4YTNA

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide
Total Genus 217
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
217
sequence length
616
structure length
616
Chain Sequence
b'SNIAQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTVKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLFKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Succinate dehydrogenase flavoprotein
publication title New Insights into the Design of Inhibitors Targeted for Parasitic Anaerobic Energy Metabolism
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 217
structure length 616
sequence length 616
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 4ytnA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ytnA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4ytnA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 4ytnA04
2WP6A 4X9NA 2BK4A 4ZCDA 2C64A 1EL5A 2R9ZA 1LV0A 3C96A 3GWFA 4JY2A 4UDPA 1YY5A 4EM3A 3P4QA 2GAHB 1E1MA 3ALLA 2WEUA 4JNAA 3FBSA 4N9XA 4H2RA 4XXGA 2R45A 3L1RA 4U8KA 3UKLA 2OA1A 5HY5A 5U1OA 2PYXA 3DGZA 2OLOA 3KD9A 4TM0A 1GRAA 4BK1A 3UKHA 2GR0A 1ZKQA 3SQPA 3CNJA 1X31B 2AR8A 2C75A 2HQMA 4U8JA 5CQFA 3NTAA 2YVFA 1S3EA 2IVEA 3PO7A 2VQBA 3EANA 3ICSA 4Z25A 2FJBA 2YR4A 1COYA 5JCIA 1BGJA 1YQ3A 2R4EA 3QVRA 4Y4MA 4YSZA 2W0HA 2XFQA 4KPRA 3O0HA 4A6NA 1BKWA 1TDOA 4PAAA 3LB8A 1DOEA 4H4VA 4IVOB 2CVJA 4BK2A 2XVJA 3AEDA 4H2QA 3VR9A 2XLPA 3CGEA 3ICTA 1ZX9A 1CJ4A 1DXLA 4Y4LA 3AWIA 3SUCA 1OJDA 4A65A 1GALA 1NG3A 2Z5XA 3AE3A 1LQTA 1PBFA 4YXDA 2Q6UA 2BXSA 4UDQA 2FJDA 4H4SA 3VRDB 1OJAA 2VOUA 3GDPA 1S2QA 3RNMA 1IUUA 4K2XA 1LQUA 2PHHA 2WS3A 2B9YA 4K5SA 4Z44A 4C77A 3AXBA 1K0JA 3BHFA 4GDPA 3P1WA 4CY6A 2EQ7A 2WU2A 2RGHA 3DK9A 3DJDA 2Y6QA 2XDOA 3NLCA 3UP5A 5IPYA 1E1KA 2BC0A 2GH5A 1QLBA 4OCGA 1DNCA 2YR6A 1CC6A 1H82A 3IF9A 4UP3A 1E1LA 1OJTA 3UKPA 4ZN0A 4UDRA 2GQWA 3B6DA 3B3RA 1KNPA 1EL7A 4H7UA 3S5WA 3V3NA 4AT0A 4CCRA 1QJDA 3G5RA 2A87A 1NDAA 4K22A 4REKA 3VR8A 4D03A 1YKJA 2FJEA 3AYJA 2XFNA 1NHRA 1L0VA 3DJJA 1FEAA 1PJ6A 2WOIA 3UOZA 3AE5A 3ICRA 3GQKA 2BACA 3UOYA 3KLJA 1P2EA 3ZDNA 4CRTA 3SFEA 3NTDA 4DGKA 1GRBA 3QSSA 2APGA 4JDRA 1PBCA 1F8SA 1H7WA 2Q0LA 1JEHA 1GRHA 3NYEA 1NG4A 3CPJG 5GRTA 3ALMA 4KX6A 2C76A 3NT6A 3IC9A 4CNKA 1D5TA 2QCUA 1GPEA 5DBJA 1PXAA 4AP3A 4Z2RA 1TYTA 4CY8A 1PXBA 3EF6A 4YTPA 2YWLA 4H4PA 5IQ1A 3CGBA 2X3NA 2XFUA 4H4YA 1E39A 1LPFA 4HA6A 1TDEA 3NN0X 1RYIA 1P2HA 3R9UA 4TM4A 3SM8A 3AE4A 5ER0A 4NEVA 3RP6A 4BURA 1JRYA 1VDCA 1UKVG 3CNSA 4LU6A 1B5QA 1GRTA 1LTXR 2O9ZA 4TM1A 1RP0A 2V61A 2OALA 3DJEA 4B64A 3AEEA 1CC2A 3BI2A 3AE1A 1TDFA 3BI4A 3CTYA 4EQXA 2VRLA 2R46A 5GSNA 2WDRA 3NK2X 1RSGA 1JRZA 1PBDA 4I58A 2ACZA 2YLSA 2BK3A 1ELIA 4WX1A 1BGNA 3KA7A 5M0ZA 5EB4A 3F8DA 3G5SA 2A89A 2XVIA 2BCPA 1DJQA 2FJAA 4BK3A 2F5ZA 3LADA 3NIXA 4P9SA 3ZYXA 2V5ZA 4PABA 2DKHA 2XVHA 1GSNA 1Y56B 3AEAA 1KSUA 2GR3A 4ICYA 3V3OA 4C3XA 4NTEA 1E7PA 3NH3X 2R0GA 4U2TA 4Y4NA 4A6NB 2V6OA 2YG7A 1M64A 4U2SA 1Y56A 2TMDA 4K8DA 2C67A 5JCMA 2XCGA 5J7XA 5U63A 1XPQA 3NYCA 5JCLA 4OPUA 2YLWA 4H4TA 3RP7A 3WE0A 2R4JA 3ATQA 1IJHA 1VQWA 3D1CA 1TDKA 5KVHA 1H7XA 4H50A 4LIIA 1H83A 2B9XA 3AYLA 1JNZA 3H8LA 3II4A 2WHDA 1V59A 1Q1WA 3M13A 2XFPA 3H8IA 3C4NA 3CNPA 2WETA 1EL9A 4CBQA 4U8LA 5KOXA 4YKFA 5KOWA 1PXCA 3AD7B 1ZK7A 2A8XA 3CNDA 4U8PA 5KRQA 1NHSA 1FL2A 3AYIA 3CNTA 2C3CA 2C65A 2C7GA 1CF3A 2BYBA 4GUVA 1O95A 4J33A 3VRBA 5TR3A 2WDQA 1JU2A 4C5OA 2WPEA 4I59A 3F8PA 1XDIA 3PS9A 1REOA 4GDEA 2XLUA 3GRSA 2GR2A 3P4PA 1Y0PA 3BNMA 5JCKA 2BCGG 1KDGA 2BABA 2EQ6A 2V3BA 1PJ7A 3ADAB 3GQHA 2JAEA 1MO9A 1O94A 4BJZA 1VG0A 2QAEA 3UTFA 1KF6A 2NVKX 2TPRA 5EB5A 1NEKA 3AD8B 3DK8A 1N4WA 3COXA 1VG9A 1DOCA 2YVGA 1ZDLA 2GVCA 2AAQA 3ALJA 2VZ2A 3FIMB 4OPLA 4USQA 2H88A 3AECA 3BI5A 5BRTA 1XANA 1L9EA 4GCMA 2Y6RA 3NK1X 2X8CA 2QA2A 1XHCA 4EMIA 3K7TA 3SFDA 2B76A 4YT0A 1EBDA 5HXIA 1QO8A 2XVEA 2AQJA 1F6MA 3SGLA 5BVAA 2EQ9A 3EAOA 2V3AA 5FS7A 4OPIA 2DKIA 3GYXA 5KVIA 3GMCA 3UTGA 2RGJA 1OJCA 2WP5A 4NZHA 4FDCB 3URHA 1ZP0A 1ZMDA 3D8XA 2JB3A 2XVFA 1F8WA 3AEFA 3OZ2A 5U25A 4E0VA 3RHAA 1MXTA 4YSYA 5EBKA 4EMJA 3CIRA 1E1NA 4A9WA 3CGDA 2C3DA 4IA5A 4D04A 2LFCA 1K0IA 2GQFA 3H4KA 5L46A 4U8NA 1GOSA 5CKUA 3ISHA 3KPFA 3AE7A 1NENA 4YSXA 1IUVA 1JRXA 1NHPA 3UCLA 4Z2UA 4Z26A 4OPDA 3Q6JA 3K7QX 4NEWA 5C3JA 3CN8A 1ZOVA 4NTCA 3AEBA 2CULA 4U8IA 1H81A 2GR1A 4EM4A 3KVEA 2YAUA 2YQUA 2QA1A 2WBAA 1GEUA 1NPXA 3CPHG 4LA1A 4TM3A 4X4JA 4OPCA 1FECA 1PJ5A 1IUTA 4ECHA 3UTHA 2IIDA 3IHMA 4APNA 3DH9A 4Z2TA 3BHKA 3Q9TA 4A5LA 1F8RA 1EL8A 4X9MA 2WQYA 4K5RA 5HYMA 3AEGA 4J31A 2VVLG 2JKCA 3QJ4A 3GYIA 4YKGA 2X99A 5IQ4A 3GWDA 3NKSA 4U8MA 4IVMB 3ITJA 1N1PA 1CC4A 1JNRA 1YQZA 1TDNA 2CFYA 3KKJA 4OPGA 2B7SA 1BWCA 3GRTA 5FS8A 5J60A 4JQ9A 2BS3A 3UP4A 2C73A 3GMBA 5HHFA 2RABA 1H6VA 1N4VA 4O5UA 3QFBA 4JN9A 1CHUA 5LV9A 1D7YA 1GT8A 2R0PA 2C72A 4K7ZA 2GAGB 2J3NA 1GRFA 2FBWA 1L9DA 5FS9A 1GXFA 1NAAA 4C3YA 1Z6LA 3FG2P 1FEBA 1HYUA 3NYFA 2JBVA 3NGCX 3P4RA 4YTMA 2X50A 1H84A 1PBEA 1D4DA 1ZMCA 1GREA 2WPFA 2ZZCA 3DGHA 4JY3A 1B8SA 3AE9A 5BULA 3RP8A 2V60A 1B37A 1CJ3A 1SEZA 3S61A 4IV9A 1PDHA 2GRTA 2JB1A 4AT2A 1CL0A 2BK5A 4OVIA 4RG3A 2WP9A 1D4EA 3LOVA 1PHHA 4JNQA 1DODA 1BZLA 2X8GA 1FOHA 1MOKA 3G5QA 1GETA 3DA1A 2IVDA 3DMEA 3NRNA 4B65A 4AOSA 2C70A 2YVJA 3K7MX 4XWZA 4A7AA 4H2PA 1GNDA 4GR1A 2YG6A 2GMJA 2WOWA 2YM2A 4EIPA 1BF3A 1JOAA 3UOVA 1LVLA 1GTHA 1M6IA 1KSSA 4M52A 1S2YA 2E4GA 2NPXA 3GYJA 2VQ7A 4H4ZA 3AE2A 3GSIA 1NHQA 2GMHA 1KNRA 1DOBA 2YLXA 3F8RA 3I3LA 2XLTA 2BXRA 1E6EA 4YWOA 1FCDA 4C74A 3ABVA 2XYOA 3NHOX 4IA6A 4YSHA 4ADWA 1K0LA 2WU5A 2XLSA 2VRMA 3M0OA 5JCNA 2VVLA 3CPIG 1L9CA 3BNUA 3FMWA 3LJPA 3NN6X 3T37A 1GTEA 4GF7A 3DK4A 3UKQA 4B66A 2WPCA 2OAMA 4DSGA 4RSLA 4B68A 2XLRA 4EMWA 1O5WA 1B4VA 1W4XA 3QFAA 5FS6A 5EOWA 2GEWA 1H86A 3PVCA 4H4QA 2BS4A 3L8KA 3NNEA 2E5VA 4J34A 4H4UA 3GD4A 1OJ9A 1GERA 2E1MA 5M10A 2BA9A 2GB0A 2I0ZA 2YLZA 4DSHA 2B9WA 2ZZBA 5C2TA 4U2LA 2OLNA 4O5QA 3UTEA 1ZY8A 3VRAA 3M12A 2X8HA 2XFOA 4J36A 4NTDA 1F3PA 1N4UA 3REDA 3UKAA 2RGOA 3UKFA 1GV4A 4J56A 2BS2A 3JSKA 4AP1A 4FK1C 4B67A 1YQ4A 2CDUA 4USRA 2GV8A 3V76A 2C66A 4H2NA 3AE8A 4J2WA 4CNJA 3UOXA 3CGCA 1Q9IA 3UKKA 5BUKA 1S3BA 3NG7X 4H4WA 2YR5A 2EQ8A 2GF3A 3IWAA 2JB2A 3E1TA 2YM1A 2UZZA 4H4XA 4RG4A 4TLXA 4WCTA 2H89A 4FX9A 1CBOA 1K4QA 3ATRA 2YLRA 2Z5YA 4HB9A 2WDVA 4A79A 2R0CA 2ZBWA 3QSEA 4AOXA 4B63A 2WOVA 3P4SA 4BJYA 2JK6A 3VQRA 1CJCA 4CCQA 4DNAA 1ONFA 3I6DA 1VRQB 1GRGA 3LZWA 4MJWA 3GDNA 3P9UA 3NK0X 3DJGX 4ZCCA 2WESA 4U8OA 4TLZA 3QSMA 2Q7VA 2B7RA 1D4CA 2VVMA 3HZLA 4J57A 3K30A 3LXDA 4EIQA 1TYPA 3AE6A 1PN0A 2YG4A 1CJ2A 3C4AA 1D7LA 3EPTA 2ZZ0A 3OC4A 1IUSA 3IHGA 1Q1RA 1IUXA 4B69A 1PBBA 2YG3A 4OPTA 2ARDA 1IUWA 3LZXA 3GD3A 2BC1A 2YG5A 4Z24A 4A99A 1PS9A 5KWFA 3AD9B 4BV6A 2YLTA 1LJ1A 1ZOYA 4EQWA 1AOGA 1KFYA 5KXJA 1TRBA 4H4RA 5FMHA 4Z43A 2Q0KA 3FPZA 3QVPA 3AB1A 4XWRA 1GESA 4GRTA 1DJNA 3KU9A 4EQSA 4FK1A 4EQRA 4B1BA 4YTNA
chains in the Genus database with same CATH superfamily
2BK4A 4IDNA 3AAIA 3AB3B 2C64A 4KBMB 4JY2A 1YY5A 3I0OA 4U31A 2WEUA 4QH1A 4N9XA 2R45A 3L1RA 3UKLA 2UXCT 2JQKA 5U1OA 3DGZA 2V1DB 4BK1A 1GRAA 3UKHA 2GR0A 3JAEA 2HQMA 4DR1T 4U72A 3EANA 1FEWA 3C51A 4YSZA 2XFQA 2ZM0A 3O0HA 4WBNE 5EZYE 5J1GA 1YKHB 1YKEB 4BK2A 4DV5T 2XVJA 3ETUA 1ZX9A 1DXLA 3IEEA 3PURA 1D0ZA 2NW7A 1OJDA 3TLUA 3QOFA 2H7VC 4Q4V4 5LGNB 4H4SA 1FJGT 2IC9A 2VOUA 1B7TA 3JADA 5DQVA 4ILUA 3E08A 4HKAA 5CJ5A 3ESLA 4CI1B 1N32T 4QXCB 3CQXC 2W61A 3JD74 4CY6A 2RGHA 1WR6A 5L47A 2BC0A 3P8CD 1CUNA 4DIDB 1DNCA 4UP3A 3N9PA 4ZHQE 1W0BA 1MMGA 1EL7A 4REKA 1NDAA 4K22A 4D03A 1YKJA 3AYJA 4PFPA 5DJQC 2ZM6T 1NHRA 1FEAA 2XQ6A 2WOIA 2XFNA 2QA7A 1P2EA 3SFEA 3NTDA 4JBWF 4X1YE 5AQPB 5GONE 1E2AA 1H7WA 1D1BA 1JEHA 3GN5B 4X64T 3NYEA 1NG4A 3C4ZA 4QKNA 2C76A 3MXZA 1D5TA 2QCUA 5DBJA 5CFBA 3I9YA 2HHHT 3PUGA 4DV0T 4HGAA 4J2CA 4AQFC 3T2YA 3CQGB 4U33A 4YJ3E 4EB6E 1TDEA 2E2AA 2QYWA 2X0YA 3NN0X 3R9UA 3K3OA 3SM8A 3RP6A 4O2AE 1GRTA 1LTXR 4TM1A 1IJ5A 5F3JA 3BI4A 4CXXA 4K0UA 2R46A 3H3AA 5GSNA 3NK2X 1PBDA 4BA9A 2ACZA 3AXJA 2NP9A 1ELIA 1HCIA 1BGNA 1WRDA 3KA7A 2V26A 5M0ZA 2RMU4 2MTQA 4IE7A 3G5SA 2JPFA 4Q4X4 2BCPA 2X5ID 1DJQA 4AKLA 4EEDA 4B3ST 3ZJ1A 5LGTB 2XVHA 3V3OA 3QNUA 4ICYA 2VKJA 4C3XA 1E7PA 3ZKRA 1UK5A 2CA5A 3ZYKA 2R0GA 2YINA 2JQ9A 5L2LA 2XAGB 4MFRA 3N9LA 3JBG4 1D0XA 5JCMA 3PV0F 1T98A 2X67A 5F8PA 3NYCA 3SX6A 4N78D 4OPUA 3ZT6A 3ZSTA 3RP7A 4KP3C 3D1CA 1O3XA 4ZS2A 3H8LA 2BZBA 1V59A 3M13A 3H8IA 2BVMA 5KOXA 5KOWA 1PXCA 3AD7B 2A8XA 1NHSA 1FL2A 5LBMA 3AYIA 2C3CA 5FYMA 1N33T 2A3DA 3VRBA 2K5BB 5TR3A 2WDQA 1D0YA 2XUEA 2CEAA 4DR7T 5JCKA 2XAJB 4A97A 3P50A 2V6YA 1MO9A 3ZCIA 3ZYLA 2HWC4 4JI6T 1VG0A 3UTFA 2W4XA 3VKGA 3AD8B 3KV4A 3COXA 1VG9A 1DOCA 2N1GA 2XQYA 1T7SA 4BJMA 3N2GE 4O4HE 5IUXA 3ALJA 2WB5A 2VZ2A 3CVRA 4H63H 3AECA 4XAXB 1XANA 4GCMA 3RI5A 1YD8G 3S4UA 2KXPB 1EBDA 5EK3A 3NWIA 4KHZF 5BVAA 2EQ9A 1HFAA 2HH7A 3GYXA 2R044 5LJNA 4NZHA 4PNIA 3FBLA 3SWHA 3D8XA 3OZ2A 2JB3A 2CXDA 5U25A 1VBC4 3ZC1A 1E1HB 4YSYA 2C5KT 5JDMA 4H9NC 2VL0A 4X62T 3HA4A 2GQFA 3H4KA 4DMVA 1GOSA 2KZ7B 3ISHA 3AE7A 4YSXA 1IUVA 1WLXA 3KBUA 3LK3B 4ANJA 1MMDA 3ZEFB 5C3JA 2BRYA 5TAOA 5KMPA 1H81A 4JLEA 2XHEB 4X4JA 2QA1A 5A1LA 1NPXA 3KVBA 2IIDA 3BHKA 3Q9TA 2LKGA 2IIUA 3CX8B 4O2BE 3QUJA 2JKCA 5LP6E 5IQ4A 2CWOA 2VKOA 3VU7H 5HEGA 4IVMB 4PW8A 3FZMB 2NWBA 2HN1A 1JNRA 2CFYA 1TDNA 4O4IE 3CMMA 2LSJA 3PU8A 4GAVA 5FVLA 2C73A 4Z91A 1N4VA 3WAJA 4H63V 3RQWA 1CHUA 5LV9A 3LSVA 2J3NA 5IWAT 5AQGB 2LSKA 1NAAA 3SOLA 3FG2P 3P4RA 4U7IA 5L3EB 1H84A 2WPFA 3X1DA 2ZZCA 5BULA 2LKHA 1B37A 3T1HT 3K1SA 2JB1A 4OVIA 2BK5A 4RG3A 1QUUA 4CI2B 2X9YA 4JNQA 4HFIA 3UFGA 1VCTA 4ZZCA 2X8GA 3LK42 1MOKA 3N2OA 2IVDA 4B65A 3UUMA 4AOSA 2WBLA 1IBMT 4XWZA 2MPKA 5L3BB 3SZFA 4GR1A 2YG6A 4DUYT 4EIPA 3JC6D 1GTHA 4ZI3D 4Q4W4 4M52A 4G6GA 1XNRT 3AE2A 2A2FX 3EDVA 1KNRA 4EEBA 2GMHA 3F8RA 3RKOA 4YLHA 4YHJA 5AQTB 5LB7B 2BBHA 2WCAA 2W0GA 4YSHA 1R8IA 5JCNA 1L9CA 3BNUA 3FMWA 1GTEA 3DK4A 2UXBT 2KWHA 2WPCA 3Q5DA 4ZS3A 3L39A 2IMLA 3B5MA 4YY3T 1B4VA 1O5WA 3ZN0B 5EOWA 2GEWA 1T8BA 5AQMB 2VQFT 4PFOA 3F31A 5HXRA 3RC3A 4KHPT 2RS54 2GB0A 2KT9A 3UUNA 3HL6A 4NTDA 4TZ4C 3UQ4A 3J7Yq 5FL0A 2L9QA 4USRA 2C66A 4U3CA 4IDQA 3UKKA 3ONJA 5F5WA 1HS7A 3NG7X 2WZIA 4A98A 2VURA 2GF3A 2JB2A 3D0TA 4WCTA 3HR0A 3Q5WA 4FX9A 3ATRA 2VB6A 2YLRA 3R84B 2PBIA 2RP4A 5FVKA 4H9SE 1CJCA 2UUCT 1VRQB 2GK9A 1GRGA 4JUYA 4MJWA 2J47A 5JVDE 3GDNA 3P9UA 4U8OA 3QSMA 5IYZE 4H9QC 3UQ7A 2YG4A 1CJ2A 2ZZ0A 1EZ3A 2VQET 4WW0A 4P1NA 1Q1RA 3PUQA 1PBBA 1VBE4 3GD3A 4I4TE 2LSGA 4A99A 4GK0E 3AD9B 1ZOYA 1M62A 2VKDA 2DCFA 2XY8B 4Z43A 5CB4E 4XWRA 3AB1A 1GESA 3ANWA 5AQJB 4EQSA 4FK1A 4EQRA 4B1BA 1FIOA 2LRLA 3PUSA 4IDOA 2WP6A 2WMOA 2JQHA 1EL5A 2R9ZA 4DR4T 1LV0A 3P4QA 3RIUA 3ALLA 2X0HA 5AQKB 4JNAA 2E8IA 2V6XA 4EZHA 4JEUB 4NPPA 1BR0A 4U8KA 2OA1A 2NTXA 5AFUL 2X9WA 4IGUA 4TM0A 2EHOB 1X31B 2AR8A 2C75A 2YVFA 2VQBA 4P09A 2CM0A 2YR4A 4Y4MA 1S35A 4KPRA 2EHOA 5KDMC 5HXSA 3PJAA 3V5UA 4H4VA 2X51A 4NXNT 3EHZA 4OYJA 2LOSA 1XHZA 1AR74 3TKLB 2RPAA 1CJ4A 3H37A 2SPCA 4LMJA 1GALA 5FMNA 4MALA 3AE3A 1LQTA 4ZZBA 2BXSA 2FJDA 3VRDB 3ZYMA 5FY1A 2EHOD 1K0JA 2YDSA 2LSIA 3CPZA 4DR3T 4GDPA 2Q9QA 3DJBA 3UP5A 2G0UA 1E1KA 2GH5A 1QLBA 4II2A 1KNZA 4EXTA 3UKPA 4ZN0A 4UDRA 3B6DA 2QGSA 2UU9T 4H7UA 3T2KA 4CCRA 1QJDA 3U3IA 2A87A 4B3MT 1MMNA 3ZT5A 1ZKEA 1PO24 3F57A 4UIGA 3GQKA 4HWFA 3AE5A 3ICRA 3PDYA 4JV5T 3UULA 4IE6A 1GRBA 1T72A 3T0KA 5LMNT 2BKOA 4JDRA 1PBCA 4DR2T 4HFBA 2Q9QD 1HF8A 3IBPA 5L3GB 2LM2A 3IC9A 4G63A 1GPEA 2R6GF 1TYTA 4NUUA 4BAYB 1PXBA 3EF6A 1KEYA 1IZNB 4YTPA 1U4QA 4H4PA 5IQ1A 3QK6A 4HA6A 4GK5E 2NR4A 4IE0A 3JC6C 4ZI3C 3AE4A 2E9XB 1JRYA 4K0KT 2AXDS 3FZLB 4IDPA 4LU6A 2V7JA 2V61A 3KINB 3NZQA 3ONLC 2M67A 4UXNB 4TN7B 2VRLA 2BVLA 4DO0A 1RUH4 2WDRA 2Z6EA 4I58A 3T31A 2YLSA 2WAUA 4TV8E 5HXHA 3UU6A 2ODVA 3FHNA 3OVUA 2CHOA 3F8DA 2K9AA 1OWAA 4H9OC 2XVIA 4HFEA 4IL4A 4TNWA 2JIWA 2XQ8A 4F6RC 2F5ZA 4B6XA 3ZYXA 2LLYA 2V5ZA 4AXPA 1GSNA 1Y56B 1KSUA 4NTEA 2E9XD 3VKHA 3RHWA 3NH3X 4Y4NA 4UV9B 2CMRA 5H6RB 4ZOLE 1Y56A 1J5WA 2C67A 2XJ7A 2XCGA 3HYXA 5J7XA 5U63A 5JCLA 3RC8A 2XQAA 2WZHA 4CZZB 4H4TA 3O1JA 3WE0A 5ETWA 2R4JA 3KVAA 3IA3A 1HRI4 4X1KE 1VBD4 4H50A 2ZMAA 2WHDA 4XZCA 3CNPA 5HEJA 4YKFA 2HPLA 5AQQB 3OPCA 1ZK7A 4U8PA 1RUI4 2XAHB 3CQCB 1O95A 1H7CA 2W66A 3KV9A 5H6QB 2ACXA 4C5OA 1HX1B 1XDIA 4GDEA 4TV9E 3P4PA 2D5UA 1Y0PA 3QB5A 3WAKA 4AISA 2BABA 5HWXA 2W2UA 2EQ6A 2V3BA 1PJ7A 3ADAB 2X66A 2KNDA 3FI7A 2J1DG 3U78A 2M6IA 2MOZA 1KF6A 4ILAA 3ZPOA 1NEKA 5JQGE 1N4WA 3ZT7A 4WYVA 2DI4A 2GVCA 4KI0F 4BJNA 2XPKA 3TLVA 3VHLA 3UT5E 4A5XA 1L9EA 3OYXA 2Y6XA 2QA2A 4P0AA 1UGOA 1X79A 5HEHA 2L3LA 5DQWA 4YT0A 3SZCA 5HXIA 4O4JE 2MBGA 5LHGB 2XVEA 2AQJA 1F6MA 1AJ3A 4OPIA 3K3QC 3SRZA 2QRXA 2WP5A 1ZP0A 4PK5A 1F8WA 2X9HA 3NRYA 3RHAA 4EMJA 4DBQA 3CIRA 4A9WA 4D04A 4IA5A 4PJLA 4UVAB 3EI0A 4EZ4A 4U8NA 3O1HA 5FY0A 5CKUA 3KPFA 1NENA 1Z0PA 4H9PC 3SZWA 4OPDA 4CN6A 5JH7E 3N2KE 4NEWA 4NTCA 2CULA 2UXNB 3ZSSA 4EM4A 2BKPA 3NKZA 3AXJB 5AQOB 2YAUA 3CPHG 4LA1A 5JDLA 4OPCA 1PJ5A 1IUTA 2I59A 3UTHA 3RRCA 1EL8A 2IDOB 3ZJ2A 4HFCA 2PLV4 3AEGA 4J31A 5FNVE 2EHOC 2YK0A 4YKGA 4DV7T 4JYAT 2HN2A 3CK6A 1CC4A 5LNKA 3B13A 4LF6T 3LDQB 5LCYA 4OPGA 1N34T 2V7IA 4DV6T 3T2ZA 2UXXB 2ES0A 5FY7A 3GRTA 1OOPD 3BQIA 5LHHB 4GYSA 1H6VA 2RABA 4JN9A 1COV4 1D7YA 2WWVA 2JMHA 4CXYA 1GT8A 4JI8T 2GAGB 1L9DA 2V7LA 4AIUA 4U2YA 3OJAA 2JBVA 2H3RA 3I0QA 3ZMSB 1ZMCA 1DU2A 2XM1A 2V60A 1CJ3A 3G06A 4IV9A 4UELA 2DWKA 4AKRB 2GRTA 4AT2A 3RYIE 2XQ9A 1WFDA 2WP9A 1DODA 1FOHA 3DA1A 2VK9A 4L5GA 3LK2B 1S94A 3N9MA 4A7AA 1XMOT 2GMJA 2WOWA 2V6YB 2CXFA 4G2AA 3M3ZB 1LVLA 3RYFE 4LF8T 1KSSA 3AAEB 1I94T 2VQ7A 1LVFA 2D9DA 2BXRA 4YWOA 5LA6E 4C74A 3RGLA 4LF5T 4ADWA 2WU5A 2XLSA 3A7MA 2C5IT 3CPIG 3T37A 4I43B 4DSGA 2OAMA 4PK4A 2K24A 4RSLA 2XAQB 5JDHA 5FS6A 4H4QA 3L8KA 2LOPA 2E5VA 3GD4A 3J9X1 1OJ9A 4GOUA 4CN1A 1GERA 4U2ZA 3SS1A 4ADZA 2VVSA 4OX9T 2BA9A 2I0ZA 2E9XC 3CWZB 2OLNA 4O5QA 3UTEA 4JI0T 1F3PA 1GV4A 5IHYA 2BS2A 4AP1A 4XBFB 4CNJA 3V76A 2GV8A 3PUXF 4J2WA 4CXWA 2XM2A 1H8TD 2WMNA 1S3BA 1XWMA 2P9BA 2YR5A 4G6HA 2W67A 2KMFA 4ISTA 3RPUA 4TLXA 1K4QA 2WDVA 1BR1A 2R0CA 4AOXA 2NW8A 1ZEEA 4BJYA 1NAFA 2CBJA 2XASB 3QB5K 1ONFA 1D1AA 3SXIA 3NK0X 3DJGX 5JDFA 4YFSA 2C0SA 4TLZA 2Q7VA 2B7RA 5ABEA 1G8XA 2VVMA 3HZLA 4WNKA 2K3WA 2CLYB 2JRKA 3C4AA 3OC4A 3NRXA 3DP7A 3V5SA 4B69A 1IUXA 4OPTA 3Q2MA 1EV14 1IUWA 3EDUA 3LZXA 1SUMB 4B3TT 2BC1A 4Z24A 3BK9A 2YLTA 4NUVA 4EQWA 2CRBA 1VBA4 1AOGA 4H4RA 5EK4A 3QVPA 4GRTA 4HWDA 1DJNA 1UCUA 1HXS4 4U7YA 2IC6A 2F4VT 4ZCDA 5E0OA 2JMKA 3C96A 3GWFA 2GAHB 5HCJA 4H2RA 1RUE4 1J5ET 1VRBA 3PUVF 1XNQT 2OLOA 4QX7B 3CNJA 1PVC4 4U8JA 3UU8A 2PZSA 1LKXA 2IVEA 2PW9A 2ZLYA 2FJBA 4Z25A 1COYA 1BGJA 1YQ3A 2W0HA 4A6NA 1BKWA 4ZEYA 1TDOA 1D1CA 4PAAA 1DOEA 1UX5A 5AQUB 2CVJA 3HI2A 2PYJA 3VR9A 3ICTA 4A65A 4CN4A 2Z5XA 3EABA 1PBFA 4YXDA 5ABFA 1OJAA 3GDPA 4K2XA 3HKCE 2WS3A 2B9YA 2WSSV 1W0AA 4KMCA 3CX7B 2YN6A 3P1WA 5FXXA 2WU2A 3MACA 2EQ7A 2BG9B 2Y6QA 3DJDA 3NLCA 1RMU4 5LOVE 2YDQA 3OYZA 1SHZC 4NXMT 4OCGA 2YR6A 4X66T 1H82A 2R064 1E1LA 1OJTA 5CGMA 3KPKA 4AT0A 3B3RA 3G5RA 2BG9A 5FL1A 3VR8A 3H3MA 3RIAA 2FJEA 4HE8A 4FI5A 3UOZA 2H7OA 3RIFA 3KLJA 3J8F4 3ZDNA 4CRTA 3MZKB 5FKYA 1VBB4 4DGKA 2CCQA 3OTOT 4G74A 1F8SA 4Q25A 2YU1A 3LJCA 4L9IA 1GRHA 2XSAA 3W15B 2B1EA 3CPJG 4Z8XA 4WZXA 3QC9A 2XQ4A 3ALMA 5KMSA 4CNKA 4AP3A 2XQ3A 1Z7S4 1HNWT 2YWLA 3PUYF 2ZM2A 3CGBA 4H4YA 2QVAA 3EAMA 5LG3A 1P2HA 3UU5A 4NEVA 2KINB 1VDCA 1UKVG 3CNSA 5AQLB 1RP0A 4LMLA 2OALA 3DJEA 3AA0B 4H9RC 4B64A 3ANWB 1NCQD 3BQLA 2KSRA 4EQXA 3TLSA 2LE8A 4QX8B 2WM9A 1HR0T 1RSGA 3GA8A 2BK3A 3C50A 5EB4A 3HYVA 1EAH4 4RHV4 2FJAA 2RS34 4IE5A 2DKHA 4PABA 3AEAA 4I55E 5FP3A 3ZCJA 4UR9A 2V6OA 4U2SA 4K8DA 2KWIB 5J2UE 1WYBA 4HWIB 3RH3A 2DWGA 4YHHT 4EIWA 1IJHA 1VQWA 1TDKA 4JI2T 5KVHA 3KBTA 4GAPA 1H83A 1LRZA 2B9XA 3AYLA 1JNZA 4DV4T 4ZI2D 2XFPA 2WETA 4U8LA 3UTKA 1IJ6A 1VOMA 4LMKA 5FXZA 3CNDA 3KDSE 3CNTA 4GKKT 3GMIA 2XAFB 2Q9QB 4ILBA 3C98B 4I59A 3PS9A 1REOA 2XLUA 3GRSA 2GR2A 3BNMA 2V8SV 5DABA 2BCGG 3FB2A 5BMVE 2JAEA 3NZPA 3K3NA 3A5XA 4EYUA 4GB34 3ZMZB 4EV6A 2TPRA 4MLKA 1RUG4 3SYIA 2YVGA 4OHFA 2A9UA 1US7B 1IBKT 4U74A 3FIMB 3M65A 2HPJA 3ZMVB 3BI5A 5BRTA 2MYSA 2Y6RA 3NK1X 2X8CA 1BR2A 1XHCA 1HX8A 4EMIA 2D2SA 3SFDA 2CXLA 2AE9A 4DV3T 1QO8A 3SGLA 3N9NA 3EAOA 2V3AA 5FS7A 2CLYC 3PUWF 1X9BA 2PYLA 1BR4A 5KVIA 4ILCA 1OJCA 4FDCB 4NWZA 1ZMDA 3AEFA 3N5LA 4E0VA 5ADXL 5EBKA 1AR94 1E1NA 3CGDA 2C3DA 2LFCA 2LHRA 5L46A 2A72A 3C64A 3MA9A 1SA0E 2IAKA 1NHPA 2LRKA 4Z26A 1RUD4 3K7QX 4DBRA 3CN8A 1ZOVA 3AEBA 4U8IA 2GR1A 3KVEA 2WBAA 4TM3A 3CX6B 1FECA 1SE7A 4C91A 4ECHA 5HYAA 2DL1A 5HEOA 4APNA 3DH9A 1XZYA 4Z2TA 4A5LA 2WQYA 4ZXLA 3T8OA 1I6ZA 3QJ4A 3GYIA 2V7MA 3NKSA 4UF0B 1YQZA 3KKJA 2PTFA 3OKQA 4IE4A 2XQ7A 1BWCA 5FS8A 5LG4A 4JQ9A 3CKDA 3ONXA 2BS3A 3GMBA 2W63A 5KNLA 5JTGA 4O5UA 3QFBA 4UF0A 1AR84 2R0PA 4K7ZA 5BR8T 1BEV4 1GRFA 5FS9A 3C4WA 1GXFA 1XHXA 3UU4A 4C3YA 4OK0A 1HG5A 3PU3A 1GQEA 4LF7T 1FEBA 3NYFA 3NGCX 1RUJ4 4YTMA 2X50A 4AI6A 5JR9B 1PBEA 1UX4A 1B8SA 4LF4T 1SEZA 3KFWX 1PDHA 1RUF4 4DMWA 2Y8DA 3ZC0A 4QHOA 2BG9C 3LOVA 5JR9A 1BZLA 2YKSA 4LF9T 1GETA 2OV9A 3DMEA 3A8YC 3NRNA 1FMWA 4AKGA 2C70A 3K7MX 2CWYA 4H2PA 4TNVA 1RUC4 3ZMTB 1Y01A 2YM2A 3MK7C 1BF3A 1M6IA 2RS14 2NPXA 4LFAT 3PUZF 2CE7A 3GSIA 2XTLA 3I3LA 5LYJE 4JI7T 4G73A 5KX5E 3ZMUB 1M7KA 4MBQA 4O8SA 3NHOX 1R094 3RYHE 5HAXA 3SY4A 3KV6A 3LJPA 3NN6X 4OFZA 4EYYR 4B66A 4B68A 4EMWA 4JI5T 1W4XA 3UUBA 4COFA 4ZI7E 2BS4A 4J34A 2E1MA 3NVOA 5M10A 4HWHA 4DSHA 1Y64B 2ZZBA 4U2LA 5L3FB 4IDZA 3Q5EA 5J0ZA 3M12A 2ZM8A 3REDA 4M1PA 1N4UA 1WR0A 2RGOA 5LMUT 2D0TA 4J56A 3RQUA 4DR5T 4FK1C 4B67A 1YQ4A 4IIJE 4ERRA 2CDUA 4H2NA 2LT3A 3UOXA 3PE0A 1Q9IA 3RIUC 1NA1D 5AQFB 3O1IA 3E1TA 2UZZA 4RG4A 5C8YE 4HEAA 2VASA 4ZI2C 2ZBWA 4B3RT 4B63A 1HRV4 2D0UA 2VL8A 4WBOA 3BQKA 3GN5A 2JK6A 4CCQA 4DNAA 1HTJF 4JI4T 3K30A 4EIQA 3EVYA 3FZFB 3AE6A 1VRH4 1MMAA 1D7LA 3IHGA 2NW9A 3R6NA 2YG3A 4IT4A 2YDRA 3L3PA 3LBXB 3CMLA 2YG5A 5KWFA 2OA5A 4GIWA 2LJLA 2XSBA 5KXJA 2BG9E 4L0RA 2R074 3FPZA 3LBXA 1W9RA 2V5DA 2X0LB 3FBZA 4IREA 1XI1A 3RLFF 4QH4A 4X9NA 1AR64 4GKJT 4UDPA 2VVNA 4EM3A 2Q9QC 1E1MA 3FBSA 4X65T 3SZ0A 1MNEA 4XXGA 5HY5A 2PYXA 3KD9A 1RVF4 4II3A 1ZKQA 3SQPA 3T14A 5CQFA 2EX3A 3NTAA 1S3EA 3PO7A 3N9QA 3RKGA 4DV1T 3ICSA 3PUAA 5JCIA 2R4EA 3QVRA 5KMGP 2V7KA 1MNDA 5HEUA 3LB8A 4I0UA 5AQIB 3AA6B 4IVOB 3AEDA 5L4EA 3N9OA 4H2QA 2XLPA 3CGEA 4Y4LA 4PK6A 3P4WA 3AWIA 3SUCA 1OEDB 2RM24 1LVKA 4PJMA 1NG3A 1RHI4 3HKBE 3WI3A 2Q6UA 4AKHA 4UDQA 2OLTA 4EOZB 5AQNB 2IHR1 5J2TE 1S2QA 3RNMA 1IUUA 1LQUA 3AAAB 5LBQB 2Y48B 1OEDA 2PHHA 4K5SA 4Z44A 4C77A 3AXBA 4PDWD 2ODUA 4JEHB 3BHFA 3I1AA 4PJJA 3DK9A 2XDOA 2BDEA 5IPYA 4QWNB 1CC6A 3IF9A 2C4CA 3V3NA 2GQWA 3S5WA 1AL24 1KNPA 3I9WA 1J1JA 4HFVA 5HXEA 3DJJA 1L0VA 1PJ6A 2LM9A 1KK7A 2BACA 3UOYA 3K8PC 3QSSA 2APGA 2Q0LA 3IHRA 1HNZT 5GRTA 4AKIA 4KX6A 2DNXA 3NT6A 3ZLIA 4C90A 1PXAA 4Z2RA 4X5TA 4CY8A 3O9XA 3FZHB 2YU2A 5JDGA 1HNXT 3FZKB 1U5PA 2X3NA 2XFUA 5JDNA 1E39A 1LPFA 1MIVA 2BBJA 1RYIA 2L8KA 4TM4A 5ER0A 2RA1A 4BURA 3Q5XA 3AVRA 4HTEA 1B5QA 2O9ZA 2FUPA 1V9DA 4LFBT 1ASJ4 1MQTD 3AEEA 5JREA 1N36T 5ABHA 3HKEE 5JR9C 3AE1A 1CC2A 1TDFA 3BI2A 3CTYA 4ASKA 4ISSA 5HCMA 1JRZA 3HYWA 4CI3B 2IUBA 4UEMA 4WX1A 1FMVA 1K5MD 3ETVA 2A89A 4E7ZA 2UUBT 4BK3A 4UVBB 3LADA 3NIXA 4P9SA 3UUXB 2GR3A 2N2NA 1MIYA 2R7FA 1Z8UA 2I6HA 4U2TA 2LHNA 4A6NB 2YG7A 1M64A 3RF1A 5AQHB 5FXVA 2TMDA 3AA1B 1XPQA 4QXHB 2YLWA 2RR14 4DV2T 3ATQA 3LG7A 4QH5A 3NBXX 1H7XA 4LIIA 4AQYT 3T1YT 3UU3A 2I0MA 3II4A 1Q1WA 2PJQA 4CBQA 3C4NA 5ABFB 1EL9A 5KMQA 5KRQA 1XMQT 2C65A 2C7GA 1CF3A 2BYBA 1UURA 4GUVA 5M4YA 4J33A 2VKHA 1IBLT 1JU2A 2WPEA 3F8PA 1KDGA 3GQHA 2KLQA 1O94A 4BJZA 2PG8A 1MIWA 2QAEA 3E22E 1PIV4 2WY2A 2NVKX 5EB5A 3DK8A 4UV8B 1ZDLA 2AAQA 2UUAT 3TLWA 4OPLA 4USQA 2H88A 5HXCA 4UVCB 1OXZA 3OBVE 1WYCA 3K7TA 1YW0A 4DUZT 2B76A 2X9XA 4E7SA 3EUHA 1UUSA 4HFDA 3O4XE 2DKIA 3GMCA 3UTGA 3L09A 2RGJA 3URHA 2XVFA 5L4HA 1MXTA 5L3CB 4OYKA 5EK2A 1K0IA 4Z2UA 1JRXA 3UCLA 3Q6JA 3B57A 2N9DA 3GWHA 4IHJE 2JQQA 2XZEA 4DNDA 2JJ9A 2DLRA 2YQUA 1GEUA 5JRCB 3IHMA 2BKNA 1F8RA 4TWDA 4X9MA 4K5RA 5HYMA 3MKDA 2WWUA 2VVLG 5JRCA 2M6BA 2X99A 4FJOA 3L8RA 3GWDA 3FXDB 4U8MA 3ITJA 5LXTE 4IL9A 1N1PA 1XDPA 1XDOA 2B7SA 2PFVA 5J60A 2PY5A 3UP4A 3FXEB 4JI1T 5HHFA 1W09A 2E5LT 3AA7B 2C72A 4AQFA 4DR6T 2FBWA 1OEDC 1G73A 3KV5A 5CA1E 2CPTA 1Z6LA 1HYUA 3TLTA 2DHRA 1D4DA 1IAPA 5LHIB 1GREA 3DGHA 4JY3A 3AE9A 1NWMX 3RP8A 3S61A 3JAFA 2IW5B 1CL0A 1D4EA 4O4LE 1PHHA 4EGWA 5FXWA 3G5QA 2YOEA 1ZHCA 2CBIA 2W62A 2YVJA 2YEVC 5JDQA 1GNDA 4LFCT 1JOAA 3UOVA 5L3DB 4PAGA 5LJMA 1S2YA 1YXRA 2E4GA 5AQRB 3GYJA 4H4ZA 1NHQA 1D4M4 1DOBA 2YLXA 1VCSA 3LFMA 2XLTA 4JI3T 1E6EA 4A56A 1FCDA 5KMRA 3ABVA 2XYOA 4IA6A 1K0LA 4MHCA 2BRAA 1WCRA 2VRMA 3M0OA 2VVLA 3RRWA 3UKQA 3PJAJ 4GF7A 3JCFA 4Z90A 2LEHA 2XLRA 3QFAA 3UFEA 1H86A 3PVCA 3PTRB 5HWYA 3NNEA 4X20E 4Q4Y4 2MAWA 4H4UA 3F2EA 2XQ5A 4F8HA 3ZN1B 3IF8B 3E0ZA 2J62A 3DTOA 2YLZA 2B9WA 1HG2A 5C2TA 3MJXA 3AVSA 2CHNA 5LGUB 1ZY8A 3VRAA 2X8HA 2V5CA 2XFOA 2X68A 4TX5A 4J36A 3UKFA 3UKAA 4QXBB 4YJ2E 3JSKA 2K48A 4HN9A 3AE8A 4HWCA 3CGCA 4TUYE 5BUKA 4H4WA 4HFHA 4TWFA 2EQ8A 4NNJA 3IWAA 2YM1A 4H4XA 4TWHA 2H89A 1CBOA 4A79A 4HB9A 2Z5YA 3QSEA 4EAHA 2WOVA 5ABGA 3Q9DA 2VWAA 4P0BA 1POV0 4CQIA 3P4SA 2J4GA 4I50E 4X1IE 3VQRA 3I6DA 3LZWA 4G9KA 4DVDA 3P7IA 5CA0E 4ZCCA 2NTYA 2WESA 1R084 4NIQA 4PJNA 1D4CA 3RYCE 4J57A 1OEDE 3LXDA 1TYPA 1PN0A 2W00A 4KUMB 3EPTA 5AQVB 1IUSA 2C5JA 2ARDA 2NOXA 2LSYA 2E9XA 1PS9A 3HKDE 4BV6A 1QSDA 5AQSB 1LJ1A 3C4XA 4GYRA 1KFYA 1TRBA 5FMHA 2UXDT 2Q0KA 4AQGA 3RX6A 3KU9A 1PO14 1ZV4X 2HWB4 4V1Av 4YTNA
chains in the Genus database with same CATH topology
2WP6A 4X9NA 2BK4A 4ZCDA 2C64A 1EL5A 2R9ZA 1LV0A 3C96A 3GWFA 4JY2A 4UDPA 1YY5A 4EM3A 3P4QA 2GAHB 1E1MA 3ALLA 2WEUA 4JNAA 3FBSA 4N9XA 3SZ0A 4H2RA 4XXGA 2R45A 3L1RA 4U8KA 3UKLA 2OA1A 5HY5A 5U1OA 2PYXA 3DGZA 2OLOA 3KD9A 4TM0A 1GRAA 4BK1A 3UKHA 2GR0A 4II3A 1ZKQA 3SQPA 3CNJA 1X31B 2AR8A 2C75A 2HQMA 4U8JA 3T14A 5CQFA 3NTAA 2YVFA 1S3EA 2IVEA 3PO7A 2VQBA 3EANA 3ICSA 4Z25A 2FJBA 2YR4A 1COYA 5JCIA 1BGJA 1YQ3A 2R4EA 3QVRA 4Y4MA 4YSZA 2W0HA 2XFQA 4KPRA 3O0HA 4A6NA 1BKWA 1TDOA 4PAAA 3LB8A 1DOEA 4H4VA 4IVOB 2CVJA 4BK2A 2XVJA 3AEDA 4H2QA 3VR9A 2XLPA 3CGEA 3ICTA 1ZX9A 1CJ4A 1DXLA 4Y4LA 3AWIA 3SUCA 1OJDA 4A65A 1GALA 1NG3A 2Z5XA 3AE3A 1LQTA 1PBFA 4YXDA 2Q6UA 2BXSA 4UDQA 2FJDA 4H4SA 3VRDB 1OJAA 2VOUA 3GDPA 1S2QA 3RNMA 1IUUA 4K2XA 1LQUA 2PHHA 2WS3A 2B9YA 4K5SA 4Z44A 4C77A 3AXBA 1K0JA 3BHFA 4GDPA 3P1WA 4CY6A 2EQ7A 2WU2A 2RGHA 3DK9A 3DJDA 2Y6QA 2XDOA 3NLCA 3UP5A 5IPYA 1E1KA 2BC0A 2GH5A 1QLBA 4II2A 4OCGA 1DNCA 2YR6A 1CC6A 1H82A 3IF9A 4UP3A 1E1LA 1OJTA 3UKPA 2C4CA 4ZN0A 3KPKA 2GQWA 3B6DA 3B3RA 1KNPA 1EL7A 4H7UA 4UDRA 3S5WA 3T2KA 4CCRA 1QJDA 3G5RA 2A87A 1NDAA 4K22A 4REKA 3VR8A 4D03A 1YKJA 2FJEA 3AYJA 2XFNA 1NHRA 1L0VA 3DJJA 1FEAA 1PJ6A 2WOIA 3UOZA 3AE5A 3ICRA 3GQKA 2BACA 3UOYA 3KLJA 1P2EA 3ZDNA 4CRTA 3SFEA 3NTDA 4DGKA 1GRBA 3QSSA 3T0KA 2APGA 4JDRA 1PBCA 4G74A 1F8SA 1H7WA 2Q0LA 1JEHA 1GRHA 3NYEA 1NG4A 3CPJG 5GRTA 3ALMA 4KX6A 2C76A 3NT6A 3IC9A 4CNKA 1D5TA 2QCUA 1GPEA 5DBJA 1PXAA 4AP3A 4Z2RA 5KMSA 1TYTA 4CY8A 1PXBA 3EF6A 4YTPA 3T2YA 2YWLA 4H4PA 5IQ1A 3CGBA 2X3NA 2XFUA 4H4YA 1E39A 1LPFA 4HA6A 1TDEA 3NN0X 1RYIA 1P2HA 3R9UA 4TM4A 3SM8A 3AE4A 5ER0A 4NEVA 3RP6A 4BURA 1JRYA 1VDCA 1UKVG 3CNSA 4LU6A 1B5QA 1GRTA 1LTXR 2O9ZA 4TM1A 1RP0A 2V61A 2OALA 3DJEA 4B64A 3AEEA 1CC2A 3BI2A 3AE1A 1TDFA 3BI4A 3CTYA 4EQXA 2VRLA 2R46A 5GSNA 2WDRA 3NK2X 1RSGA 1JRZA 1PBDA 4I58A 3T31A 2ACZA 2YLSA 3HYWA 2BK3A 1ELIA 4WX1A 1BGNA 3KA7A 5M0ZA 5EB4A 3HYVA 3F8DA 3G5SA 2A89A 2XVIA 2BCPA 1DJQA 2FJAA 4BK3A 2F5ZA 3LADA 3NIXA 4P9SA 3ZYXA 2V5ZA 4PABA 2DKHA 2XVHA 1GSNA 1Y56B 3AEAA 1KSUA 2GR3A 4ICYA 3V3OA 4C3XA 4NTEA 1E7PA 3NH3X 2R0GA 4U2TA 4Y4NA 4A6NB 2V6OA 2YG7A 1M64A 4U2SA 1Y56A 2TMDA 4K8DA 2C67A 5JCMA 2XCGA 3HYXA 5J7XA 1XPQA 3NYCA 5U63A 5JCLA 3SX6A 4AT0A 4OPUA 2YLWA 4H4TA 3RP7A 3WE0A 2R4JA 3ATQA 1IJHA 1VQWA 3D1CA 1TDKA 5KVHA 1H7XA 4H50A 4GAPA 4LIIA 1H83A 2B9XA 3AYLA 1JNZA 3H8LA 3II4A 2WHDA 1V59A 1Q1WA 3M13A 2XFPA 3H8IA 3C4NA 3CNPA 2WETA 1EL9A 4CBQA 4U8LA 5KOXA 4YKFA 5KOWA 1PXCA 5KMQA 3AD7B 1ZK7A 2A8XA 3CNDA 4U8PA 5KRQA 1NHSA 1FL2A 3AYIA 3CNTA 2C3CA 2C65A 2C7GA 1CF3A 2BYBA 4GUVA 1O95A 4J33A 3VRBA 5TR3A 2WDQA 1JU2A 4C5OA 2WPEA 4I59A 3F8PA 1XDIA 3PS9A 1REOA 4GDEA 2XLUA 3GRSA 2GR2A 3P4PA 1Y0PA 3BNMA 5JCKA 2BCGG 1KDGA 2BABA 2EQ6A 2V3BA 1PJ7A 3ADAB 3GQHA 2JAEA 1MO9A 1O94A 4BJZA 5JCNA 1VG0A 2QAEA 3UTFA 1KF6A 2NVKX 2TPRA 5EB5A 1NEKA 3AD8B 3DK8A 1N4WA 3COXA 1VG9A 1DOCA 2YVGA 1ZDLA 3SYIA 2GVCA 2AAQA 3ALJA 2VZ2A 3FIMB 4OPLA 4USQA 2H88A 3AECA 3BI5A 5BRTA 1XANA 1L9EA 4GCMA 2Y6RA 3NK1X 2X8CA 2QA2A 1XHCA 4EMIA 3K7TA 3SFDA 2B76A 4YT0A 1EBDA 3SZCA 5HXIA 1QO8A 2XVEA 2AQJA 1F6MA 3SGLA 5BVAA 2EQ9A 3EAOA 2V3AA 5FS7A 4OPIA 2DKIA 3GYXA 5KVIA 3GMCA 3UTGA 2RGJA 1OJCA 2WP5A 4NZHA 4FDCB 4NWZA 3URHA 1ZP0A 1ZMDA 3D8XA 2JB3A 2XVFA 1F8WA 3AEFA 3OZ2A 5U25A 4E0VA 3RHAA 1MXTA 4YSYA 5EBKA 4EMJA 3CIRA 1E1NA 4A9WA 3CGDA 2C3DA 4IA5A 4D04A 2LFCA 1K0IA 2GQFA 3H4KA 5L46A 4U8NA 1GOSA 5CKUA 3ISHA 3KPFA 3AE7A 1NENA 4YSXA 1IUVA 1JRXA 1NHPA 3UCLA 3SZWA 4Z2UA 4Z26A 4OPDA 3Q6JA 3K7QX 4NEWA 5C3JA 2BRYA 3CN8A 1ZOVA 4NTCA 3AEBA 2CULA 4U8IA 1H81A 5KMPA 2GR1A 4EM4A 3KVEA 2YAUA 2YQUA 2QA1A 2WBAA 1GEUA 1NPXA 3CPHG 4LA1A 4TM3A 4X4JA 4OPCA 1FECA 1PJ5A 1IUTA 4ECHA 3UTHA 2IIDA 3IHMA 4APNA 3DH9A 4Z2TA 3BHKA 3Q9TA 4A5LA 1F8RA 1EL8A 4X9MA 2WQYA 4K5RA 5HYMA 3AEGA 4J31A 2VVLG 2JKCA 3QJ4A 3GYIA 4YKGA 2X99A 5IQ4A 3GWDA 3NKSA 4U8MA 4IVMB 3ITJA 1N1PA 1CC4A 1JNRA 1YQZA 1TDNA 2CFYA 3KKJA 4OPGA 2B7SA 3CMMA 1BWCA 3T2ZA 3GRTA 5FS8A 5J60A 4JQ9A 4GAVA 2BS3A 3UP4A 2C73A 3GMBA 5KNLA 5HHFA 2RABA 1H6VA 1N4VA 4O5UA 3QFBA 4JN9A 1CHUA 5LV9A 1D7YA 1GT8A 2R0PA 2C72A 4K7ZA 2GAGB 2J3NA 1GRFA 2FBWA 1L9DA 5FS9A 1GXFA 1NAAA 4C3YA 1Z6LA 3FG2P 1FEBA 1HYUA 3NYFA 2JBVA 3NGCX 3P4RA 4YTMA 2X50A 1H84A 1PBEA 1D4DA 1ZMCA 1GREA 2WPFA 2ZZCA 3DGHA 4JY3A 1B8SA 3AE9A 5BULA 3RP8A 2V60A 1B37A 1CJ3A 1SEZA 3S61A 4IV9A 1PDHA 2GRTA 2JB1A 4AT2A 1CL0A 2BK5A 4OVIA 4RG3A 2WP9A 1D4EA 3LOVA 1PHHA 4JNQA 1DODA 1BZLA 2X8GA 1FOHA 1MOKA 3G5QA 1GETA 3DA1A 2IVDA 3DMEA 3NRNA 4B65A 4AOSA 2C70A 2YVJA 3K7MX 4XWZA 4A7AA 4H2PA 3SZFA 1GNDA 4GR1A 2YG6A 2GMJA 2WOWA 2YM2A 4EIPA 1BF3A 1JOAA 3UOVA 1LVLA 1GTHA 1M6IA 1KSSA 4M52A 1S2YA 2E4GA 2NPXA 4G6GA 3GYJA 2VQ7A 4H4ZA 3AE2A 3GSIA 1NHQA 2GMHA 1KNRA 1DOBA 2YLXA 3F8RA 3I3LA 2XLTA 4G73A 2BXRA 1E6EA 4YWOA 1FCDA 5KMRA 4C74A 3ABVA 3V3NA 2XYOA 3NHOX 4IA6A 4YSHA 4ADWA 1K0LA 2WU5A 2XLSA 2BRAA 2VRMA 3M0OA 3SY4A 2VVLA 3CPIG 1L9CA 3BNUA 3FMWA 3LJPA 3NN6X 3T37A 1GTEA 4GF7A 3DK4A 3UKQA 4B66A 2WPCA 2OAMA 4DSGA 4RSLA 4B68A 2XLRA 4EMWA 1O5WA 1B4VA 1W4XA 3QFAA 5FS6A 5EOWA 2GEWA 1H86A 3PVCA 4H4QA 2BS4A 3L8KA 3NNEA 2E5VA 4J34A 4H4UA 3GD4A 1OJ9A 1GERA 2E1MA 5M10A 2BA9A 2GB0A 2I0ZA 2YLZA 4DSHA 2B9WA 2ZZBA 5C2TA 4U2LA 2OLNA 4O5QA 3UTEA 1ZY8A 3VRAA 3M12A 2X8HA 2XFOA 4J36A 4NTDA 1F3PA 1N4UA 3REDA 3UKAA 2RGOA 3UKFA 1GV4A 4J56A 2BS2A 3JSKA 4AP1A 4FK1C 4B67A 1YQ4A 2CDUA 4USRA 2GV8A 3V76A 2C66A 4H2NA 3AE8A 4J2WA 4CNJA 3UOXA 3CGCA 1Q9IA 3UKKA 5BUKA 1S3BA 3NG7X 4H4WA 2YR5A 2EQ8A 4G6HA 4NNJA 2GF3A 3IWAA 2JB2A 3E1TA 2YM1A 2UZZA 4H4XA 4RG4A 4TLXA 4WCTA 2H89A 4FX9A 1CBOA 1K4QA 3ATRA 2YLRA 2Z5YA 4HB9A 2WDVA 4A79A 2R0CA 2ZBWA 3QSEA 4AOXA 4B63A 2WOVA 3P4SA 4BJYA 2JK6A 3VQRA 1CJCA 4CCQA 4DNAA 1ONFA 3I6DA 1VRQB 1GRGA 3LZWA 4MJWA 3GDNA 4G9KA 3SXIA 3P9UA 3NK0X 3DJGX 4ZCCA 2WESA 4U8OA 4TLZA 3QSMA 2Q7VA 2B7RA 1D4CA 2VVMA 3HZLA 4J57A 3K30A 3LXDA 4EIQA 1TYPA 3AE6A 1PN0A 2YG4A 1CJ2A 3C4AA 1D7LA 3EPTA 2ZZ0A 3OC4A 1IUSA 3IHGA 1Q1RA 1IUXA 4B69A 1PBBA 2YG3A 4OPTA 2ARDA 1IUWA 3LZXA 3GD3A 2BC1A 2YG5A 4Z24A 4A99A 1PS9A 5KWFA 3AD9B 4BV6A 2YLTA 1LJ1A 1ZOYA 4EQWA 1AOGA 1KFYA 5KXJA 1TRBA 4H4RA 5FMHA 4Z43A 2Q0KA 3FPZA 3QVPA 3AB1A 4XWRA 1GESA 4GRTA 1DJNA 3KU9A 4EQSA 4FK1A 4EQRA 4B1BA 4YTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP6 A;  4X9N A;  2BK4 A;  4ZCD A;  2C64 A;  1EL5 A;  2R9Z A;  1LV0 A;  3C96 A;  3GWF A;  4JY2 A;  4UDP A;  1YY5 A;  4EM3 A;  3P4Q A;  2GAH B;  1E1M A;  3ALL A;  2WEU A;  4JNA A;  3FBS A;  4N9X A;  4H2R A;  4XXG A;  2R45 A;  3L1R A;  4U8K A;  3UKL A;  2OA1 A;  5HY5 A;  5U1O A;  2PYX A;  3DGZ A;  2OLO A;  3KD9 A;  4TM0 A;  1GRA A;  4BK1 A;  3UKH A;  2GR0 A;  1ZKQ A;  3SQP A;  3CNJ A;  1X31 B;  2AR8 A;  2C75 A;  2HQM A;  4U8J A;  5CQF A;  3NTA A;  2YVF A;  1S3E A;  2IVE A;  3PO7 A;  2VQB A;  3EAN A;  3ICS A;  4Z25 A;  2FJB A;  2YR4 A;  1COY A;  5JCI A;  1BGJ A;  1YQ3 A;  2R4E A;  3QVR A;  4Y4M A;  4YSZ A;  2W0H A;  2XFQ A;  4KPR A;  3O0H A;  4A6N A;  1BKW A;  1TDO A;  4PAA A;  3LB8 A;  1DOE A;  4H4V A;  4IVO B;  2CVJ A;  4BK2 A;  2XVJ A;  3AED A;  4H2Q A;  3VR9 A;  2XLP A;  3CGE A;  3ICT A;  1ZX9 A;  1CJ4 A;  1DXL A;  4Y4L A;  3AWI A;  3SUC A;  1OJD A;  4A65 A;  1GAL A;  1NG3 A;  2Z5X A;  3AE3 A;  1LQT A;  1PBF A;  4YXD A;  2Q6U A;  2BXS A;  4UDQ A;  2FJD A;  4H4S A;  3VRD B;  1OJA A;  2VOU A;  3GDP A;  1S2Q A;  3RNM A;  1IUU A;  4K2X A;  1LQU A;  2PHH A;  2WS3 A;  2B9Y A;  4K5S A;  4Z44 A;  4C77 A;  3AXB A;  1K0J A;  3BHF A;  4GDP A;  3P1W A;  4CY6 A;  2EQ7 A;  2WU2 A;  2RGH A;  3DK9 A;  3DJD A;  2Y6Q A;  2XDO A;  3NLC A;  3UP5 A;  5IPY A;  1E1K A;  2BC0 A;  2GH5 A;  1QLB A;  4OCG A;  1DNC A;  2YR6 A;  1CC6 A;  1H82 A;  3IF9 A;  4UP3 A;  1E1L A;  1OJT A;  3UKP A;  4ZN0 A;  4UDR A;  2GQW A;  3B6D A;  3B3R A;  1KNP A;  1EL7 A;  4H7U A;  3S5W A;  3V3N A;  4AT0 A;  4CCR A;  1QJD A;  3G5R A;  2A87 A;  1NDA A;  4K22 A;  4REK A;  3VR8 A;  4D03 A;  1YKJ A;  2FJE A;  3AYJ A;  2XFN A;  1NHR A;  1L0V A;  3DJJ A;  1FEA A;  1PJ6 A;  2WOI A;  3UOZ A;  3AE5 A;  3ICR A;  3GQK A;  2BAC A;  3UOY A;  3KLJ A;  1P2E A;  3ZDN A;  4CRT A;  3SFE A;  3NTD A;  4DGK A;  1GRB A;  3QSS A;  2APG A;  4JDR A;  1PBC A;  1F8S A;  1H7W A;  2Q0L A;  1JEH A;  1GRH A;  3NYE A;  1NG4 A;  3CPJ G;  5GRT A;  3ALM A;  4KX6 A;  2C76 A;  3NT6 A;  3IC9 A;  4CNK A;  1D5T A;  2QCU A;  1GPE A;  5DBJ A;  1PXA A;  4AP3 A;  4Z2R A;  1TYT A;  4CY8 A;  1PXB A;  3EF6 A;  4YTP A;  2YWL A;  4H4P A;  5IQ1 A;  3CGB A;  2X3N A;  2XFU A;  4H4Y A;  1E39 A;  1LPF A;  4HA6 A;  1TDE A;  3NN0 X;  1RYI A;  1P2H A;  3R9U A;  4TM4 A;  3SM8 A;  3AE4 A;  5ER0 A;  4NEV A;  3RP6 A;  4BUR A;  1JRY A;  1VDC A;  1UKV G;  3CNS A;  4LU6 A;  1B5Q A;  1GRT A;  1LTX R;  2O9Z A;  4TM1 A;  1RP0 A;  2V61 A;  2OAL A;  3DJE A;  4B64 A;  3AEE A;  1CC2 A;  3BI2 A;  3AE1 A;  1TDF A;  3BI4 A;  3CTY A;  4EQX A;  2VRL A;  2R46 A;  5GSN A;  2WDR A;  3NK2 X;  1RSG A;  1JRZ A;  1PBD A;  4I58 A;  2ACZ A;  2YLS A;  2BK3 A;  1ELI A;  4WX1 A;  1BGN A;  3KA7 A;  5M0Z A;  5EB4 A;  3F8D A;  3G5S A;  2A89 A;  2XVI A;  2BCP A;  1DJQ A;  2FJA A;  4BK3 A;  2F5Z A;  3LAD A;  3NIX A;  4P9S A;  3ZYX A;  2V5Z A;  4PAB A;  2DKH A;  2XVH A;  1GSN A;  1Y56 B;  3AEA A;  1KSU A;  2GR3 A;  4ICY A;  3V3O A;  4C3X A;  4NTE A;  1E7P A;  3NH3 X;  2R0G A;  4U2T A;  4Y4N A;  4A6N B;  2V6O A;  2YG7 A;  1M64 A;  4U2S A;  1Y56 A;  2TMD A;  4K8D A;  2C67 A;  5JCM A;  2XCG A;  5J7X A;  5U63 A;  1XPQ A;  3NYC A;  5JCL A;  4OPU A;  2YLW A;  4H4T A;  3RP7 A;  3WE0 A;  2R4J A;  3ATQ A;  1IJH A;  1VQW A;  3D1C A;  1TDK A;  5KVH A;  1H7X A;  4H50 A;  4LII A;  1H83 A;  2B9X A;  3AYL A;  1JNZ A;  3H8L A;  3II4 A;  2WHD A;  1V59 A;  1Q1W A;  3M13 A;  2XFP A;  3H8I A;  3C4N A;  3CNP A;  2WET A;  1EL9 A;  4CBQ A;  4U8L A;  5KOX A;  4YKF A;  5KOW A;  1PXC A;  3AD7 B;  1ZK7 A;  2A8X A;  3CND A;  4U8P A;  5KRQ A;  1NHS A;  1FL2 A;  3AYI A;  3CNT A;  2C3C A;  2C65 A;  2C7G A;  1CF3 A;  2BYB A;  4GUV A;  1O95 A;  4J33 A;  3VRB A;  5TR3 A;  2WDQ A;  1JU2 A;  4C5O A;  2WPE A;  4I59 A;  3F8P A;  1XDI A;  3PS9 A;  1REO A;  4GDE A;  2XLU A;  3GRS A;  2GR2 A;  3P4P A;  1Y0P A;  3BNM A;  5JCK A;  2BCG G;  1KDG A;  2BAB A;  2EQ6 A;  2V3B A;  1PJ7 A;  3ADA B;  3GQH A;  2JAE A;  1MO9 A;  1O94 A;  4BJZ A;  1VG0 A;  2QAE A;  3UTF A;  1KF6 A;  2NVK X;  2TPR A;  5EB5 A;  1NEK A;  3AD8 B;  3DK8 A;  1N4W A;  3COX A;  1VG9 A;  1DOC A;  2YVG A;  1ZDL A;  2GVC A;  2AAQ A;  3ALJ A;  2VZ2 A;  3FIM B;  4OPL A;  4USQ A;  2H88 A;  3AEC A;  3BI5 A;  5BRT A;  1XAN A;  1L9E A;  4GCM A;  2Y6R A;  3NK1 X;  2X8C A;  2QA2 A;  1XHC A;  4EMI A;  3K7T A;  3SFD A;  2B76 A;  4YT0 A;  1EBD A;  5HXI A;  1QO8 A;  2XVE A;  2AQJ A;  1F6M A;  3SGL A;  5BVA A;  2EQ9 A;  3EAO A;  2V3A A;  5FS7 A;  4OPI A;  2DKI A;  3GYX A;  5KVI A;  3GMC A;  3UTG A;  2RGJ A;  1OJC A;  2WP5 A;  4NZH A;  4FDC B;  3URH A;  1ZP0 A;  1ZMD A;  3D8X A;  2JB3 A;  2XVF A;  1F8W A;  3AEF A;  3OZ2 A;  5U25 A;  4E0V A;  3RHA A;  1MXT A;  4YSY A;  5EBK A;  4EMJ A;  3CIR A;  1E1N A;  4A9W A;  3CGD A;  2C3D A;  4IA5 A;  4D04 A;  2LFC A;  1K0I A;  2GQF A;  3H4K A;  5L46 A;  4U8N A;  1GOS A;  5CKU A;  3ISH A;  3KPF A;  3AE7 A;  1NEN A;  4YSX A;  1IUV A;  1JRX A;  1NHP A;  3UCL A;  4Z2U A;  4Z26 A;  4OPD A;  3Q6J A;  3K7Q X;  4NEW A;  5C3J A;  3CN8 A;  1ZOV A;  4NTC A;  3AEB A;  2CUL A;  4U8I A;  1H81 A;  2GR1 A;  4EM4 A;  3KVE A;  2YAU A;  2YQU A;  2QA1 A;  2WBA A;  1GEU A;  1NPX A;  3CPH G;  4LA1 A;  4TM3 A;  4X4J A;  4OPC A;  1FEC A;  1PJ5 A;  1IUT A;  4ECH A;  3UTH A;  2IID A;  3IHM A;  4APN A;  3DH9 A;  4Z2T A;  3BHK A;  3Q9T A;  4A5L A;  1F8R A;  1EL8 A;  4X9M A;  2WQY A;  4K5R A;  5HYM A;  3AEG A;  4J31 A;  2VVL G;  2JKC A;  3QJ4 A;  3GYI A;  4YKG A;  2X99 A;  5IQ4 A;  3GWD A;  3NKS A;  4U8M A;  4IVM B;  3ITJ A;  1N1P A;  1CC4 A;  1JNR A;  1YQZ A;  1TDN A;  2CFY A;  3KKJ A;  4OPG A;  2B7S A;  1BWC A;  3GRT A;  5FS8 A;  5J60 A;  4JQ9 A;  2BS3 A;  3UP4 A;  2C73 A;  3GMB A;  5HHF A;  2RAB A;  1H6V A;  1N4V A;  4O5U A;  3QFB A;  4JN9 A;  1CHU A;  5LV9 A;  1D7Y A;  1GT8 A;  2R0P A;  2C72 A;  4K7Z A;  2GAG B;  2J3N A;  1GRF A;  2FBW A;  1L9D A;  5FS9 A;  1GXF A;  1NAA A;  4C3Y A;  1Z6L A;  3FG2 P;  1FEB A;  1HYU A;  3NYF A;  2JBV A;  3NGC X;  3P4R A;  4YTM A;  2X50 A;  1H84 A;  1PBE A;  1D4D A;  1ZMC A;  1GRE A;  2WPF A;  2ZZC A;  3DGH A;  4JY3 A;  1B8S A;  3AE9 A;  5BUL A;  3RP8 A;  2V60 A;  1B37 A;  1CJ3 A;  1SEZ A;  3S61 A;  4IV9 A;  1PDH A;  2GRT A;  2JB1 A;  4AT2 A;  1CL0 A;  2BK5 A;  4OVI A;  4RG3 A;  2WP9 A;  1D4E A;  3LOV A;  1PHH A;  4JNQ A;  1DOD A;  1BZL A;  2X8G A;  1FOH A;  1MOK A;  3G5Q A;  1GET A;  3DA1 A;  2IVD A;  3DME A;  3NRN A;  4B65 A;  4AOS A;  2C70 A;  2YVJ A;  3K7M X;  4XWZ A;  4A7A A;  4H2P A;  1GND A;  4GR1 A;  2YG6 A;  2GMJ A;  2WOW A;  2YM2 A;  4EIP A;  1BF3 A;  1JOA A;  3UOV A;  1LVL A;  1GTH A;  1M6I A;  1KSS A;  4M52 A;  1S2Y A;  2E4G A;  2NPX A;  3GYJ A;  2VQ7 A;  4H4Z A;  3AE2 A;  3GSI A;  1NHQ A;  2GMH A;  1KNR A;  1DOB A;  2YLX A;  3F8R A;  3I3L A;  2XLT A;  2BXR A;  1E6E A;  4YWO A;  1FCD A;  4C74 A;  3ABV A;  2XYO A;  3NHO X;  4IA6 A;  4YSH A;  4ADW A;  1K0L A;  2WU5 A;  2XLS A;  2VRM A;  3M0O A;  5JCN A;  2VVL A;  3CPI G;  1L9C A;  3BNU A;  3FMW A;  3LJP A;  3NN6 X;  3T37 A;  1GTE A;  4GF7 A;  3DK4 A;  3UKQ A;  4B66 A;  2WPC A;  2OAM A;  4DSG A;  4RSL A;  4B68 A;  2XLR A;  4EMW A;  1O5W A;  1B4V A;  1W4X A;  3QFA A;  5FS6 A;  5EOW A;  2GEW A;  1H86 A;  3PVC A;  4H4Q A;  2BS4 A;  3L8K A;  3NNE A;  2E5V A;  4J34 A;  4H4U A;  3GD4 A;  1OJ9 A;  1GER A;  2E1M A;  5M10 A;  2BA9 A;  2GB0 A;  2I0Z A;  2YLZ A;  4DSH A;  2B9W A;  2ZZB A;  5C2T A;  4U2L A;  2OLN A;  4O5Q A;  3UTE A;  1ZY8 A;  3VRA A;  3M12 A;  2X8H A;  2XFO A;  4J36 A;  4NTD A;  1F3P A;  1N4U A;  3RED A;  3UKA A;  2RGO A;  3UKF A;  1GV4 A;  4J56 A;  2BS2 A;  3JSK A;  4AP1 A;  4FK1 C;  4B67 A;  1YQ4 A;  2CDU A;  4USR A;  2GV8 A;  3V76 A;  2C66 A;  4H2N A;  3AE8 A;  4J2W A;  4CNJ A;  3UOX A;  3CGC A;  1Q9I A;  3UKK A;  5BUK A;  1S3B A;  3NG7 X;  4H4W A;  2YR5 A;  2EQ8 A;  2GF3 A;  3IWA A;  2JB2 A;  3E1T A;  2YM1 A;  2UZZ A;  4H4X A;  4RG4 A;  4TLX A;  4WCT A;  2H89 A;  4FX9 A;  1CBO A;  1K4Q A;  3ATR A;  2YLR A;  2Z5Y A;  4HB9 A;  2WDV A;  4A79 A;  2R0C A;  2ZBW A;  3QSE A;  4AOX A;  4B63 A;  2WOV A;  3P4S A;  4BJY A;  2JK6 A;  3VQR A;  1CJC A;  4CCQ A;  4DNA A;  1ONF A;  3I6D A;  1VRQ B;  1GRG A;  3LZW A;  4MJW A;  3GDN A;  3P9U A;  3NK0 X;  3DJG X;  4ZCC A;  2WES A;  4U8O A;  4TLZ A;  3QSM A;  2Q7V A;  2B7R A;  1D4C A;  2VVM A;  3HZL A;  4J57 A;  3K30 A;  3LXD A;  4EIQ A;  1TYP A;  3AE6 A;  1PN0 A;  2YG4 A;  1CJ2 A;  3C4A A;  1D7L A;  3EPT A;  2ZZ0 A;  3OC4 A;  1IUS A;  3IHG A;  1Q1R A;  1IUX A;  4B69 A;  1PBB A;  2YG3 A;  4OPT A;  2ARD A;  1IUW A;  3LZX A;  3GD3 A;  2BC1 A;  2YG5 A;  4Z24 A;  4A99 A;  1PS9 A;  5KWF A;  3AD9 B;  4BV6 A;  2YLT A;  1LJ1 A;  1ZOY A;  4EQW A;  1AOG A;  1KFY A;  5KXJ A;  1TRB A;  4H4R A;  5FMH A;  4Z43 A;  2Q0K A;  3FPZ A;  3QVP A;  3AB1 A;  4XWR A;  1GES A;  4GRT A;  1DJN A;  3KU9 A;  4EQS A;  4FK1 A;  4EQR A;  4B1B A;  4YTN A; 
#chains in the Genus database with same CATH topology
 2BK4 A;  4IDN A;  3AAI A;  3AB3 B;  2C64 A;  4KBM B;  4JY2 A;  1YY5 A;  3I0O A;  4U31 A;  2WEU A;  4QH1 A;  4N9X A;  2R45 A;  3L1R A;  3UKL A;  2UXC T;  2JQK A;  5U1O A;  3DGZ A;  2V1D B;  4BK1 A;  1GRA A;  3UKH A;  2GR0 A;  3JAE A;  2HQM A;  4DR1 T;  4U72 A;  3EAN A;  1FEW A;  3C51 A;  4YSZ A;  2XFQ A;  2ZM0 A;  3O0H A;  4WBN E;  5EZY E;  5J1G A;  1YKH B;  1YKE B;  4BK2 A;  4DV5 T;  2XVJ A;  3ETU A;  1ZX9 A;  1DXL A;  3IEE A;  3PUR A;  1D0Z A;  2NW7 A;  1OJD A;  3TLU A;  3QOF A;  2H7V C;  4Q4V 4;  5LGN B;  4H4S A;  1FJG T;  2IC9 A;  2VOU A;  1B7T A;  3JAD A;  5DQV A;  4ILU A;  3E08 A;  4HKA A;  5CJ5 A;  3ESL A;  4CI1 B;  1N32 T;  4QXC B;  3CQX C;  2W61 A;  3JD7 4;  4CY6 A;  2RGH A;  1WR6 A;  5L47 A;  2BC0 A;  3P8C D;  1CUN A;  4DID B;  1DNC A;  4UP3 A;  3N9P A;  4ZHQ E;  1W0B A;  1MMG A;  1EL7 A;  4REK A;  1NDA A;  4K22 A;  4D03 A;  1YKJ A;  3AYJ A;  4PFP A;  5DJQ C;  2ZM6 T;  1NHR A;  1FEA A;  2XQ6 A;  2WOI A;  2XFN A;  2QA7 A;  1P2E A;  3SFE A;  3NTD A;  4JBW F;  4X1Y E;  5AQP B;  5GON E;  1E2A A;  1H7W A;  1D1B A;  1JEH A;  3GN5 B;  4X64 T;  3NYE A;  1NG4 A;  3C4Z A;  4QKN A;  2C76 A;  3MXZ A;  1D5T A;  2QCU A;  5DBJ A;  5CFB A;  3I9Y A;  2HHH T;  3PUG A;  4DV0 T;  4HGA A;  4J2C A;  4AQF C;  3T2Y A;  3CQG B;  4U33 A;  4YJ3 E;  4EB6 E;  1TDE A;  2E2A A;  2QYW A;  2X0Y A;  3NN0 X;  3R9U A;  3K3O A;  3SM8 A;  3RP6 A;  4O2A E;  1GRT A;  1LTX R;  4TM1 A;  1IJ5 A;  5F3J A;  3BI4 A;  4CXX A;  4K0U A;  2R46 A;  3H3A A;  5GSN A;  3NK2 X;  1PBD A;  4BA9 A;  2ACZ A;  3AXJ A;  2NP9 A;  1ELI A;  1HCI A;  1BGN A;  1WRD A;  3KA7 A;  2V26 A;  5M0Z A;  2RMU 4;  2MTQ A;  4IE7 A;  3G5S A;  2JPF A;  4Q4X 4;  2BCP A;  2X5I D;  1DJQ A;  4AKL A;  4EED A;  4B3S T;  3ZJ1 A;  5LGT B;  2XVH A;  3V3O A;  3QNU A;  4ICY A;  2VKJ A;  4C3X A;  1E7P A;  3ZKR A;  1UK5 A;  2CA5 A;  3ZYK A;  2R0G A;  2YIN A;  2JQ9 A;  5L2L A;  2XAG B;  4MFR A;  3N9L A;  3JBG 4;  1D0X A;  5JCM A;  3PV0 F;  1T98 A;  2X67 A;  5F8P A;  3NYC A;  3SX6 A;  4N78 D;  4OPU A;  3ZT6 A;  3ZST A;  3RP7 A;  4KP3 C;  3D1C A;  1O3X A;  4ZS2 A;  3H8L A;  2BZB A;  1V59 A;  3M13 A;  3H8I A;  2BVM A;  5KOX A;  5KOW A;  1PXC A;  3AD7 B;  2A8X A;  1NHS A;  1FL2 A;  5LBM A;  3AYI A;  2C3C A;  5FYM A;  1N33 T;  2A3D A;  3VRB A;  2K5B B;  5TR3 A;  2WDQ A;  1D0Y A;  2XUE A;  2CEA A;  4DR7 T;  5JCK A;  2XAJ B;  4A97 A;  3P50 A;  2V6Y A;  1MO9 A;  3ZCI A;  3ZYL A;  2HWC 4;  4JI6 T;  1VG0 A;  3UTF A;  2W4X A;  3VKG A;  3AD8 B;  3KV4 A;  3COX A;  1VG9 A;  1DOC A;  2N1G A;  2XQY A;  1T7S A;  4BJM A;  3N2G E;  4O4H E;  5IUX A;  3ALJ A;  2WB5 A;  2VZ2 A;  3CVR A;  4H63 H;  3AEC A;  4XAX B;  1XAN A;  4GCM A;  3RI5 A;  1YD8 G;  3S4U A;  2KXP B;  1EBD A;  5EK3 A;  3NWI A;  4KHZ F;  5BVA A;  2EQ9 A;  1HFA A;  2HH7 A;  3GYX A;  2R04 4;  5LJN A;  4NZH A;  4PNI A;  3FBL A;  3SWH A;  3D8X A;  3OZ2 A;  2JB3 A;  2CXD A;  5U25 A;  1VBC 4;  3ZC1 A;  1E1H B;  4YSY A;  2C5K T;  5JDM A;  4H9N C;  2VL0 A;  4X62 T;  3HA4 A;  2GQF A;  3H4K A;  4DMV A;  1GOS A;  2KZ7 B;  3ISH A;  3AE7 A;  4YSX A;  1IUV A;  1WLX A;  3KBU A;  3LK3 B;  4ANJ A;  1MMD A;  3ZEF B;  5C3J A;  2BRY A;  5TAO A;  5KMP A;  1H81 A;  4JLE A;  2XHE B;  4X4J A;  2QA1 A;  5A1L A;  1NPX A;  3KVB A;  2IID A;  3BHK A;  3Q9T A;  2LKG A;  2IIU A;  3CX8 B;  4O2B E;  3QUJ A;  2JKC A;  5LP6 E;  5IQ4 A;  2CWO A;  2VKO A;  3VU7 H;  5HEG A;  4IVM B;  4PW8 A;  3FZM B;  2NWB A;  2HN1 A;  1JNR A;  2CFY A;  1TDN A;  4O4I E;  3CMM A;  2LSJ A;  3PU8 A;  4GAV A;  5FVL A;  2C73 A;  4Z91 A;  1N4V A;  3WAJ A;  4H63 V;  3RQW A;  1CHU A;  5LV9 A;  3LSV A;  2J3N A;  5IWA T;  5AQG B;  2LSK A;  1NAA A;  3SOL A;  3FG2 P;  3P4R A;  4U7I A;  5L3E B;  1H84 A;  2WPF A;  3X1D A;  2ZZC A;  5BUL A;  2LKH A;  1B37 A;  3T1H T;  3K1S A;  2JB1 A;  4OVI A;  2BK5 A;  4RG3 A;  1QUU A;  4CI2 B;  2X9Y A;  4JNQ A;  4HFI A;  3UFG A;  1VCT A;  4ZZC A;  2X8G A;  3LK4 2;  1MOK A;  3N2O A;  2IVD A;  4B65 A;  3UUM A;  4AOS A;  2WBL A;  1IBM T;  4XWZ A;  2MPK A;  5L3B B;  3SZF A;  4GR1 A;  2YG6 A;  4DUY T;  4EIP A;  3JC6 D;  1GTH A;  4ZI3 D;  4Q4W 4;  4M52 A;  4G6G A;  1XNR T;  3AE2 A;  2A2F X;  3EDV A;  1KNR A;  4EEB A;  2GMH A;  3F8R A;  3RKO A;  4YLH A;  4YHJ A;  5AQT B;  5LB7 B;  2BBH A;  2WCA A;  2W0G A;  4YSH A;  1R8I A;  5JCN A;  1L9C A;  3BNU A;  3FMW A;  1GTE A;  3DK4 A;  2UXB T;  2KWH A;  2WPC A;  3Q5D A;  4ZS3 A;  3L39 A;  2IML A;  3B5M A;  4YY3 T;  1B4V A;  1O5W A;  3ZN0 B;  5EOW A;  2GEW A;  1T8B A;  5AQM B;  2VQF T;  4PFO A;  3F31 A;  5HXR A;  3RC3 A;  4KHP T;  2RS5 4;  2GB0 A;  2KT9 A;  3UUN A;  3HL6 A;  4NTD A;  4TZ4 C;  3UQ4 A;  3J7Y q;  5FL0 A;  2L9Q A;  4USR A;  2C66 A;  4U3C A;  4IDQ A;  3UKK A;  3ONJ A;  5F5W A;  1HS7 A;  3NG7 X;  2WZI A;  4A98 A;  2VUR A;  2GF3 A;  2JB2 A;  3D0T A;  4WCT A;  3HR0 A;  3Q5W A;  4FX9 A;  3ATR A;  2VB6 A;  2YLR A;  3R84 B;  2PBI A;  2RP4 A;  5FVK A;  4H9S E;  1CJC A;  2UUC T;  1VRQ B;  2GK9 A;  1GRG A;  4JUY A;  4MJW A;  2J47 A;  5JVD E;  3GDN A;  3P9U A;  4U8O A;  3QSM A;  5IYZ E;  4H9Q C;  3UQ7 A;  2YG4 A;  1CJ2 A;  2ZZ0 A;  1EZ3 A;  2VQE T;  4WW0 A;  4P1N A;  1Q1R A;  3PUQ A;  1PBB A;  1VBE 4;  3GD3 A;  4I4T E;  2LSG A;  4A99 A;  4GK0 E;  3AD9 B;  1ZOY A;  1M62 A;  2VKD A;  2DCF A;  2XY8 B;  4Z43 A;  5CB4 E;  4XWR A;  3AB1 A;  1GES A;  3ANW A;  5AQJ B;  4EQS A;  4FK1 A;  4EQR A;  4B1B A;  1FIO A;  2LRL A;  3PUS A;  4IDO A;  2WP6 A;  2WMO A;  2JQH A;  1EL5 A;  2R9Z A;  4DR4 T;  1LV0 A;  3P4Q A;  3RIU A;  3ALL A;  2X0H A;  5AQK B;  4JNA A;  2E8I A;  2V6X A;  4EZH A;  4JEU B;  4NPP A;  1BR0 A;  4U8K A;  2OA1 A;  2NTX A;  5AFU L;  2X9W A;  4IGU A;  4TM0 A;  2EHO B;  1X31 B;  2AR8 A;  2C75 A;  2YVF A;  2VQB A;  4P09 A;  2CM0 A;  2YR4 A;  4Y4M A;  1S35 A;  4KPR A;  2EHO A;  5KDM C;  5HXS A;  3PJA A;  3V5U A;  4H4V A;  2X51 A;  4NXN T;  3EHZ A;  4OYJ A;  2LOS A;  1XHZ A;  1AR7 4;  3TKL B;  2RPA A;  1CJ4 A;  3H37 A;  2SPC A;  4LMJ A;  1GAL A;  5FMN A;  4MAL A;  3AE3 A;  1LQT A;  4ZZB A;  2BXS A;  2FJD A;  3VRD B;  3ZYM A;  5FY1 A;  2EHO D;  1K0J A;  2YDS A;  2LSI A;  3CPZ A;  4DR3 T;  4GDP A;  2Q9Q A;  3DJB A;  3UP5 A;  2G0U A;  1E1K A;  2GH5 A;  1QLB A;  4II2 A;  1KNZ A;  4EXT A;  3UKP A;  4ZN0 A;  4UDR A;  3B6D A;  2QGS A;  2UU9 T;  4H7U A;  3T2K A;  4CCR A;  1QJD A;  3U3I A;  2A87 A;  4B3M T;  1MMN A;  3ZT5 A;  1ZKE A;  1PO2 4;  3F57 A;  4UIG A;  3GQK A;  4HWF A;  3AE5 A;  3ICR A;  3PDY A;  4JV5 T;  3UUL A;  4IE6 A;  1GRB A;  1T72 A;  3T0K A;  5LMN T;  2BKO A;  4JDR A;  1PBC A;  4DR2 T;  4HFB A;  2Q9Q D;  1HF8 A;  3IBP A;  5L3G B;  2LM2 A;  3IC9 A;  4G63 A;  1GPE A;  2R6G F;  1TYT A;  4NUU A;  4BAY B;  1PXB A;  3EF6 A;  1KEY A;  1IZN B;  4YTP A;  1U4Q A;  4H4P A;  5IQ1 A;  3QK6 A;  4HA6 A;  4GK5 E;  2NR4 A;  4IE0 A;  3JC6 C;  4ZI3 C;  3AE4 A;  2E9X B;  1JRY A;  4K0K T;  2AXD S;  3FZL B;  4IDP A;  4LU6 A;  2V7J A;  2V61 A;  3KIN B;  3NZQ A;  3ONL C;  2M67 A;  4UXN B;  4TN7 B;  2VRL A;  2BVL A;  4DO0 A;  1RUH 4;  2WDR A;  2Z6E A;  4I58 A;  3T31 A;  2YLS A;  2WAU A;  4TV8 E;  5HXH A;  3UU6 A;  2ODV A;  3FHN A;  3OVU A;  2CHO A;  3F8D A;  2K9A A;  1OWA A;  4H9O C;  2XVI A;  4HFE A;  4IL4 A;  4TNW A;  2JIW A;  2XQ8 A;  4F6R C;  2F5Z A;  4B6X A;  3ZYX A;  2LLY A;  2V5Z A;  4AXP A;  1GSN A;  1Y56 B;  1KSU A;  4NTE A;  2E9X D;  3VKH A;  3RHW A;  3NH3 X;  4Y4N A;  4UV9 B;  2CMR A;  5H6R B;  4ZOL E;  1Y56 A;  1J5W A;  2C67 A;  2XJ7 A;  2XCG A;  3HYX A;  5J7X A;  5U63 A;  5JCL A;  3RC8 A;  2XQA A;  2WZH A;  4CZZ B;  4H4T A;  3O1J A;  3WE0 A;  5ETW A;  2R4J A;  3KVA A;  3IA3 A;  1HRI 4;  4X1K E;  1VBD 4;  4H50 A;  2ZMA A;  2WHD A;  4XZC A;  3CNP A;  5HEJ A;  4YKF A;  2HPL A;  5AQQ B;  3OPC A;  1ZK7 A;  4U8P A;  1RUI 4;  2XAH B;  3CQC B;  1O95 A;  1H7C A;  2W66 A;  3KV9 A;  5H6Q B;  2ACX A;  4C5O A;  1HX1 B;  1XDI A;  4GDE A;  4TV9 E;  3P4P A;  2D5U A;  1Y0P A;  3QB5 A;  3WAK A;  4AIS A;  2BAB A;  5HWX A;  2W2U A;  2EQ6 A;  2V3B A;  1PJ7 A;  3ADA B;  2X66 A;  2KND A;  3FI7 A;  2J1D G;  3U78 A;  2M6I A;  2MOZ A;  1KF6 A;  4ILA A;  3ZPO A;  1NEK A;  5JQG E;  1N4W A;  3ZT7 A;  4WYV A;  2DI4 A;  2GVC A;  4KI0 F;  4BJN A;  2XPK A;  3TLV A;  3VHL A;  3UT5 E;  4A5X A;  1L9E A;  3OYX A;  2Y6X A;  2QA2 A;  4P0A A;  1UGO A;  1X79 A;  5HEH A;  2L3L A;  5DQW A;  4YT0 A;  3SZC A;  5HXI A;  4O4J E;  2MBG A;  5LHG B;  2XVE A;  2AQJ A;  1F6M A;  1AJ3 A;  4OPI A;  3K3Q C;  3SRZ A;  2QRX A;  2WP5 A;  1ZP0 A;  4PK5 A;  1F8W A;  2X9H A;  3NRY A;  3RHA A;  4EMJ A;  4DBQ A;  3CIR A;  4A9W A;  4D04 A;  4IA5 A;  4PJL A;  4UVA B;  3EI0 A;  4EZ4 A;  4U8N A;  3O1H A;  5FY0 A;  5CKU A;  3KPF A;  1NEN A;  1Z0P A;  4H9P C;  3SZW A;  4OPD A;  4CN6 A;  5JH7 E;  3N2K E;  4NEW A;  4NTC A;  2CUL A;  2UXN B;  3ZSS A;  4EM4 A;  2BKP A;  3NKZ A;  3AXJ B;  5AQO B;  2YAU A;  3CPH G;  4LA1 A;  5JDL A;  4OPC A;  1PJ5 A;  1IUT A;  2I59 A;  3UTH A;  3RRC A;  1EL8 A;  2IDO B;  3ZJ2 A;  4HFC A;  2PLV 4;  3AEG A;  4J31 A;  5FNV E;  2EHO C;  2YK0 A;  4YKG A;  4DV7 T;  4JYA T;  2HN2 A;  3CK6 A;  1CC4 A;  5LNK A;  3B13 A;  4LF6 T;  3LDQ B;  5LCY A;  4OPG A;  1N34 T;  2V7I A;  4DV6 T;  3T2Z A;  2UXX B;  2ES0 A;  5FY7 A;  3GRT A;  1OOP D;  3BQI A;  5LHH B;  4GYS A;  1H6V A;  2RAB A;  4JN9 A;  1COV 4;  1D7Y A;  2WWV A;  2JMH A;  4CXY A;  1GT8 A;  4JI8 T;  2GAG B;  1L9D A;  2V7L A;  4AIU A;  4U2Y A;  3OJA A;  2JBV A;  2H3R A;  3I0Q A;  3ZMS B;  1ZMC A;  1DU2 A;  2XM1 A;  2V60 A;  1CJ3 A;  3G06 A;  4IV9 A;  4UEL A;  2DWK A;  4AKR B;  2GRT A;  4AT2 A;  3RYI E;  2XQ9 A;  1WFD A;  2WP9 A;  1DOD A;  1FOH A;  3DA1 A;  2VK9 A;  4L5G A;  3LK2 B;  1S94 A;  3N9M A;  4A7A A;  1XMO T;  2GMJ A;  2WOW A;  2V6Y B;  2CXF A;  4G2A A;  3M3Z B;  1LVL A;  3RYF E;  4LF8 T;  1KSS A;  3AAE B;  1I94 T;  2VQ7 A;  1LVF A;  2D9D A;  2BXR A;  4YWO A;  5LA6 E;  4C74 A;  3RGL A;  4LF5 T;  4ADW A;  2WU5 A;  2XLS A;  3A7M A;  2C5I T;  3CPI G;  3T37 A;  4I43 B;  4DSG A;  2OAM A;  4PK4 A;  2K24 A;  4RSL A;  2XAQ B;  5JDH A;  5FS6 A;  4H4Q A;  3L8K A;  2LOP A;  2E5V A;  3GD4 A;  3J9X 1;  1OJ9 A;  4GOU A;  4CN1 A;  1GER A;  4U2Z A;  3SS1 A;  4ADZ A;  2VVS A;  4OX9 T;  2BA9 A;  2I0Z A;  2E9X C;  3CWZ B;  2OLN A;  4O5Q A;  3UTE A;  4JI0 T;  1F3P A;  1GV4 A;  5IHY A;  2BS2 A;  4AP1 A;  4XBF B;  4CNJ A;  3V76 A;  2GV8 A;  3PUX F;  4J2W A;  4CXW A;  2XM2 A;  1H8T D;  2WMN A;  1S3B A;  1XWM A;  2P9B A;  2YR5 A;  4G6H A;  2W67 A;  2KMF A;  4IST A;  3RPU A;  4TLX A;  1K4Q A;  2WDV A;  1BR1 A;  2R0C A;  4AOX A;  2NW8 A;  1ZEE A;  4BJY A;  1NAF A;  2CBJ A;  2XAS B;  3QB5 K;  1ONF A;  1D1A A;  3SXI A;  3NK0 X;  3DJG X;  5JDF A;  4YFS A;  2C0S A;  4TLZ A;  2Q7V A;  2B7R A;  5ABE A;  1G8X A;  2VVM A;  3HZL A;  4WNK A;  2K3W A;  2CLY B;  2JRK A;  3C4A A;  3OC4 A;  3NRX A;  3DP7 A;  3V5S A;  4B69 A;  1IUX A;  4OPT A;  3Q2M A;  1EV1 4;  1IUW A;  3EDU A;  3LZX A;  1SUM B;  4B3T T;  2BC1 A;  4Z24 A;  3BK9 A;  2YLT A;  4NUV A;  4EQW A;  2CRB A;  1VBA 4;  1AOG A;  4H4R A;  5EK4 A;  3QVP A;  4GRT A;  4HWD A;  1DJN A;  1UCU A;  1HXS 4;  4U7Y A;  2IC6 A;  2F4V T;  4ZCD A;  5E0O A;  2JMK A;  3C96 A;  3GWF A;  2GAH B;  5HCJ A;  4H2R A;  1RUE 4;  1J5E T;  1VRB A;  3PUV F;  1XNQ T;  2OLO A;  4QX7 B;  3CNJ A;  1PVC 4;  4U8J A;  3UU8 A;  2PZS A;  1LKX A;  2IVE A;  2PW9 A;  2ZLY A;  2FJB A;  4Z25 A;  1COY A;  1BGJ A;  1YQ3 A;  2W0H A;  4A6N A;  1BKW A;  4ZEY A;  1TDO A;  1D1C A;  4PAA A;  1DOE A;  1UX5 A;  5AQU B;  2CVJ A;  3HI2 A;  2PYJ A;  3VR9 A;  3ICT A;  4A65 A;  4CN4 A;  2Z5X A;  3EAB A;  1PBF A;  4YXD A;  5ABF A;  1OJA A;  3GDP A;  4K2X A;  3HKC E;  2WS3 A;  2B9Y A;  2WSS V;  1W0A A;  4KMC A;  3CX7 B;  2YN6 A;  3P1W A;  5FXX A;  2WU2 A;  3MAC A;  2EQ7 A;  2BG9 B;  2Y6Q A;  3DJD A;  3NLC A;  1RMU 4;  5LOV E;  2YDQ A;  3OYZ A;  1SHZ C;  4NXM T;  4OCG A;  2YR6 A;  4X66 T;  1H82 A;  2R06 4;  1E1L A;  1OJT A;  5CGM A;  3KPK A;  4AT0 A;  3B3R A;  3G5R A;  2BG9 A;  5FL1 A;  3VR8 A;  3H3M A;  3RIA A;  2FJE A;  4HE8 A;  4FI5 A;  3UOZ A;  2H7O A;  3RIF A;  3KLJ A;  3J8F 4;  3ZDN A;  4CRT A;  3MZK B;  5FKY A;  1VBB 4;  4DGK A;  2CCQ A;  3OTO T;  4G74 A;  1F8S A;  4Q25 A;  2YU1 A;  3LJC A;  4L9I A;  1GRH A;  2XSA A;  3W15 B;  2B1E A;  3CPJ G;  4Z8X A;  4WZX A;  3QC9 A;  2XQ4 A;  3ALM A;  5KMS A;  4CNK A;  4AP3 A;  2XQ3 A;  1Z7S 4;  1HNW T;  2YWL A;  3PUY F;  2ZM2 A;  3CGB A;  4H4Y A;  2QVA A;  3EAM A;  5LG3 A;  1P2H A;  3UU5 A;  4NEV A;  2KIN B;  1VDC A;  1UKV G;  3CNS A;  5AQL B;  1RP0 A;  4LML A;  2OAL A;  3DJE A;  3AA0 B;  4H9R C;  4B64 A;  3ANW B;  1NCQ D;  3BQL A;  2KSR A;  4EQX A;  3TLS A;  2LE8 A;  4QX8 B;  2WM9 A;  1HR0 T;  1RSG A;  3GA8 A;  2BK3 A;  3C50 A;  5EB4 A;  3HYV A;  1EAH 4;  4RHV 4;  2FJA A;  2RS3 4;  4IE5 A;  2DKH A;  4PAB A;  3AEA A;  4I55 E;  5FP3 A;  3ZCJ A;  4UR9 A;  2V6O A;  4U2S A;  4K8D A;  2KWI B;  5J2U E;  1WYB A;  4HWI B;  3RH3 A;  2DWG A;  4YHH T;  4EIW A;  1IJH A;  1VQW A;  1TDK A;  4JI2 T;  5KVH A;  3KBT A;  4GAP A;  1H83 A;  1LRZ A;  2B9X A;  3AYL A;  1JNZ A;  4DV4 T;  4ZI2 D;  2XFP A;  2WET A;  4U8L A;  3UTK A;  1IJ6 A;  1VOM A;  4LMK A;  5FXZ A;  3CND A;  3KDS E;  3CNT A;  4GKK T;  3GMI A;  2XAF B;  2Q9Q B;  4ILB A;  3C98 B;  4I59 A;  3PS9 A;  1REO A;  2XLU A;  3GRS A;  2GR2 A;  3BNM A;  2V8S V;  5DAB A;  2BCG G;  3FB2 A;  5BMV E;  2JAE A;  3NZP A;  3K3N A;  3A5X A;  4EYU A;  4GB3 4;  3ZMZ B;  4EV6 A;  2TPR A;  4MLK A;  1RUG 4;  3SYI A;  2YVG A;  4OHF A;  2A9U A;  1US7 B;  1IBK T;  4U74 A;  3FIM B;  3M65 A;  2HPJ A;  3ZMV B;  3BI5 A;  5BRT A;  2MYS A;  2Y6R A;  3NK1 X;  2X8C A;  1BR2 A;  1XHC A;  1HX8 A;  4EMI A;  2D2S A;  3SFD A;  2CXL A;  2AE9 A;  4DV3 T;  1QO8 A;  3SGL A;  3N9N A;  3EAO A;  2V3A A;  5FS7 A;  2CLY C;  3PUW F;  1X9B A;  2PYL A;  1BR4 A;  5KVI A;  4ILC A;  1OJC A;  4FDC B;  4NWZ A;  1ZMD A;  3AEF A;  3N5L A;  4E0V A;  5ADX L;  5EBK A;  1AR9 4;  1E1N A;  3CGD A;  2C3D A;  2LFC A;  2LHR A;  5L46 A;  2A72 A;  3C64 A;  3MA9 A;  1SA0 E;  2IAK A;  1NHP A;  2LRK A;  4Z26 A;  1RUD 4;  3K7Q X;  4DBR A;  3CN8 A;  1ZOV A;  3AEB A;  4U8I A;  2GR1 A;  3KVE A;  2WBA A;  4TM3 A;  3CX6 B;  1FEC A;  1SE7 A;  4C91 A;  4ECH A;  5HYA A;  2DL1 A;  5HEO A;  4APN A;  3DH9 A;  1XZY A;  4Z2T A;  4A5L A;  2WQY A;  4ZXL A;  3T8O A;  1I6Z A;  3QJ4 A;  3GYI A;  2V7M A;  3NKS A;  4UF0 B;  1YQZ A;  3KKJ A;  2PTF A;  3OKQ A;  4IE4 A;  2XQ7 A;  1BWC A;  5FS8 A;  5LG4 A;  4JQ9 A;  3CKD A;  3ONX A;  2BS3 A;  3GMB A;  2W63 A;  5KNL A;  5JTG A;  4O5U A;  3QFB A;  4UF0 A;  1AR8 4;  2R0P A;  4K7Z A;  5BR8 T;  1BEV 4;  1GRF A;  5FS9 A;  3C4W A;  1GXF A;  1XHX A;  3UU4 A;  4C3Y A;  4OK0 A;  1HG5 A;  3PU3 A;  1GQE A;  4LF7 T;  1FEB A;  3NYF A;  3NGC X;  1RUJ 4;  4YTM A;  2X50 A;  4AI6 A;  5JR9 B;  1PBE A;  1UX4 A;  1B8S A;  4LF4 T;  1SEZ A;  3KFW X;  1PDH A;  1RUF 4;  4DMW A;  2Y8D A;  3ZC0 A;  4QHO A;  2BG9 C;  3LOV A;  5JR9 A;  1BZL A;  2YKS A;  4LF9 T;  1GET A;  2OV9 A;  3DME A;  3A8Y C;  3NRN A;  1FMW A;  4AKG A;  2C70 A;  3K7M X;  2CWY A;  4H2P A;  4TNV A;  1RUC 4;  3ZMT B;  1Y01 A;  2YM2 A;  3MK7 C;  1BF3 A;  1M6I A;  2RS1 4;  2NPX A;  4LFA T;  3PUZ F;  2CE7 A;  3GSI A;  2XTL A;  3I3L A;  5LYJ E;  4JI7 T;  4G73 A;  5KX5 E;  3ZMU B;  1M7K A;  4MBQ A;  4O8S A;  3NHO X;  1R09 4;  3RYH E;  5HAX A;  3SY4 A;  3KV6 A;  3LJP A;  3NN6 X;  4OFZ A;  4EYY R;  4B66 A;  4B68 A;  4EMW A;  4JI5 T;  1W4X A;  3UUB A;  4COF A;  4ZI7 E;  2BS4 A;  4J34 A;  2E1M A;  3NVO A;  5M10 A;  4HWH A;  4DSH A;  1Y64 B;  2ZZB A;  4U2L A;  5L3F B;  4IDZ A;  3Q5E A;  5J0Z A;  3M12 A;  2ZM8 A;  3RED A;  4M1P A;  1N4U A;  1WR0 A;  2RGO A;  5LMU T;  2D0T A;  4J56 A;  3RQU A;  4DR5 T;  4FK1 C;  4B67 A;  1YQ4 A;  4IIJ E;  4ERR A;  2CDU A;  4H2N A;  2LT3 A;  3UOX A;  3PE0 A;  1Q9I A;  3RIU C;  1NA1 D;  5AQF B;  3O1I A;  3E1T A;  2UZZ A;  4RG4 A;  5C8Y E;  4HEA A;  2VAS A;  4ZI2 C;  2ZBW A;  4B3R T;  4B63 A;  1HRV 4;  2D0U A;  2VL8 A;  4WBO A;  3BQK A;  3GN5 A;  2JK6 A;  4CCQ A;  4DNA A;  1HTJ F;  4JI4 T;  3K30 A;  4EIQ A;  3EVY A;  3FZF B;  3AE6 A;  1VRH 4;  1MMA A;  1D7L A;  3IHG A;  2NW9 A;  3R6N A;  2YG3 A;  4IT4 A;  2YDR A;  3L3P A;  3LBX B;  3CML A;  2YG5 A;  5KWF A;  2OA5 A;  4GIW A;  2LJL A;  2XSB A;  5KXJ A;  2BG9 E;  4L0R A;  2R07 4;  3FPZ A;  3LBX A;  1W9R A;  2V5D A;  2X0L B;  3FBZ A;  4IRE A;  1XI1 A;  3RLF F;  4QH4 A;  4X9N A;  1AR6 4;  4GKJ T;  4UDP A;  2VVN A;  4EM3 A;  2Q9Q C;  1E1M A;  3FBS A;  4X65 T;  3SZ0 A;  1MNE A;  4XXG A;  5HY5 A;  2PYX A;  3KD9 A;  1RVF 4;  4II3 A;  1ZKQ A;  3SQP A;  3T14 A;  5CQF A;  2EX3 A;  3NTA A;  1S3E A;  3PO7 A;  3N9Q A;  3RKG A;  4DV1 T;  3ICS A;  3PUA A;  5JCI A;  2R4E A;  3QVR A;  5KMG P;  2V7K A;  1MND A;  5HEU A;  3LB8 A;  4I0U A;  5AQI B;  3AA6 B;  4IVO B;  3AED A;  5L4E A;  3N9O A;  4H2Q A;  2XLP A;  3CGE A;  4Y4L A;  4PK6 A;  3P4W A;  3AWI A;  3SUC A;  1OED B;  2RM2 4;  1LVK A;  4PJM A;  1NG3 A;  1RHI 4;  3HKB E;  3WI3 A;  2Q6U A;  4AKH A;  4UDQ A;  2OLT A;  4EOZ B;  5AQN B;  2IHR 1;  5J2T E;  1S2Q A;  3RNM A;  1IUU A;  1LQU A;  3AAA B;  5LBQ B;  2Y48 B;  1OED A;  2PHH A;  4K5S A;  4Z44 A;  4C77 A;  3AXB A;  4PDW D;  2ODU A;  4JEH B;  3BHF A;  3I1A A;  4PJJ A;  3DK9 A;  2XDO A;  2BDE A;  5IPY A;  4QWN B;  1CC6 A;  3IF9 A;  2C4C A;  3V3N A;  2GQW A;  3S5W A;  1AL2 4;  1KNP A;  3I9W A;  1J1J A;  4HFV A;  5HXE A;  3DJJ A;  1L0V A;  1PJ6 A;  2LM9 A;  1KK7 A;  2BAC A;  3UOY A;  3K8P C;  3QSS A;  2APG A;  2Q0L A;  3IHR A;  1HNZ T;  5GRT A;  4AKI A;  4KX6 A;  2DNX A;  3NT6 A;  3ZLI A;  4C90 A;  1PXA A;  4Z2R A;  4X5T A;  4CY8 A;  3O9X A;  3FZH B;  2YU2 A;  5JDG A;  1HNX T;  3FZK B;  1U5P A;  2X3N A;  2XFU A;  5JDN A;  1E39 A;  1LPF A;  1MIV A;  2BBJ A;  1RYI A;  2L8K A;  4TM4 A;  5ER0 A;  2RA1 A;  4BUR A;  3Q5X A;  3AVR A;  4HTE A;  1B5Q A;  2O9Z A;  2FUP A;  1V9D A;  4LFB T;  1ASJ 4;  1MQT D;  3AEE A;  5JRE A;  1N36 T;  5ABH A;  3HKE E;  5JR9 C;  3AE1 A;  1CC2 A;  1TDF A;  3BI2 A;  3CTY A;  4ASK A;  4ISS A;  5HCM A;  1JRZ A;  3HYW A;  4CI3 B;  2IUB A;  4UEM A;  4WX1 A;  1FMV A;  1K5M D;  3ETV A;  2A89 A;  4E7Z A;  2UUB T;  4BK3 A;  4UVB B;  3LAD A;  3NIX A;  4P9S A;  3UUX B;  2GR3 A;  2N2N A;  1MIY A;  2R7F A;  1Z8U A;  2I6H A;  4U2T A;  2LHN A;  4A6N B;  2YG7 A;  1M64 A;  3RF1 A;  5AQH B;  5FXV A;  2TMD A;  3AA1 B;  1XPQ A;  4QXH B;  2YLW A;  2RR1 4;  4DV2 T;  3ATQ A;  3LG7 A;  4QH5 A;  3NBX X;  1H7X A;  4LII A;  4AQY T;  3T1Y T;  3UU3 A;  2I0M A;  3II4 A;  1Q1W A;  2PJQ A;  4CBQ A;  3C4N A;  5ABF B;  1EL9 A;  5KMQ A;  5KRQ A;  1XMQ T;  2C65 A;  2C7G A;  1CF3 A;  2BYB A;  1UUR A;  4GUV A;  5M4Y A;  4J33 A;  2VKH A;  1IBL T;  1JU2 A;  2WPE A;  3F8P A;  1KDG A;  3GQH A;  2KLQ A;  1O94 A;  4BJZ A;  2PG8 A;  1MIW A;  2QAE A;  3E22 E;  1PIV 4;  2WY2 A;  2NVK X;  5EB5 A;  3DK8 A;  4UV8 B;  1ZDL A;  2AAQ A;  2UUA T;  3TLW A;  4OPL A;  4USQ A;  2H88 A;  5HXC A;  4UVC B;  1OXZ A;  3OBV E;  1WYC A;  3K7T A;  1YW0 A;  4DUZ T;  2B76 A;  2X9X A;  4E7S A;  3EUH A;  1UUS A;  4HFD A;  3O4X E;  2DKI A;  3GMC A;  3UTG A;  3L09 A;  2RGJ A;  3URH A;  2XVF A;  5L4H A;  1MXT A;  5L3C B;  4OYK A;  5EK2 A;  1K0I A;  4Z2U A;  1JRX A;  3UCL A;  3Q6J A;  3B57 A;  2N9D A;  3GWH A;  4IHJ E;  2JQQ A;  2XZE A;  4DND A;  2JJ9 A;  2DLR A;  2YQU A;  1GEU A;  5JRC B;  3IHM A;  2BKN A;  1F8R A;  4TWD A;  4X9M A;  4K5R A;  5HYM A;  3MKD A;  2WWU A;  2VVL G;  5JRC A;  2M6B A;  2X99 A;  4FJO A;  3L8R A;  3GWD A;  3FXD B;  4U8M A;  3ITJ A;  5LXT E;  4IL9 A;  1N1P A;  1XDP A;  1XDO A;  2B7S A;  2PFV A;  5J60 A;  2PY5 A;  3UP4 A;  3FXE B;  4JI1 T;  5HHF A;  1W09 A;  2E5L T;  3AA7 B;  2C72 A;  4AQF A;  4DR6 T;  2FBW A;  1OED C;  1G73 A;  3KV5 A;  5CA1 E;  2CPT A;  1Z6L A;  1HYU A;  3TLT A;  2DHR A;  1D4D A;  1IAP A;  5LHI B;  1GRE A;  3DGH A;  4JY3 A;  3AE9 A;  1NWM X;  3RP8 A;  3S61 A;  3JAF A;  2IW5 B;  1CL0 A;  1D4E A;  4O4L E;  1PHH A;  4EGW A;  5FXW A;  3G5Q A;  2YOE A;  1ZHC A;  2CBI A;  2W62 A;  2YVJ A;  2YEV C;  5JDQ A;  1GND A;  4LFC T;  1JOA A;  3UOV A;  5L3D B;  4PAG A;  5LJM A;  1S2Y A;  1YXR A;  2E4G A;  5AQR B;  3GYJ A;  4H4Z A;  1NHQ A;  1D4M 4;  1DOB A;  2YLX A;  1VCS A;  3LFM A;  2XLT A;  4JI3 T;  1E6E A;  4A56 A;  1FCD A;  5KMR A;  3ABV A;  2XYO A;  4IA6 A;  1K0L A;  4MHC A;  2BRA A;  1WCR A;  2VRM A;  3M0O A;  2VVL A;  3RRW A;  3UKQ A;  3PJA J;  4GF7 A;  3JCF A;  4Z90 A;  2LEH A;  2XLR A;  3QFA A;  3UFE A;  1H86 A;  3PVC A;  3PTR B;  5HWY A;  3NNE A;  4X20 E;  4Q4Y 4;  2MAW A;  4H4U A;  3F2E A;  2XQ5 A;  4F8H A;  3ZN1 B;  3IF8 B;  3E0Z A;  2J62 A;  3DTO A;  2YLZ A;  2B9W A;  1HG2 A;  5C2T A;  3MJX A;  3AVS A;  2CHN A;  5LGU B;  1ZY8 A;  3VRA A;  2X8H A;  2V5C A;  2XFO A;  2X68 A;  4TX5 A;  4J36 A;  3UKF A;  3UKA A;  4QXB B;  4YJ2 E;  3JSK A;  2K48 A;  4HN9 A;  3AE8 A;  4HWC A;  3CGC A;  4TUY E;  5BUK A;  4H4W A;  4HFH A;  4TWF A;  2EQ8 A;  4NNJ A;  3IWA A;  2YM1 A;  4H4X A;  4TWH A;  2H89 A;  1CBO A;  4A79 A;  4HB9 A;  2Z5Y A;  3QSE A;  4EAH A;  2WOV A;  5ABG A;  3Q9D A;  2VWA A;  4P0B A;  1POV 0;  4CQI A;  3P4S A;  2J4G A;  4I50 E;  4X1I E;  3VQR A;  3I6D A;  3LZW A;  4G9K A;  4DVD A;  3P7I A;  5CA0 E;  4ZCC A;  2NTY A;  2WES A;  1R08 4;  4NIQ A;  4PJN A;  1D4C A;  3RYC E;  4J57 A;  1OED E;  3LXD A;  1TYP A;  1PN0 A;  2W00 A;  4KUM B;  3EPT A;  5AQV B;  1IUS A;  2C5J A;  2ARD A;  2NOX A;  2LSY A;  2E9X A;  1PS9 A;  3HKD E;  4BV6 A;  1QSD A;  5AQS B;  1LJ1 A;  3C4X A;  4GYR A;  1KFY A;  1TRB A;  5FMH A;  2UXD T;  2Q0K A;  4AQG A;  3RX6 A;  3KU9 A;  1PO1 4;  1ZV4 X;  2HWB 4;  4V1A v;  4YTN A; 
#chains in the Genus database with same CATH homology
 2WP6 A;  4X9N A;  2BK4 A;  4ZCD A;  2C64 A;  1EL5 A;  2R9Z A;  1LV0 A;  3C96 A;  3GWF A;  4JY2 A;  4UDP A;  1YY5 A;  4EM3 A;  3P4Q A;  2GAH B;  1E1M A;  3ALL A;  2WEU A;  4JNA A;  3FBS A;  4N9X A;  3SZ0 A;  4H2R A;  4XXG A;  2R45 A;  3L1R A;  4U8K A;  3UKL A;  2OA1 A;  5HY5 A;  5U1O A;  2PYX A;  3DGZ A;  2OLO A;  3KD9 A;  4TM0 A;  1GRA A;  4BK1 A;  3UKH A;  2GR0 A;  4II3 A;  1ZKQ A;  3SQP A;  3CNJ A;  1X31 B;  2AR8 A;  2C75 A;  2HQM A;  4U8J A;  3T14 A;  5CQF A;  3NTA A;  2YVF A;  1S3E A;  2IVE A;  3PO7 A;  2VQB A;  3EAN A;  3ICS A;  4Z25 A;  2FJB A;  2YR4 A;  1COY A;  5JCI A;  1BGJ A;  1YQ3 A;  2R4E A;  3QVR A;  4Y4M A;  4YSZ A;  2W0H A;  2XFQ A;  4KPR A;  3O0H A;  4A6N A;  1BKW A;  1TDO A;  4PAA A;  3LB8 A;  1DOE A;  4H4V A;  4IVO B;  2CVJ A;  4BK2 A;  2XVJ A;  3AED A;  4H2Q A;  3VR9 A;  2XLP A;  3CGE A;  3ICT A;  1ZX9 A;  1CJ4 A;  1DXL A;  4Y4L A;  3AWI A;  3SUC A;  1OJD A;  4A65 A;  1GAL A;  1NG3 A;  2Z5X A;  3AE3 A;  1LQT A;  1PBF A;  4YXD A;  2Q6U A;  2BXS A;  4UDQ A;  2FJD A;  4H4S A;  3VRD B;  1OJA A;  2VOU A;  3GDP A;  1S2Q A;  3RNM A;  1IUU A;  4K2X A;  1LQU A;  2PHH A;  2WS3 A;  2B9Y A;  4K5S A;  4Z44 A;  4C77 A;  3AXB A;  1K0J A;  3BHF A;  4GDP A;  3P1W A;  4CY6 A;  2EQ7 A;  2WU2 A;  2RGH A;  3DK9 A;  3DJD A;  2Y6Q A;  2XDO A;  3NLC A;  3UP5 A;  5IPY A;  1E1K A;  2BC0 A;  2GH5 A;  1QLB A;  4II2 A;  4OCG A;  1DNC A;  2YR6 A;  1CC6 A;  1H82 A;  3IF9 A;  4UP3 A;  1E1L A;  1OJT A;  3UKP A;  2C4C A;  4ZN0 A;  3KPK A;  2GQW A;  3B6D A;  3B3R A;  1KNP A;  1EL7 A;  4H7U A;  4UDR A;  3S5W A;  3T2K A;  4CCR A;  1QJD A;  3G5R A;  2A87 A;  1NDA A;  4K22 A;  4REK A;  3VR8 A;  4D03 A;  1YKJ A;  2FJE A;  3AYJ A;  2XFN A;  1NHR A;  1L0V A;  3DJJ A;  1FEA A;  1PJ6 A;  2WOI A;  3UOZ A;  3AE5 A;  3ICR A;  3GQK A;  2BAC A;  3UOY A;  3KLJ A;  1P2E A;  3ZDN A;  4CRT A;  3SFE A;  3NTD A;  4DGK A;  1GRB A;  3QSS A;  3T0K A;  2APG A;  4JDR A;  1PBC A;  4G74 A;  1F8S A;  1H7W A;  2Q0L A;  1JEH A;  1GRH A;  3NYE A;  1NG4 A;  3CPJ G;  5GRT A;  3ALM A;  4KX6 A;  2C76 A;  3NT6 A;  3IC9 A;  4CNK A;  1D5T A;  2QCU A;  1GPE A;  5DBJ A;  1PXA A;  4AP3 A;  4Z2R A;  5KMS A;  1TYT A;  4CY8 A;  1PXB A;  3EF6 A;  4YTP A;  3T2Y A;  2YWL A;  4H4P A;  5IQ1 A;  3CGB A;  2X3N A;  2XFU A;  4H4Y A;  1E39 A;  1LPF A;  4HA6 A;  1TDE A;  3NN0 X;  1RYI A;  1P2H A;  3R9U A;  4TM4 A;  3SM8 A;  3AE4 A;  5ER0 A;  4NEV A;  3RP6 A;  4BUR A;  1JRY A;  1VDC A;  1UKV G;  3CNS A;  4LU6 A;  1B5Q A;  1GRT A;  1LTX R;  2O9Z A;  4TM1 A;  1RP0 A;  2V61 A;  2OAL A;  3DJE A;  4B64 A;  3AEE A;  1CC2 A;  3BI2 A;  3AE1 A;  1TDF A;  3BI4 A;  3CTY A;  4EQX A;  2VRL A;  2R46 A;  5GSN A;  2WDR A;  3NK2 X;  1RSG A;  1JRZ A;  1PBD A;  4I58 A;  3T31 A;  2ACZ A;  2YLS A;  3HYW A;  2BK3 A;  1ELI A;  4WX1 A;  1BGN A;  3KA7 A;  5M0Z A;  5EB4 A;  3HYV A;  3F8D A;  3G5S A;  2A89 A;  2XVI A;  2BCP A;  1DJQ A;  2FJA A;  4BK3 A;  2F5Z A;  3LAD A;  3NIX A;  4P9S A;  3ZYX A;  2V5Z A;  4PAB A;  2DKH A;  2XVH A;  1GSN A;  1Y56 B;  3AEA A;  1KSU A;  2GR3 A;  4ICY A;  3V3O A;  4C3X A;  4NTE A;  1E7P A;  3NH3 X;  2R0G A;  4U2T A;  4Y4N A;  4A6N B;  2V6O A;  2YG7 A;  1M64 A;  4U2S A;  1Y56 A;  2TMD A;  4K8D A;  2C67 A;  5JCM A;  2XCG A;  3HYX A;  5J7X A;  1XPQ A;  3NYC A;  5U63 A;  5JCL A;  3SX6 A;  4AT0 A;  4OPU A;  2YLW A;  4H4T A;  3RP7 A;  3WE0 A;  2R4J A;  3ATQ A;  1IJH A;  1VQW A;  3D1C A;  1TDK A;  5KVH A;  1H7X A;  4H50 A;  4GAP A;  4LII A;  1H83 A;  2B9X A;  3AYL A;  1JNZ A;  3H8L A;  3II4 A;  2WHD A;  1V59 A;  1Q1W A;  3M13 A;  2XFP A;  3H8I A;  3C4N A;  3CNP A;  2WET A;  1EL9 A;  4CBQ A;  4U8L A;  5KOX A;  4YKF A;  5KOW A;  1PXC A;  5KMQ A;  3AD7 B;  1ZK7 A;  2A8X A;  3CND A;  4U8P A;  5KRQ A;  1NHS A;  1FL2 A;  3AYI A;  3CNT A;  2C3C A;  2C65 A;  2C7G A;  1CF3 A;  2BYB A;  4GUV A;  1O95 A;  4J33 A;  3VRB A;  5TR3 A;  2WDQ A;  1JU2 A;  4C5O A;  2WPE A;  4I59 A;  3F8P A;  1XDI A;  3PS9 A;  1REO A;  4GDE A;  2XLU A;  3GRS A;  2GR2 A;  3P4P A;  1Y0P A;  3BNM A;  5JCK A;  2BCG G;  1KDG A;  2BAB A;  2EQ6 A;  2V3B A;  1PJ7 A;  3ADA B;  3GQH A;  2JAE A;  1MO9 A;  1O94 A;  4BJZ A;  5JCN A;  1VG0 A;  2QAE A;  3UTF A;  1KF6 A;  2NVK X;  2TPR A;  5EB5 A;  1NEK A;  3AD8 B;  3DK8 A;  1N4W A;  3COX A;  1VG9 A;  1DOC A;  2YVG A;  1ZDL A;  3SYI A;  2GVC A;  2AAQ A;  3ALJ A;  2VZ2 A;  3FIM B;  4OPL A;  4USQ A;  2H88 A;  3AEC A;  3BI5 A;  5BRT A;  1XAN A;  1L9E A;  4GCM A;  2Y6R A;  3NK1 X;  2X8C A;  2QA2 A;  1XHC A;  4EMI A;  3K7T A;  3SFD A;  2B76 A;  4YT0 A;  1EBD A;  3SZC A;  5HXI A;  1QO8 A;  2XVE A;  2AQJ A;  1F6M A;  3SGL A;  5BVA A;  2EQ9 A;  3EAO A;  2V3A A;  5FS7 A;  4OPI A;  2DKI A;  3GYX A;  5KVI A;  3GMC A;  3UTG A;  2RGJ A;  1OJC A;  2WP5 A;  4NZH A;  4FDC B;  4NWZ A;  3URH A;  1ZP0 A;  1ZMD A;  3D8X A;  2JB3 A;  2XVF A;  1F8W A;  3AEF A;  3OZ2 A;  5U25 A;  4E0V A;  3RHA A;  1MXT A;  4YSY A;  5EBK A;  4EMJ A;  3CIR A;  1E1N A;  4A9W A;  3CGD A;  2C3D A;  4IA5 A;  4D04 A;  2LFC A;  1K0I A;  2GQF A;  3H4K A;  5L46 A;  4U8N A;  1GOS A;  5CKU A;  3ISH A;  3KPF A;  3AE7 A;  1NEN A;  4YSX A;  1IUV A;  1JRX A;  1NHP A;  3UCL A;  3SZW A;  4Z2U A;  4Z26 A;  4OPD A;  3Q6J A;  3K7Q X;  4NEW A;  5C3J A;  2BRY A;  3CN8 A;  1ZOV A;  4NTC A;  3AEB A;  2CUL A;  4U8I A;  1H81 A;  5KMP A;  2GR1 A;  4EM4 A;  3KVE A;  2YAU A;  2YQU A;  2QA1 A;  2WBA A;  1GEU A;  1NPX A;  3CPH G;  4LA1 A;  4TM3 A;  4X4J A;  4OPC A;  1FEC A;  1PJ5 A;  1IUT A;  4ECH A;  3UTH A;  2IID A;  3IHM A;  4APN A;  3DH9 A;  4Z2T A;  3BHK A;  3Q9T A;  4A5L A;  1F8R A;  1EL8 A;  4X9M A;  2WQY A;  4K5R A;  5HYM A;  3AEG A;  4J31 A;  2VVL G;  2JKC A;  3QJ4 A;  3GYI A;  4YKG A;  2X99 A;  5IQ4 A;  3GWD A;  3NKS A;  4U8M A;  4IVM B;  3ITJ A;  1N1P A;  1CC4 A;  1JNR A;  1YQZ A;  1TDN A;  2CFY A;  3KKJ A;  4OPG A;  2B7S A;  3CMM A;  1BWC A;  3T2Z A;  3GRT A;  5FS8 A;  5J60 A;  4JQ9 A;  4GAV A;  2BS3 A;  3UP4 A;  2C73 A;  3GMB A;  5KNL A;  5HHF A;  2RAB A;  1H6V A;  1N4V A;  4O5U A;  3QFB A;  4JN9 A;  1CHU A;  5LV9 A;  1D7Y A;  1GT8 A;  2R0P A;  2C72 A;  4K7Z A;  2GAG B;  2J3N A;  1GRF A;  2FBW A;  1L9D A;  5FS9 A;  1GXF A;  1NAA A;  4C3Y A;  1Z6L A;  3FG2 P;  1FEB A;  1HYU A;  3NYF A;  2JBV A;  3NGC X;  3P4R A;  4YTM A;  2X50 A;  1H84 A;  1PBE A;  1D4D A;  1ZMC A;  1GRE A;  2WPF A;  2ZZC A;  3DGH A;  4JY3 A;  1B8S A;  3AE9 A;  5BUL A;  3RP8 A;  2V60 A;  1B37 A;  1CJ3 A;  1SEZ A;  3S61 A;  4IV9 A;  1PDH A;  2GRT A;  2JB1 A;  4AT2 A;  1CL0 A;  2BK5 A;  4OVI A;  4RG3 A;  2WP9 A;  1D4E A;  3LOV A;  1PHH A;  4JNQ A;  1DOD A;  1BZL A;  2X8G A;  1FOH A;  1MOK A;  3G5Q A;  1GET A;  3DA1 A;  2IVD A;  3DME A;  3NRN A;  4B65 A;  4AOS A;  2C70 A;  2YVJ A;  3K7M X;  4XWZ A;  4A7A A;  4H2P A;  3SZF A;  1GND A;  4GR1 A;  2YG6 A;  2GMJ A;  2WOW A;  2YM2 A;  4EIP A;  1BF3 A;  1JOA A;  3UOV A;  1LVL A;  1GTH A;  1M6I A;  1KSS A;  4M52 A;  1S2Y A;  2E4G A;  2NPX A;  4G6G A;  3GYJ A;  2VQ7 A;  4H4Z A;  3AE2 A;  3GSI A;  1NHQ A;  2GMH A;  1KNR A;  1DOB A;  2YLX A;  3F8R A;  3I3L A;  2XLT A;  4G73 A;  2BXR A;  1E6E A;  4YWO A;  1FCD A;  5KMR A;  4C74 A;  3ABV A;  3V3N A;  2XYO A;  3NHO X;  4IA6 A;  4YSH A;  4ADW A;  1K0L A;  2WU5 A;  2XLS A;  2BRA A;  2VRM A;  3M0O A;  3SY4 A;  2VVL A;  3CPI G;  1L9C A;  3BNU A;  3FMW A;  3LJP A;  3NN6 X;  3T37 A;  1GTE A;  4GF7 A;  3DK4 A;  3UKQ A;  4B66 A;  2WPC A;  2OAM A;  4DSG A;  4RSL A;  4B68 A;  2XLR A;  4EMW A;  1O5W A;  1B4V A;  1W4X A;  3QFA A;  5FS6 A;  5EOW A;  2GEW A;  1H86 A;  3PVC A;  4H4Q A;  2BS4 A;  3L8K A;  3NNE A;  2E5V A;  4J34 A;  4H4U A;  3GD4 A;  1OJ9 A;  1GER A;  2E1M A;  5M10 A;  2BA9 A;  2GB0 A;  2I0Z A;  2YLZ A;  4DSH A;  2B9W A;  2ZZB A;  5C2T A;  4U2L A;  2OLN A;  4O5Q A;  3UTE A;  1ZY8 A;  3VRA A;  3M12 A;  2X8H A;  2XFO A;  4J36 A;  4NTD A;  1F3P A;  1N4U A;  3RED A;  3UKA A;  2RGO A;  3UKF A;  1GV4 A;  4J56 A;  2BS2 A;  3JSK A;  4AP1 A;  4FK1 C;  4B67 A;  1YQ4 A;  2CDU A;  4USR A;  2GV8 A;  3V76 A;  2C66 A;  4H2N A;  3AE8 A;  4J2W A;  4CNJ A;  3UOX A;  3CGC A;  1Q9I A;  3UKK A;  5BUK A;  1S3B A;  3NG7 X;  4H4W A;  2YR5 A;  2EQ8 A;  4G6H A;  4NNJ A;  2GF3 A;  3IWA A;  2JB2 A;  3E1T A;  2YM1 A;  2UZZ A;  4H4X A;  4RG4 A;  4TLX A;  4WCT A;  2H89 A;  4FX9 A;  1CBO A;  1K4Q A;  3ATR A;  2YLR A;  2Z5Y A;  4HB9 A;  2WDV A;  4A79 A;  2R0C A;  2ZBW A;  3QSE A;  4AOX A;  4B63 A;  2WOV A;  3P4S A;  4BJY A;  2JK6 A;  3VQR A;  1CJC A;  4CCQ A;  4DNA A;  1ONF A;  3I6D A;  1VRQ B;  1GRG A;  3LZW A;  4MJW A;  3GDN A;  4G9K A;  3SXI A;  3P9U A;  3NK0 X;  3DJG X;  4ZCC A;  2WES A;  4U8O A;  4TLZ A;  3QSM A;  2Q7V A;  2B7R A;  1D4C A;  2VVM A;  3HZL A;  4J57 A;  3K30 A;  3LXD A;  4EIQ A;  1TYP A;  3AE6 A;  1PN0 A;  2YG4 A;  1CJ2 A;  3C4A A;  1D7L A;  3EPT A;  2ZZ0 A;  3OC4 A;  1IUS A;  3IHG A;  1Q1R A;  1IUX A;  4B69 A;  1PBB A;  2YG3 A;  4OPT A;  2ARD A;  1IUW A;  3LZX A;  3GD3 A;  2BC1 A;  2YG5 A;  4Z24 A;  4A99 A;  1PS9 A;  5KWF A;  3AD9 B;  4BV6 A;  2YLT A;  1LJ1 A;  1ZOY A;  4EQW A;  1AOG A;  1KFY A;  5KXJ A;  1TRB A;  4H4R A;  5FMH A;  4Z43 A;  2Q0K A;  3FPZ A;  3QVP A;  3AB1 A;  4XWR A;  1GES A;  4GRT A;  1DJN A;  3KU9 A;  4EQS A;  4FK1 A;  4EQR A;  4B1B A;  4YTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...