4YTNB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into the Design of Inhibitors Targeted for Parasitic Anaerobic Energy Metabolism
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 61
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ytnB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ytnB01
1N5WA 3AM9A 1JALA 4ZHPA 4N6EB 3W5VB 2L52A 1ZOYB 2E3TA 4P6VF 2BS2B 3HUIA 5C2TB 2WU5B 1F0ZA 1FXIA 1NVID 1JWAD 1GT8A 1FO4A 1L0VB 1WXQA 1XLNA 1NEKB 2BS4B 4YTMB 2WS3B 4KX6B 4IDIA 1TKEA 3AE3B 4YSYB 1AWDA 2B76B 2QJLA 5G5GA 2WDVB 2N0SB 2BS3B 1DOXA 2CJNA 2WU2B 1N61A 2Y5CA 3W5UB 2MJ3A 3NVYA 1B9RA 1N63A 3LXFA 2WDRB 1ZUD2 2MJDA 3ABVB 2ACZB 1RFKA 3L4PA 4ITKA 5G5HA 1FXAA 4YTNB 3VR9B 1TKGA 1R7SA 2WQYB 3AEFB 1E10A 2H89B 3FC4A 1FIQA 1FRDA 3KWLA 1H7XA 4YXDB 3P4SB 1E9MA 1IUEA 2BT6A 1DGJA 2K22A 2Q5WD 4YT0B 1FRRA 2QIEB 1NYRA 1NENB 1L6VA 2WP9B 1QOGA 1ZP0B 1GAQB 1QOFA 1RWSA 4HROA 3AE1B 1QT9A 2K5PA 4WWMA 5AUKA 1KF6B 1FM0D 3NS1A 1V8CA 1EWYC 1OQQA 3AV8A 3NRZA 4C80A 2M19A 1N62A 5H92C 2W55A 1GPXA 1YJIA 1NI3A 3P63A 4ZHOA 2DBYA 1L6UA 1GTEA 1E6EB 1I7HA 1RM6C 1E7PB 1UWMA 1VLBA 2DWQA 3NVVA 3AEAB 3VRBB 4FXCA 1WWTA 1KFYB 1VJKA 4N59A 1OFFA 5AUIA 4WQMA 2KMMA 3NVWA 3DWGC 4LTUA 2PVOD 1WRIA 4JWUC 3AEBB 2PVGC 1PUTA 3SR6A 5EE3A 5EE1A 1TYGB 3AECB 2CU3A 2JQRB 1DOIA 1PDXA 1ROEA 1FFUA 3AH7A 1T3QA 2EKIA 1OQRA 2L83A 3W9CB 1A70A 1J7CA 3AE8B 1VDVA 4JX1C 5EE9A 1JWBD 3P4PB 1QOBA 1TKYA 1N60A 3AE7B 1JW9D 3AN1A 3RPFC 3P4RB 1DOYA 1RYJA 4HRSA 1JRPA 1XLPA 1FMAD 2H88B 4YTPB 1CZPA 1WGKA 2LEKA 3AEEB 1N5XA 2HTME 2M56B 3CWIA 3AEGB 1QLBB 1J7AA 1FFVA 1SB3C 1E0ZA 4JWSC 3AE6B 3WCQA 5C3JB 2W3SA 4USAA 3LB8C 3HRDD 2K9XA 3NVZA 2JX5A 5MPOA 5GXGB 2W3RA 3AE2B 3AE5B 1GTHA 3EUB2 1L5PA 4C7ZA 1JQ4A 2W54A 1SF0A 2PKOA 3B2FA 1NYQA 2WLBA 5EE0A 2MJEA 3ZYYX 3SFEB 3BIID 1TJEA 2OHFA 1JROA 1QOAA 3CF4A 4US9A 4C7YA 3HVZA 3AE4B 1YQ3B 1SIJA 1V97A 3B9JA 3DWMA 3ETRA 4YSXB 2FBWB 4ZOHC 1XLOA 2PIAA 3B2GA 3AMZA 3AE9B 1XO3A 1YQ4B 3CIRB 1YJJA 2G1EA 1PFDA 2AX5A 3FAHA 2CJOA 3PO0A 4N58A 2MH7A 4US8A 5H8YE 1AYFA 1CJEA 1ZXIA 3P4QB 1KRHA 1QF6A 4A9AA 3AB5A 1J7BA 3VR8B 1H7WA 1WYGA 3P1MA 3AEDB 3SFDB 4YSZB 1XLQA 2KAJA 3VRAB 2WDQB
chains in the Genus database with same CATH superfamily
4DHJB 4WJQA 1WZ0A 2E3TA 4EZLA 2D5GA 1XLNA 3PGEA 2CHZA 1F2RI 4EOYA 3V6CB 1BXTA 1AWDA 2QJLA 2ZVNA 4RCOA 3FILA 3VUYA 2WU2B 5IAAC 2BB6A 1UNSA 2AQ2B 3GB1A 1TKGA 3AXCA 2LVPA 2V4LA 3KWLA 1PGBA 2NPTA 1XXGA 2Q5WD 4P1CC 3DHIC 2LI5A 3H7PA 3K9PB 4WQOB 3C19A 2K25A 1L2NA 1GUAB 2JYEA 2MRPA 3WALA 4JE3B 2GMIC 4KZCA 3RNAC 1UWMA 1HZ5A 3DWGC 1YNTE 3FILB 1F52A 2JQRB 3L10B 3N1YC 2EKIA 4K7WA 2IGHA 5EE9A 1EF1A 3RPFC 1DOYA 1I4QA 2V3SA 1PYWD 2Z59B 4OVZA 2HTME 1NBFC 3VTWA 1GB4A 4ZYNA 5GMVA 4ARIA 3KQ4A 5MPOA 1HQRD 1JQ4A 3B2FA 2L7RA 4W9DA 4CYEA 3DHGC 3DQVA 4MH8A 3DVNV 4C7YA 4PYUA 1ACCA 3EC8A 3ECIA 3ZLZA 3OJ4B 3RUIB 2DX5B 3BVMA 1YJJA 3FAHA 1LXDA 2I1KA 4FLHA 2YEPF 1IP9A 1Z2MA 4HXDA 4NJ6A 3VRAB 2ICIA 3ZXRA 1YJ1A 2LVOA 2DZIA 2LXCA 3UQBA 3PRPB 4DXFA 4IDIA 4YSYB 5FR6A 1SJED 1KH0A 3UI3A 4JL9A 1ZUD2 1IPGA 4D2KA 5BMIA 4YTNB 1EO6A 2KD0A 3VR9B 4NQLB 4OHJA 1E10A 2H89B 1TY0A 3GE3C 1FRDA 3H7PB 3OWEB 4LDTD 1NYRA 4KKIA 3D32A 3VQIA 4OW0A 1ZP0B 2K5PA 3MP9A 3QCAA 4MT5A 1K52A 4C80A 3H8HA 1EF5A 4JGHB 3X23A 2MBOA 3A9JB 2D3GA 3I9V1 1E8YA 1WGGA 4HK2A 3EECA 4A55A 2GBRA 1Q10A 1ROEA 3W9CB 3ZJVA 2WNMA 2GBNA 3DBLB 1N60A 3RFZB 2KC1A 2LEKA 3U8ZA 2ZEQA 3TBLD 2RPVA 2X8XX 5E6OA 2FUHB 2KTRA 3QHTA 3QK0A 3X0WA 4TQ1A 2VZKB 4OZCA 1V6EA 3VHTC 2BBCA 2MJEA 2XK5B 2M17A 1WJ4A 3BK2A 5LXIB 3U7DA 2KN4A 3CF4A 1SIJA 2LRUA 1E7UA 1L0YB 3RD2A 4NAWB 5CHWA 2LASA 3U7ZA 1V80A 4TV3A 1WX7A 2RDHA 1MHHE 2XK5A 2QC8A 5BMHA 4MJSA 2KDFB 4AQ7A 3GZNI 2WU5B 4FJVB 1NEKB 2WS3B 1KTKA 3AE3B 2B76B 2V9HA 2BS3B 3HK0A 4BKGA 2Y5CA 3NVYA 2DZJA 4G50A 3VAWA 5D6JB 2MP2A 1KOTA 2BKRB 1RFKA 1FXAA 4KZ0A 3MHSD 2C7HA 4FJZA 2WX0A 2I1JA 3P4SB 3DVGX 2RDBC 5DPWA 2QCZA 2WP9B 1C4CA 2FIFA 1I4GA 5CTRC 1RWSA 3CSTA 2KK8A 3NS1A 1WGHA 2FCQA 3RNCC 1YJIA 4G11A 4BAXA 4CO7A 3VDZA 4FULA 1TY2A 4MACA 3R2TA 2J4XA 1LGRA 3Q3FA 4M8NA 2IGGA 3ML8A 3SEBA 1TKYA 3AN1A 3KUZA 5HKHA 2MBQA 1LQBA 3ZNZB 2NR2A 2VH2A 1WJNA 2M56B 3ZTCA 3AI5A 1WRDB 2YVCA 4M0WA 5T8IA 2IZVB 3AU4A 4ZRPA 2JX5A 4GDLA 3EUB2 3BZDB 2WLBA 4ASWC 3ZYYX 1L4ZB 3U4EG 1JROA 2LGDA 1M4VA 2KC2A 1L4DB 1V1PA 1E90A 2KJHB 2XBBC 5FKAC 4KKJA 1ZXHA 4XE0A 4LNIA 2L3ZA 2ON8A 1R4NI 1UGJA 2JRHA 1OEYA 2L76A 3HUIA 2SAKA 1D5XC 1FO4A 3MJWA 1V9JA 4BBNF 2KQ7A 1TKEA 1ZW7A 3RT3B 3I5JC 2O2VA 3W5UB 4BOSC 5CX3A 1RAXA 1C4AA 2M0XA 4EZJA 3UGBB 2QMTA 4ITKA 3ZGZA 1AARA 2L00B 1FIQA 3MC9A 4MGIE 1KLUD 4NZLB 2REXA 4GXBA 1GAQB 4WWMA 2J0JA 1OQQA 2WXIA 3NRZA 4J3OD 4E71A 2M19A 4KIKA 2D10A 2WYQA 2WXFA 3ALBA 2M8SA 2K0PA 1I7HA 1Q5WB 2K8CA 5AUIA 1C9FA 2ZPNA 2KJ6A 2NBUA 5EE1A 2GI9A 2CU3A 3A33B 1B1ZA 3N3KB 3B08A 2INDC 1MI0A 2N9XA 1C76A 4OVVA 2KTFA 1VCBA 1RFAA 2W82A 3PHWB 4YTPB 2D3CA 3O13A 3V3XA 2LVQA 4AJWA 1WZ3A 3VUWA 2L8JA 2LUMA 2DYBA 4L23A 1K51A 2W3RA 2KO3A 2WXOA 4C7ZA 1WXAA 2W54A 5EE0A 1KM7A 2WXKA 4IUMB 3P2BA 3WAMA 2LGIA 4GLSC 4WWPA 2G4DB 4YSXB 4NY0A 4YL8A 2LGSA 1E8ZA 1UD7A 4HJKA 4B0EA 2G1EA 4HEA1 5G2NA 1QF6A 1PQSA 4IM0A 2KLGA 1HXYD 1TIFA 1N5WA 2LGYA 3KH0A 2L52A 3PSEB 4FBJB 2KOXA 4KVGB 5AZHA 2K39A 1SXTA 1SGHA 3LXFA 1SE3A 1WGDA 4NJ7A 2BB5A 5IO9A 2VZKD 4NPNA 1YN5A 3PTFC 3MHZA 3QQ8B 2PJHA 4W9KA 1LO5D 1TS2A 3BY4B 1QT9A 4PYZA 1IYFA 2KWCA 1ET6A 2AQ3B 3PPAA 4XDDA 4OZBA 2DWQA 3NVVA 3AEAB 3NY5A 3TEXA 1WWTA 3NVWA 3Q8AA 1WRIA 5C1ZA 2PVGC 3SR6A 4LJPB 2WXHA 3AECB 2QHOA 2KDEB 3BYYB 3Q3NC 1MVKA 1J0GA 2JF5A 1EM7A 2GLSA 4RGNA 4AJYB 4GN1A 3AEEB 2JZ3B 2YEPB 5C3JB 4IM2A 4OVUA 3JSVB 1Q1OA 5BMGA 2O6VD 1GG3A 3PVLA 2KVRA 3QX1A 3IXSA 5AEKB 3AMZA 2AQ1B 3CIRB 3VUXA 4DK5A 5H8YE 4AOFA 1BUIC 1J7BA 4MDKE 2IJ0A 2NPTB 3EFCA 4AWJA 4WAFA 3PS6A 2AL6A 4CQNA 2VRRB 3OAWA 4C4VB 1T5XD 4BKTA 3ZNID 3ZKJC 4XWWA 3M95A 4A3PA 2BWES 3T9LA 1TBEA 4ANXA 4RMAA 1IGDA 3A1QA 3HIZA 3Q8BA 4R3DA 3ZJUA 1WM2A 1T6BX 1IBXA 1Y8RC 3MTNB 1QOFA 4MM3B 3SDLC 1PGXA 5FK9C 3DOWA 2KN5A 1TZ1A 3GP7A 2M1MA 3CSFA 1MG4A 2V3PA 3WA0A 1GPXA 1C4PA 4FXCA 1KFYB 2BYVE 1V81A 3ML9A 3ZDMC 1FCCC 1FFUA 3GE8C 2WXPA 2ZCCA 4GDKB 2DZKA 1V5TA 2I2YA 3C0RB 3QC8B 1G6JA 2J0KA 1E0ZA 3WCQA 3B1LX 4BBNC 4S0RA 3U2SC 3LB8C 2JSVX 3HRDD 1IGCA 3KUDB 5IA7A 1Q0WB 4ARCA 2XN9C 2K6DB 3VVWB 4M02A 3PREA 1R4MB 2C60A 3C8YA 2KDIA 2JXTA 3SFEB 1XT9B 5LXHA 2N1WA 3DWMA 5G55A 1WR6E 4NAWA 2ZVOA 3IG3A 2PIAA 1TS4A 3UQAA 2MW5A 2BQQA 4M01A 2LRWA 1WMHA 2KWUB 4ICUA 2CKHB 5C2TB 3TCAA 3V62A 2IO3B 5D7GA 2RD0A 4QAYA 3L16A 3SD5A 2CR5A 2FCSA 1T0SC 3I57A 1B9RA 1BMLC 2MP2B 1N63A 3RI7C 3VH4B 2DYOA 1J19A 2KLCA 2K8BA 3DDCB 3U30A 2LMCA 2RR9A 3TEWA 4RF1A 1ZPSA 3JVZX 1KF6B 3V60A 2GRIA 1FCLA 3AV8A 2AWTA 3DBSA 1UBQA 3TSSA 1NI3A 4F8CB 3MC8A 4IG7B 2JU6X 1I4RA 5IP4D 4NQKE 2PVOD 1XCQL 2MCNB 2D3AA 1P1AA 3BK1A 1WX8A 3BVGA 2BVCA 1OQRA 4EKUA 1A5RA 5E6PA 2MSED 4L1BA 3WAOA 1FMAD 4K81A 1SB3C 4JWSC 1TS5A 3UINB 3VH3B 2NVUI 2JYTA 3VTUA 4HCPB 3ETRA 4IWOA 5LLIA 4I6PA 1NDDA 2BGFA 5L83A 2Z0EB 1YQ4B 3WANA 3Q14C 4HPLB 1EUVB 5JZEB 3DBRI 2KMCA 4HDOA 1D3ZA 4KSLC 1FNVA 1YOVB 3Q6BA 2E6XA 2LHDA 3FKYA 1OQYA 3PZ7A 4YTMB 2J53A 4FADA 4DHZE 1SE4A 4FN2A 4J6IA 2ZW0A 4MGZE 4RGTA 2LGXA 1F1HA 1P0RA 4ZRIA 1WX9A 4EFOA 1R7SA 3APCA 3FC4A 2NMQA 2DYMA 3A9KB 1HTQA 4IC7B 3ZO5B 3HVDA 1VZ7A 2KXJA 3AE1B 4ZRQA 1ZDXA 4BKSD 4PT5A 1WM3A 5H92C 4L2YA 4ZHOA 2Y5PA 1RM6C 1GTEA 1F9JA 3GS2A 2C9WB 1VJKA 1TGZB 5JHBA 3TEYA 2NTTA 3AULA 5LNK1 2BWFA 2L83A 2KYWA 2KACA 1VDVA 3W1SC 4HRSA 2ZZPB 2O6VB 3DVGY 1T0RC 5AZGA 4F7ZA 2KFKB 3CWIA 4K3CA 1D5MC 3L54A 4C56C 3AE6B 3RZFA 1SIFA 5TSSA 2G3QB 1T0QC 1E8WA 1L7YA 2JZZA 3AE2B 2IDYA 2KHWB 2ZNVC 1UELA 1TJEA 2OHFA 1KLGD 3ZRFA 3NS8A 2TSSA 4XX5A 1VD2A 2PE9A 4ZOHC 3DCGA 3AE9B 3U52E 1XO3A 3LYYA 2WXLA 4K7UA 3L13A 3P4QB 1H7WA 2N9PC 1XLQA 1CMXB 1GB1A 4NAMA 1RLFA 4RM9A 1WXVA 3DVNU 3UIPB 1V5OA 1YD8U 2WXJA 5FR3A 2V3NA 3HHMA 3EA6A 5G5GA 5D2MB 1SEBD 4JIOU 1WE6A 4ACFA 3PHXB 5BYRA 5E6JA 2NS5A 3L4PA 3RNBC 2ZPYA 2HE7A 1F2RC 4RF0A 1H7XA 3W1SA 1SE9A 2QIEB 1L6VA 3NZUA 1I4HA 4BFRA 4KGTA 3DBLI 1WJ6A 2VH1A 1EWYC 1EU3A 1C78A 1E6EB 1VLBA 4FHKA 1F77A 2JXXA 2QILA 2YLMA 4P7IA 1YQBA 1FD6A 3Q2AC 4RNAA 1DOIA 3VFKA 1WI0A 2AEHA 3AH7A 3ZXVA 1IBXB 2PE6B 4FHJA 2MBHA 3EFUA 2INNE 2WGSA 3QWZB 1CZPA 2B3AA 3M62B 2HDEA 3CMMB 4MEMA 1UWXA 4HVBA 4GIVA 1WXMA 3NVZA 1ISNA 2K8HA 4DBGA 1UF0A 2N7JA 1NYQA 2LWPA 2MA9B 2KTRB 3URYA 1CQVA 2IBIB 3MC0B 2X38A 3KYDD 2FBWB 5L95C 3B2GA 4ZYSA 3E9SA 3PLVA 4ZRJA 3PO0A 2MH7A 3TIXA 1WGYA 1KLVA 2M4NA 1JRUA 4WH4A 3R2IA 1L0XB 2EKEC 3W5VB 1P98A 1FXIA 2GBKA 5IKCM 4BZAA 2GBJA 2WXNA 1WFYA 4KX6B 2WXQA 2N9LA 4WJPA 3DPDA 3APFA 1DOXA 5J18A 3ZNGC 2OOBB 3RNEC 4DXGA 2GB1A 3AEFB 5BYQA 1X1MA 4YXDB 2QDFA 1I4PA 1N6ZA 2MX2A 1NENB 1QOGA 4HROA 5JXVA 1H8CA 5BYSA 3RYTA 1S3SG 2N9KA 2KDMA 2KVZA 3KW5B 4XYCA 1E7PB 1OFFA 3Q3JA 4JWUC 4NJCA 4HWIB 1XCTL 2IPKD 4IM3A 4I6LB 2FIDA 2DAFA 2K3UA 1Z5SB 3KVFB 4H2AA 5AZFA 2MBBB 3AEGB 1YX5B 1STEA 3MJ5A 1YN3A 1Y56A 4FJYA 4USAA 4AP4C 2L32A 2JRIB 1HTOA 4EUTA 2K9XA 2J52A 1GTHA 1QILA 2G45B 4HKZE 3NJTA 2V1YA 2ZCBA 3MFGA 2BPSA 3B9JA 4XGAB 5CHVC 5IN7A 2N9EB 2HTHA 4N58A 3R3MA 3A1QB 4IKGA 3QIJA 3ZW3A 1WMHB 2KANA 2WDQB 1LM8B 4X57B 1PGAA 1ZE3D 2BS2B 3E56A 1JWSD 2L0TA 1WXSA 1KJTA 2RGFA 4LNKA 4KDIC 1WYWB 4WURA 1N61A 2MJ3A 3N32A 2WDRB 1K53A 2R2QA 1ESFA 3KLSX 2FCNA 2KX0A 1AW7A 1E9MA 2K22A 2CS4A 2JZPA 1C79A 4S17A 4IWPA 2J42A 4WIPA 3TMPB 4YWGG 3R7QA 2LZ6A 4LNFA 3APDA 4HPMB 1VRAB 3I3TB 4A8XC 2M0AA 1DYQA 1T0YA 2RPQA 4N9F4 2C5LC 4PS3A 1EU4A 1TZOA 1WJUA 3R7RA 5J17A 1K8RB 4II2B 1JWUD 2JPHA 2KQSA 2AL3A 2D3BA 2ZNVB 4BKSA 2IY1B 1TYGB 2LXAA 4HDQA 5DPTA 2KNBA 5JH5C 1JMLA 2IO2B 1E5WA 3P4PB 1JW9D 1RYJA 2WHIA 3UIOB 4RGOS 4A90A 3ZVVA 4XDCA 4FA6A 1N5XA 2BF8B 5C23A 3DHHC 2K1FA 3Q3MC 3Q8EA 3AE5B 4ICVA 3HM6X 2R2OA 2PPHA 3BIID 1V1OA 4MGKE 4XC2A 3O65B 2N7EA 1UZXB 4TKNA 1E7VA 1YN4A 3H9DA 1H4RA 1PFDA 2WDTB 1AYFA 1CJEA 1MJDA 2AYOB 1ENFA 2HJ8A 4EEWA 1C3TA 1GJZA 4ZHPA 4PK1A 4N6EB 4O1NA 3RULA 1NVID 4C4VA 1GT8A 4DHZB 1L0VB 2QEJC 3ZRCA 1WR1A 4M8MA 1I35A 2LJIA 4W9LA 4WWNA 5HI1A 2N0SB 2KT7A 4KV2A 4XWTA 4ZRKA 3L08A 5DPSA 4LK0M 1C77A 1D4BA 4PS7A 4KDLB 1WGRA 4DDID 4G0NB 5J2RA 3RZWC 2MEKA 1GC6A 2LD9A 1QQRA 2BYEA 4HJGE 4I6NB 3VRBB 4AUQC 4N59A 4KGSA 4LTUA 4WQMA 2KQ4X 3AEBB 2MQJA 5KHOA 3M3JA 4JX1C 3SHQA 1QOBA 4AS1A 2BTEA 4URKA 2ZW1A 1QKZA 1J7AA 1FFVA 5DPRA 4CHKA 1YMHE 2W3SA 4K7SA 3PZDA 4W9HA 2WXMA 3NHEB 4RFBA 4M0WB 4DXAB 3HVZA 1YQ3B 3A4RA 2W9NA 3T3NA 4JPSA 3KWVA 5BO4B 1GC7A 2N7DA 2HD5B 3Q8FA 1YX6B 1I42A 2UWQA 1JALA 3LDZE 3WAPA 3PRZA 1MHXA 3PRMB 4HKQA 4JQWC 1JWAD 4XZ4A 4GSWA 2MLBA 2JWZA 2WWZA 3NOBA 3PV1A 3CF6E 2NBVB 2CJNA 1ZGUB 5CHFA 2Z8LA 3ABVB 2IGDA 5G5HA 3IFWB 4IOIE 1FNWA 5E6NA 1MG8A 4DDGD 2CHXA 1S1QB 4REZA 3ONSA 4KGRA 3QA8A 4TMAB 1QZEA 1V8CA 1AN8A 4GOCA 3IT6B 4W9JA 3PT2B 4LDTB 2DBYA 2D07B 3RNFC 2PW9A 2D2QA 1UUPA 2IO1B 1A70A 3AE8B 1JWBD 3N1XC 3AE7B 4E74A 3VTVA 3JW0X 2LFIA 1P7EA 2CHWA 3ZNHB 2H88B 4LLGM 2DNFA 2ZJDA 2KWVB 2DAJA 4HPPA 4NNJB 1VZ8A 5D94A 3GOEA 4PS8A 3IVFA 5TR5A 3W1YA 1L5PA 1U4AA 1WF9A 2V4IB 1EWCA 1P9DU 4ANWA 3ZIMA 4W9GA 5HFYA 1UBIA 3ZDTA 2DLBA 1KRHA 2JWUA 3DBHB 3VR8B 1WYGA 4MM3A 1NI2A 2FE8A 4YSZB 5I4DA 2PMVA 1D5ZC 3SU8X 3T8MA 3VXWA 1J8CA 1TT5B 3AM9A 2EMTA 4MSMB 2ASQA 4P6VF 1ZOYB 4MH0E 4A3OA 3I63C 3Q3OC 2BS4B 1FXTB 3PLUA 3ENEA 4DHJD 2KX3A 2RSUA 1HA5A 3RN9C 3N30A 2ACZB 3V61A 3OG5A 3UF8A 1IUEA 3LJ3A 4YT0B 4P16A 3QARA 3NG0A 5AUKA 2PEAA 1HZ6A 2C7NB 1MFWA 2JT4B 2WX1A 3K9OB 1E8XA 4KSKC 4WJNA 1SBBB 1OTRB 3P63A 3WIMA 1L6UA 4W9FA 1MPEA 4MJSB 2N4FA 4DQOC 2IY0B 1ET9A 1WSPA 2L05A 2FAZA 2K6QA 5EE3A 3ZJTA 1OEYJ 3Q69A 3AU5A 2Y5BB 3S2AA 4P1BC 2GOWA 1SSNA 2A5UA 1WGKA 3N20C 4LCDE 2KFKA 2GBMA 4ANUA 3TJPA 4ZDVA 2INCC 1R4NB 3GZNB 4DWFA 3P42A 2KKCA 1YIWA 4B6WA 3ZTDA 3B0AA 4US9A 4TSSA 4II3B 3AE4B 4TQ0A 5JHAA 5KHQA 1XF5L 4K3BA 2JUOA 4RM8A 4BVUC 1I4XA 2DENB 2G9HD 5HHDG 2J7QB 2SEBD 3IHPC 2LHEA 3AEDB 3SFDB 2JY6A 2KAJA 3A4SC 5D3DA 3KYCD 3V05A 2J0MA 3JYUA 2N1VA 2UU7A 3PZ8A 4W9EA 3N9YC 1WY8A 2C7MB 4BOZB 4RGMA 4C00A 2WDVB 4ANVA 2BYFA 3T3OA 2XEWA 2NBWB 4W9IA 3OLMD 1UGMA 1XQQA 3DBHI 1WE7A 2KFJA 3EHVA 2KJRA 1GNUA 4LJOB 4W9CA 2BYTA 1M94A 2A4ZA 2BT6A 1DGJA 1FRRA 2MBEA 4F1SA 2IYDB 3H7SA 2RMMA 1FM0D 1V86A 3DBRB 2L1AA 4EE2A 1FNUA 2WXRA 1N62A 1FPYA 1R4MI 1JCKB 2OEDA 2R61A 2LJ5A 1FEHA 2FCMA 4IWQA 4HCNB 5D3IB 1PDXA 1T3QA 3NZSA 4Q2JA 1P3QU 4GGQA 2DHZA 1UH6A 1VZ6A 4UDUC 3NZ3A 1JRPA 3H6NA 3A9JA 2I38A 1GOZA 2QSDA 4IW0A 3L17A 1V49A 4OZAA 4B9KA 5GXGB 1WH3A 2PKOA 3N1ZC 2DZMA 2FUG1 3HM3A 2NCNA 2OJWA 3EGRA 5HG2A 1XLOA 4EZKA 1TTNA 1SJHD 2AX5A 3IAS1 2CJOA 2V0GA 3IBEA 4E3CA 1ZXIA 3TUOA 2G4SA 3RNGC 2BKFA 1HE8A 1OGWA 1C1YB 3L0WB 4GDKA 1TS3A 1F0ZA 3BYTB 1K50A 1SE2A 4MELA 1WIAA 1WXQA 2D11A 2WXGA 4G3XB 3TL5A 1D6EC 4A6QA 2O2VB 2Z0DB 1HEZE 1LFDA 3RCZA 2MJDA 4KIKB 4RH6A 4K1RB 4WJOA 2WQYB 1ZDVA 4MGYE 3KUCB 4LNNA 3RMKC 2RDGA 2KDBA 2O6VA 3NUHB 4GB9A 2XNAC 3ZUNA 3BINA 2BW2A 2Y3AA 1VR9A 2EMSA 2OJRA 3ZQ4A 4TUUA 4A20A 4B0MA 2EELA 3IT4B 2W55A 3BVZA 1CK1A 2MHJA 2IO0B 1XD3B 4B95A 2KWDA 2KMMA 1V2YA 4GU2A 2UYZB 1PUTA 5DCNA 3TEZA 1ZKHA 1XEEA 4LNOA 2HJ1A 2CU1A 2LUEA 1J7CA 3IAM1 4M00A 1BT0A 2NTSA 3P4RB 3A9KA 2L0FA 4JLCA 1XLPA 2PLPA 4WAAA 3JSVA 3BWUD 3QAQA 2INPE 1QLBB 3M63B 1RRBA 2MWSB 3R66C 4WWOA 1P7FA 4GMVA 4MSQB 2ONQA 3Q8CA 1SF0A 3R8BA 2FNJB 2KZRA 4GDLB 1QOAA 5EDSA 1JWMD 1V97A 3V6EB 2JVCA 2PTLA 3W2DA 3OJ3A 3QJZA 4US8A 1V1PB 2KMAA 4A9AA 3AB5A 3P1MA 4HLEA 3J9CA 3H1UA 5IOIA
chains in the Genus database with same CATH topology
1N5WA 1JALA 2L52A 2E3TA 1MHXA 4HKQA 1JWAD 2D5GA 2WXJA 5FR3A 1XLNA 2V3NA 1F2RI 3EA6A 1BXTA 1AWDA 5G5GA 2QJLA 4RCOA 1SEBD 3FILA 1SXTA 2WU2B 2CJNA 2Z8LA 5BYRA 2BB6A 3LXFA 1SE3A 5E6JA 1UNSA 2AQ2B 3ABVB 3GB1A 3L4PA 2BB5A 2IGDA 5G5HA 1TKGA 1F2RC 1PGBA 2VZKD 3KWLA 4IOIE 1FNWA 4RF0A 1H7XA 3W1SA 1YN5A 1XXGA 2Q5WD 2QIEB 3MHZA 1L6VA 4REZA 1LO5D 1TS2A 4KGRA 1I4HA 4TMAB 1QT9A 4KGTA 1V8CA 1AN8A 1EWYC 2JYEA 1ET6A 3IT6B 2AQ3B 4JE3B 1EU3A 1C78A 4XDDA 4OZBA 2DBYA 2DWQA 1E6EB 1UWMA 1VLBA 3NVVA 3AEAB 1F77A 3TEXA 1WWTA 2QILA 1HZ5A 3NVWA 3DWGC 3Q8AA 1YNTE 2PW9A 1WRIA 3FILB 2PVGC 3SR6A 1UUPA 2WXHA 1FD6A 4RNAA 3AECB 2JQRB 1DOIA 3AH7A 2EKIA 3BYYB 1IBXB 1A70A 2IGHA 5EE9A 3AE8B 1JWBD 1MVKA 3AE7B 3RPFC 1DOYA 1EM7A 2LFIA 2INNE 1I4QA 1P7EA 4RGNA 1PYWD 2H88B 4LLGM 4OVZA 1CZPA 3AEEB 2HTME 2YEPB 1GB4A 2HDEA 1UWXA 5C3JB 1VZ8A 4ARIA 3KQ4A 5BMGA 3NVZA 5MPOA 1HQRD 1JQ4A 1L5PA 2N7JA 3B2FA 1NYQA 3URYA 1CQVA 4MH8A 4C7YA 3IXSA 2V4IB 3MC0B 1ACCA 1EWCA 2X38A 2FBWB 3B2GA 3AMZA 4ZYSA 3E9SA 3BVMA 5HFYA 2AQ1B 3CIRB 1YJJA 3PO0A 3FAHA 2DLBA 2MH7A 5H8YE 1KRHA 1BUIC 2YEPF 2JWUA 1J7BA 3VR8B 1WYGA 2FE8A 4YSZB 5I4DA 2PMVA 4WH4A 2IJ0A 1D5ZC 3R2IA 4WAFA 1L0XB 2ICIA 3VRAB 3AM9A 4CQNA 3W5VB 4P6VF 1ZOYB 1T5XD 1FXIA 2BS4B 4DXFA 2WXNA 4KX6B 4IDIA 4XWWA 2WXQA 4YSYB 2N9LA 1SJED 1DOXA 1KH0A 3UI3A 5BMIA 1HA5A 1ZUD2 4D2KA 2ACZB 1IGDA 3Q8BA 4DXGA 4YTNB 2GB1A 4R3DA 3VR9B 4OHJA 3AEFB 3ZJUA 1E10A 2H89B 1TY0A 5BYQA 1FRDA 4YXDB 1T6BX 1IUEA 3OWEB 1I4PA 4YT0B 1NYRA 4KKIA 1IBXA 1NENB 1QOGA 4OW0A 1ZP0B 4P16A 3VQIA 3T3NA 4HROA 1QOFA 5JXVA 4MM3B 2K5PA 1PGXA 3MP9A 5FK9C 5AUKA 4MT5A 1HZ6A 1K52A 4C80A 3GP7A 3H8HA 5BYSA 2V3PA 2N9KA 2KDMA 1GPXA 1SBBB 3P63A 1L6UA 1E7PB 1C4PA 3I9V1 4FXCA 1MPEA 1KFYB 4DQOC 1OFFA 1ET9A 4JWUC 1WSPA 4NJCA 4A55A 5EE3A 1Q10A 1FCCC 3ZJTA 1ROEA 1FFUA 1XCTL 2IPKD 3Q69A 3W9CB 3ZJVA 2WXPA 2WNMA 4GDKB 1N60A 2K3UA 3RFZB 2I2YA 1SSNA 1WGKA 2LEKA 4H2AA 3AEGB 2RPVA 1E0ZA 1STEA 3MJ5A 3WCQA 1YN3A 3U2SC 1Y56A 4USAA 3LB8C 2JSVX 2L32A 1IGCA 3HRDD 4TQ1A 2K9XA 2VZKB 4OZCA 4ARCA 2J52A 2XN9C 1GTHA 1QILA 3P42A 4HKZE 2BBCA 2MJEA 3C8YA 2JXTA 3SFEB 3BK2A 2KN4A 3MFGA 3CF4A 4US9A 4TSSA 3AE4B 1SIJA 3B9JA 3DWMA 4TQ0A 1XF5L 1L0YB 2PIAA 4NAWB 1TS4A 4N58A 1I4XA 3U7ZA 2G9HD 5HHDG 2SEBD 2LHEA 4IKGA 2RDHA 3AEDB 3SFDB 1MHHE 2KAJA 5BMHA 2WDQB 5D3DA 1PGAA 3V05A 4AQ7A 1ZE3D 2BS2B 5C2TB 3E56A 1JWSD 2WU5B 3PZ8A 5D7GA 3N9YC 1NEKB 2WS3B 1KTKA 3AE3B 4RGMA 2B76B 2WDVB 4WURA 2BS3B 1N61A 2Y5CA 3T3OA 2MJ3A 3I57A 3NVYA 1B9RA 1BMLC 1N63A 2WDRB 1K53A 1ESFA 1RFKA 2DYOA 3KLSX 1FXAA 1AW7A 2BYTA 1E9MA 3P4SB 2BT6A 1DGJA 2K22A 2JZPA 1FRRA 1C79A 2WP9B 1C4CA 1I4GA 2J42A 1RWSA 4WIPA 2LMCA 3TEWA 4RF1A 1ZPSA 2RMMA 4YWGG 1KF6B 1FM0D 3NS1A 2GRIA 1FCLA 1VRAB 2L1AA 3AV8A 4A8XC 2M0AA 4EE2A 1DYQA 1FNUA 2WXRA 1N62A 3TSSA 1JCKB 1EU4A 1TZOA 1NI3A 1YJIA 2OEDA 2R61A 1JWUD 2JU6X 1I4RA 1FEHA 2PVOD 1TY2A 1XCQL 4MACA 3BK1A 1TYGB 3R2TA 2J4XA 3BVGA 5D3IB 1PDXA 1T3QA 1OQRA 2IGGA 4Q2JA 3SEBA 1JMLA 3P4PB 1TKYA 1JW9D 3AN1A 1RYJA 1VZ6A 4L1BA 3NZ3A 4RGOS 4UDUC 1JRPA 4A90A 1FMAD 4XDCA 1N5XA 2M56B 2I38A 1GOZA 2QSDA 1SB3C 4JWSC 1TS5A 4M0WA 4OZAA 5T8IA 4ZRPA 3Q8EA 2JX5A 5GXGB 3AE5B 3EUB2 3BZDB 2PKOA 2FUG1 2WLBA 2JYTA 3ZYYX 3BIID 1L4ZB 3U4EG 1JROA 1V1OA 1M4VA 1L4DB 1V1PA 3ETRA 3EGRA 5HG2A 1XLOA 5FKAC 1YN4A 1YQ4B 4KKJA 1PFDA 1SJHD 2AX5A 2CJOA 1ZXHA 3IAS1 2V0GA 1AYFA 1CJEA 1ZXIA 4XE0A 3TUOA 2ON8A 1ENFA 1UGJA 1FNVA 4ZHPA 4N6EB 2E6XA 3HUIA 4O1NA 1TS3A 2LHDA 1F0ZA 2SAKA 3PZ7A 1D5XC 1NVID 1GT8A 3BYTB 1FO4A 1L0VB 1K50A 1SE2A 4YTMB 1WXQA 2QEJC 2J53A 2WXGA 1TKEA 1SE4A 2LJIA 1D6EC 4A6QA 5HI1A 2N0SB 2ZW0A 3W5UB 1HEZE 4RGTA 4XWTA 1C4AA 2MJDA 4RH6A 2QMTA 4ITKA 3ZGZA 4LK0M 1R7SA 2WQYB 1ZDVA 3FC4A 2NMQA 1FIQA 1C77A 2RDGA 1D4BA 2DYMA 3NUHB 1KLUD 2XNAC 4NZLB 2BW2A 2Y3AA 3HVDA 1GAQB 1VR9A 1VZ7A 3AE1B 4WWMA 2MEKA 3ZQ4A 1OQQA 4ZRQA 2WXIA 3NRZA 1ZDXA 4J3OD 1QQRA 2M19A 4PT5A 2WXFA 4B0MA 2EELA 3IT4B 5H92C 4L2YA 2W55A 3BVZA 4ZHOA 2Y5PA 4HJGE 1RM6C 1GTEA 1I7HA 2K0PA 1CK1A 3VRBB 3GS2A 1VJKA 4N59A 2KWDA 5AUIA 4KGSA 2KMMA 4LTUA 4WQMA 2KQ4X 3AEBB 1C9FA 1PUTA 3TEYA 5EE1A 3TEZA 2GI9A 2CU3A 1XEEA 2NTTA 5LNK1 1B1ZA 2L83A 2KACA 1J7CA 1VDVA 3IAM1 4JX1C 1MI0A 2NTSA 1QOBA 1C76A 4AS1A 3P4RB 2BTEA 4HRSA 1XLPA 2PLPA 2ZW1A 2W82A 4YTPB 3O13A 3V3XA 3BWUD 3CWIA 1QKZA 1D5MC 1QLBB 2INPE 1J7AA 1FFVA 4C56C 2LUMA 3AE6B 1YMHE 5TSSA 2W3SA 4L23A 1P7FA 1K51A 2W3RA 3AE2B 2ONQA 2WXOA 4C7ZA 3Q8CA 2IDYA 2W54A 2WXMA 1SF0A 3R8BA 5EE0A 4RFBA 2WXKA 1TJEA 2OHFA 4GDLB 1KLGD 1QOAA 2LGIA 4GLSC 1JWMD 3HVZA 2TSSA 1YQ3B 1V97A 4YSXB 4ZOHC 2PTLA 3AE9B 3U52E 1XO3A 4JPSA 3W2DA 3KWVA 3LYYA 2G1EA 4B0EA 2WXLA 4HEA1 4US8A 1QF6A 1V1PB 3P4QB 4A9AA 3AB5A 1HXYD 1H7WA 3P1MA 3Q8FA 3J9CA 1XLQA 1GB1A 4NAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5W A;  3AM9 A;  1JAL A;  4ZHP A;  4N6E B;  3W5V B;  2L52 A;  1ZOY B;  2E3T A;  4P6V F;  2BS2 B;  3HUI A;  5C2T B;  2WU5 B;  1F0Z A;  1FXI A;  1NVI D;  1JWA D;  1GT8 A;  1FO4 A;  1L0V B;  1WXQ A;  1XLN A;  1NEK B;  2BS4 B;  4YTM B;  2WS3 B;  4KX6 B;  4IDI A;  1TKE A;  3AE3 B;  4YSY B;  1AWD A;  2B76 B;  2QJL A;  5G5G A;  2WDV B;  2N0S B;  2BS3 B;  1DOX A;  2CJN A;  2WU2 B;  1N61 A;  2Y5C A;  3W5U B;  2MJ3 A;  3NVY A;  1B9R A;  1N63 A;  3LXF A;  2WDR B;  1ZUD 2;  2MJD A;  3ABV B;  2ACZ B;  1RFK A;  3L4P A;  4ITK A;  5G5H A;  1FXA A;  4YTN B;  3VR9 B;  1TKG A;  1R7S A;  2WQY B;  3AEF B;  1E10 A;  2H89 B;  3FC4 A;  1FIQ A;  1FRD A;  3KWL A;  1H7X A;  4YXD B;  3P4S B;  1E9M A;  1IUE A;  2BT6 A;  1DGJ A;  2K22 A;  2Q5W D;  4YT0 B;  1FRR A;  2QIE B;  1NYR A;  1NEN B;  1L6V A;  2WP9 B;  1QOG A;  1ZP0 B;  1GAQ B;  1QOF A;  1RWS A;  4HRO A;  3AE1 B;  1QT9 A;  2K5P A;  4WWM A;  5AUK A;  1KF6 B;  1FM0 D;  3NS1 A;  1V8C A;  1EWY C;  1OQQ A;  3AV8 A;  3NRZ A;  4C80 A;  2M19 A;  1N62 A;  5H92 C;  2W55 A;  1GPX A;  1YJI A;  1NI3 A;  3P63 A;  4ZHO A;  2DBY A;  1L6U A;  1GTE A;  1E6E B;  1I7H A;  1RM6 C;  1E7P B;  1UWM A;  1VLB A;  2DWQ A;  3NVV A;  3AEA B;  3VRB B;  4FXC A;  1WWT A;  1KFY B;  1VJK A;  4N59 A;  1OFF A;  5AUI A;  4WQM A;  2KMM A;  3NVW A;  3DWG C;  4LTU A;  2PVO D;  1WRI A;  4JWU C;  3AEB B;  2PVG C;  1PUT A;  3SR6 A;  5EE3 A;  5EE1 A;  1TYG B;  3AEC B;  2CU3 A;  2JQR B;  1DOI A;  1PDX A;  1ROE A;  1FFU A;  3AH7 A;  1T3Q A;  2EKI A;  1OQR A;  2L83 A;  3W9C B;  1A70 A;  1J7C A;  3AE8 B;  1VDV A;  4JX1 C;  5EE9 A;  1JWB D;  3P4P B;  1QOB A;  1TKY A;  1N60 A;  3AE7 B;  1JW9 D;  3AN1 A;  3RPF C;  3P4R B;  1DOY A;  1RYJ A;  4HRS A;  1JRP A;  1XLP A;  1FMA D;  2H88 B;  4YTP B;  1CZP A;  1WGK A;  2LEK A;  3AEE B;  1N5X A;  2HTM E;  2M56 B;  3CWI A;  3AEG B;  1QLB B;  1J7A A;  1FFV A;  1SB3 C;  1E0Z A;  4JWS C;  3AE6 B;  3WCQ A;  5C3J B;  2W3S A;  4USA A;  3LB8 C;  3HRD D;  2K9X A;  3NVZ A;  2JX5 A;  5MPO A;  5GXG B;  2W3R A;  3AE2 B;  3AE5 B;  1GTH A;  3EUB 2;  1L5P A;  4C7Z A;  1JQ4 A;  2W54 A;  1SF0 A;  2PKO A;  3B2F A;  1NYQ A;  2WLB A;  5EE0 A;  2MJE A;  3ZYY X;  3SFE B;  3BII D;  1TJE A;  2OHF A;  1JRO A;  1QOA A;  3CF4 A;  4US9 A;  4C7Y A;  3HVZ A;  3AE4 B;  1YQ3 B;  1SIJ A;  1V97 A;  3B9J A;  3DWM A;  3ETR A;  4YSX B;  2FBW B;  4ZOH C;  1XLO A;  2PIA A;  3B2G A;  3AMZ A;  3AE9 B;  1XO3 A;  1YQ4 B;  3CIR B;  1YJJ A;  2G1E A;  1PFD A;  2AX5 A;  3FAH A;  2CJO A;  3PO0 A;  4N58 A;  2MH7 A;  4US8 A;  5H8Y E;  1AYF A;  1CJE A;  1ZXI A;  3P4Q B;  1KRH A;  1QF6 A;  4A9A A;  3AB5 A;  1J7B A;  3VR8 B;  1H7W A;  1WYG A;  3P1M A;  3AED B;  3SFD B;  4YSZ B;  1XLQ A;  2KAJ A;  3VRA B;  2WDQ B; 
#chains in the Genus database with same CATH topology
 4DHJ B;  4WJQ A;  1WZ0 A;  2E3T A;  4EZL A;  2D5G A;  1XLN A;  3PGE A;  2CHZ A;  1F2R I;  4EOY A;  3V6C B;  1BXT A;  1AWD A;  2QJL A;  2ZVN A;  4RCO A;  3FIL A;  3VUY A;  2WU2 B;  5IAA C;  2BB6 A;  1UNS A;  2AQ2 B;  3GB1 A;  1TKG A;  3AXC A;  2LVP A;  2V4L A;  3KWL A;  1PGB A;  2NPT A;  1XXG A;  2Q5W D;  4P1C C;  3DHI C;  2LI5 A;  3H7P A;  3K9P B;  4WQO B;  3C19 A;  2K25 A;  1L2N A;  1GUA B;  2JYE A;  2MRP A;  3WAL A;  4JE3 B;  2GMI C;  4KZC A;  3RNA C;  1UWM A;  1HZ5 A;  3DWG C;  1YNT E;  3FIL B;  1F52 A;  2JQR B;  3L10 B;  3N1Y C;  2EKI A;  4K7W A;  2IGH A;  5EE9 A;  1EF1 A;  3RPF C;  1DOY A;  1I4Q A;  2V3S A;  1PYW D;  2Z59 B;  4OVZ A;  2HTM E;  1NBF C;  3VTW A;  1GB4 A;  4ZYN A;  5GMV A;  4ARI A;  3KQ4 A;  5MPO A;  1HQR D;  1JQ4 A;  3B2F A;  2L7R A;  4W9D A;  4CYE A;  3DHG C;  3DQV A;  4MH8 A;  3DVN V;  4C7Y A;  4PYU A;  1ACC A;  3EC8 A;  3ECI A;  3ZLZ A;  3OJ4 B;  3RUI B;  2DX5 B;  3BVM A;  1YJJ A;  3FAH A;  1LXD A;  2I1K A;  4FLH A;  2YEP F;  1IP9 A;  1Z2M A;  4HXD A;  4NJ6 A;  3VRA B;  2ICI A;  3ZXR A;  1YJ1 A;  2LVO A;  2DZI A;  2LXC A;  3UQB A;  3PRP B;  4DXF A;  4IDI A;  4YSY B;  5FR6 A;  1SJE D;  1KH0 A;  3UI3 A;  4JL9 A;  1ZUD 2;  1IPG A;  4D2K A;  5BMI A;  4YTN B;  1EO6 A;  2KD0 A;  3VR9 B;  4NQL B;  4OHJ A;  1E10 A;  2H89 B;  1TY0 A;  3GE3 C;  1FRD A;  3H7P B;  3OWE B;  4LDT D;  1NYR A;  4KKI A;  3D32 A;  3VQI A;  4OW0 A;  1ZP0 B;  2K5P A;  3MP9 A;  3QCA A;  4MT5 A;  1K52 A;  4C80 A;  3H8H A;  1EF5 A;  4JGH B;  3X23 A;  2MBO A;  3A9J B;  2D3G A;  3I9V 1;  1E8Y A;  1WGG A;  4HK2 A;  3EEC A;  4A55 A;  2GBR A;  1Q10 A;  1ROE A;  3W9C B;  3ZJV A;  2WNM A;  2GBN A;  3DBL B;  1N60 A;  3RFZ B;  2KC1 A;  2LEK A;  3U8Z A;  2ZEQ A;  3TBL D;  2RPV A;  2X8X X;  5E6O A;  2FUH B;  2KTR A;  3QHT A;  3QK0 A;  3X0W A;  4TQ1 A;  2VZK B;  4OZC A;  1V6E A;  3VHT C;  2BBC A;  2MJE A;  2XK5 B;  2M17 A;  1WJ4 A;  3BK2 A;  5LXI B;  3U7D A;  2KN4 A;  3CF4 A;  1SIJ A;  2LRU A;  1E7U A;  1L0Y B;  3RD2 A;  4NAW B;  5CHW A;  2LAS A;  3U7Z A;  1V80 A;  4TV3 A;  1WX7 A;  2RDH A;  1MHH E;  2XK5 A;  2QC8 A;  5BMH A;  4MJS A;  2KDF B;  4AQ7 A;  3GZN I;  2WU5 B;  4FJV B;  1NEK B;  2WS3 B;  1KTK A;  3AE3 B;  2B76 B;  2V9H A;  2BS3 B;  3HK0 A;  4BKG A;  2Y5C A;  3NVY A;  2DZJ A;  4G50 A;  3VAW A;  5D6J B;  2MP2 A;  1KOT A;  2BKR B;  1RFK A;  1FXA A;  4KZ0 A;  3MHS D;  2C7H A;  4FJZ A;  2WX0 A;  2I1J A;  3P4S B;  3DVG X;  2RDB C;  5DPW A;  2QCZ A;  2WP9 B;  1C4C A;  2FIF A;  1I4G A;  5CTR C;  1RWS A;  3CST A;  2KK8 A;  3NS1 A;  1WGH A;  2FCQ A;  3RNC C;  1YJI A;  4G11 A;  4BAX A;  4CO7 A;  3VDZ A;  4FUL A;  1TY2 A;  4MAC A;  3R2T A;  2J4X A;  1LGR A;  3Q3F A;  4M8N A;  2IGG A;  3ML8 A;  3SEB A;  1TKY A;  3AN1 A;  3KUZ A;  5HKH A;  2MBQ A;  1LQB A;  3ZNZ B;  2NR2 A;  2VH2 A;  1WJN A;  2M56 B;  3ZTC A;  3AI5 A;  1WRD B;  2YVC A;  4M0W A;  5T8I A;  2IZV B;  3AU4 A;  4ZRP A;  2JX5 A;  4GDL A;  3EUB 2;  3BZD B;  2WLB A;  4ASW C;  3ZYY X;  1L4Z B;  3U4E G;  1JRO A;  2LGD A;  1M4V A;  2KC2 A;  1L4D B;  1V1P A;  1E90 A;  2KJH B;  2XBB C;  5FKA C;  4KKJ A;  1ZXH A;  4XE0 A;  4LNI A;  2L3Z A;  2ON8 A;  1R4N I;  1UGJ A;  2JRH A;  1OEY A;  2L76 A;  3HUI A;  2SAK A;  1D5X C;  1FO4 A;  3MJW A;  1V9J A;  4BBN F;  2KQ7 A;  1TKE A;  1ZW7 A;  3RT3 B;  3I5J C;  2O2V A;  3W5U B;  4BOS C;  5CX3 A;  1RAX A;  1C4A A;  2M0X A;  4EZJ A;  3UGB B;  2QMT A;  4ITK A;  3ZGZ A;  1AAR A;  2L00 B;  1FIQ A;  3MC9 A;  4MGI E;  1KLU D;  4NZL B;  2REX A;  4GXB A;  1GAQ B;  4WWM A;  2J0J A;  1OQQ A;  2WXI A;  3NRZ A;  4J3O D;  4E71 A;  2M19 A;  4KIK A;  2D10 A;  2WYQ A;  2WXF A;  3ALB A;  2M8S A;  2K0P A;  1I7H A;  1Q5W B;  2K8C A;  5AUI A;  1C9F A;  2ZPN A;  2KJ6 A;  2NBU A;  5EE1 A;  2GI9 A;  2CU3 A;  3A33 B;  1B1Z A;  3N3K B;  3B08 A;  2IND C;  1MI0 A;  2N9X A;  1C76 A;  4OVV A;  2KTF A;  1VCB A;  1RFA A;  2W82 A;  3PHW B;  4YTP B;  2D3C A;  3O13 A;  3V3X A;  2LVQ A;  4AJW A;  1WZ3 A;  3VUW A;  2L8J A;  2LUM A;  2DYB A;  4L23 A;  1K51 A;  2W3R A;  2KO3 A;  2WXO A;  4C7Z A;  1WXA A;  2W54 A;  5EE0 A;  1KM7 A;  2WXK A;  4IUM B;  3P2B A;  3WAM A;  2LGI A;  4GLS C;  4WWP A;  2G4D B;  4YSX B;  4NY0 A;  4YL8 A;  2LGS A;  1E8Z A;  1UD7 A;  4HJK A;  4B0E A;  2G1E A;  4HEA 1;  5G2N A;  1QF6 A;  1PQS A;  4IM0 A;  2KLG A;  1HXY D;  1TIF A;  1N5W A;  2LGY A;  3KH0 A;  2L52 A;  3PSE B;  4FBJ B;  2KOX A;  4KVG B;  5AZH A;  2K39 A;  1SXT A;  1SGH A;  3LXF A;  1SE3 A;  1WGD A;  4NJ7 A;  2BB5 A;  5IO9 A;  2VZK D;  4NPN A;  1YN5 A;  3PTF C;  3MHZ A;  3QQ8 B;  2PJH A;  4W9K A;  1LO5 D;  1TS2 A;  3BY4 B;  1QT9 A;  4PYZ A;  1IYF A;  2KWC A;  1ET6 A;  2AQ3 B;  3PPA A;  4XDD A;  4OZB A;  2DWQ A;  3NVV A;  3AEA B;  3NY5 A;  3TEX A;  1WWT A;  3NVW A;  3Q8A A;  1WRI A;  5C1Z A;  2PVG C;  3SR6 A;  4LJP B;  2WXH A;  3AEC B;  2QHO A;  2KDE B;  3BYY B;  3Q3N C;  1MVK A;  1J0G A;  2JF5 A;  1EM7 A;  2GLS A;  4RGN A;  4AJY B;  4GN1 A;  3AEE B;  2JZ3 B;  2YEP B;  5C3J B;  4IM2 A;  4OVU A;  3JSV B;  1Q1O A;  5BMG A;  2O6V D;  1GG3 A;  3PVL A;  2KVR A;  3QX1 A;  3IXS A;  5AEK B;  3AMZ A;  2AQ1 B;  3CIR B;  3VUX A;  4DK5 A;  5H8Y E;  4AOF A;  1BUI C;  1J7B A;  4MDK E;  2IJ0 A;  2NPT B;  3EFC A;  4AWJ A;  4WAF A;  3PS6 A;  2AL6 A;  4CQN A;  2VRR B;  3OAW A;  4C4V B;  1T5X D;  4BKT A;  3ZNI D;  3ZKJ C;  4XWW A;  3M95 A;  4A3P A;  2BWE S;  3T9L A;  1TBE A;  4ANX A;  4RMA A;  1IGD A;  3A1Q A;  3HIZ A;  3Q8B A;  4R3D A;  3ZJU A;  1WM2 A;  1T6B X;  1IBX A;  1Y8R C;  3MTN B;  1QOF A;  4MM3 B;  3SDL C;  1PGX A;  5FK9 C;  3DOW A;  2KN5 A;  1TZ1 A;  3GP7 A;  2M1M A;  3CSF A;  1MG4 A;  2V3P A;  3WA0 A;  1GPX A;  1C4P A;  4FXC A;  1KFY B;  2BYV E;  1V81 A;  3ML9 A;  3ZDM C;  1FCC C;  1FFU A;  3GE8 C;  2WXP A;  2ZCC A;  4GDK B;  2DZK A;  1V5T A;  2I2Y A;  3C0R B;  3QC8 B;  1G6J A;  2J0K A;  1E0Z A;  3WCQ A;  3B1L X;  4BBN C;  4S0R A;  3U2S C;  3LB8 C;  2JSV X;  3HRD D;  1IGC A;  3KUD B;  5IA7 A;  1Q0W B;  4ARC A;  2XN9 C;  2K6D B;  3VVW B;  4M02 A;  3PRE A;  1R4M B;  2C60 A;  3C8Y A;  2KDI A;  2JXT A;  3SFE B;  1XT9 B;  5LXH A;  2N1W A;  3DWM A;  5G55 A;  1WR6 E;  4NAW A;  2ZVO A;  3IG3 A;  2PIA A;  1TS4 A;  3UQA A;  2MW5 A;  2BQQ A;  4M01 A;  2LRW A;  1WMH A;  2KWU B;  4ICU A;  2CKH B;  5C2T B;  3TCA A;  3V62 A;  2IO3 B;  5D7G A;  2RD0 A;  4QAY A;  3L16 A;  3SD5 A;  2CR5 A;  2FCS A;  1T0S C;  3I57 A;  1B9R A;  1BML C;  2MP2 B;  1N63 A;  3RI7 C;  3VH4 B;  2DYO A;  1J19 A;  2KLC A;  2K8B A;  3DDC B;  3U30 A;  2LMC A;  2RR9 A;  3TEW A;  4RF1 A;  1ZPS A;  3JVZ X;  1KF6 B;  3V60 A;  2GRI A;  1FCL A;  3AV8 A;  2AWT A;  3DBS A;  1UBQ A;  3TSS A;  1NI3 A;  4F8C B;  3MC8 A;  4IG7 B;  2JU6 X;  1I4R A;  5IP4 D;  4NQK E;  2PVO D;  1XCQ L;  2MCN B;  2D3A A;  1P1A A;  3BK1 A;  1WX8 A;  3BVG A;  2BVC A;  1OQR A;  4EKU A;  1A5R A;  5E6P A;  2MSE D;  4L1B A;  3WAO A;  1FMA D;  4K81 A;  1SB3 C;  4JWS C;  1TS5 A;  3UIN B;  3VH3 B;  2NVU I;  2JYT A;  3VTU A;  4HCP B;  3ETR A;  4IWO A;  5LLI A;  4I6P A;  1NDD A;  2BGF A;  5L83 A;  2Z0E B;  1YQ4 B;  3WAN A;  3Q14 C;  4HPL B;  1EUV B;  5JZE B;  3DBR I;  2KMC A;  4HDO A;  1D3Z A;  4KSL C;  1FNV A;  1YOV B;  3Q6B A;  2E6X A;  2LHD A;  3FKY A;  1OQY A;  3PZ7 A;  4YTM B;  2J53 A;  4FAD A;  4DHZ E;  1SE4 A;  4FN2 A;  4J6I A;  2ZW0 A;  4MGZ E;  4RGT A;  2LGX A;  1F1H A;  1P0R A;  4ZRI A;  1WX9 A;  4EFO A;  1R7S A;  3APC A;  3FC4 A;  2NMQ A;  2DYM A;  3A9K B;  1HTQ A;  4IC7 B;  3ZO5 B;  3HVD A;  1VZ7 A;  2KXJ A;  3AE1 B;  4ZRQ A;  1ZDX A;  4BKS D;  4PT5 A;  1WM3 A;  5H92 C;  4L2Y A;  4ZHO A;  2Y5P A;  1RM6 C;  1GTE A;  1F9J A;  3GS2 A;  2C9W B;  1VJK A;  1TGZ B;  5JHB A;  3TEY A;  2NTT A;  3AUL A;  5LNK 1;  2BWF A;  2L83 A;  2KYW A;  2KAC A;  1VDV A;  3W1S C;  4HRS A;  2ZZP B;  2O6V B;  3DVG Y;  1T0R C;  5AZG A;  4F7Z A;  2KFK B;  3CWI A;  4K3C A;  1D5M C;  3L54 A;  4C56 C;  3AE6 B;  3RZF A;  1SIF A;  5TSS A;  2G3Q B;  1T0Q C;  1E8W A;  1L7Y A;  2JZZ A;  3AE2 B;  2IDY A;  2KHW B;  2ZNV C;  1UEL A;  1TJE A;  2OHF A;  1KLG D;  3ZRF A;  3NS8 A;  2TSS A;  4XX5 A;  1VD2 A;  2PE9 A;  4ZOH C;  3DCG A;  3AE9 B;  3U52 E;  1XO3 A;  3LYY A;  2WXL A;  4K7U A;  3L13 A;  3P4Q B;  1H7W A;  2N9P C;  1XLQ A;  1CMX B;  1GB1 A;  4NAM A;  1RLF A;  4RM9 A;  1WXV A;  3DVN U;  3UIP B;  1V5O A;  1YD8 U;  2WXJ A;  5FR3 A;  2V3N A;  3HHM A;  3EA6 A;  5G5G A;  5D2M B;  1SEB D;  4JIO U;  1WE6 A;  4ACF A;  3PHX B;  5BYR A;  5E6J A;  2NS5 A;  3L4P A;  3RNB C;  2ZPY A;  2HE7 A;  1F2R C;  4RF0 A;  1H7X A;  3W1S A;  1SE9 A;  2QIE B;  1L6V A;  3NZU A;  1I4H A;  4BFR A;  4KGT A;  3DBL I;  1WJ6 A;  2VH1 A;  1EWY C;  1EU3 A;  1C78 A;  1E6E B;  1VLB A;  4FHK A;  1F77 A;  2JXX A;  2QIL A;  2YLM A;  4P7I A;  1YQB A;  1FD6 A;  3Q2A C;  4RNA A;  1DOI A;  3VFK A;  1WI0 A;  2AEH A;  3AH7 A;  3ZXV A;  1IBX B;  2PE6 B;  4FHJ A;  2MBH A;  3EFU A;  2INN E;  2WGS A;  3QWZ B;  1CZP A;  2B3A A;  3M62 B;  2HDE A;  3CMM B;  4MEM A;  1UWX A;  4HVB A;  4GIV A;  1WXM A;  3NVZ A;  1ISN A;  2K8H A;  4DBG A;  1UF0 A;  2N7J A;  1NYQ A;  2LWP A;  2MA9 B;  2KTR B;  3URY A;  1CQV A;  2IBI B;  3MC0 B;  2X38 A;  3KYD D;  2FBW B;  5L95 C;  3B2G A;  4ZYS A;  3E9S A;  3PLV A;  4ZRJ A;  3PO0 A;  2MH7 A;  3TIX A;  1WGY A;  1KLV A;  2M4N A;  1JRU A;  4WH4 A;  3R2I A;  1L0X B;  2EKE C;  3W5V B;  1P98 A;  1FXI A;  2GBK A;  5IKC M;  4BZA A;  2GBJ A;  2WXN A;  1WFY A;  4KX6 B;  2WXQ A;  2N9L A;  4WJP A;  3DPD A;  3APF A;  1DOX A;  5J18 A;  3ZNG C;  2OOB B;  3RNE C;  4DXG A;  2GB1 A;  3AEF B;  5BYQ A;  1X1M A;  4YXD B;  2QDF A;  1I4P A;  1N6Z A;  2MX2 A;  1NEN B;  1QOG A;  4HRO A;  5JXV A;  1H8C A;  5BYS A;  3RYT A;  1S3S G;  2N9K A;  2KDM A;  2KVZ A;  3KW5 B;  4XYC A;  1E7P B;  1OFF A;  3Q3J A;  4JWU C;  4NJC A;  4HWI B;  1XCT L;  2IPK D;  4IM3 A;  4I6L B;  2FID A;  2DAF A;  2K3U A;  1Z5S B;  3KVF B;  4H2A A;  5AZF A;  2MBB B;  3AEG B;  1YX5 B;  1STE A;  3MJ5 A;  1YN3 A;  1Y56 A;  4FJY A;  4USA A;  4AP4 C;  2L32 A;  2JRI B;  1HTO A;  4EUT A;  2K9X A;  2J52 A;  1GTH A;  1QIL A;  2G45 B;  4HKZ E;  3NJT A;  2V1Y A;  2ZCB A;  3MFG A;  2BPS A;  3B9J A;  4XGA B;  5CHV C;  5IN7 A;  2N9E B;  2HTH A;  4N58 A;  3R3M A;  3A1Q B;  4IKG A;  3QIJ A;  3ZW3 A;  1WMH B;  2KAN A;  2WDQ B;  1LM8 B;  4X57 B;  1PGA A;  1ZE3 D;  2BS2 B;  3E56 A;  1JWS D;  2L0T A;  1WXS A;  1KJT A;  2RGF A;  4LNK A;  4KDI C;  1WYW B;  4WUR A;  1N61 A;  2MJ3 A;  3N32 A;  2WDR B;  1K53 A;  2R2Q A;  1ESF A;  3KLS X;  2FCN A;  2KX0 A;  1AW7 A;  1E9M A;  2K22 A;  2CS4 A;  2JZP A;  1C79 A;  4S17 A;  4IWP A;  2J42 A;  4WIP A;  3TMP B;  4YWG G;  3R7Q A;  2LZ6 A;  4LNF A;  3APD A;  4HPM B;  1VRA B;  3I3T B;  4A8X C;  2M0A A;  1DYQ A;  1T0Y A;  2RPQ A;  4N9F 4;  2C5L C;  4PS3 A;  1EU4 A;  1TZO A;  1WJU A;  3R7R A;  5J17 A;  1K8R B;  4II2 B;  1JWU D;  2JPH A;  2KQS A;  2AL3 A;  2D3B A;  2ZNV B;  4BKS A;  2IY1 B;  1TYG B;  2LXA A;  4HDQ A;  5DPT A;  2KNB A;  5JH5 C;  1JML A;  2IO2 B;  1E5W A;  3P4P B;  1JW9 D;  1RYJ A;  2WHI A;  3UIO B;  4RGO S;  4A90 A;  3ZVV A;  4XDC A;  4FA6 A;  1N5X A;  2BF8 B;  5C23 A;  3DHH C;  2K1F A;  3Q3M C;  3Q8E A;  3AE5 B;  4ICV A;  3HM6 X;  2R2O A;  2PPH A;  3BII D;  1V1O A;  4MGK E;  4XC2 A;  3O65 B;  2N7E A;  1UZX B;  4TKN A;  1E7V A;  1YN4 A;  3H9D A;  1H4R A;  1PFD A;  2WDT B;  1AYF A;  1CJE A;  1MJD A;  2AYO B;  1ENF A;  2HJ8 A;  4EEW A;  1C3T A;  1GJZ A;  4ZHP A;  4PK1 A;  4N6E B;  4O1N A;  3RUL A;  1NVI D;  4C4V A;  1GT8 A;  4DHZ B;  1L0V B;  2QEJ C;  3ZRC A;  1WR1 A;  4M8M A;  1I35 A;  2LJI A;  4W9L A;  4WWN A;  5HI1 A;  2N0S B;  2KT7 A;  4KV2 A;  4XWT A;  4ZRK A;  3L08 A;  5DPS A;  4LK0 M;  1C77 A;  1D4B A;  4PS7 A;  4KDL B;  1WGR A;  4DDI D;  4G0N B;  5J2R A;  3RZW C;  2MEK A;  1GC6 A;  2LD9 A;  1QQR A;  2BYE A;  4HJG E;  4I6N B;  3VRB B;  4AUQ C;  4N59 A;  4KGS A;  4LTU A;  4WQM A;  2KQ4 X;  3AEB B;  2MQJ A;  5KHO A;  3M3J A;  4JX1 C;  3SHQ A;  1QOB A;  4AS1 A;  2BTE A;  4URK A;  2ZW1 A;  1QKZ A;  1J7A A;  1FFV A;  5DPR A;  4CHK A;  1YMH E;  2W3S A;  4K7S A;  3PZD A;  4W9H A;  2WXM A;  3NHE B;  4RFB A;  4M0W B;  4DXA B;  3HVZ A;  1YQ3 B;  3A4R A;  2W9N A;  3T3N A;  4JPS A;  3KWV A;  5BO4 B;  1GC7 A;  2N7D A;  2HD5 B;  3Q8F A;  1YX6 B;  1I42 A;  2UWQ A;  1JAL A;  3LDZ E;  3WAP A;  3PRZ A;  1MHX A;  3PRM B;  4HKQ A;  4JQW C;  1JWA D;  4XZ4 A;  4GSW A;  2MLB A;  2JWZ A;  2WWZ A;  3NOB A;  3PV1 A;  3CF6 E;  2NBV B;  2CJN A;  1ZGU B;  5CHF A;  2Z8L A;  3ABV B;  2IGD A;  5G5H A;  3IFW B;  4IOI E;  1FNW A;  5E6N A;  1MG8 A;  4DDG D;  2CHX A;  1S1Q B;  4REZ A;  3ONS A;  4KGR A;  3QA8 A;  4TMA B;  1QZE A;  1V8C A;  1AN8 A;  4GOC A;  3IT6 B;  4W9J A;  3PT2 B;  4LDT B;  2DBY A;  2D07 B;  3RNF C;  2PW9 A;  2D2Q A;  1UUP A;  2IO1 B;  1A70 A;  3AE8 B;  1JWB D;  3N1X C;  3AE7 B;  4E74 A;  3VTV A;  3JW0 X;  2LFI A;  1P7E A;  2CHW A;  3ZNH B;  2H88 B;  4LLG M;  2DNF A;  2ZJD A;  2KWV B;  2DAJ A;  4HPP A;  4NNJ B;  1VZ8 A;  5D94 A;  3GOE A;  4PS8 A;  3IVF A;  5TR5 A;  3W1Y A;  1L5P A;  1U4A A;  1WF9 A;  2V4I B;  1EWC A;  1P9D U;  4ANW A;  3ZIM A;  4W9G A;  5HFY A;  1UBI A;  3ZDT A;  2DLB A;  1KRH A;  2JWU A;  3DBH B;  3VR8 B;  1WYG A;  4MM3 A;  1NI2 A;  2FE8 A;  4YSZ B;  5I4D A;  2PMV A;  1D5Z C;  3SU8 X;  3T8M A;  3VXW A;  1J8C A;  1TT5 B;  3AM9 A;  2EMT A;  4MSM B;  2ASQ A;  4P6V F;  1ZOY B;  4MH0 E;  4A3O A;  3I63 C;  3Q3O C;  2BS4 B;  1FXT B;  3PLU A;  3ENE A;  4DHJ D;  2KX3 A;  2RSU A;  1HA5 A;  3RN9 C;  3N30 A;  2ACZ B;  3V61 A;  3OG5 A;  3UF8 A;  1IUE A;  3LJ3 A;  4YT0 B;  4P16 A;  3QAR A;  3NG0 A;  5AUK A;  2PEA A;  1HZ6 A;  2C7N B;  1MFW A;  2JT4 B;  2WX1 A;  3K9O B;  1E8X A;  4KSK C;  4WJN A;  1SBB B;  1OTR B;  3P63 A;  3WIM A;  1L6U A;  4W9F A;  1MPE A;  4MJS B;  2N4F A;  4DQO C;  2IY0 B;  1ET9 A;  1WSP A;  2L05 A;  2FAZ A;  2K6Q A;  5EE3 A;  3ZJT A;  1OEY J;  3Q69 A;  3AU5 A;  2Y5B B;  3S2A A;  4P1B C;  2GOW A;  1SSN A;  2A5U A;  1WGK A;  3N20 C;  4LCD E;  2KFK A;  2GBM A;  4ANU A;  3TJP A;  4ZDV A;  2INC C;  1R4N B;  3GZN B;  4DWF A;  3P42 A;  2KKC A;  1YIW A;  4B6W A;  3ZTD A;  3B0A A;  4US9 A;  4TSS A;  4II3 B;  3AE4 B;  4TQ0 A;  5JHA A;  5KHQ A;  1XF5 L;  4K3B A;  2JUO A;  4RM8 A;  4BVU C;  1I4X A;  2DEN B;  2G9H D;  5HHD G;  2J7Q B;  2SEB D;  3IHP C;  2LHE A;  3AED B;  3SFD B;  2JY6 A;  2KAJ A;  3A4S C;  5D3D A;  3KYC D;  3V05 A;  2J0M A;  3JYU A;  2N1V A;  2UU7 A;  3PZ8 A;  4W9E A;  3N9Y C;  1WY8 A;  2C7M B;  4BOZ B;  4RGM A;  4C00 A;  2WDV B;  4ANV A;  2BYF A;  3T3O A;  2XEW A;  2NBW B;  4W9I A;  3OLM D;  1UGM A;  1XQQ A;  3DBH I;  1WE7 A;  2KFJ A;  3EHV A;  2KJR A;  1GNU A;  4LJO B;  4W9C A;  2BYT A;  1M94 A;  2A4Z A;  2BT6 A;  1DGJ A;  1FRR A;  2MBE A;  4F1S A;  2IYD B;  3H7S A;  2RMM A;  1FM0 D;  1V86 A;  3DBR B;  2L1A A;  4EE2 A;  1FNU A;  2WXR A;  1N62 A;  1FPY A;  1R4M I;  1JCK B;  2OED A;  2R61 A;  2LJ5 A;  1FEH A;  2FCM A;  4IWQ A;  4HCN B;  5D3I B;  1PDX A;  1T3Q A;  3NZS A;  4Q2J A;  1P3Q U;  4GGQ A;  2DHZ A;  1UH6 A;  1VZ6 A;  4UDU C;  3NZ3 A;  1JRP A;  3H6N A;  3A9J A;  2I38 A;  1GOZ A;  2QSD A;  4IW0 A;  3L17 A;  1V49 A;  4OZA A;  4B9K A;  5GXG B;  1WH3 A;  2PKO A;  3N1Z C;  2DZM A;  2FUG 1;  3HM3 A;  2NCN A;  2OJW A;  3EGR A;  5HG2 A;  1XLO A;  4EZK A;  1TTN A;  1SJH D;  2AX5 A;  3IAS 1;  2CJO A;  2V0G A;  3IBE A;  4E3C A;  1ZXI A;  3TUO A;  2G4S A;  3RNG C;  2BKF A;  1HE8 A;  1OGW A;  1C1Y B;  3L0W B;  4GDK A;  1TS3 A;  1F0Z A;  3BYT B;  1K50 A;  1SE2 A;  4MEL A;  1WIA A;  1WXQ A;  2D11 A;  2WXG A;  4G3X B;  3TL5 A;  1D6E C;  4A6Q A;  2O2V B;  2Z0D B;  1HEZ E;  1LFD A;  3RCZ A;  2MJD A;  4KIK B;  4RH6 A;  4K1R B;  4WJO A;  2WQY B;  1ZDV A;  4MGY E;  3KUC B;  4LNN A;  3RMK C;  2RDG A;  2KDB A;  2O6V A;  3NUH B;  4GB9 A;  2XNA C;  3ZUN A;  3BIN A;  2BW2 A;  2Y3A A;  1VR9 A;  2EMS A;  2OJR A;  3ZQ4 A;  4TUU A;  4A20 A;  4B0M A;  2EEL A;  3IT4 B;  2W55 A;  3BVZ A;  1CK1 A;  2MHJ A;  2IO0 B;  1XD3 B;  4B95 A;  2KWD A;  2KMM A;  1V2Y A;  4GU2 A;  2UYZ B;  1PUT A;  5DCN A;  3TEZ A;  1ZKH A;  1XEE A;  4LNO A;  2HJ1 A;  2CU1 A;  2LUE A;  1J7C A;  3IAM 1;  4M00 A;  1BT0 A;  2NTS A;  3P4R B;  3A9K A;  2L0F A;  4JLC A;  1XLP A;  2PLP A;  4WAA A;  3JSV A;  3BWU D;  3QAQ A;  2INP E;  1QLB B;  3M63 B;  1RRB A;  2MWS B;  3R66 C;  4WWO A;  1P7F A;  4GMV A;  4MSQ B;  2ONQ A;  3Q8C A;  1SF0 A;  3R8B A;  2FNJ B;  2KZR A;  4GDL B;  1QOA A;  5EDS A;  1JWM D;  1V97 A;  3V6E B;  2JVC A;  2PTL A;  3W2D A;  3OJ3 A;  3QJZ A;  4US8 A;  1V1P B;  2KMA A;  4A9A A;  3AB5 A;  3P1M A;  4HLE A;  3J9C A;  3H1U A;  5IOI A; 
#chains in the Genus database with same CATH homology
 1N5W A;  1JAL A;  2L52 A;  2E3T A;  1MHX A;  4HKQ A;  1JWA D;  2D5G A;  2WXJ A;  5FR3 A;  1XLN A;  2V3N A;  1F2R I;  3EA6 A;  1BXT A;  1AWD A;  5G5G A;  2QJL A;  4RCO A;  1SEB D;  3FIL A;  1SXT A;  2WU2 B;  2CJN A;  2Z8L A;  5BYR A;  2BB6 A;  3LXF A;  1SE3 A;  5E6J A;  1UNS A;  2AQ2 B;  3ABV B;  3GB1 A;  3L4P A;  2BB5 A;  2IGD A;  5G5H A;  1TKG A;  1F2R C;  1PGB A;  2VZK D;  3KWL A;  4IOI E;  1FNW A;  4RF0 A;  1H7X A;  3W1S A;  1YN5 A;  1XXG A;  2Q5W D;  2QIE B;  3MHZ A;  1L6V A;  4REZ A;  1LO5 D;  1TS2 A;  4KGR A;  1I4H A;  4TMA B;  1QT9 A;  4KGT A;  1V8C A;  1AN8 A;  1EWY C;  2JYE A;  1ET6 A;  3IT6 B;  2AQ3 B;  4JE3 B;  1EU3 A;  1C78 A;  4XDD A;  4OZB A;  2DBY A;  2DWQ A;  1E6E B;  1UWM A;  1VLB A;  3NVV A;  3AEA B;  1F77 A;  3TEX A;  1WWT A;  2QIL A;  1HZ5 A;  3NVW A;  3DWG C;  3Q8A A;  1YNT E;  2PW9 A;  1WRI A;  3FIL B;  2PVG C;  3SR6 A;  1UUP A;  2WXH A;  1FD6 A;  4RNA A;  3AEC B;  2JQR B;  1DOI A;  3AH7 A;  2EKI A;  3BYY B;  1IBX B;  1A70 A;  2IGH A;  5EE9 A;  3AE8 B;  1JWB D;  1MVK A;  3AE7 B;  3RPF C;  1DOY A;  1EM7 A;  2LFI A;  2INN E;  1I4Q A;  1P7E A;  4RGN A;  1PYW D;  2H88 B;  4LLG M;  4OVZ A;  1CZP A;  3AEE B;  2HTM E;  2YEP B;  1GB4 A;  2HDE A;  1UWX A;  5C3J B;  1VZ8 A;  4ARI A;  3KQ4 A;  5BMG A;  3NVZ A;  5MPO A;  1HQR D;  1JQ4 A;  1L5P A;  2N7J A;  3B2F A;  1NYQ A;  3URY A;  1CQV A;  4MH8 A;  4C7Y A;  3IXS A;  2V4I B;  3MC0 B;  1ACC A;  1EWC A;  2X38 A;  2FBW B;  3B2G A;  3AMZ A;  4ZYS A;  3E9S A;  3BVM A;  5HFY A;  2AQ1 B;  3CIR B;  1YJJ A;  3PO0 A;  3FAH A;  2DLB A;  2MH7 A;  5H8Y E;  1KRH A;  1BUI C;  2YEP F;  2JWU A;  1J7B A;  3VR8 B;  1WYG A;  2FE8 A;  4YSZ B;  5I4D A;  2PMV A;  4WH4 A;  2IJ0 A;  1D5Z C;  3R2I A;  4WAF A;  1L0X B;  2ICI A;  3VRA B;  3AM9 A;  4CQN A;  3W5V B;  4P6V F;  1ZOY B;  1T5X D;  1FXI A;  2BS4 B;  4DXF A;  2WXN A;  4KX6 B;  4IDI A;  4XWW A;  2WXQ A;  4YSY B;  2N9L A;  1SJE D;  1DOX A;  1KH0 A;  3UI3 A;  5BMI A;  1HA5 A;  1ZUD 2;  4D2K A;  2ACZ B;  1IGD A;  3Q8B A;  4DXG A;  4YTN B;  2GB1 A;  4R3D A;  3VR9 B;  4OHJ A;  3AEF B;  3ZJU A;  1E10 A;  2H89 B;  1TY0 A;  5BYQ A;  1FRD A;  4YXD B;  1T6B X;  1IUE A;  3OWE B;  1I4P A;  4YT0 B;  1NYR A;  4KKI A;  1IBX A;  1NEN B;  1QOG A;  4OW0 A;  1ZP0 B;  4P16 A;  3VQI A;  3T3N A;  4HRO A;  1QOF A;  5JXV A;  4MM3 B;  2K5P A;  1PGX A;  3MP9 A;  5FK9 C;  5AUK A;  4MT5 A;  1HZ6 A;  1K52 A;  4C80 A;  3GP7 A;  3H8H A;  5BYS A;  2V3P A;  2N9K A;  2KDM A;  1GPX A;  1SBB B;  3P63 A;  1L6U A;  1E7P B;  1C4P A;  3I9V 1;  4FXC A;  1MPE A;  1KFY B;  4DQO C;  1OFF A;  1ET9 A;  4JWU C;  1WSP A;  4NJC A;  4A55 A;  5EE3 A;  1Q10 A;  1FCC C;  3ZJT A;  1ROE A;  1FFU A;  1XCT L;  2IPK D;  3Q69 A;  3W9C B;  3ZJV A;  2WXP A;  2WNM A;  4GDK B;  1N60 A;  2K3U A;  3RFZ B;  2I2Y A;  1SSN A;  1WGK A;  2LEK A;  4H2A A;  3AEG B;  2RPV A;  1E0Z A;  1STE A;  3MJ5 A;  3WCQ A;  1YN3 A;  3U2S C;  1Y56 A;  4USA A;  3LB8 C;  2JSV X;  2L32 A;  1IGC A;  3HRD D;  4TQ1 A;  2K9X A;  2VZK B;  4OZC A;  4ARC A;  2J52 A;  2XN9 C;  1GTH A;  1QIL A;  3P42 A;  4HKZ E;  2BBC A;  2MJE A;  3C8Y A;  2JXT A;  3SFE B;  3BK2 A;  2KN4 A;  3MFG A;  3CF4 A;  4US9 A;  4TSS A;  3AE4 B;  1SIJ A;  3B9J A;  3DWM A;  4TQ0 A;  1XF5 L;  1L0Y B;  2PIA A;  4NAW B;  1TS4 A;  4N58 A;  1I4X A;  3U7Z A;  2G9H D;  5HHD G;  2SEB D;  2LHE A;  4IKG A;  2RDH A;  3AED B;  3SFD B;  1MHH E;  2KAJ A;  5BMH A;  2WDQ B;  5D3D A;  1PGA A;  3V05 A;  4AQ7 A;  1ZE3 D;  2BS2 B;  5C2T B;  3E56 A;  1JWS D;  2WU5 B;  3PZ8 A;  5D7G A;  3N9Y C;  1NEK B;  2WS3 B;  1KTK A;  3AE3 B;  4RGM A;  2B76 B;  2WDV B;  4WUR A;  2BS3 B;  1N61 A;  2Y5C A;  3T3O A;  2MJ3 A;  3I57 A;  3NVY A;  1B9R A;  1BML C;  1N63 A;  2WDR B;  1K53 A;  1ESF A;  1RFK A;  2DYO A;  3KLS X;  1FXA A;  1AW7 A;  2BYT A;  1E9M A;  3P4S B;  2BT6 A;  1DGJ A;  2K22 A;  2JZP A;  1FRR A;  1C79 A;  2WP9 B;  1C4C A;  1I4G A;  2J42 A;  1RWS A;  4WIP A;  2LMC A;  3TEW A;  4RF1 A;  1ZPS A;  2RMM A;  4YWG G;  1KF6 B;  1FM0 D;  3NS1 A;  2GRI A;  1FCL A;  1VRA B;  2L1A A;  3AV8 A;  4A8X C;  2M0A A;  4EE2 A;  1DYQ A;  1FNU A;  2WXR A;  1N62 A;  3TSS A;  1JCK B;  1EU4 A;  1TZO A;  1NI3 A;  1YJI A;  2OED A;  2R61 A;  1JWU D;  2JU6 X;  1I4R A;  1FEH A;  2PVO D;  1TY2 A;  1XCQ L;  4MAC A;  3BK1 A;  1TYG B;  3R2T A;  2J4X A;  3BVG A;  5D3I B;  1PDX A;  1T3Q A;  1OQR A;  2IGG A;  4Q2J A;  3SEB A;  1JML A;  3P4P B;  1TKY A;  1JW9 D;  3AN1 A;  1RYJ A;  1VZ6 A;  4L1B A;  3NZ3 A;  4RGO S;  4UDU C;  1JRP A;  4A90 A;  1FMA D;  4XDC A;  1N5X A;  2M56 B;  2I38 A;  1GOZ A;  2QSD A;  1SB3 C;  4JWS C;  1TS5 A;  4M0W A;  4OZA A;  5T8I A;  4ZRP A;  3Q8E A;  2JX5 A;  5GXG B;  3AE5 B;  3EUB 2;  3BZD B;  2PKO A;  2FUG 1;  2WLB A;  2JYT A;  3ZYY X;  3BII D;  1L4Z B;  3U4E G;  1JRO A;  1V1O A;  1M4V A;  1L4D B;  1V1P A;  3ETR A;  3EGR A;  5HG2 A;  1XLO A;  5FKA C;  1YN4 A;  1YQ4 B;  4KKJ A;  1PFD A;  1SJH D;  2AX5 A;  2CJO A;  1ZXH A;  3IAS 1;  2V0G A;  1AYF A;  1CJE A;  1ZXI A;  4XE0 A;  3TUO A;  2ON8 A;  1ENF A;  1UGJ A;  1FNV A;  4ZHP A;  4N6E B;  2E6X A;  3HUI A;  4O1N A;  1TS3 A;  2LHD A;  1F0Z A;  2SAK A;  3PZ7 A;  1D5X C;  1NVI D;  1GT8 A;  3BYT B;  1FO4 A;  1L0V B;  1K50 A;  1SE2 A;  4YTM B;  1WXQ A;  2QEJ C;  2J53 A;  2WXG A;  1TKE A;  1SE4 A;  2LJI A;  1D6E C;  4A6Q A;  5HI1 A;  2N0S B;  2ZW0 A;  3W5U B;  1HEZ E;  4RGT A;  4XWT A;  1C4A A;  2MJD A;  4RH6 A;  2QMT A;  4ITK A;  3ZGZ A;  4LK0 M;  1R7S A;  2WQY B;  1ZDV A;  3FC4 A;  2NMQ A;  1FIQ A;  1C77 A;  2RDG A;  1D4B A;  2DYM A;  3NUH B;  1KLU D;  2XNA C;  4NZL B;  2BW2 A;  2Y3A A;  3HVD A;  1GAQ B;  1VR9 A;  1VZ7 A;  3AE1 B;  4WWM A;  2MEK A;  3ZQ4 A;  1OQQ A;  4ZRQ A;  2WXI A;  3NRZ A;  1ZDX A;  4J3O D;  1QQR A;  2M19 A;  4PT5 A;  2WXF A;  4B0M A;  2EEL A;  3IT4 B;  5H92 C;  4L2Y A;  2W55 A;  3BVZ A;  4ZHO A;  2Y5P A;  4HJG E;  1RM6 C;  1GTE A;  1I7H A;  2K0P A;  1CK1 A;  3VRB B;  3GS2 A;  1VJK A;  4N59 A;  2KWD A;  5AUI A;  4KGS A;  2KMM A;  4LTU A;  4WQM A;  2KQ4 X;  3AEB B;  1C9F A;  1PUT A;  3TEY A;  5EE1 A;  3TEZ A;  2GI9 A;  2CU3 A;  1XEE A;  2NTT A;  5LNK 1;  1B1Z A;  2L83 A;  2KAC A;  1J7C A;  1VDV A;  3IAM 1;  4JX1 C;  1MI0 A;  2NTS A;  1QOB A;  1C76 A;  4AS1 A;  3P4R B;  2BTE A;  4HRS A;  1XLP A;  2PLP A;  2ZW1 A;  2W82 A;  4YTP B;  3O13 A;  3V3X A;  3BWU D;  3CWI A;  1QKZ A;  1D5M C;  1QLB B;  2INP E;  1J7A A;  1FFV A;  4C56 C;  2LUM A;  3AE6 B;  1YMH E;  5TSS A;  2W3S A;  4L23 A;  1P7F A;  1K51 A;  2W3R A;  3AE2 B;  2ONQ A;  2WXO A;  4C7Z A;  3Q8C A;  2IDY A;  2W54 A;  2WXM A;  1SF0 A;  3R8B A;  5EE0 A;  4RFB A;  2WXK A;  1TJE A;  2OHF A;  4GDL B;  1KLG D;  1QOA A;  2LGI A;  4GLS C;  1JWM D;  3HVZ A;  2TSS A;  1YQ3 B;  1V97 A;  4YSX B;  4ZOH C;  2PTL A;  3AE9 B;  3U52 E;  1XO3 A;  4JPS A;  3W2D A;  3KWV A;  3LYY A;  2G1E A;  4B0E A;  2WXL A;  4HEA 1;  4US8 A;  1QF6 A;  1V1P B;  3P4Q B;  4A9A A;  3AB5 A;  1HXY D;  1H7W A;  3P1M A;  3Q8F A;  3J9C A;  1XLQ A;  1GB1 A;  4NAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...