X31B 4K8DA 5JCKA 4YTMA 1GXFA 1NG4A 4CCRA 4OPUA 3HZLA 3T2KA 1GESA 1NAAA 2XVEA 1NPXA 1E1KA 3CGCA 3KA7A 4GDPA 2CVJA 1GSNA 3AWIA 3GDNA 1YQ3A 1P2EA 2JAEA 1S2YA 3CPIG 4BURA 4DSGA 1H7WA 4FK1A 2JB2A 1H81A 2WPCA 5BRTA 5BVAA 1JEHA 4FK1C 2C67A 2BRYA 1IUUA 1CJCA 3SZCA 4Z44A 1LQTA 3GSIA 4EM4A 3VQRA 3QVPA 1NENA 5FS8A 5EB5A 2BK4A 2XFPA 4K22A 1IUSA 2DKIA 2XFUA 2C66A 1PN0A 2GQFA 4EM3A 2JB3A 1DOBA 1ZP0A 1KNPA 2Y6QA 1Q1WA 1LPFA 3AE6A 1LJ1A 3IF9A 1ZMDA 3FBSA 3G5SA 4GR1A 2GR3A 2CDUA 2RGOA 2YLXA 3T37A 4K5RA 2B9WA 2XFQA 1TDKA 3O0HA 3GDPA 3T2YA 2JKCA 1EL7A 3NK2X 2QA1A 4CNKA 1CJ3A 3II4A 3VRBA 3AE1A 1IUXA 3ITJA 4J34A 3SM8A 2DKHA 4H4YA 3DGHA 4U8JA 3AEDA 2WETA 2XVJA 2C72A 2Q6UA 1M64A 4XWRA 1XPQA 1DOCA 1E1MA 1K4QA 3KPFA 3AD7B 3NTDA 4UP3A 2R0GA 2YLWA 1PS9A 3GYIA 4H4UA 1H6VA 2W0HA 4U8LA 1EL8A 3UKLA 2CFYA 2VQ7A 3PS9A 2BS3A 1H86A 4GCMA 4H7UA 5J7XA 3ATQA 1Q1RA 1KFYA 1F6MA 1S3BA 4AT2A 5KMSA 1N1PA 3NTAA 4OPDA 1PHHA 1ZY8A 2YM2A 2GQWA 1PBFA 2WPEA 5KOXA 2BCGG 2BK3A 3SZWA 1OJTA 2WESA 3T14A 1CF3A 5KRQA 2BS4A 5L46A 2ZBWA 2V5ZA 4EQXA 4NNJA 2WDRA 3GD3A 3QFAA 2GRTA 2C70A 1GRHA 3GRSA 2XFNA 1DOEA 4DGKA 1RP0A 1L9DA 4YSYA 5IQ4A 5ER0A 3REDA 2PYXA 1PJ6A 4A79A 4IVMB 4K7ZA 2Y6RA 2QA2A 2GMHA 4NZHA 1BZLA 3G5RA 3NIXA 4A7AA 1VG9A 2XVHA 5HHFA 3VR9A 1MO9A 3AE4A 3CPHG 1EL9A 2J3NA 3H8LA 1EBDA 3GYXA 4HB9A 3HYXA 3NN0X 2XVIA 1IUVA 1JRYA 5IPYA 2YVFA 3AEBA 1F3PA 3UOZA 1GRAA 2ZZBA 2WP6A 2QCUA 2YG6A 4Z25A 1PBBA 3PVCA 4B69A 1PJ7A 4H2RA 1KSUA 3HYVA 1B8SA 1BWCA 4I59A 1E6EA 3DMEA 5EBKA 3CNJA 2FJAA 1REOA 2NVKX 4KPRA 4U8KA 5CQFA 1JU2A 3QSMA 3DGZA 1PDHA 2OAMA 4EIQA 5U25A 3P4RA 3UKKA 3F8PA 3NK1X 1YY5A 3NNEA 1Z6LA 3AE5A 4U8IA 2LFCA 1D4CA 4GUVA 3IWAA 5HYMA 2XCGA 4CNJA 1E7PA 3P1WA 3ALMA 3DJEA 3GD4A 4Y4NA 3CNTA 1S2QA 1FECA 3ICSA 5C2TA 3ALLA 3LXDA 2YWLA 4H4TA 4WX1A 5EOWA 3VRAA 1F8WA 4OPIA 1O94A 4UDRA 5KMQA 2X8HA 3IHGA 3DJDA 3UOYA 2B9YA 3ZDNA 3M0OA 4BV6A 1L9CA 1FOHA 4BJYA 1GTEA 2WOIA 3NN6X 4H4ZA 2B7RA 1GRTA 1PBCA 4C74A 2WDVA 1D5TA 1TDEA 2CULA 4H2NA 1YQ4A 3SUCA 1COYA 2WDQA 5GRTA 4A9WA 2WU2A 4YSZA 3BHKA 4NTEA 3SQPA 4J57A 4Z24A 1B5QA 2XLPA 3RP8A 4A6NA 4ADWA 4U2SA 3AB1A 2R4JA 1XANA 2YLTA 4U2LA 2X50A 2XLSA 2XLUA 3BNUA 1E1LA 2YLSA 2IVDA 4TM0A 3SFEA 1LV0A 3ZYXA 2RABA 2C64A 1PXCA 4TM1A 5KXJA 4PABA 2YQUA 1GREA 3Q9TA 2ARDA 3AYJA 4MJWA 2BCPA 3F8DA 3AE3A 2C75A 1JRXA 3LZXA 3FG2P 3UKHA 1L9EA 4B64A 2GAHB 3SXIA 4II2A 3ATRA 2GR0A 4OVIA 5HY5A 4JN9A 1TYPA 2R0PA 3UKPA 4JNQA 3DK4A 4YSXA 4XXGA 3UKFA 4IVOB 2R45A 4A5LA 1DXLA 4EQRA 2FJDA 1N4WA 1VRQB 3CN8A 4I58A 4JY2A 4N9XA 1JRZA 3S5WA 2BRAA 2X99A 3NH3X 2NPXA 1GV4A 2GH5A 1GRGA 3UTEA 3AXBA 5M10A 4D04A 4B68A 2F5ZA 4G74A 4IA6A 3GMBA 5LV9A 3CTYA 4AOSA 2A87A 5KMPA 3CNPA 4DSHA 3RP7A 1B37A 4CY8A 5FS9A 2IVEA 2R9ZA 3H8IA 3NGCX 3Q6JA 4Z2RA 3BI5A 2RGJA 4TLZA 2WS3A 2YG5A 4HA6A 2PHHA 3RP6A 1EL5A 3E1TA 2Q0LA 3GMCA 3AYLA 1ONFA 4NWZA 5FS6A 4IV9A 5M0ZA 5BULA 2HQMA 3EF6A 3IHMA 3L8KA 3NHOX 4Z2TA 3KVEA 1Y0PA 3UTFA 4CCQA 1PBEA 1JNRA 4YTPA 4BJZA 3ABVA 4H2PA 1F8SA 1CJ2A 3NG7X 5JCNA 1Q9IA 3UP5A 1GRFA 2OA1A 2ZZCA 1H7XA 4TLXA 1XHCA 4X9MA 3ISHA 3KU9A 5DBJA 1CL0A 1VG0A 4USQA 4JDRA 4CY6A 3CGBA 4FX9A 4H4VA 1YKJA 2E4GA 5FS7A 1OJCA 3DK8A 2BYBA 4REKA 2XFOA 2VVLA 4APNA 4NEVA 3BI4A 2JBVA 1QO8A 3AEFA 2VVLG 2YG7A 4LA1A 4NEWA 3S61A 2WQYA 4UDQA 4USRA 1UKVG 5J60A 5KOWA 2R4EA 3VR8A 1NG3A 2BXSA 3AYIA 5KVHA 5JCMA 3AE7A 1S3EA 2C3CA 4H4XA 4LU6A 3UTGA 3H4KA 3V3OA 1GOSA 5KNLA 2ZZ0A 3P4QA 2WP5A 1HYUA 4AP1A 1LQUA 2VRMA 3DA1A 3ADAB 3DH9A 4G73A 3UOXA 2GR2A 1TYTA 4H4SA 1CC4A 1TDFA 2YG3A 2VQBA 3CIRA 4O5UA 2XYOA 3KPKA 2H88A 1GETA 2A89A 3D1CA 4H4WA 1AOGA 1PXBA 2C7GA 4H4QA 5JCIA 3SGLA 4U8MA 3AECA 4GF7A 4H50A 3K7TA 4EMWA 3DJJA 2TMDA 2BS2A 2YR4A 3NYCA 3OC4A 2ACZA 4A65A 4IA5A 1ZOYA 1ZDLA 1QLBA 3GRTA 2YVJA 4PAAA 4EQSA 4OPGA 4B63A 1W4XA 1ZX9A 4AT0A 1BKWA 1GALA 1NHQA 3B3RA 3RNMA 3NRNA 3QSSA 4C3YA 1E39A 1Y56B 1IUWA 2H89A 1MXTA 1VQWA 1CHUA 3NLCA 1NHPA 4Z43A 3BI2A 2E5VA 4RG4A 1ZOVA 3LJPA 4JY3A 4J31A 4XWZA 4WCTA 3I3LA 1RYIA 3ALJA 3NKSA 5HXIA 3SYIA 2R0CA 3COXA 3UCLA 3CNDA 3AEGA 5TR3A 1NDAA 5CKUA 3AE8A 1GRBA 1GEUA 3LZWA 5KWFA 2Z5YA 3EPTA 4Z2UA 3NK0X 2OLNA 3K7MX 2GF3A 3GYJA 3R9UA 4C3XA 2FJBA 3FIMB 3F8RA 3K7QX 2X8CA 1GTHA 3JSKA 3NT6A 4P9SA 1PBDA 1VDCA 4ZCDA 2GEWA 3KD9A 3PO7A 2Z5XA 1E1NA 2EQ6A 1OJ9A 4J33A 1N4UA 2VRLA 4B1BA 4KX6A 1ZMCA 3AEAA 2R46A 4BK3A 1GNDA 1CC6A 3DK9A 4ZN0A 4JNAA 4NTCA 5C3JA 2YM1A 1RSGA 1H82A 1MOKA 3SX6A 2BXRA 3FMWA 5BUKA 2BACA 2WOVA 3T2ZA 4EMIA 4G6GA 1FL2A 1TDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M13 A;  1DNC A;  5KVI A;  1M6I A;  1OJA A;  1B4V A;  4AP3 A;  5JCL A;  1D4E A;  1DJN A;  4CBQ A;  2YAU A;  4X4J A;  2JK6 A;  2FJE A;  1K0J A;  2XVF A;  1QJD A;  1JOA A;  2AQJ A;  2VOU A;  5U63 A;  3GQK A;  2X3N A;  1BGJ A;  3FPZ A;  1KSS A;  1D7Y A;  3GWF A;  3AD9 B;  4GDE A;  2B76 A;  2V6O A;  4OPC A;  5EB4 A;  2Q0K A;  5IQ1 A;  2V61 A;  3V76 A;  2APG A;  1CJ4 A;  1ZK7 A;  1IJH A;  3WE0 A;  2EQ9 A;  4YSH A;  4J36 A;  2YR5 A;  3G5Q A;  2C76 A;  3IC9 A;  4YT0 A;  1FEA A;  3ICR A;  3CNS A;  3QVR A;  3RHA A;  4CRT A;  1PXA A;  2OLO A;  1D4D A;  4D03 A;  1N4V A;  4OCG A;  4DNA A;  2YLR A;  1LTX R;  1H83 A;  2BC0 A;  2C65 A;  4EMJ A;  1BF3 A;  2C73 A;  1XDI A;  2RGH A;  1D7L A;  2A8X A;  2YR6 A;  1V59 A;  4B67 A;  4RSL A;  3UKA A;  1ELI A;  4A99 A;  1ZKQ A;  3C96 A;  3KKJ A;  2B9X A;  4J2W A;  3C4N A;  3K30 A;  2WHD A;  4E0V A;  1JNZ A;  2AR8 A;  3L1R A;  3AD8 B;  3KLJ A;  1CBO A;  3CPJ G;  1K0I A;  3UP4 A;  2WP9 A;  1O5W A;  3AE9 A;  2XLT A;  4RG3 A;  4K2X A;  3AEE A;  2YG4 A;  4U8N A;  1OJD A;  2GR1 A;  4U8O A;  1DJQ A;  4YXD A;  3D8X A;  1GT8 A;  1O95 A;  1GPE A;  1NHS A;  4O5Q A;  3UKQ A;  1CC2 A;  1PJ5 A;  4B66 A;  4ICY A;  1TDO A;  3BHF A;  4ZCC A;  2GV8 A;  2XDO A;  1H84 A;  3EAN A;  3LOV A;  4H4P A;  2VVM A;  3CGE A;  2WEU A;  2GMJ A;  2GB0 A;  4EIP A;  2WOW A;  2BC1 A;  1K0L A;  2EQ7 A;  3CGD A;  1BGN A;  4TM3 A;  1FEB A;  4M52 A;  1KF6 A;  4YTN A;  3LB8 A;  1LVL A;  2E1M A;  2V3B A;  2Q7V A;  4Z26 A;  2TPR A;  4Y4L A;  1KNR A;  2FBW A;  2QAE A;  3GWD A;  3VRD B;  2I0Z A;  3GQH A;  2O9Z A;  4TM4 A;  1NHR A;  4B65 A;  4K5S A;  1NEK A;  3AE2 A;  2OAL A;  3P4S A;  4J56 A;  1F8R A;  4YWO A;  3P9U A;  2BAB A;  3QJ4 A;  3URH A;  3BNM A;  1GER A;  3DJG X;  4H4R A;  4U2T A;  2JB1 A;  2AAQ A;  3ICT A;  4EQW A;  4GRT A;  1Y56 A;  4LII A;  2BK5 A;  1P2H A;  2YLZ A;  4NTD A;  5GSN A;  4H2Q A;  4FDC B;  2BA9 A;  4X9N A;  3M12 A;  4AOX A;  2WBA A;  2YVG A;  1IUT A;  3UOV A;  2V3A A;  4UDP A;  4OPL A;  4A6N B;  4U8P A;  3EAO A;  1KDG A;  2IID A;  3I6D A;  4OPT A;  3UTH A;  3OZ2 A;  3QFB A;  4YKG A;  2XLR A;  2VZ2 A;  1FCD A;  1SEZ A;  4ECH A;  3P4P A;  2GAG B;  2UZZ A;  4JQ9 A;  4BK1 A;  2WPF A;  2C3D A;  3B6D A;  3LAD A;  4C5O A;  5U1O A;  3SFD A;  4Y4M A;  2EQ8 A;  3NYE A;  2B7S A;  2GVC A;  1DOD A;  3QSE A;  5FMH A;  2X8G A;  4C77 A;  3NYF A;  2WU5 A;  4YKF A;  1L0V A;  2V60 A;  3V3N A;  3C4A A;  1TRB A;  4BK2 A;  1YQZ A;  1X31 B;  4K8D A;  5JCK A;  4YTM A;  1GXF A;  1NG4 A;  4CCR A;  4OPU A;  3HZL A;  1GES A;  1NAA A;  2XVE A;  1NPX A;  1E1K A;  3CGC A;  3KA7 A;  4GDP A;  2CVJ A;  1GSN A;  3AWI A;  3GDN A;  1YQ3 A;  1P2E A;  2JAE A;  1S2Y A;  3CPI G;  4BUR A;  4DSG A;  1H7W A;  4FK1 A;  2JB2 A;  1H81 A;  2WPC A;  5BRT A;  5BVA A;  1JEH A;  4FK1 C;  2C67 A;  1IUU A;  1CJC A;  4Z44 A;  1LQT A;  3GSI A;  4EM4 A;  3VQR A;  3QVP A;  1NEN A;  5FS8 A;  5EB5 A;  2BK4 A;  2XFP A;  4K22 A;  1IUS A;  2DKI A;  2XFU A;  2C66 A;  1PN0 A;  2GQF A;  4EM3 A;  2JB3 A;  1DOB A;  1ZP0 A;  1KNP A;  2Y6Q A;  1Q1W A;  1LPF A;  3AE6 A;  1LJ1 A;  3IF9 A;  1ZMD A;  3FBS A;  3G5S A;  4GR1 A;  2GR3 A;  2CDU A;  2RGO A;  2YLX A;  3T37 A;  4K5R A;  2B9W A;  2XFQ A;  1TDK A;  3O0H A;  3GDP A;  2JKC A;  1EL7 A;  3NK2 X;  2QA1 A;  4CNK A;  1CJ3 A;  3II4 A;  3VRB A;  3AE1 A;  1IUX A;  3ITJ A;  4J34 A;  3SM8 A;  2DKH A;  4H4Y A;  3DGH A;  4U8J A;  3AED A;  2WET A;  2XVJ A;  2C72 A;  2Q6U A;  1M64 A;  4XWR A;  1XPQ A;  1DOC A;  1E1M A;  1K4Q A;  3KPF A;  3AD7 B;  3NTD A;  4UP3 A;  2R0G A;  2YLW A;  1PS9 A;  3GYI A;  4H4U A;  1H6V A;  2W0H A;  4U8L A;  1EL8 A;  3UKL A;  2CFY A;  2VQ7 A;  3PS9 A;  2BS3 A;  1H86 A;  4GCM A;  4H7U A;  5J7X A;  3ATQ A;  1Q1R A;  1KFY A;  1F6M A;  1S3B A;  4AT2 A;  1N1P A;  3NTA A;  4OPD A;  1PHH A;  1ZY8 A;  2YM2 A;  2GQW A;  1PBF A;  2WPE A;  5KOX A;  2BCG G;  2BK3 A;  1OJT A;  2WES A;  1CF3 A;  5KRQ A;  2BS4 A;  5L46 A;  2ZBW A;  2V5Z A;  4EQX A;  2WDR A;  3GD3 A;  3QFA A;  2GRT A;  2C70 A;  1GRH A;  3GRS A;  2XFN A;  1DOE A;  4DGK A;  1RP0 A;  1L9D A;  4YSY A;  5IQ4 A;  5ER0 A;  3RED A;  2PYX A;  1PJ6 A;  4A79 A;  4IVM B;  4K7Z A;  2Y6R A;  2QA2 A;  2GMH A;  4NZH A;  1BZL A;  3G5R A;  3NIX A;  4A7A A;  1VG9 A;  2XVH A;  5HHF A;  3VR9 A;  1MO9 A;  3AE4 A;  3CPH G;  1EL9 A;  2J3N A;  3H8L A;  1EBD A;  4HB9 A;  5M10 A;  3GYX A;  3NN0 X;  2XVI A;  1IUV A;  1JRY A;  5IPY A;  2YVF A;  3AEB A;  1F3P A;  3UOZ A;  1GRA A;  2ZZB A;  2WP6 A;  2QCU A;  2YG6 A;  4Z25 A;  1PBB A;  3PVC A;  4B69 A;  1PJ7 A;  4H2R A;  1KSU A;  1B8S A;  1BWC A;  4I59 A;  1E6E A;  3DME A;  5EBK A;  3CNJ A;  2FJA A;  1REO A;  2NVK X;  4KPR A;  4U8K A;  5CQF A;  1JU2 A;  3QSM A;  3DGZ A;  1PDH A;  2OAM A;  4EIQ A;  5U25 A;  3P4R A;  3UKK A;  3F8P A;  3NK1 X;  1YY5 A;  3NNE A;  1Z6L A;  3AE5 A;  4U8I A;  2LFC A;  1D4C A;  4GUV A;  3IWA A;  5HYM A;  2XCG A;  4CNJ A;  1E7P A;  3P1W A;  3ALM A;  3DJE A;  3GD4 A;  4Y4N A;  3CNT A;  1S2Q A;  1FEC A;  3ICS A;  5C2T A;  3ALL A;  3LXD A;  2YWL A;  4H4T A;  4WX1 A;  5EOW A;  3VRA A;  1F8W A;  4OPI A;  1O94 A;  4UDR A;  2X8H A;  3IHG A;  3DJD A;  3UOY A;  2B9Y A;  3ZDN A;  3M0O A;  4BV6 A;  1L9C A;  1FOH A;  4BJY A;  1GTE A;  2WOI A;  3NN6 X;  4H4Z A;  2B7R A;  1GRT A;  1PBC A;  4C74 A;  2WDV A;  1D5T A;  1TDE A;  2CUL A;  4H2N A;  1YQ4 A;  3SUC A;  1COY A;  2WDQ A;  5GRT A;  4A9W A;  2WU2 A;  4YSZ A;  3BHK A;  4NTE A;  3SQP A;  4J57 A;  4Z24 A;  1B5Q A;  2XLP A;  3RP8 A;  4A6N A;  4ADW A;  4U2S A;  3AB1 A;  2R4J A;  1XAN A;  2YLT A;  4U2L A;  2X50 A;  2XLS A;  2XLU A;  3BNU A;  1E1L A;  2YLS A;  2IVD A;  4TM0 A;  3SFE A;  1LV0 A;  3ZYX A;  2RAB A;  2C64 A;  1PXC A;  4TM1 A;  5KXJ A;  4PAB A;  2YQU A;  1GRE A;  3Q9T A;  2ARD A;  3AYJ A;  4MJW A;  2BCP A;  3F8D A;  3AE3 A;  2C75 A;  1JRX A;  3LZX A;  3FG2 P;  3UKH A;  1L9E A;  4B64 A;  2GAH B;  5HY5 A;  3ATR A;  2GR0 A;  4OVI A;  4JN9 A;  1TYP A;  2R0P A;  3UKP A;  4JNQ A;  3DK4 A;  4YSX A;  4XXG A;  3UKF A;  4IVO B;  2R45 A;  4A5L A;  1DXL A;  4EQR A;  2FJD A;  1N4W A;  1VRQ B;  3CN8 A;  4I58 A;  4JY2 A;  4N9X A;  1JRZ A;  3S5W A;  2X99 A;  3NH3 X;  2NPX A;  1GV4 A;  2GH5 A;  1GRG A;  3UTE A;  3AXB A;  4D04 A;  4B68 A;  2F5Z A;  4IA6 A;  3GMB A;  5LV9 A;  3CTY A;  4AOS A;  2A87 A;  3CNP A;  4DSH A;  3RP7 A;  1B37 A;  4CY8 A;  5FS9 A;  2IVE A;  2R9Z A;  3H8I A;  3NGC X;  3Q6J A;  4Z2R A;  3BI5 A;  2RGJ A;  4TLZ A;  2WS3 A;  2YG5 A;  4HA6 A;  2PHH A;  3RP6 A;  1EL5 A;  3E1T A;  2Q0L A;  3GMC A;  3AYL A;  1ONF A;  5FS6 A;  5M0Z A;  4IV9 A;  5BUL A;  2HQM A;  3EF6 A;  3IHM A;  3L8K A;  3NHO X;  4Z2T A;  3KVE A;  1Y0P A;  3UTF A;  4CCQ A;  1PBE A;  1JNR A;  4YTP A;  4BJZ A;  3ABV A;  4H2P A;  1F8S A;  1CJ2 A;  3NG7 X;  5JCN A;  1Q9I A;  3UP5 A;  1GRF A;  2OA1 A;  2ZZC A;  1H7X A;  4TLX A;  1XHC A;  4X9M A;  3ISH A;  3KU9 A;  5DBJ A;  1CL0 A;  1VG0 A;  4USQ A;  4JDR A;  4CY6 A;  3CGB A;  4FX9 A;  4H4V A;  1YKJ A;  2E4G A;  5FS7 A;  1OJC A;  3DK8 A;  2BYB A;  4REK A;  2XFO A;  2VVL A;  4APN A;  4NEV A;  3BI4 A;  2JBV A;  1QO8 A;  3AEF A;  2VVL G;  2YG7 A;  4LA1 A;  4NEW A;  3S61 A;  2WQY A;  4UDQ A;  4USR A;  1UKV G;  5J60 A;  5KOW A;  2R4E A;  3VR8 A;  1NG3 A;  2BXS A;  3AYI A;  5KVH A;  5JCM A;  3AE7 A;  1S3E A;  2C3C A;  4H4X A;  4LU6 A;  3UTG A;  3H4K A;  3V3O A;  1GOS A;  2ZZ0 A;  3P4Q A;  2WP5 A;  1HYU A;  4AP1 A;  1LQU A;  2VRM A;  3DA1 A;  3ADA B;  3DH9 A;  3UOX A;  2GR2 A;  1TYT A;  4H4S A;  1CC4 A;  1TDF A;  2YG3 A;  2VQB A;  3CIR A;  4O5U A;  2XYO A;  2H88 A;  1GET A;  2A89 A;  3D1C A;  4H4W A;  1AOG A;  1PXB A;  2C7G A;  4H4Q A;  5JCI A;  3SGL A;  4U8M A;  3AEC A;  4GF7 A;  4H50 A;  3K7T A;  4EMW A;  3DJJ A;  2TMD A;  2BS2 A;  2YR4 A;  3NYC A;  3OC4 A;  2ACZ A;  4A65 A;  4IA5 A;  1ZOY A;  1ZDL A;  1QLB A;  3GRT A;  2YVJ A;  4PAA A;  4EQS A;  4OPG A;  4B63 A;  1W4X A;  1ZX9 A;  4AT0 A;  1BKW A;  1GAL A;  1NHQ A;  3B3R A;  3RNM A;  3NRN A;  3QSS A;  4C3Y A;  1E39 A;  1Y56 B;  1IUW A;  2H89 A;  1MXT A;  1VQW A;  1CHU A;  3NLC A;  1NHP A;  4Z43 A;  3BI2 A;  2E5V A;  4RG4 A;  1ZOV A;  3LJP A;  4JY3 A;  4J31 A;  4XWZ A;  4WCT A;  3I3L A;  1RYI A;  3ALJ A;  3NKS A;  5HXI A;  2R0C A;  3COX A;  3UCL A;  3CND A;  3AEG A;  5TR3 A;  1NDA A;  5CKU A;  3AE8 A;  1GRB A;  1GEU A;  3LZW A;  5KWF A;  2Z5Y A;  3EPT A;  4Z2U A;  3NK0 X;  2OLN A;  3K7M X;  2GF3 A;  3GYJ A;  3R9U A;  4C3X A;  2FJB A;  3FIM B;  3F8R A;  3K7Q X;  2X8C A;  1GTH A;  3JSK A;  3NT6 A;  4P9S A;  1PBD A;  1VDC A;  4ZCD A;  2GEW A;  3KD9 A;  3PO7 A;  2Z5X A;  1E1N A;  2EQ6 A;  1OJ9 A;  4J33 A;  1N4U A;  2VRL A;  4B1B A;  4KX6 A;  1ZMC A;  3AEA A;  2R46 A;  4BK3 A;  1GND A;  1CC6 A;  3DK9 A;  4ZN0 A;  4JNA A;  4NTC A;  5C3J A;  2YM1 A;  1RSG A;  1H82 A;  1MOK A;  2BXR A;  3FMW A;  5BUK A;  2BAC A;  2WOV A;  4EMI A;  1FL2 A;  1TDN A; 
#chains in the Genus database with same CATH topology
 4ZZC A;  5KVI A;  1OJA A;  4AP3 A;  2RA1 A;  2H7V C;  5HEJ A;  3SZ0 A;  1D4E A;  2VUR A;  1YKE B;  2JK6 A;  2FJE A;  1I94 T;  4RHV 4;  2JIW A;  2AQJ A;  3GQK A;  2CWY A;  3LDQ B;  3AD9 B;  4COF A;  5EB4 A;  2Q0K A;  5KMG P;  3V76 A;  4X5T A;  1CJ4 A;  1ZK7 A;  2LJL A;  3SY4 A;  2DL1 A;  4YSH A;  2PG8 A;  2C76 A;  5KX5 E;  4IGU A;  3IC9 A;  2BKO A;  1FEA A;  1KNZ A;  4CRT A;  1N4V A;  4OCG A;  1BF3 A;  1XDI A;  1D7L A;  4IDQ A;  4X64 T;  2IC9 A;  2A9U A;  3KKJ A;  2BG9 B;  2X51 A;  4E0V A;  2AR8 A;  3AD8 B;  1ZKE A;  2XAJ B;  1D0Y A;  3FXE B;  3BQI A;  1R09 4;  2GK9 A;  4YXD A;  2R06 4;  5FYM A;  1GT8 A;  3V5S A;  4TWF A;  3UKQ A;  3ZN0 B;  1PJ5 A;  4ICY A;  2GV8 A;  3HYW A;  5L47 A;  3WAJ A;  5AQO B;  1RHI 4;  2WEU A;  3NRY A;  2GMJ A;  2LHN A;  2Y8D A;  2BC1 A;  3TKL B;  1BGN A;  1XZY A;  3N2K E;  4QWN B;  4WW0 A;  4TN7 B;  1IZN B;  1OED E;  3B13 A;  5CJ5 A;  3WI3 A;  4Z26 A;  2FBW A;  4ZS2 A;  3GWD A;  2X5I D;  3VRD B;  2XAQ B;  1FEW A;  3QC9 A;  3OJA A;  2OAL A;  2VL8 A;  4G9K A;  2C4C A;  3URH A;  2BAB A;  4CXY A;  3QJ4 A;  5AQH B;  3F57 A;  3N9P A;  3DJG X;  4O4I E;  1LRZ A;  2JB1 A;  5JDM A;  4LII A;  2E5L T;  1I6Z A;  5ABF A;  1RUD 4;  4UV9 B;  1RUE 4;  1XI1 A;  3ZC1 A;  2RPA A;  1WFD A;  4A6N B;  5DQV A;  3Q5X A;  2OA5 A;  3QFB A;  2VZ2 A;  3QB5 A;  3I9Y A;  2FUP A;  2GAG B;  1PO2 4;  5J2T E;  3B6D A;  3LAD A;  2IDO B;  2XQ9 A;  4LF6 T;  2EQ8 A;  5LBQ B;  1DOD A;  4H9Q C;  2VL0 A;  3NYF A;  3UFG A;  4EZH A;  4NUV A;  1IAP A;  1OED C;  2W4X A;  1HNX T;  2J4G A;  5LB7 B;  2D2S A;  5FXV A;  3ZJ2 A;  4HWH A;  5JCK A;  3RPU A;  4BA9 A;  4P1N A;  3J8F 4;  3T2K A;  1NAA A;  3KA7 A;  1YQ3 A;  1S2Y A;  2CXF A;  2V1D B;  2WPC A;  3CWZ B;  2C67 A;  4ZI2 C;  1LQT A;  2KIN B;  3GSI A;  3JAE A;  4EM4 A;  3QUJ A;  4OYK A;  3I0O A;  5FS8 A;  5EB5 A;  3D0T A;  4DV4 T;  2C66 A;  3KV6 A;  3EAB A;  3CK6 A;  1XMQ T;  5CB4 E;  1ZMD A;  1BR0 A;  3MKD A;  2GR3 A;  2RGO A;  3RC8 A;  4JI1 T;  3MZK B;  2B9W A;  1VRB A;  1TDK A;  2QA7 A;  2QA1 A;  1CJ3 A;  3VRB A;  1IUX A;  5EK3 A;  3B5M A;  1HG5 A;  5TAO A;  2E9X A;  2Q6U A;  3O4X E;  3KPF A;  3AD7 B;  3NTD A;  2R0G A;  2YLW A;  1PS9 A;  4H4U A;  1H6V A;  2JQK A;  3CVR A;  4U8L A;  3N2O A;  5J7X A;  3BQK A;  1N34 T;  2ZLY A;  2XSA A;  2Y6X A;  3MJX A;  2YM2 A;  4U2Z A;  3KV9 A;  4QX7 B;  2PJQ A;  2BS4 A;  3JAD A;  5HXH A;  2XM1 A;  1T98 A;  3C4Z A;  4EQX A;  4TV8 E;  2KLQ A;  2C70 A;  4UVA B;  1RP0 A;  4YSY A;  5IQ4 A;  5ER0 A;  2XAF B;  1D1A A;  4IVM B;  4K7Z A;  1US7 B;  1BZL A;  3NIX A;  2NTX A;  2JMH A;  3VR9 A;  1EL9 A;  2J3N A;  3H8L A;  5L3E B;  2MTQ A;  4X20 E;  3NN0 X;  3C50 A;  1N33 T;  4LFB T;  2YVF A;  1F3P A;  2YG6 A;  3RF1 A;  4ILA A;  2FJA A;  2NVK X;  5JR9 A;  1JU2 A;  3DGZ A;  4O8S A;  3UQ7 A;  2XY8 B;  1DU2 A;  1SE7 A;  4B3T T;  3KVB A;  3AE5 A;  4UVC B;  4TWH A;  5FY1 A;  5HYM A;  4CNJ A;  5L3D B;  4PW8 A;  5AQM B;  5JDH A;  2ZMA A;  1W9R A;  1S2Q A;  3GD4 A;  3ALL A;  4WX1 A;  4V1A v;  4EOZ B;  5JDL A;  4H4T A;  3FXD B;  3P50 A;  4IL9 A;  4OPI A;  2X8H A;  3IF8 B;  3M0O A;  5BR8 T;  2RS1 4;  3RQU A;  2ES0 A;  4BJY A;  2V26 A;  1GTE A;  2XTL A;  4H4Z A;  5LGT B;  1U5P A;  2W62 A;  2XQ3 A;  2WDV A;  4CN4 A;  4H2N A;  4UVB B;  3SUC A;  5LCY A;  4X62 T;  1VBD 4;  4J57 A;  1B5Q A;  2XLP A;  3RP8 A;  2HN2 A;  1X9B A;  2V7I A;  3CML A;  1D0Z A;  4O4L E;  3ESL A;  1E1L A;  4PJL A;  1LV0 A;  2RAB A;  1FMW A;  2WY2 A;  2Z6E A;  1PXC A;  5FNV E;  1E1H B;  1GRE A;  2NP9 A;  4HN9 A;  2C75 A;  1MMA A;  1U4Q A;  3RHW A;  1L9E A;  4ISS A;  3SXI A;  2GR0 A;  3UTK A;  1LVF A;  3Q9D A;  2WZI A;  1TYP A;  2R0P A;  4YSX A;  3O1H A;  4IVO B;  1O3X A;  4N9X A;  3FBL A;  5JVD E;  2X99 A;  1HX8 A;  2UUC T;  2PFV A;  4B68 A;  3CTY A;  3OKQ A;  4CY8 A;  2HWB 4;  2D9D A;  2WMN A;  3H8I A;  3NGC X;  4JBW F;  2D0T A;  3WAK A;  1AR8 4;  1EL5 A;  3C51 A;  1RUF 4;  2KZ7 B;  3DTO A;  1ONF A;  3GMC A;  5FS6 A;  4IV9 A;  5M0Z A;  4IT4 A;  3IHM A;  2Q9Q C;  4CCQ A;  4BJZ A;  3OYX A;  4H2P A;  5AQR B;  3ZN1 B;  2QRX A;  2CLY B;  2X9Y A;  5JDQ A;  3K8P C;  4WYV A;  4FX9 A;  3I0Q A;  3DK8 A;  2VVL A;  4QHO A;  2LSG A;  3AEF A;  2YG7 A;  2WQY A;  5L3F B;  2XQ5 A;  3HKB E;  1UKV G;  5KOW A;  3C4W A;  5KVH A;  5JCM A;  3AE7 A;  1S3E A;  2C3C A;  3V3O A;  1RUI 4;  2RM2 4;  4I50 E;  4BJN A;  1T8B A;  1LQU A;  1RUG 4;  3HKE E;  4YHH T;  3DH9 A;  3UOX A;  3CX8 B;  1CC4 A;  4ANJ A;  1TDF A;  4LMK A;  4PAG A;  2H88 A;  2A89 A;  4H4Q A;  4P0A A;  4U8M A;  3K7T A;  3DJJ A;  2YR4 A;  4HFE A;  1S35 A;  2UXX B;  4DR3 T;  1RUC 4;  2N2N A;  4LF7 T;  2YU1 A;  1ZDL A;  3GRT A;  2BVL A;  1NWM X;  4GYS A;  4EQS A;  2RR1 4;  4B63 A;  5JR9 B;  1ZX9 A;  1MIW A;  1CUN A;  2IHR 1;  1NHQ A;  3QSS A;  3FB2 A;  4TZ4 C;  1E39 A;  1Y56 B;  1VQW A;  1HFA A;  5HCJ A;  2K3W A;  4RG4 A;  4EGW A;  3CX6 B;  2RP4 A;  3JBG 4;  3LBX B;  4JY3 A;  2LM2 A;  3RYC E;  4TNV A;  3SYI A;  3UCL A;  4MHC A;  3HI2 A;  1ASJ 4;  4Q4X 4;  5CKU A;  3PE0 A;  3NK0 X;  2OLN A;  3AVS A;  4QXH B;  3R9U A;  2FJB A;  2M67 A;  2YN6 A;  4HFV A;  3L39 A;  2D5U A;  2V7J A;  3NT6 A;  4P9S A;  5HYA A;  3L09 A;  1PBD A;  2GEW A;  2IUB A;  3KD9 A;  3UUM A;  2Z5X A;  1E1N A;  2I6H A;  2XHE B;  4BK3 A;  1OXZ A;  3QK6 A;  4U74 A;  4K0K T;  4H63 H;  4G63 A;  4CXW A;  4HGA A;  1RSG A;  2WMO A;  2LE8 A;  2X68 A;  3KFW X;  3FMW A;  1YW0 A;  3FZL B;  3KBU A;  2BKP A;  5L3G B;  4JI0 T;  1FL2 A;  1TDN A;  1VBC 4;  3CKD A;  1DNC A;  2L9Q A;  3SS1 A;  3F2E A;  2VVS A;  5LJM A;  1DJN A;  4P09 A;  4OX9 T;  1K0J A;  1IJ5 A;  2VOU A;  4C90 A;  1Z8U A;  2NTY A;  3RIA A;  1J5W A;  2X3N A;  5FP3 A;  3N2G E;  3RLF F;  4G6H A;  2V61 A;  1VBB 4;  1IJH A;  1AJ3 A;  3J7Y q;  2YR5 A;  3G5Q A;  5IWA T;  1W0B A;  2C0S A;  3QVR A;  1PXA A;  2HHH T;  3AXJ A;  2YLR A;  4H9N C;  2C65 A;  3FZF B;  2A8X A;  4HFB A;  4A99 A;  1ELI A;  1ZKQ A;  3C96 A;  2CA5 A;  3ZMU B;  3LFM A;  3C4N A;  3P8C D;  1CBO A;  4WBN E;  5JH7 E;  1O5W A;  4U8O A;  1O95 A;  1GPE A;  4OHF A;  1TDO A;  3BHF A;  4ZCC A;  1H84 A;  3EAN A;  1K5M D;  4H4P A;  1WYC A;  4TWD A;  2V6Y A;  3MXZ A;  4OK0 A;  1AR9 4;  2P9B A;  4I0U A;  1K0L A;  2ZM2 A;  3RYF E;  3CGD A;  2JRK A;  4TM3 A;  1VBE 4;  1FEB A;  4M52 A;  4X1I E;  1KF6 A;  3LB8 A;  2NOX A;  4U72 A;  1HNW T;  1LVL A;  4ZI3 C;  3X1D A;  4DUZ T;  2TPR A;  1NAF A;  5AQQ B;  4B65 A;  2KMF A;  4K5S A;  3P4S A;  2VQF T;  3PTR B;  4UEL A;  3ZYL A;  4GAV A;  2XJ7 A;  4CI2 B;  4H4R A;  4U2T A;  2K5B B;  2AAQ A;  3ICT A;  3QB5 K;  4EQW A;  2LHR A;  5IHY A;  4GRT A;  1G8X A;  4NTD A;  5GSN A;  2NR4 A;  3AA7 B;  3IBP A;  3OBV E;  2WBA A;  3H3M A;  2N1G A;  1WR0 A;  3ZMV B;  4GK0 E;  3EAO A;  2IC6 A;  3K3O A;  3I6D A;  2VKD A;  5F3J A;  4KHP T;  1FCD A;  1SEZ A;  4IRE A;  3UUN A;  4ECH A;  4BK1 A;  3EAM A;  2WM9 A;  2V5C A;  4HWF A;  3K3N A;  2CWO A;  3LK3 B;  2X8G A;  4U31 A;  3RQW A;  2WU5 A;  4GYR A;  4LF9 T;  2XQ4 A;  4O2B E;  4L9I A;  3C4A A;  2PZS A;  3GN5 B;  1NG4 A;  1HTJ F;  3T8O A;  5LP6 E;  2J47 A;  4LF4 T;  4GDP A;  3GDN A;  2JAE A;  1P2E A;  4BUR A;  4PFP A;  1H7W A;  3PJA J;  2JB2 A;  5BRT A;  4FK1 C;  2R07 4;  3CQC B;  1CJC A;  1MMD A;  3SZC A;  3VQR A;  2BK4 A;  1UGO A;  4K22 A;  1IBL T;  2XFU A;  2RS3 4;  2W66 A;  3RIU A;  3NZP A;  1PN0 A;  2GQF A;  2JB3 A;  2G0U A;  2W00 A;  2XAG B;  2Y6Q A;  1MMN A;  3IF9 A;  3G5S A;  4GR1 A;  2YLX A;  2CDU A;  4K5R A;  3ONJ A;  5J2U E;  2XFQ A;  4PK6 A;  3T2Y A;  2EHO A;  4CNK A;  4J34 A;  3SM8 A;  3FBZ A;  4H4Y A;  3AB3 B;  3DGH A;  3AED A;  3ETV A;  4U8J A;  5JRC A;  1M64 A;  2V8S V;  1K4Q A;  4UXN B;  3GYI A;  3UKL A;  5M4Y A;  3ZPO A;  2DWK A;  2CFY A;  2X9X A;  2BS3 A;  1H86 A;  4NIQ A;  2VQ7 A;  2OLT A;  3ATQ A;  1EZ3 A;  2IML A;  1ZEE A;  4GCM A;  1KFY A;  1F6M A;  1S3B A;  5KMS A;  4YLH A;  2J62 A;  3NTA A;  5CA1 E;  2CRB A;  4OPD A;  2ZM8 A;  2X9H A;  2GQW A;  2WPE A;  1CF3 A;  4U7I A;  2UXD T;  2PYJ A;  5KRQ A;  1MIV A;  2WBL A;  2CXD A;  2ZBW A;  4IHJ E;  2V5Z A;  5FL0 A;  3ZMS B;  2W61 A;  2XPK A;  3CQX C;  4Q25 A;  3GD3 A;  1QUU A;  2GRT A;  3Q5W A;  1XNQ T;  1GRH A;  5JRE A;  1DOE A;  3UUL A;  3RED A;  2V6Y B;  5FMN A;  2GMH A;  5DJQ C;  3ONX A;  2IW5 B;  2XVH A;  1PIV 4;  5M10 A;  3AE4 A;  2CXL A;  4QH5 A;  1IUV A;  1B7T A;  3AEB A;  5L4E A;  2W63 A;  2LLY A;  2HN1 A;  1HCI A;  2QCU A;  1PJ7 A;  1KSU A;  4EIW A;  5J0Z A;  3HYV A;  4JI6 T;  3UU8 A;  3CNJ A;  3DME A;  4KPR A;  5HEH A;  4U8K A;  5CQF A;  3QSM A;  2X66 A;  4EIQ A;  3F8P A;  3NK1 X;  4AQF A;  3A5X A;  3NNE A;  3RI5 A;  3UUB A;  5LHG B;  4U8I A;  4GUV A;  1AR6 4;  2CPT A;  2JJ9 A;  4F6R C;  1E7P A;  3DJE A;  4DBQ A;  2YWL A;  3VRA A;  1F8W A;  4BJM A;  1O94 A;  4UDR A;  3P4W A;  3UOY A;  3ZDN A;  5LOV E;  2LSI A;  3H37 A;  4BV6 A;  2BVM A;  3PUA A;  3RYH E;  2XQA A;  4IDN A;  3NN6 X;  2B7R A;  3UU6 A;  1YQ4 A;  3O1I A;  5H6R B;  5GRT A;  4A9W A;  2HWC 4;  3BHK A;  4Z24 A;  3HR0 A;  4NXN T;  4U2S A;  3AB1 A;  2XQ6 A;  2X50 A;  2XLU A;  4EXT A;  3UU3 A;  2NW9 A;  3IHR A;  4WBO A;  5KXJ A;  4PAB A;  2YQU A;  4MJW A;  4Z8X A;  3HA4 A;  3F8D A;  1H8T D;  3AE3 A;  2XAH B;  4AIS A;  2GAH B;  3ETU A;  3PU8 A;  4JN9 A;  3ZT5 A;  4JNQ A;  4AKG A;  2UUA T;  3UKF A;  4DR6 T;  2NWB A;  4A5L A;  1DXL A;  2FJD A;  3UFE A;  1N4W A;  4PJM A;  2MYS A;  4A97 A;  2GH5 A;  5EZY E;  1GRG A;  3UTE A;  3FZK B;  4D04 A;  2F5Z A;  4G74 A;  3OPC A;  3GMB A;  4GKK T;  4AOS A;  2HPL A;  5KMP A;  3CNP A;  4DSH A;  4CI1 B;  5FS9 A;  2LT3 A;  3UUX B;  3CQG B;  3BI5 A;  3F31 A;  2YG5 A;  1HS7 A;  4B3M T;  2PHH A;  3E1T A;  3N9O A;  2Q0L A;  2Q9Q A;  4JUY A;  2EHO B;  5JQG E;  3NHO X;  4Z2T A;  3L8K A;  3KVE A;  1PBE A;  1JNR A;  4ERR A;  4HKA A;  1CJ2 A;  1XDP A;  4JI5 T;  3UP5 A;  2OA1 A;  5FXW A;  4U3C A;  4USQ A;  4CY6 A;  3CPZ A;  2E4G A;  2XQ7 A;  3FHN A;  4REK A;  4FI5 A;  2XFO A;  4APN A;  3AAI A;  4NEV A;  3BI4 A;  1QO8 A;  4IE5 A;  1D0X A;  4USR A;  5J60 A;  2R4E A;  2ODU A;  4PNI A;  3ZKR A;  1E2A A;  3H4K A;  5KNL A;  2ZZ0 A;  1HYU A;  3M3Z B;  1TYT A;  4H4S A;  4LMJ A;  3CIR A;  4O5U A;  1AOG A;  1GET A;  3Q5D A;  1PXB A;  2C7G A;  1COV 4;  1J5E T;  4X65 T;  1N32 T;  4H50 A;  3S4U A;  4EMW A;  5L3B B;  2ACZ A;  3U3I A;  3TLV A;  4UEM A;  4ZHQ E;  2YVJ A;  5CA0 E;  3B3R A;  3GMI A;  3RNM A;  1RMU 4;  1OWA A;  4Z43 A;  5ABF B;  1ZOV A;  3KV4 A;  3VKG A;  2CMR A;  4DV3 T;  1YKH B;  4WCT A;  4UIG A;  1RYI A;  3ALJ A;  5LNK A;  3NKS A;  3PUZ F;  2R0C A;  3CND A;  3AEG A;  5TR3 A;  3AE8 A;  1GRB A;  5AQP B;  5KWF A;  4AXP A;  2EHO D;  4CXX A;  2C5I T;  1IJ6 A;  4HFC A;  3JSK A;  1VDC A;  4PDW D;  2EQ6 A;  2PLV 4;  4J33 A;  3ZC0 A;  4B1B A;  2CCQ A;  2K24 A;  2K9A A;  1CC6 A;  3R84 B;  4DV2 T;  4NTC A;  4IE7 A;  4IDO A;  1T72 A;  1H82 A;  4PJJ A;  2BXR A;  4AKI A;  2BAC A;  4LF5 T;  2PYL A;  4Q4W 4;  3T2Z A;  4EMI A;  4G6G A;  1HXS 4;  4AKL A;  4O2A E;  3J9X 1;  4NXM T;  1UUR A;  3OYZ A;  2ODV A;  5AQS B;  2YIN A;  4CBQ A;  5KMR A;  2WAU A;  1MNE A;  4X4J A;  1VCT A;  1FMV A;  1JOA A;  1WR6 A;  5FVL A;  1XHX A;  3AVR A;  4AKH A;  1BGJ A;  1SHZ C;  3FPZ A;  1D7Y A;  4XZC A;  4OPC A;  4IE0 A;  4ZOL E;  2APG A;  5FKY A;  2KSR A;  1WLX A;  4ADZ A;  1IBK T;  2EQ9 A;  2UXC T;  3ZEF B;  2X0Y A;  3CNS A;  2BBH A;  2ZM6 T;  4K0U A;  4PJN A;  4D03 A;  4DNA A;  2E9X B;  1H83 A;  4EMJ A;  5A1L A;  2Q9Q B;  1QSD A;  4Z91 A;  2CBJ A;  2UXB T;  2V7L A;  4B67 A;  4RSL A;  1UX5 A;  2B9X A;  5JDG A;  3K30 A;  2WHD A;  1JNZ A;  3L1R A;  3CPJ G;  1K0I A;  2WP9 A;  3VU7 H;  1R08 4;  2CLY C;  2LOP A;  3AE9 A;  4RG3 A;  2YG4 A;  4U8N A;  2GR1 A;  5HWX A;  3D8X A;  4IL4 A;  4O5Q A;  1MQT D;  1CC2 A;  5F8P A;  3GA8 A;  2XDO A;  1YD8 G;  2CBI A;  3Q5E A;  4J2C A;  2VVM A;  2WSS V;  2KXP B;  4E7S A;  1FIO A;  3UU5 A;  4DV1 T;  2GB0 A;  4EIP A;  5LYJ E;  2WOW A;  3DP7 A;  5JDF A;  2C5J A;  3AAA B;  3W15 B;  2CEA A;  3C64 A;  2E1M A;  4DMV A;  2V3B A;  4O4J E;  2Q7V A;  4Y4L A;  1KNR A;  3AA0 B;  2QAE A;  4WNK A;  2F4V T;  4TM4 A;  1AR7 4;  1T7S A;  3ZJ1 A;  1HRV 4;  2X67 A;  1F8R A;  4YWO A;  3BNM A;  1GER A;  4U7Y A;  5JR9 C;  4JI7 T;  4LML A;  4DND A;  2CHO A;  2DHR A;  1P2H A;  2YLZ A;  4JV5 T;  4XAX B;  2BA9 A;  4X9N A;  2YVG A;  3UOV A;  3LJC A;  4GAP A;  2V3A A;  4UDP A;  1Z0P A;  5LG3 A;  4DR5 T;  3AAE B;  2IID A;  2LSK A;  3ZSS A;  4OPT A;  3UTH A;  4YKG A;  1PVC 4;  2XLR A;  2E9X D;  3P4P A;  4E7Z A;  5AQJ B;  4JQ9 A;  2Q9Q D;  4C5O A;  5U1O A;  3SFD A;  2ACX A;  4Y4M A;  2B7S A;  5IYZ E;  5IUX A;  3RX6 A;  3QSE A;  3V5U A;  4YKF A;  1FJG T;  2DLR A;  3V3N A;  2KT9 A;  2VKO A;  1TRB A;  1YQZ A;  1X31 B;  1H7C A;  4K8D A;  4YTM A;  1GXF A;  5FY0 A;  3HZL A;  2JPF A;  1NPX A;  1LKX A;  2XVE A;  2DWG A;  1HX1 B;  1E1K A;  3AWI A;  3JC6 D;  4DSG A;  1UX4 A;  4FK1 A;  3PUW F;  4AIU A;  1H81 A;  5BVA A;  1JEH A;  2PBI A;  5CFB A;  3LG7 A;  4Z44 A;  4KMC A;  4LF8 T;  3K1S A;  3RRW A;  1MIY A;  4H9S E;  4YY3 T;  1NEN A;  2VKJ A;  2H3R A;  2A72 A;  2NW7 A;  1IUS A;  2DKI A;  3NKZ A;  5FXZ A;  4HWI B;  4DV6 T;  2L8K A;  4EM3 A;  5ABE A;  1DOB A;  1ZP0 A;  1MND A;  1KNP A;  5LG4 A;  1Q1W A;  1LJ1 A;  2LKG A;  4GK5 E;  3T37 A;  3P7I A;  4A98 A;  1HF8 A;  3GDP A;  2JQQ A;  1EL7 A;  3NK2 X;  3ITJ A;  2DKH A;  2WET A;  2C72 A;  1E1M A;  1HG2 A;  4IIJ E;  3E0Z A;  2SPC A;  3PS9 A;  4GKJ T;  4EEB A;  1Y64 B;  3K3Q C;  4DV0 T;  1VOM A;  2E2A A;  1PHH A;  3RGL A;  4DVD A;  1ZY8 A;  5KOX A;  1PBF A;  3QNU A;  2BCG G;  1OJT A;  2WES A;  3T14 A;  2BDE A;  5F5W A;  4DMW A;  4CZZ B;  3LK4 2;  2WDR A;  1G73 A;  3GRS A;  2XFN A;  3VHL A;  2PYX A;  1PJ6 A;  1KEY A;  2Y6R A;  2QA2 A;  4A7A A;  4EB6 E;  3G5R A;  3MK7 C;  1MMG A;  4PK5 A;  1W09 A;  5HHF A;  4TV9 E;  1MO9 A;  4ZEY A;  4HB9 A;  3HYX A;  5IPY A;  2MBG A;  3UOZ A;  3PVC A;  4AQY T;  4B69 A;  4H2R A;  3EDV A;  1BWC A;  4JYA T;  1E6E A;  4I59 A;  5EBK A;  5AQN B;  2OV9 A;  1PDH A;  4F8H A;  5U25 A;  4ZS3 A;  3UKK A;  3NBX X;  1YY5 A;  3U78 A;  1D4C A;  3IWA A;  2R6G F;  2I59 A;  1Z7S 4;  4Y4N A;  2X0H A;  4CI3 B;  3ALM A;  3CNT A;  3ICS A;  3LXD A;  1WYB A;  2R7F A;  2MOZ A;  2KWI B;  3KBT A;  4B6X A;  3DJD A;  3IHG A;  2VQE T;  2B9Y A;  3EVY A;  2L3L A;  3PUR A;  1GRT A;  3HKD E;  4NUU A;  2NW8 A;  4C74 A;  3RH3 A;  4B3R T;  1TDE A;  2CUL A;  4A6N A;  1VBA 4;  4DR7 T;  3ZMZ B;  1OED A;  2R4J A;  5LHH B;  2YLT A;  2YLS A;  3ZYX A;  3SFE A;  2XSB A;  2C64 A;  5ABH A;  4TM1 A;  2CE7 A;  2ARD A;  3ZYK A;  3AYJ A;  2I0M A;  2BG9 E;  5AQK B;  4TUY E;  4Z90 A;  4HE8 A;  2LRL A;  3RRC A;  1JRX A;  3LZX A;  3T1H T;  3FG2 P;  2YU2 A;  2LRK A;  4II2 A;  4OVI A;  2YEV C;  3L8R A;  4A56 A;  3EI0 A;  3DK4 A;  4XXG A;  4H9O C;  4L0R A;  5HCM A;  4JI2 T;  1ZHC A;  3NH3 X;  1GV4 A;  4A5X A;  4JI8 T;  4LFA T;  2DNX A;  4KHZ F;  4HFD A;  3B57 A;  3OTO T;  2JMK A;  3T1Y T;  1LVK A;  2A87 A;  5L4H A;  3ZYM A;  4ZI3 D;  2IVE A;  2R9Z A;  2EX3 A;  3Q6J A;  3CX7 B;  3AXJ B;  4TLZ A;  4QKN A;  2KWH A;  4L5G A;  1NCQ D;  1RUH 4;  1BR1 A;  3MAC A;  3AYL A;  4NWZ A;  5BUL A;  4IE4 A;  3E08 A;  4QXC B;  3EF6 A;  2WZH A;  4MLK A;  5HWY A;  4QXB B;  4YTP A;  4KUM B;  1Q9I A;  4PFO A;  1H7X A;  2BG9 C;  4TLX A;  5JTG A;  3A7M A;  3KU9 A;  5DBJ A;  5GON E;  2VKH A;  2ZM0 A;  1OOP D;  4KBM B;  5FS7 A;  2VK9 A;  2R04 4;  3KIN B;  2BYB A;  4IE6 A;  2VVL G;  2LKH A;  4LA1 A;  3S61 A;  3KVA A;  4ZI7 E;  2VB6 A;  3EHZ A;  5LA6 E;  2W0G A;  1NG3 A;  3AYI A;  1M62 A;  2WCA A;  3UTG A;  4H4X A;  1KK7 A;  1GOS A;  4N78 D;  3PUX F;  4MFR A;  3DA1 A;  3ADA B;  2GR2 A;  3EDU A;  2YG3 A;  2VQB A;  5AQU B;  2XYO A;  3KPK A;  4H4W A;  3D1C A;  5JCI A;  3SGL A;  3AEC A;  4GF7 A;  4QX8 B;  5DAB A;  1XWM A;  1UK5 A;  2BS2 A;  4TX5 A;  2K48 A;  3OC4 A;  4IA5 A;  2DCF A;  1QLB A;  4UV8 B;  4PAA A;  5HEO A;  1W4X A;  3I9W A;  4DO0 A;  1GAL A;  3HKC E;  4C3Y A;  2YDS A;  1IUW A;  2H89 A;  1NHP A;  1Y01 A;  3BI2 A;  2E5V A;  1UUS A;  4AI6 A;  1XHZ A;  5HXS A;  4EYY R;  5AQF B;  2Y48 B;  4QH1 A;  3HL6 A;  5HXI A;  3COX A;  1W0A A;  3N5L A;  5CGM A;  2E8I A;  3TLT A;  4DR4 T;  2Z5Y A;  3EPT A;  4Z2U A;  3A8Y C;  2GF3 A;  3FIM B;  3I1A A;  3F8R A;  5L3C B;  4U33 A;  1GTH A;  2LOS A;  1OED B;  3PO7 A;  1OJ9 A;  4KI0 F;  1N4U A;  1HNZ T;  2VRL A;  4KX6 A;  1ZMC A;  2R46 A;  4C91 A;  3DK9 A;  2KND A;  3LSV A;  4TNW A;  2YM1 A;  1MOK A;  3SX6 A;  4Q4Y 4;  2WOV A;  3IEE A;  3M13 A;  4JLE A;  1M6I A;  5JCL A;  1B4V A;  4Q4V 4;  3PU3 A;  2BZB A;  3GWH A;  5HXE A;  2VVN A;  2YAU A;  2XVF A;  1QJD A;  4BAY B;  5U63 A;  2UXN B;  1KSS A;  3GWF A;  4GDE A;  2B76 A;  2V6O A;  5IQ1 A;  4ILB A;  3WE0 A;  4J36 A;  4I43 B;  1VCS A;  4HWC A;  2YK0 A;  2DI4 A;  4AKR B;  3RIU C;  4YT0 A;  4QH4 A;  3ICR A;  3RHA A;  2OLO A;  1D4M 4;  3L3P A;  2V6X A;  1D4D A;  1LTX R;  2BC0 A;  3PUV F;  4EZ4 A;  5JRC B;  3CMM A;  2C73 A;  2LSY A;  4HFH A;  2RGH A;  2YR6 A;  2CHN A;  1V59 A;  3TLU A;  3UKA A;  2EHO C;  2HH7 A;  4J2W A;  3PUQ A;  1X79 A;  4EED A;  3KLJ A;  3UP4 A;  4OYJ A;  3T0K A;  4I4T E;  4YJ3 E;  2XLT A;  4AQG A;  4K2X A;  3AEE A;  1OJD A;  5FL1 A;  1DJQ A;  5C8Y E;  4UF0 A;  4U2Y A;  1NHS A;  4II3 A;  4B66 A;  2LM9 A;  2HPJ A;  3LOV A;  5AQT B;  3CGE A;  4OFZ A;  3M65 A;  2BBJ A;  4YHJ A;  1XDO A;  2EQ7 A;  3KV5 A;  3SZF A;  1AL2 4;  4H9P C;  4I55 E;  3UU4 A;  4YTN A;  3ANW A;  4GB3 4;  4M1P A;  5LGU B;  3OVU A;  4ZI2 D;  1EV1 4;  3SWH A;  4IST A;  3G06 A;  4IDZ A;  3NWI A;  2I0Z A;  3GQH A;  3ZCI A;  2UUB T;  2O9Z A;  1NHR A;  3C98 B;  1NEK A;  3AE2 A;  3N9L A;  3RC3 A;  4DID B;  4J56 A;  5ABG A;  3P9U A;  4DR2 T;  3R6N A;  3EUH A;  3N9N A;  5EK2 A;  1Y56 A;  2AXD S;  2BK5 A;  4AQF C;  4H2Q A;  4CQI A;  4G2A A;  4FDC B;  2AE9 A;  3M12 A;  4AOX A;  4P0B A;  1IUT A;  3ZT6 A;  1J1J A;  3LBX A;  2MPK A;  3PUY F;  4OPL A;  4IDP A;  4U8P A;  3SRZ A;  3N9Q A;  1KDG A;  4GIW A;  3OZ2 A;  4KP3 C;  2UZZ A;  1M7K A;  2WPF A;  2C3D A;  2RMU 4;  1HRI 4;  3NYE A;  2YDR A;  2GVC A;  2X9W A;  5FMH A;  1WCR A;  2XQY A;  4C77 A;  3T31 A;  3ZT7 A;  5H6Q B;  1L0V A;  2V60 A;  2V7M A;  4BK2 A;  1S94 A;  4CCR A;  1EAH 4;  4OPU A;  1GES A;  5LGN B;  3CGC A;  2J1D G;  2CVJ A;  1GSN A;  4H63 V;  3CPI G;  4JEH B;  5FXX A;  3C4X A;  2H7O A;  2BRY A;  1IUU A;  2QVA A;  5FVK A;  5LJN A;  4UR9 A;  3QVP A;  3SOL A;  2XFP A;  5HXR A;  4ASK A;  2A2F X;  3TLW A;  4X1K E;  3O9X A;  3ZLI A;  3RKO A;  1LPF A;  3AE6 A;  3FBS A;  5J1G A;  4ZXL A;  4LFC T;  3IA3 A;  4NPP A;  3O0H A;  2JKC A;  5HAX A;  3PUG A;  1GQE A;  5LMU T;  5AQV B;  3II4 A;  3AE1 A;  2QYW A;  2XVJ A;  4XWR A;  1XPQ A;  1DOC A;  2E9X C;  4JEU B;  4UP3 A;  2W0H A;  1EL8 A;  4WZX A;  1PO1 4;  4H7U A;  1VRH 4;  1Q1R A;  4AT2 A;  3UT5 E;  1YXR A;  1N1P A;  3RKG A;  2A3D A;  2YKS A;  2BK3 A;  3SZW A;  2VWA A;  1D1C A;  2XQ8 A;  3FZH B;  4UF0 B;  3PUS A;  5L46 A;  4NNJ A;  4CN1 A;  3QFA A;  4DGK A;  3JC6 C;  3NVO A;  1L9D A;  2PTF A;  3PDY A;  2XAS B;  4A79 A;  2D0U A;  4NZH A;  1VG9 A;  3MA9 A;  4O4H E;  2WB5 A;  3CPH G;  3GYX A;  1EBD A;  2XVI A;  1JRY A;  3ANW B;  5HXC A;  1GRA A;  2JQ9 A;  2ZZB A;  3RIF A;  2WP6 A;  4Z25 A;  1PBB A;  2WWU A;  1B8S A;  1REO A;  3ZMT B;  4EV6 A;  2OAM A;  3P4R A;  1Z6L A;  4DV5 T;  2LFC A;  3VKH A;  2XCG A;  3P1W A;  3ONL C;  1FEC A;  5EOW A;  5C2T A;  4JI4 T;  1BR4 A;  3KDS E;  2C5K T;  5KMQ A;  1L9C A;  1FOH A;  2WOI A;  5LHI B;  1PBC A;  1D5T A;  2UU9 T;  3Q2M A;  1COY A;  2WDQ A;  2WU2 A;  4YSZ A;  4NTE A;  3SQP A;  3PV0 F;  4DBR A;  3AA1 B;  4ADW A;  2YOE A;  1XAN A;  4U2L A;  2XLS A;  5LMN T;  3BNU A;  2IVD A;  5L2L A;  4TM0 A;  5ETW A;  1RUJ 4;  3Q9T A;  2BCP A;  5JDN A;  3E22 E;  2PW9 A;  2RS5 4;  3UKH A;  4B64 A;  3GN5 A;  1UCU A;  5HY5 A;  3ATR A;  2IIU A;  3UKP A;  1POV 0;  2R45 A;  4EQR A;  1VRQ B;  3CN8 A;  4I58 A;  4JY2 A;  3S5W A;  1JRZ A;  2BRA A;  5HEG A;  2NPX A;  4ILU A;  3AXB A;  4FJO A;  1IBM T;  3JAF A;  4HTE A;  4IA6 A;  5LV9 A;  5DQW A;  1SUM B;  3RP7 A;  1B37 A;  2XUE A;  4HEA A;  4DV7 T;  1ZV4 X;  4Z2R A;  2VAS A;  2RGJ A;  2WS3 A;  4HA6 A;  1BR2 A;  3RP6 A;  5AQG B;  3NRX A;  4ZZB A;  2HQM A;  3N9M A;  2XZE A;  1Y0P A;  2B1E A;  3UTF A;  3O1J A;  4B3S T;  3ABV A;  4EYU A;  1F8S A;  3NG7 X;  5JCN A;  2MAW A;  3DJB A;  2BG9 A;  2XM2 A;  1N36 T;  1GRF A;  3ZST A;  2ZZC A;  4X1Y E;  1XHC A;  4X9M A;  4PK4 A;  1V9D A;  3ISH A;  4YFS A;  5FY7 A;  1CL0 A;  2IAK A;  1VG0 A;  4JDR A;  3CGB A;  4H4V A;  4YJ2 E;  1YKJ A;  1NA1 D;  1OJC A;  4MBQ A;  3QOF A;  2JBV A;  1XNR T;  4NEW A;  3H3A A;  4UDQ A;  3TLS A;  3VR8 A;  2BXS A;  2W67 A;  5ADX L;  3ZCJ A;  4XBF B;  5AQI B;  4LU6 A;  3BK9 A;  2M6B A;  2QGS A;  3P4Q A;  2WP5 A;  2N9D A;  4X66 T;  3NZQ A;  4AP1 A;  2VRM A;  2V7K A;  4G73 A;  1BEV 4;  1R8I A;  2V5D A;  2TMD A;  2YDQ A;  3NYC A;  4A65 A;  2W2U A;  1ZOY A;  4CN6 A;  5AQL B;  1RVF 4;  2LSJ A;  4OPG A;  4AT0 A;  5LBM A;  1BKW A;  3RYI E;  3NRN A;  1MXT A;  1CHU A;  3NLC A;  5LXT E;  3LK2 B;  4JI3 T;  2CM0 A;  2LEH A;  1D1B A;  3LJP A;  1SA0 E;  4J31 A;  4DUY T;  4XWZ A;  2PY5 A;  3I3L A;  2M6I A;  1XMO T;  5AFU L;  4H9R C;  3BQL A;  3AA6 B;  1HR0 T;  1NDA A;  1GEU A;  3LZW A;  3JCF A;  3K7M X;  3GYJ A;  4C3X A;  2WWV A;  3K7Q X;  2X8C A;  4DR1 T;  4ZCD A;  1WRD A;  3UQ4 A;  5BMV E;  3JD7 4;  2X0L B;  3FI7 A;  3AEA A;  5EK4 A;  3PJA A;  4HFI A;  5E0O A;  1GND A;  2JQH A;  4HWD A;  4ZN0 A;  4JNA A;  5KDM C;  2BKN A;  5HEU A;  5C3J A;  3FZM B;  4ILC A;  4MAL A;  5BUK A;  4EAH A;  4GOU A; 
#chains in the Genus database with same CATH homology
 3M13 A;  1DNC A;  5KVI A;  1M6I A;  1OJA A;  1B4V A;  4AP3 A;  5JCL A;  3SZ0 A;  1D4E A;  1DJN A;  4CBQ A;  5KMR A;  2YAU A;  4X4J A;  2JK6 A;  2FJE A;  1K0J A;  2XVF A;  1QJD A;  1JOA A;  2AQJ A;  2VOU A;  5U63 A;  3GQK A;  2X3N A;  1BGJ A;  3FPZ A;  1KSS A;  1D7Y A;  3GWF A;  3AD9 B;  4GDE A;  2B76 A;  2V6O A;  4OPC A;  5EB4 A;  2Q0K A;  5IQ1 A;  4G6H A;  2V61 A;  3V76 A;  2APG A;  1CJ4 A;  1ZK7 A;  1IJH A;  3WE0 A;  3SY4 A;  2EQ9 A;  4YSH A;  4J36 A;  2YR5 A;  3G5Q A;  2C76 A;  3IC9 A;  4YT0 A;  1FEA A;  3ICR A;  3CNS A;  3QVR A;  3RHA A;  4CRT A;  1PXA A;  2OLO A;  1D4D A;  4D03 A;  1N4V A;  4OCG A;  4DNA A;  2YLR A;  1LTX R;  1H83 A;  2BC0 A;  2C65 A;  3CMM A;  4EMJ A;  1BF3 A;  2C73 A;  1XDI A;  2RGH A;  1D7L A;  2A8X A;  2YR6 A;  1V59 A;  4B67 A;  4RSL A;  3UKA A;  1ELI A;  4A99 A;  1ZKQ A;  3C96 A;  3KKJ A;  2B9X A;  4J2W A;  3C4N A;  3K30 A;  2WHD A;  4E0V A;  1JNZ A;  2AR8 A;  3L1R A;  3AD8 B;  3KLJ A;  1CBO A;  3CPJ G;  1K0I A;  3UP4 A;  3T0K A;  2WP9 A;  1O5W A;  3AE9 A;  2XLT A;  4RG3 A;  4K2X A;  3AEE A;  2YG4 A;  4U8N A;  1OJD A;  2GR1 A;  4U8O A;  1DJQ A;  4YXD A;  3D8X A;  1GT8 A;  1O95 A;  1GPE A;  1NHS A;  4O5Q A;  3UKQ A;  1CC2 A;  1PJ5 A;  4II3 A;  4ICY A;  1TDO A;  3BHF A;  4ZCC A;  2GV8 A;  2XDO A;  4B66 A;  1H84 A;  3EAN A;  3LOV A;  4H4P A;  3HYW A;  2VVM A;  3CGE A;  2WEU A;  2GMJ A;  2GB0 A;  4EIP A;  2WOW A;  2BC1 A;  1K0L A;  2EQ7 A;  3CGD A;  1BGN A;  4TM3 A;  3SZF A;  1FEB A;  4M52 A;  1KF6 A;  4YTN A;  3LB8 A;  1LVL A;  2E1M A;  2V3B A;  2Q7V A;  4Z26 A;  2TPR A;  4Y4L A;  1KNR A;  2FBW A;  2QAE A;  3GWD A;  3VRD B;  2I0Z A;  3GQH A;  2O9Z A;  4TM4 A;  1NHR A;  4B65 A;  4K5S A;  1NEK A;  3AE2 A;  2OAL A;  3P4S A;  4G9K A;  1F8R A;  2C4C A;  4J56 A;  4YWO A;  3P9U A;  2BAB A;  3QJ4 A;  3URH A;  3BNM A;  1GER A;  4GAV A;  3DJG X;  4H4R A;  4U2T A;  2JB1 A;  2AAQ A;  3ICT A;  4EQW A;  4GRT A;  1Y56 A;  4LII A;  2BK5 A;  1P2H A;  2YLZ A;  4NTD A;  5GSN A;  4H2Q A;  4FDC B;  2BA9 A;  4X9N A;  3M12 A;  4AOX A;  2WBA A;  2YVG A;  1IUT A;  3UOV A;  4GAP A;  2V3A A;  4UDP A;  4OPL A;  4A6N B;  4U8P A;  3EAO A;  1KDG A;  2IID A;  3I6D A;  4OPT A;  3UTH A;  3OZ2 A;  3QFB A;  4YKG A;  2XLR A;  2VZ2 A;  1FCD A;  1SEZ A;  4ECH A;  3P4P A;  2GAG B;  2UZZ A;  4JQ9 A;  4BK1 A;  2WPF A;  2C3D A;  3B6D A;  3LAD A;  4C5O A;  5U1O A;  3SFD A;  4Y4M A;  2EQ8 A;  3NYE A;  2B7S A;  2GVC A;  1DOD A;  3QSE A;  5FMH A;  2X8G A;  4C77 A;  3NYF A;  2WU5 A;  4YKF A;  3T31 A;  1L0V A;  2V60 A;  3V3N A;  3C4A A;  1TRB A;  4BK2 A;  1YQZ A;  1X31 B;  4K8D A;  5JCK A;  4YTM A;  1GXF A;  1NG4 A;  4CCR A;  4OPU A;  3HZL A;  3T2K A;  1GES A;  1NAA A;  2XVE A;  1NPX A;  1E1K A;  3CGC A;  3KA7 A;  4GDP A;  2CVJ A;  1GSN A;  3AWI A;  3GDN A;  1YQ3 A;  1P2E A;  2JAE A;  1S2Y A;  3CPI G;  4BUR A;  4DSG A;  1H7W A;  4FK1 A;  2JB2 A;  1H81 A;  2WPC A;  5BRT A;  5BVA A;  1JEH A;  4FK1 C;  2C67 A;  2BRY A;  1IUU A;  1CJC A;  3SZC A;  4Z44 A;  1LQT A;  3GSI A;  4EM4 A;  3VQR A;  3QVP A;  1NEN A;  5FS8 A;  5EB5 A;  2BK4 A;  2XFP A;  4K22 A;  1IUS A;  2DKI A;  2XFU A;  2C66 A;  1PN0 A;  2GQF A;  4EM3 A;  2JB3 A;  1DOB A;  1ZP0 A;  1KNP A;  2Y6Q A;  1Q1W A;  1LPF A;  3AE6 A;  1LJ1 A;  3IF9 A;  1ZMD A;  3FBS A;  3G5S A;  4GR1 A;  2GR3 A;  2CDU A;  2RGO A;  2YLX A;  3T37 A;  4K5R A;  2B9W A;  2XFQ A;  1TDK A;  3O0H A;  3GDP A;  3T2Y A;  2JKC A;  1EL7 A;  3NK2 X;  2QA1 A;  4CNK A;  1CJ3 A;  3II4 A;  3VRB A;  3AE1 A;  1IUX A;  3ITJ A;  4J34 A;  3SM8 A;  2DKH A;  4H4Y A;  3DGH A;  4U8J A;  3AED A;  2WET A;  2XVJ A;  2C72 A;  2Q6U A;  1M64 A;  4XWR A;  1XPQ A;  1DOC A;  1E1M A;  1K4Q A;  3KPF A;  3AD7 B;  3NTD A;  4UP3 A;  2R0G A;  2YLW A;  1PS9 A;  3GYI A;  4H4U A;  1H6V A;  2W0H A;  4U8L A;  1EL8 A;  3UKL A;  2CFY A;  2VQ7 A;  3PS9 A;  2BS3 A;  1H86 A;  4GCM A;  4H7U A;  5J7X A;  3ATQ A;  1Q1R A;  1KFY A;  1F6M A;  1S3B A;  4AT2 A;  5KMS A;  1N1P A;  3NTA A;  4OPD A;  1PHH A;  1ZY8 A;  2YM2 A;  2GQW A;  1PBF A;  2WPE A;  5KOX A;  2BCG G;  2BK3 A;  3SZW A;  1OJT A;  2WES A;  3T14 A;  1CF3 A;  5KRQ A;  2BS4 A;  5L46 A;  2ZBW A;  2V5Z A;  4EQX A;  4NNJ A;  2WDR A;  3GD3 A;  3QFA A;  2GRT A;  2C70 A;  1GRH A;  3GRS A;  2XFN A;  1DOE A;  4DGK A;  1RP0 A;  1L9D A;  4YSY A;  5IQ4 A;  5ER0 A;  3RED A;  2PYX A;  1PJ6 A;  4A79 A;  4IVM B;  4K7Z A;  2Y6R A;  2QA2 A;  2GMH A;  4NZH A;  1BZL A;  3G5R A;  3NIX A;  4A7A A;  1VG9 A;  2XVH A;  5HHF A;  3VR9 A;  1MO9 A;  3AE4 A;  3CPH G;  1EL9 A;  2J3N A;  3H8L A;  1EBD A;  3GYX A;  4HB9 A;  3HYX A;  3NN0 X;  2XVI A;  1IUV A;  1JRY A;  5IPY A;  2YVF A;  3AEB A;  1F3P A;  3UOZ A;  1GRA A;  2ZZB A;  2WP6 A;  2QCU A;  2YG6 A;  4Z25 A;  1PBB A;  3PVC A;  4B69 A;  1PJ7 A;  4H2R A;  1KSU A;  3HYV A;  1B8S A;  1BWC A;  4I59 A;  1E6E A;  3DME A;  5EBK A;  3CNJ A;  2FJA A;  1REO A;  2NVK X;  4KPR A;  4U8K A;  5CQF A;  1JU2 A;  3QSM A;  3DGZ A;  1PDH A;  2OAM A;  4EIQ A;  5U25 A;  3P4R A;  3UKK A;  3F8P A;  3NK1 X;  1YY5 A;  3NNE A;  1Z6L A;  3AE5 A;  4U8I A;  2LFC A;  1D4C A;  4GUV A;  3IWA A;  5HYM A;  2XCG A;  4CNJ A;  1E7P A;  3P1W A;  3ALM A;  3DJE A;  3GD4 A;  4Y4N A;  3CNT A;  1S2Q A;  1FEC A;  3ICS A;  5C2T A;  3ALL A;  3LXD A;  2YWL A;  4H4T A;  4WX1 A;  5EOW A;  3VRA A;  1F8W A;  4OPI A;  1O94 A;  4UDR A;  5KMQ A;  2X8H A;  3IHG A;  3DJD A;  3UOY A;  2B9Y A;  3ZDN A;  3M0O A;  4BV6 A;  1L9C A;  1FOH A;  4BJY A;  1GTE A;  2WOI A;  3NN6 X;  4H4Z A;  2B7R A;  1GRT A;  1PBC A;  4C74 A;  2WDV A;  1D5T A;  1TDE A;  2CUL A;  4H2N A;  1YQ4 A;  3SUC A;  1COY A;  2WDQ A;  5GRT A;  4A9W A;  2WU2 A;  4YSZ A;  3BHK A;  4NTE A;  3SQP A;  4J57 A;  4Z24 A;  1B5Q A;  2XLP A;  3RP8 A;  4A6N A;  4ADW A;  4U2S A;  3AB1 A;  2R4J A;  1XAN A;  2YLT A;  4U2L A;  2X50 A;  2XLS A;  2XLU A;  3BNU A;  1E1L A;  2YLS A;  2IVD A;  4TM0 A;  3SFE A;  1LV0 A;  3ZYX A;  2RAB A;  2C64 A;  1PXC A;  4TM1 A;  5KXJ A;  4PAB A;  2YQU A;  1GRE A;  3Q9T A;  2ARD A;  3AYJ A;  4MJW A;  2BCP A;  3F8D A;  3AE3 A;  2C75 A;  1JRX A;  3LZX A;  3FG2 P;  3UKH A;  1L9E A;  4B64 A;  2GAH B;  3SXI A;  4II2 A;  3ATR A;  2GR0 A;  4OVI A;  5HY5 A;  4JN9 A;  1TYP A;  2R0P A;  3UKP A;  4JNQ A;  3DK4 A;  4YSX A;  4XXG A;  3UKF A;  4IVO B;  2R45 A;  4A5L A;  1DXL A;  4EQR A;  2FJD A;  1N4W A;  1VRQ B;  3CN8 A;  4I58 A;  4JY2 A;  4N9X A;  1JRZ A;  3S5W A;  2BRA A;  2X99 A;  3NH3 X;  2NPX A;  1GV4 A;  2GH5 A;  1GRG A;  3UTE A;  3AXB A;  5M10 A;  4D04 A;  4B68 A;  2F5Z A;  4G74 A;  4IA6 A;  3GMB A;  5LV9 A;  3CTY A;  4AOS A;  2A87 A;  5KMP A;  3CNP A;  4DSH A;  3RP7 A;  1B37 A;  4CY8 A;  5FS9 A;  2IVE A;  2R9Z A;  3H8I A;  3NGC X;  3Q6J A;  4Z2R A;  3BI5 A;  2RGJ A;  4TLZ A;  2WS3 A;  2YG5 A;  4HA6 A;  2PHH A;  3RP6 A;  1EL5 A;  3E1T A;  2Q0L A;  3GMC A;  3AYL A;  1ONF A;  4NWZ A;  5FS6 A;  4IV9 A;  5M0Z A;  5BUL A;  2HQM A;  3EF6 A;  3IHM A;  3L8K A;  3NHO X;  4Z2T A;  3KVE A;  1Y0P A;  3UTF A;  4CCQ A;  1PBE A;  1JNR A;  4YTP A;  4BJZ A;  3ABV A;  4H2P A;  1F8S A;  1CJ2 A;  3NG7 X;  5JCN A;  1Q9I A;  3UP5 A;  1GRF A;  2OA1 A;  2ZZC A;  1H7X A;  4TLX A;  1XHC A;  4X9M A;  3ISH A;  3KU9 A;  5DBJ A;  1CL0 A;  1VG0 A;  4USQ A;  4JDR A;  4CY6 A;  3CGB A;  4FX9 A;  4H4V A;  1YKJ A;  2E4G A;  5FS7 A;  1OJC A;  3DK8 A;  2BYB A;  4REK A;  2XFO A;  2VVL A;  4APN A;  4NEV A;  3BI4 A;  2JBV A;  1QO8 A;  3AEF A;  2VVL G;  2YG7 A;  4LA1 A;  4NEW A;  3S61 A;  2WQY A;  4UDQ A;  4USR A;  1UKV G;  5J60 A;  5KOW A;  2R4E A;  3VR8 A;  1NG3 A;  2BXS A;  3AYI A;  5KVH A;  5JCM A;  3AE7 A;  1S3E A;  2C3C A;  4H4X A;  4LU6 A;  3UTG A;  3H4K A;  3V3O A;  1GOS A;  5KNL A;  2ZZ0 A;  3P4Q A;  2WP5 A;  1HYU A;  4AP1 A;  1LQU A;  2VRM A;  3DA1 A;  3ADA B;  3DH9 A;  4G73 A;  3UOX A;  2GR2 A;  1TYT A;  4H4S A;  1CC4 A;  1TDF A;  2YG3 A;  2VQB A;  3CIR A;  4O5U A;  2XYO A;  3KPK A;  2H88 A;  1GET A;  2A89 A;  3D1C A;  4H4W A;  1AOG A;  1PXB A;  2C7G A;  4H4Q A;  5JCI A;  3SGL A;  4U8M A;  3AEC A;  4GF7 A;  4H50 A;  3K7T A;  4EMW A;  3DJJ A;  2TMD A;  2BS2 A;  2YR4 A;  3NYC A;  3OC4 A;  2ACZ A;  4A65 A;  4IA5 A;  1ZOY A;  1ZDL A;  1QLB A;  3GRT A;  2YVJ A;  4PAA A;  4EQS A;  4OPG A;  4B63 A;  1W4X A;  1ZX9 A;  4AT0 A;  1BKW A;  1GAL A;  1NHQ A;  3B3R A;  3RNM A;  3NRN A;  3QSS A;  4C3Y A;  1E39 A;  1Y56 B;  1IUW A;  2H89 A;  1MXT A;  1VQW A;  1CHU A;  3NLC A;  1NHP A;  4Z43 A;  3BI2 A;  2E5V A;  4RG4 A;  1ZOV A;  3LJP A;  4JY3 A;  4J31 A;  4XWZ A;  4WCT A;  3I3L A;  1RYI A;  3ALJ A;  3NKS A;  5HXI A;  3SYI A;  2R0C A;  3COX A;  3UCL A;  3CND A;  3AEG A;  5TR3 A;  1NDA A;  5CKU A;  3AE8 A;  1GRB A;  1GEU A;  3LZW A;  5KWF A;  2Z5Y A;  3EPT A;  4Z2U A;  3NK0 X;  2OLN A;  3K7M X;  2GF3 A;  3GYJ A;  3R9U A;  4C3X A;  2FJB A;  3FIM B;  3F8R A;  3K7Q X;  2X8C A;  1GTH A;  3JSK A;  3NT6 A;  4P9S A;  1PBD A;  1VDC A;  4ZCD A;  2GEW A;  3KD9 A;  3PO7 A;  2Z5X A;  1E1N A;  2EQ6 A;  1OJ9 A;  4J33 A;  1N4U A;  2VRL A;  4B1B A;  4KX6 A;  1ZMC A;  3AEA A;  2R46 A;  4BK3 A;  1GND A;  1CC6 A;  3DK9 A;  4ZN0 A;  4JNA A;  4NTC A;  5C3J A;  2YM1 A;  1RSG A;  1H82 A;  1MOK A;  3SX6 A;  2BXR A;  3FMW A;  5BUK A;  2BAC A;  2WOV A;  3T2Z A;  4EMI A;  4G6G A;  1FL2 A;  1TDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...