4YTNB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
250
structure length
250
Chain Sequence
b'KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title New Insights into the Design of Inhibitors Targeted for Parasitic Anaerobic Energy Metabolism
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 61
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ytnB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ytnB01
3BIID 2WLBA 3AH7A 1KFYB 3AMZA 1DOYA 5EE1A 1GTHA 1QF6A 1R7SA 2HTME 1J7BA 3NVWA 2M56B 3AE1B 2LEKA 2BS2B 1L0VB 1SF0A 1V8CA 2DWQA 3DWMA 1RYJA 4ITKA 2K9XA 2H88B 1A70A 1TJEA 3WCQA 1ROEA 2MH7A 1DOXA 3SR6A 1E10A 4IDIA 3AE3B 3AEGB 5GXGB 3PO0A 3P63A 2QJLA 1QOAA 2WDRB 3ZYYX 4C80A 4YT0B 1YQ3B 1FXIA 1TKEA 1WYGA 3VRAB 1L5PA 1NYRA 1QOFA 3L4PA 3AE7B 3DWGC 3W5UB 5C3JB 3AE4B 1RFKA 1T3QA 1XLOA 1FO4A 2KMMA 1VDVA 5AUKA 3VR8B 5MPOA 1FIQA 1JWBD 3FAHA 2QIEB 1CJEA 4YTPB 2W3RA 4JWSC 4JX1C 3AV8A 1YJJA 4US8A 1YQ4B 1FMAD 3AEBB 2PKOA 1GPXA 1WXQA 3ABVB 3P4RB 2CJOA 4N6EB 2BS3B 4KX6B 1NENB 3LB8C 1FRDA 1GAQB 2MJDA 1H7WA 3AEEB 3AECB 4YXDB 1FXAA 4YTMB 3ETRA 3KWLA 1WRIA 4C7YA 1IUEA 2Q5WD 3CIRB 1SB3C 2W54A 4YSYB 3P4QB 1VJKA 1QLBB 1ZP0B 2WDVB 4A9AA 2JX5A 2K22A 2JQRB 3P1MA 3HVZA 1XLPA 2Y5CA 3W5VB 2B76B 1GTEA 1NI3A 4C7ZA 2WP9B 3EUB2 2KAJA 4HRSA 1V97A 4FXCA 5H8YE 3NRZA 2EKIA 2W3SA 1FM0D 3LXFA 2BT6A 1OQRA 3B9JA 1H7XA 1JW9D 1JROA 2W55A 2FBWB 3B2GA 4HROA 3AEAB 1KRHA 3CWIA 4YTNB 2WDQB 2WU2B 3AE6B 1N5WA 1L6UA 1QOGA 2L52A 1N61A 4N59A 3HUIA 3SFDB 2WQYB 4USAA 1B9RA 2WS3B 1OQQA 1ZOYB 1FFUA 1NVID 3CF4A 1PUTA 1E9MA 1TYGB 2CJNA 5G5GA 3AB5A 3RPFC 1AYFA 1ZXIA 3P4SB 1N63A 3NS1A 4JWUC 1TKYA 2DBYA 4P6VF 1RWSA 4US9A 1GT8A 3VR9B 2MJ3A 3W9CB 1JWAD 2ACZB 1WWTA 4ZHOA 3AM9A 1L6VA 3NVZA 2E3TA 1OFFA 2AX5A 2PVOD 4ZHPA 3AEDB 4YSXB 1DOIA 3HRDD 3VRBB 2M19A 1SIJA 1XO3A 1NEKB 1JALA 1PFDA 2PIAA 4WQMA 1VLBA 1F0ZA 1JRPA 2PVGC 3AE8B 2K5PA 1N62A 4YSZB 4N58A 3NVYA 1TKGA 1I7HA 5AUIA 2N0SB 3FC4A 4ZOHC 2L83A 3P4PB 1PDXA 3AE9B 3AN1A 4WWMA 1E0ZA 2CU3A 1KF6B 1XLQA 1RM6C 1FFVA 1XLNA 1DGJA 1QOBA 1NYQA 5H92C 1UWMA 1N5XA 1EWYC 1E6EB 3SFEB 1WGKA 4LTUA 1ZUD2 5G5HA 5EE9A 3AEFB 3NVVA 1CZPA 1FRRA 3AE5B 2H89B 1N60A 1JQ4A 5C2TB 2MJEA 1E7PB 2WU5B 1AWDA 5EE0A 1QT9A 2OHFA 1YJIA 5EE3A 1J7CA 2G1EA 1J7AA 3B2FA 3AE2B 2BS4B
chains in the Genus database with same CATH superfamily
2JVCA 5EE1A 3N3KB 4WURA 2AYOB 4ARCA 3BYYB 2V1YA 3IAM1 1YNTE 3Q8FA 4HDQA 5HG2A 4CHKA 1QOAA 2BGFA 3R7RA 2Y5BB 2N1WA 4BZAA 1T3QA 5JXVA 5MPOA 3TBLD 5T8IA 3R3MA 3AV8A 2KLCA 2K39A 3P4RB 3QC8B 1HEZE 4N6EB 1TBEA 1FXAA 1E8ZA 1HXYD 1FEHA 1I4HA 2Q5WD 2L8JA 3HM3A 2OOBB 3ZO5B 3IBEA 3Q69A 4XZ4A 2JQRB 2OJWA 2NBWB 1L0XB 4M8NA 2WP9B 5IP4D 4HRSA 3TJPA 4K3CA 2PLPA 2MX2A 4HROA 2KYWA 3AEAB 1MHHE 4FJYA 1IPGA 3TIXA 3SFDB 3SDLC 2DNFA 2WXQA 1PUTA 3RPFC 2KD0A 2KJHB 1D5XC 3GB1A 3Q6BA 5LXHA 3VR9B 4NJ6A 4OVVA 5G2NA 4KDIC 2MQJA 3AE8B 1UF0A 1R4NI 1TZOA 2MRPA 2WYQA 3UQAA 4ANWA 2ASQA 1G6JA 1KF6B 4ASWC 4LNOA 2N9KA 2KWDA 3C0RB 1N5XA 1T0SC 4II2B 2KKCA 5C2TB 2M17A 5EE3A 3UIOB 4ANUA 1V81A 3V6EB 2JXTA 2FCMA 1LO5D 4EEWA 1A70A 2O6VB 3VXWA 3R2TA 4ARIA 1SSNA 3P63A 3Q3JA 4HJKA 1QKZA 2O2VB 2M0XA 1AW7A 2XK5A 4TSSA 3W1SC 2HTHA 2ZJDA 4IM3A 1WXQA 3RZFA 3VH4B 1D4BA 2DX5B 3KWLA 1SXTA 4HK2A 4W9DA 2PE9A 1UELA 1CMXB 2V3NA 4AQ7A 3N1ZC 4MJSA 3ZNZB 1TS4A 1F77A 4B0MA 1H7XA 1YOVB 2FBWB 1HE8A 4PYZA 5KHQA 2ICIA 2LGSA 3V05A 1UH6A 1FNUA 1B9RA 1AARA 1E9MA 3C19A 4K7WA 2WXKA 1J0GA 3A9JA 3ZDMC 1BUIC 2MJ3A 1WWTA 2E3TA 2MW5A 4K1RB 3M3JA 3TSSA 3PLVA 2KFJA 3PS6A 2R2QA 4A55A 4L23A 1P1AA 4WQMA 3BK2A 3D32A 4ZYNA 4TMAB 1IYFA 3OG5A 5BO4B 1OTRB 1E8WA 1XLQA 3TEXA 1IBXB 3DHHC 2JXXA 2WX1A 2H89B 2W9NA 2YLMA 3VTUA 3T3NA 1TIFA 3PZ8A 1WXAA 2MWSB 1V5OA 3AMZA 4IM2A 2V3SA 3GP7A 1KOTA 1FNVA 1ISNA 2KK8A 1L0VB 4NNJB 2K9XA 3WCQA 4ZRQA 3AU4A 1TS3A 3KYCD 2X8XX 3U7DA 2IGDA 1XLOA 3OAWA 5D2MB 4KGRA 3K9OB 3ZTDA 4W9FA 3PHXB 3W1YA 5HFYA 3VQIA 4MM3B 3T3OA 1GC7A 3LB8C 3AI5A 3PV1A 1P9DU 4IW0A 3HK0A 4RMAA 2K6QA 1GC6A 1WGDA 1QLBB 2JZZA 3RD2A 1P7FA 2KWVB 1E7UA 3WAPA 3MHSD 4GIVA 3TCAA 2IO2B 2KQ4X 2SEBD 4WJQA 4EZJA 1P98A 3DBHB 1C4AA 1WXVA 4GDLB 3U2SC 1CQVA 4OHJA 1RRBA 1FNWA 3QJZA 1M4VA 2L7RA 1F2RC 3VDZA 2KC1A 1K51A 3T8MA 2IY1B 3RNEC 3R7QA 1AN8A 3MP9A 1HTOA 4IWPA 1EF1A 1NEKB 4FN2A 4W9EA 2N4FA 2DZMA 1I4RA 2HD5B 3WANA 4FBJB 3AE9B 1PQSA 3M95A 4LK0M 2PTLA 3K9PB 4MDKE 2IBIB 3W1SA 3UF8A 3SFEB 2JWUA 4MH0E 4E74A 2ZPNA 3N30A 2LVPA 4MGZE 1LFDA 2MBOA 1YN3A 3ZLZA 3MTNB 4TQ0A 1FCCC 2LUEA 4DHJD 2KTFA 2HTME 1A5RA 2LEKA 4GMVA 4A90A 2H88B 3RNCC 4EZKA 3ZYYX 1FXTB 3IT6B 1TKEA 3EFCA 1Z2MA 2L3ZA 1DYQA 1V1PA 4GN1A 3P42A 1BMLC 4MH8A 1C4CA 4LJOB 4YXDB 2FIFA 1TGZB 4BKSA 2UYZB 4AOFA 4HXDA 4RCOA 2ZCBA 4W9CA 3NS8A 1WJUA 1YJ1A 4WQOB 2BWFA 2LHDA 4HDOA 3URYA 2XNAC 4FA6A 1ZOYB 4KGTA 3N1YC 3ZQ4A 2L1AA 2EKEC 2I38A 1RWSA 2QCZA 4JL9A 3MC9A 1GT8A 3ZUNA 2K3UA 1P7EA 3ML9A 1DOIA 3OJ3A 3O65B 2MEKA 2BWES 2MBQA 3QIJA 1F0ZA 3DBRI 2PVGC 1SEBD 4C4VB 4N58A 4XDDA 3KUDB 2XBBC 3DBLB 3AN1A 4WJOA 2KN5A 2O6VA 5D94A 3ZNHB 2V0GA 4B0EA 1CZPA 1FRRA 2QSDA 2J42A 1JQ4A 1AWDA 2O2VA 4A20A 5LXIB 2LXCA 3TEWA 2CHWA 2FE8A 2KFKB 2V4LA 1YN4A 3H9DA 2J4XA 4G50A 3J9CA 1I35A 2EELA 1DOXA 1WXSA 2DYOA 3AEGB 3PSEB 2LGDA 2BYFA 2K8CA 1QOFA 2ONQA 3PLUA 4AUQC 4A6QA 1VDVA 2R61A 4YTPB 1WJ4A 4C00A 3LJ3A 2ZVNA 5GMVA 5AZFA 1WRDB 3MJWA 4KKJA 2BBCA 4C7YA 3DVNU 4YL8A 1IUEA 2DYBA 1ENFA 4W9KA 1WE6A 3W5VB 4C7ZA 5E6OA 3NG0A 4M0WB 5H8YE 3RN9C 1UBQA 1XXGA 1UBIA 1MG8A 3IXSA 2LGYA 3M63B 1N6ZA 4LDTD 1WXMA 3RZWC 4USAA 1KM7A 3PZDA 4II3B 1IBXA 2CU1A 2LXAA 2GI9A 2LI5A 2ZZPB 2JY6A 3BYTB 2LZ6A 4MGIE 1WX7A 2JYEA 3PRPB 2DZIA 1VLBA 1YIWA 5E6NA 3DVGX 4RGMA 2CKHB 2KNBA 1XF5L 2IO3B 3NVYA 2GBKA 4WWNA 4M00A 2Z59B 1L0YB 5C1ZA 4L2YA 2M4NA 1WGKA 2HJ1A 3UINB 1JMLA 2V9HA 4A8XC 1E7PB 2BPSA 5D3IB 3RYTA 3EA6A 3RMKC 1ZE3D 4WJNA 4ZYSA 4W9HA 3PHWB 1R7SA 2JPHA 3VAWA 3L0WB 2WXPA 3ZTCA 2I2YA 2HE7A 1L2NA 1PGAA 3ZJVA 3A9KB 2ZPYA 2Y3AA 1YQ3B 1YD8U 1L5PA 2EMSA 1NYRA 4DXFA 1VCBA 2WXFA 1RFAA 4GDLA 1YQ4B 1FMAD 4KIKB 1WH3A 1WY8A 1YMHE 2NCNA 1S3SG 3IVFA 5AEKB 3U30A 1SB3C 2W54A 2L76A 2MHJA 1Q1OA 1WGRA 1VD2A 4LLGM 3TUOA 3AU5A 3N1XC 2FAZA 4D2KA 3Q3MC 1E8YA 1VZ6A 1E8XA 2IGHA 1XD3B 2IJ0A 1TY2A 4W9LA 1TYGB 3GE8C 5FKAC 3AM9A 1KLUD 3CSTA 2KJRA 1V1PB 2CHZA 1SIJA 3L17A 5E6PA 1WX8A 5AUIA 3SU8X 2L83A 2C7MB 1J19A 3APFA 1DGJA 3NZUA 1KTKA 2WDTB 3O13A 4X57B 1QT9A 1WE7A 1J7CA 3VTVA 1MVKA 3QHTA 4BVUC 2JRIB 1YX6B 2KANA 2CHXA 2B3AA 1C4PA 1SF0A 1V8CA 1RYJA 3CMMB 3KUCB 1VRAB 4HPLB 3IG3A 4IDIA 1QZEA 4C80A 3WAOA 2J0JA 2INPE 4FJVB 1WX9A 3Q3FA 2KWCA 2QDFA 1FIQA 4ZRJA 3I5JC 1JWMD 1T5XD 3TEYA 2MJDA 2BQQA 3PGEA 3ETRA 2QEJC 3NOBA 1K50A 3CIRB 4QAYA 4NAWB 1SE4A 3ALBA 4HJGE 2IY0B 2MBBB 3KH0A 2LVOA 2A5UA 1ZPSA 2KQSA 2KVZA 5KHOA 3OJ4B 4PS7A 1MHXA 3CWIA 4C4VA 5L95C 2WU2B 1EM7A 3KW5B 2KDBA 4W9IA 1OFFA 3AEDB 3V3XA 4WIPA 1WGYA 2PPHA 1QQRA 2KFKA 2KT7A 3TL5A 2WXLA 3VUYA 3FILB 2ZEQA 1HA5A 2WXIA 2VZKD 1RM6C 1QOBA 2BW2A 3NUHB 5IOIA 5IA7A 5CX3A 1UNSA 3KQ4A 4RF1A 3PRMB 3B2FA 2I1KA 2JU6X 5IAAC 5C23A 2RD0A 2ZW1A 3UI3A 2DWQA 4ITKA 2MH7A 2FIDA 4FULA 4DHZE 1VR9A 1QILA 4BKSD 4XWTA 4YT0B 2SAKA 4B95A 4KZCA 5C3JB 1C79A 2KMMA 4M0WA 3QAQA 1CJEA 4JWSC 4JX1C 4K7SA 4XE0A 1JWSD 2KX0A 3ABVB 3IAS1 4HCNB 2BS3B 2OEDA 1NENB 3L08A 1KLVA 3C8YA 5CTRC 4LNNA 5BYRA 1ET6A 2WDVB 3MHZA 4EKUA 3A1QB 4AP4C 3BVMA 1L4ZB 2IDYA 5BMGA 1SE2A 1FM0D 3ZRCA 2ZNVC 2BT6A 3T9LA 4WAFA 1L6UA 2J0KA 3HUIA 4PT5A 2WQYB 2WX0A 3ZDTA 3V6CB 1OQQA 2O6VD 3MC0B 3EGRA 2QC8A 4ZRKA 4CO7A 4CQNA 4JWUC 4EOYA 2KX3A 3ML8A 5HKHA 2GMIC 3N9YC 4AJYB 2ACZB 3PTFC 4TUUA 2KO3A 1E90A 1K8RB 1WM2A 1F2RI 1V80A 1WIAA 2FCQA 2DAJA 2CU3A 5LLIA 1XLNA 2PJHA 4HPMB 3A9KA 2J0MA 3NHEB 2A4ZA 1V9JA 1UGJA 2UU7A 4OVZA 1ZGUB 1WF9A 4DXGA 2WLBA 3AH7A 1GTHA 2WWZA 3I57A 4KIKA 4HWIB 1J7BA 1VZ8A 1Z5SB 3DHGC 4R3DA 4I6NB 1C77A 1UZXB 2LWPA 3DWMA 5J2RA 4XGAB 1KH0A 4JGHB 1VZ7A 3AE3B 2EMTA 2QJLA 2RGFA 1H4RA 3QA8A 1J8CA 3W5UB 1FO4A 4K3BA 4F7ZA 2GOWA 2QIEB 3AEBB 4S17A 1V49A 4WWPA 3JYUA 4EE2A 4KX6B 1XQQA 3SD5A 4RM8A 3QK0A 3R66C 3QCAA 4LNIA 3GS2A 3GZNB 2XEWA 1GB1A 4EZLA 5BMIA 2DZJA 2DAFA 3ZXVA 4TQ1A 1EF5A 2ON8A 4XC2A 5JZEB 1LXDA 2JT4B 4FXCA 3NRZA 3LXFA 5LNK1 5L83A 2RSUA 2KDMA 3R8BA 4KDLB 1WZ3A 2LASA 1C3TA 4KKIA 1Y56A 3NVZA 4HKQA 3ZGZA 4YSXB 4GSWA 2M19A 2AEHA 4ANVA 3H7SA 3H7PB 3DBHI 3DQVA 1R4MB 1TKGA 1WR6E 4ZOHC 2MSED 3EHVA 1E0ZA 2NR2A 1LQBA 1F1HA 2KVRA 3E56A 1I4QA 2JSVX 2ZCCA 4FJZA 3JW0X 3NVVA 3AE5B 2N9XA 3ZNGC 3BVZA 3MC8A 4RM9A 2IO0B 2DYMA 1QF6A 3EC8A 4RGNA 3WIMA 1YQBA 2R2OA 4JPSA 2IO1B 2KWUB 3SR6A 4PYUA 3APCA 1MPEA 2BYVE 4NAWA 3SHQA 2LJIA 4ZDVA 2NS5A 3VVWB 4OW0A 1TY0A 1RFKA 1NI2A 2BB5A 3QQ8B 2N7EA 3BK1A 3PT2B 1GOZA 4KSKC 3R2IA 4F1SA 1FPYA 1WMHB 3KYDD 3JVZX 4DDGD 1FRDA 1GAQB 2VH1A 1V1OA 5DPWA 2I1JA 2KTRB 2LUMA 2D10A 3BINA 4DQOC 3QX1A 4GU2A 3H1UA 1PGBA 5G55A 3BY4B 1KRHA 4I6PA 4IWOA 1N5WA 3FILA 5JHBA 1NVID 5DPTA 3CF4A 1JWUD 5G5GA 3AB5A 2AQ2B 1D3ZA 3SEBA 3P4SB 1N63A 4P6VF 4TKNA 1OEYA 1I4XA 1LGRA 2KACA 3I9V1 5CHWA 3W9CB 3VUWA 1P3QU 4ZHPA 5E6JA 5BYQA 3UQBA 3PVLA 5JH5C 3V61A 1WJNA 1EWCA 1FD6A 4N9F4 1JALA 1UWXA 4KV2A 1JRPA 1C78A 1NDDA 1I42A 4YSZB 4LNKA 2N0SB 4P1CC 1R4MI 2K0PA 2Y5PA 1FFVA 1IGDA 3A4RA 3KUZA 3AEFB 2MJEA 3E9SA 3TEZA 4FHJA 1T0RC 1BT0A 3X0WA 3AE2B 2G4SA 3RNAC 4IM0A 1PYWD 2N9EB 4M02A 5AUKA 3LDZE 2BKFA 3DBLI 4DBGA 1V86A 2RMMA 1P0RA 1ESFA 1OEYJ 3A1QA 1WYGA 3L16A 3DWGC 1GB4A 1K52A 5FR6A 3Q14C 1WZ0A 4BBNC 2PEAA 2MBEA 3UIPB 1JWBD 2J53A 2JWZA 1YN5A 3VUXA 4NQLB 1MFWA 1U4AA 2K1FA 4IUMB 3GOEA 1PGXA 2G4DB 2KDEB 2INDC 3Q8BA 4RF0A 4P1BC 2EKIA 1R4NB 3RNFC 2W55A 4MGKE 4BOSC 2NBUA 1JRUA 4HLEA 2INCC 1ACCA 4ACFA 5I4DA 1SGHA 1QOGA 4KVGB 1F52A 2WS3B 1FFUA 2MP2B 3Q8AA 4RGOS 4BBNF 3WA0A 4K81A 2K8BA 2WHIA 5BYSA 4ZHOA 2DENB 1T0YA 3B0AA 2L0TA 4JLCA 2D3BA 4FLHA 1H8CA 3V60A 1FCLA 4G0NB 4ANXA 1I7HA 2WXJA 3OWEB 2D2QA 4EFOA 3Q2AC 4IWQA 4W9JA 4CYEA 5G5HA 5EE9A 3FKYA 1EO6A 2LGIA 4DDID 4W9GA 2LMCA 3ZJTA 2G1EA 1SJED 2BS4B 4P16A 2W82A 3BIID 1DOYA 2KLGA 2Z0EB 2WNMA 2BTEA 3RNBC 3NZSA 2D3CA 2BKRB 2VZKB 3Q8EA 2UWQA 2INNE 2PW9A 4A3PA 4BFRA 1FXIA 3DOWA 4MEMA 1XEEA 2RDGA 4GDKB 2K8HA 1I4GA 3FAHA 3HM6X 2WXMA 2HDEA 2GLSA 4NAMA 3BZDB 4DHZB 5DPRA 1D5ZC 1XT9B 1IP9A 3QARA 2JX5A 4URKA 2BYEA 1XLPA 4L1BA 2B76B 1SJHD 3EUB2 1YX5B 1V97A 3DCGA 1HZ5A 1WM3A 1JW9D 1JROA 2KQ7A 1TT5B 4YTNB 2RDBC 3H7PA 5HI1A 4GLSC 1K53A 3AE6B 2L52A 1N61A 2D07B 4FADA 4BAXA 5D3DA 4RH6A 4LNFA 2VH2A 2ZNVB 3NS1A 4M8MA 4K7UA 3I3TB 2V3PA 1SE9A 3RUIB 5J18A 2C9WB 1JWAD 2L00B 1L7YA 1OGWA 3VRBB 1RLFA 1EUVB 2IZVB 2G45B 3ZXRA 3H6NA 2JZPA 1C76A 3RNGC 1ZKHA 2KXJA 3NJTA 3TMPB 2DZKA 2WXGA 3L54A 4OZBA 5IO9A 2MA9B 4TV3A 5H92C 2DHZA 2LRWA 1ZUD2 3WALA 1MG4A 3KVFB 3NZ3A 4NZLB 5EE0A 2Z8LA 2D3GA 3JSVB 2HJ8A 3RFZB 2NBVB 3KLSX 3VTWA 1WYWB 2JYTA 4RNAA 1WMHA 2BS2B 2JRHA 3U4EG 3RCZA 4WH4A 4Q2JA 3W2DA 2KTRA 1HTQA 2WXNA 1C1YB 4OZAA 5AZGA 5GXGB 1E10A 1UD7A 5EDSA 2KMCA 4US8A 2FUHB 2PKOA 1D5MC 2NPTB 4M01A 1Q10A 2G3QB 3ONSA 2QILA 2GB1A 2JZ3B 1E7VA 2ZW0A 3V62A 1WRIA 2PE6B 4A9AA 4PK1A 3HIZA 2KDIA 2GRIA 1GTEA 1NI3A 3N32A 1X1MA 4OZCA 2REXA 2D11A 1Q0WB 4B6WA 3B9JA 1CK1A 4HVBA 4DHJB 3B2GA 3P2BA 1E5WA 5CHFA 4C56C 1MI0A 5FR3A 2NTSA 2GBNA 2D3AA 4XX5A 3BWUD 1ZDXA 2XN9C 1ZXIA 1GUAB 1T0QC 2VRRB 3MJ5A 3ZVVA 2KN4A 3IT4B 3RT3B 4MSMB 1NBFC 3DDCB 1OQYA 2AX5A 2PVOD 5HHDG 1T6BX 2ZVOA 2L05A 2K5PA 2DLBA 3HVDA 3APDA 4WWOA 4ZRPA 1WGHA 2MCNB 3MFGA 1NYQA 4J6IA 1E6EB 1UUPA 3ZW3A 3VFKA 1ZW7A 2K6DB 2LHEA 2AWTA 3L10B 4ICUA 1V6EA 2MBHA 1S1QB 3DHIC 3IHPC 1L4DB 2K25A 2AQ3B 4MACA 2D5GA 1TJEA 1ROEA 2N7JA 5BMHA 1WGGA 4BKGA 2AL3A 2LD9A 2LVQA 3VRAB 3AE7B 2QHOA 4IG7B 2W3RA 2FUG1 2M0AA 2X38A 2C5LC 2MLBA 1GPXA 4HKZE 2KOXA 2RPQA 4I6LB 2KMAA 3AEEB 3AECB 2MP2A 4YTMB 4WAAA 4E3CA 2QMTA 1VJKA 4IKGA 3P1MA 2Y5CA 3U52E 3ENEA 1HQRD 2NMQA 3AXCA 1I4PA 2AL6A 3DBRB 2N7DA 2W3SA 2M1MA 1OQRA 4NJCA 2J52A 3L13A 4NJ7A 4DWFA 2WDQB 1WSPA 2NVUI 2WXOA 1EU3A 4RGTA 2C7NB 4BOZB 2WGSA 2LRUA 4KZ0A 4LCDE 1EU4A 4MELA 2DBYA 2CR5A 4XDCA 4MGYE 1V5TA 2KDFB 4JE3B 2N9LA 1GNUA 2L0FA 5D7GA 4P7IA 1L6VA 3VH3B 4REZA 4YWGG 5D6JB 3HRDD 3I63C 3RULA 1SIFA 3PREA 1UGMA 3HHMA 4S0RA 3FC4A 3P4PB 4IOIE 5FK9C 1SBBB 3DBSA 2FNJB 3U8ZA 1M94A 1MJDA 4GB9A 4FHKA 4XYCA 5J17A 3B08A 3ZNID 3A33B 4GDKA 3BVGA 3Q3NC 4O1NA 3Q3OC 1KFYB 3LYYA 4AWJA 1HZ6A 2YEPB 3NVWA 1B1ZA 4LDTB 1ZDVA 2RDHA 1WFYA 3Q8CA 1V2YA 1XCQL 2BVCA 2KZRA 3B1LX 2YVCA 1GJZA 3L4PA 5CHVC 2FCSA 4NQKE 4GXBA 2C60A 4KSLC 2FCNA 2E6XA 4MT5A 1YJJA 2G9HD 2L32A 2KC2A 1TTNA 2CJOA 3VHTC 3UGBB 3ZJUA 4A3OA 2M8SA 1H7WA 4NPNA 1SE3A 3DPDA 3S2AA 2K22A 4J3OD 3DVNV 2OJRA 2KAJA 2XK5B 5TSSA 3ECIA 4G11A 3RI7C 2IYDB 3AULA 2BYTA 4MSQB 4NY0A 4N59A 2LGXA 1WI0A 3GZNI 2PMVA 4DXAB 2LFIA 2IPKD 4IC7B 4US9A 2TSSA 1Y8RC 4GGQA 4MJSB 2J7QB 3JSVA 4H2AA 3PZ7A 3CSFA 1Q5WB 3WAMA 1TZ1A 1PDXA 1XCTL 4WWMA 3KWVA 2JF5A 3EFUA 3ZIMA 1RAXA 2IGGA 4LTUA 3A9JB 5DPSA 4B9KA 1WR1A 3H8HA 1D6EC 2RPVA 1ZXHA 1YJIA 3PPAA 3GE3C 2C7HA 4E71A 2N9PC 1F9JA 2CS4A 2LJ5A 2NPTA 2JUOA 2M56B 3AE1B 4BKTA 5JHAA 2V4IB 2GBMA 4ZRIA 4DK5A 3PO0A 2WDRB 4KGSA 5IN7A 3IFWB 3AE4B 2RR9A 5DCNA 1KJTA 3VR8B 2KHWB 4XWWA 4LJPB 2WXHA 4ICVA 4WJPA 1ET9A 4PS8A 2KJ6A 4HPPA 3DVGY 1GG3A 1C9FA 4YSYB 3P4QB 1ZP0B 4G3XB 3M62B 3HVZA 1IGCA 1LM8B 4UDUC 1TS2A 4OVUA 3A4SC 1JCKB 4PS3A 2AQ1B 4HEA1 2NTTA 4RFBA 4AS1A 5AZHA 2YEPF 2BB6A 3N20C 4JQWC 2GBRA 2CJNA 3ZKJC 4EUTA 1AYFA 1TKYA 3U7ZA 3ZRFA 3QWZB 1KLGD 4AJWA 2GBJA 3NY5A 4JIOU 1TS5A 4GOCA 1XO3A 5IKCM 1PFDA 2PIAA 3PRZA 3CF6E 1N62A 4MM3A 5TR5A 3X23A 3OLMD 2Z0DB 2BF8B 4HCPB 1BXTA 1UWMA 1EWYC 2WXRA 3EECA 4F8CB 1N60A 2WU5B 1STEA 2OHFA 1WJ6A 1J7AA 2N1VA
chains in the Genus database with same CATH topology
3KLSX 4DXGA 2WLBA 3AH7A 5EE1A 1GTHA 1YN4A 3I57A 2JYTA 4WURA 4RNAA 1J7BA 1VZ8A 2J4XA 4ARCA 3BYYB 4R3DA 3J9CA 1C77A 2BS2B 3DWMA 3IAM1 3U4EG 1YNTE 4WH4A 4Q2JA 3Q8FA 3W2DA 2EELA 5HG2A 1KH0A 1DOXA 2WXNA 2DYOA 1VZ7A 3AE3B 3AEGB 4OZAA 5GXGB 1E10A 2QJLA 1QOAA 1QOFA 2ONQA 3W5UB 4OVZA 1T3QA 5JXVA 1FO4A 4A6QA 1VDVA 5MPOA 2R61A 5T8IA 2QIEB 4YTPB 3AV8A 4US8A 3AEBB 1D5MC 2PKOA 3P4RB 1Q10A 4EE2A 1HEZE 4N6EB 4KX6B 2QILA 2GB1A 2ZW0A 3GS2A 4KKJA 1FXAA 2BBCA 4C7YA 1HXYD 1WRIA 1FEHA 1IUEA 1I4HA 2Q5WD 1GB1A 1ENFA 4A9AA 5BMIA 3Q69A 2JQRB 4TQ1A 2ON8A 3W5VB 2GRIA 1GTEA 1L0XB 1NI3A 4C7ZA 2WP9B 4HRSA 4OZCA 4FXCA 5H8YE 3NRZA 1XXGA 3LXFA 2PLPA 3B9JA 1CK1A 5LNK1 3B2GA 4HROA 3AEAB 1MHHE 2KDMA 3R8BA 3IXSA 4C56C 1MI0A 5FR3A 3SFDB 2NTSA 4USAA 2WXQA 1IBXA 1PUTA 3BWUD 1ZDXA 2XN9C 2GI9A 3RPFC 1ZXIA 3MJ5A 3BYTB 2KN4A 1D5XC 3IT4B 3GB1A 3VR9B 4KKIA 1Y56A 3NVZA 2PVOD 2AX5A 4HKQA 3ZGZA 4YSXB 2M19A 5HHDG 1T6BX 2JYEA 1VLBA 3AE8B 4RGMA 2K5PA 1TZOA 2DLBA 1XF5L 3NVYA 1TKGA 3HVDA 4ZOHC 4ZRPA 1E0ZA 1KF6B 1L0YB 3MFGA 4L2YA 2N9KA 2KWDA 1NYQA 3E56A 1I4QA 1N5XA 1E6EB 1UUPA 1WGKA 2JSVX 1JMLA 3NVVA 3AE5B 5C2TB 4A8XC 1E7PB 5D3IB 2LHEA 5EE3A 3EA6A 1ZE3D 3BVZA 2JXTA 2DYMA 1L4DB 1QF6A 4ZYSA 1R7SA 4RGNA 2AQ3B 2WXPA 4MACA 2D5GA 1LO5D 2I2YA 1A70A 1TJEA 1PGAA 4JPSA 1ROEA 2N7JA 3R2TA 5BMHA 3ZJVA 4ARIA 3SR6A 1SSNA 1MPEA 2Y3AA 3P63A 1YQ3B 2LJIA 3VRAB 1L5PA 1NYRA 4DXFA 4OW0A 1TY0A 3AE7B 2WXFA 1QKZA 1RFKA 2BB5A 1AW7A 4TSSA 3BK1A 2W3RA 2FUG1 2M0AA 2X38A 1GOZA 1YQ4B 1FMAD 1GPXA 1WXQA 4HKZE 3R2IA 1FRDA 1GAQB 1YMHE 3AEEB 3AECB 1V1OA 1D4BA 4YTMB 3KWLA 1SXTA 2LUMA 2QMTA 1SB3C 2W54A 1VJKA 4IKGA 3P1MA 2Y5CA 2V3NA 3U52E 4DQOC 4AQ7A 1HQRD 2NMQA 1I4PA 4LLGM 1TS4A 2W3SA 3TUOA 1F77A 4B0MA 1OQRA 1H7XA 1PGBA 4D2KA 2FBWB 4NJCA 1KRHA 1VZ6A 2ICIA 2J52A 2WDQB 2IGHA 3V05A 1WSPA 1N5WA 3FILA 2WXOA 2IJ0A 1TY2A 1EU3A 1FNUA 1B9RA 1NVID 1TYGB 3CF4A 4RGTA 1E9MA 1JWUD 5G5GA 3AB5A 2AQ2B 3SEBA 3P4SB 1N63A 1EU4A 2WXKA 2DBYA 4P6VF 4XDCA 1BUIC 1I4XA 2KACA 3I9V1 4JE3B 2N9LA 3W9CB 2MJ3A 5D7GA 5FKAC 1WWTA 3AM9A 1L6VA 4ZHPA 2E3TA 4REZA 5E6JA 4YWGG 1KLUD 5BYQA 3TSSA 3HRDD 1V1PB 1EWCA 4L23A 1SIJA 4A55A 1FD6A 1JALA 1UWXA 4WQMA 1JRPA 1C78A 3BK2A 4YSZB 5AUIA 2N0SB 4TMAB 3FC4A 2L83A 3P4PB 4IOIE 5FK9C 2K0PA 1SBBB 1XLQA 2Y5PA 3TEXA 1IBXB 1FFVA 1IGDA 1DGJA 3AEFB 1KTKA 2H89B 3O13A 2MJEA 1QT9A 3E9SA 3TEZA 3T3NA 3PZ8A 3BVGA 1J7CA 3AE2B 1MVKA 4O1NA 1KFYB 3AMZA 3LYYA 1PYWD 3GP7A 1FNVA 1HZ6A 2YEPB 3NVWA 1B1ZA 1ZDVA 1C4PA 1L0VB 1SF0A 1V8CA 2RDHA 5AUKA 1RYJA 2K9XA 3WCQA 3Q8CA 1XCQL 1VRAB 2RMMA 4IDIA 4ZRQA 4C80A 2INPE 1TS3A 1ESFA 1WYGA 3L4PA 3DWGC 1GB4A 2IGDA 1K52A 1XLOA 1FIQA 1JWBD 4KGRA 2E6XA 4MT5A 2J53A 1YJJA 2G9HD 2L32A 5HFYA 1JWMD 1YN5A 1T5XD 3VQIA 2CJOA 4MM3B 3T3OA 3TEYA 3LB8C 3ZJUA 2MJDA 1H7WA 3ETRA 2QEJC 1SE3A 1K50A 1PGXA 3CIRB 1QLBB 4NAWB 1SE4A 2K22A 4J3OD 1P7FA 4HJGE 3Q8BA 2KAJA 4RF0A 2KQ4X 1ZPSA 2EKIA 2SEBD 5TSSA 2W55A 1C4AA 4GDLB 3U2SC 1CQVA 1MHXA 3CWIA 4OHJA 1ACCA 2BYTA 5I4DA 1FNWA 2WU2B 1QOGA 4N59A 1M4VA 1F2RC 2WS3B 1FFUA 3Q8AA 1K51A 4RGOS 1EM7A 2PMVA 2LFIA 2IPKD 5BYSA 4US9A 2TSSA 1AN8A 4ZHOA 3MP9A 1OFFA 3AEDB 3V3XA 4WIPA 4H2AA 1NEKB 1QQRA 1FCLA 3PZ7A 2WXLA 1I4RA 3FILB 1I7HA 1HA5A 2WXJA 3OWEB 1PDXA 1XCTL 3AE9B 2WXIA 3KWVA 4LK0M 4WWMA 2VZKD 2PTLA 1RM6C 1QOBA 3W1SA 2IGGA 4LTUA 3SFEB 2BW2A 3NUHB 5G5HA 2JWUA 5EE9A 1UNSA 3H8HA 2LGIA 3KQ4A 1D6EC 2RPVA 4RF1A 1ZXHA 1YJIA 2LMCA 3ZJTA 1YN3A 2G1EA 3B2FA 1SJED 2BS4B 4TQ0A 1FCCC 2JU6X 4P16A 2W82A 3BIID 1DOYA 2WNMA 2BTEA 2HTME 2M56B 3AE1B 2ZW1A 2LEKA 3UI3A 2VZKB 3Q8EA 4A90A 2DWQA 2V4IB 4ITKA 2INNE 2H88B 2PW9A 2MH7A 1VR9A 1QILA 3ZYYX 3PO0A 2WDRB 4XWTA 4YT0B 1FXIA 2SAKA 3IT6B 4KGSA 1XEEA 1TKEA 2RDGA 4GDKB 5C3JB 3AE4B 1C79A 2KMMA 3VR8B 4M0WA 1I4GA 1DYQA 1V1PA 4XWWA 3FAHA 1CJEA 4JWSC 4JX1C 4XE0A 3P42A 2WXMA 1BMLC 1JWSD 2WXHA 2HDEA 3ABVB 1ET9A 3IAS1 4NAMA 3BZDB 2BS3B 4MH8A 2OEDA 1NENB 1C4CA 4YXDB 1C9FA 3C8YA 1D5ZC 5BYRA 4YSYB 3P4QB 1ET6A 1ZP0B 2WDVB 3MHZA 2JX5A 3HVZA 1XLPA 1IGCA 4L1BA 2B76B 4UDUC 1TS2A 1SJHD 3EUB2 4RCOA 3BVMA 1V97A 1L4ZB 2IDYA 5BMGA 1HZ5A 1SE2A 1FM0D 1JCKB 2BT6A 1JW9D 1JROA 4WAFA 2AQ1B 4YTNB 4HEA1 2LHDA 4GLSC 5HI1A 1K53A 3AE6B 2L52A 2NTTA 1L6UA 4RFBA 4AS1A 1N61A 2YEPF 3HUIA 3URYA 4PT5A 2WQYB 2XNAC 2BB6A 1OQQA 5D3DA 2CJNA 1ZOYB 4KGTA 4RH6A 3MC0B 3EGRA 3ZQ4A 2L1AA 1AYFA 4CQNA 3NS1A 4JWUC 1TKYA 2I38A 3U7ZA 1RWSA 2V3PA 1GT8A 1JWAD 3N9YC 2ACZB 1KLGD 2K3UA 1P7EA 1DOIA 3VRBB 1TS5A 2MEKA 1F2RI 1XO3A 1F0ZA 1PFDA 2PIAA 2PVGC 1SEBD 1N62A 2JZPA 4N58A 4XDDA 1C76A 3AN1A 2CU3A 2WXGA 4OZBA 1XLNA 1BXTA 2V0GA 5H92C 1UWMA 1EWYC 2WXRA 1ZUD2 4B0EA 1CZPA 1FRRA 2QSDA 1N60A 2J42A 1JQ4A 3NZ3A 2WU5B 1AWDA 4NZLB 5EE0A 1STEA 1UGJA 2Z8LA 2OHFA 3TEWA 1J7AA 2FE8A 3RFZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BII D;  2WLB A;  3AH7 A;  1KFY B;  3AMZ A;  1DOY A;  5EE1 A;  1GTH A;  1QF6 A;  1R7S A;  2HTM E;  1J7B A;  3NVW A;  2M56 B;  3AE1 B;  2LEK A;  2BS2 B;  1L0V B;  1SF0 A;  1V8C A;  2DWQ A;  3DWM A;  1RYJ A;  4ITK A;  2K9X A;  2H88 B;  1A70 A;  1TJE A;  3WCQ A;  1ROE A;  2MH7 A;  1DOX A;  3SR6 A;  1E10 A;  4IDI A;  3AE3 B;  3AEG B;  5GXG B;  3PO0 A;  3P63 A;  2QJL A;  1QOA A;  2WDR B;  3ZYY X;  4C80 A;  4YT0 B;  1YQ3 B;  1FXI A;  1TKE A;  1WYG A;  3VRA B;  1L5P A;  1NYR A;  1QOF A;  3L4P A;  3AE7 B;  3DWG C;  3W5U B;  5C3J B;  3AE4 B;  1RFK A;  1T3Q A;  1XLO A;  1FO4 A;  2KMM A;  1VDV A;  5AUK A;  3VR8 B;  5MPO A;  1FIQ A;  1JWB D;  3FAH A;  2QIE B;  1CJE A;  4YTP B;  2W3R A;  4JWS C;  4JX1 C;  3AV8 A;  1YJJ A;  4US8 A;  1YQ4 B;  1FMA D;  3AEB B;  2PKO A;  1GPX A;  1WXQ A;  3ABV B;  3P4R B;  2CJO A;  4N6E B;  2BS3 B;  4KX6 B;  1NEN B;  3LB8 C;  1FRD A;  1GAQ B;  2MJD A;  1H7W A;  3AEE B;  3AEC B;  4YXD B;  1FXA A;  4YTM B;  3ETR A;  3KWL A;  1WRI A;  4C7Y A;  1IUE A;  2Q5W D;  3CIR B;  1SB3 C;  2W54 A;  4YSY B;  3P4Q B;  1VJK A;  1QLB B;  1ZP0 B;  2WDV B;  4A9A A;  2JX5 A;  2K22 A;  2JQR B;  3P1M A;  3HVZ A;  1XLP A;  2Y5C A;  3W5V B;  2B76 B;  1GTE A;  1NI3 A;  4C7Z A;  2WP9 B;  3EUB 2;  2KAJ A;  4HRS A;  1V97 A;  4FXC A;  5H8Y E;  3NRZ A;  2EKI A;  2W3S A;  1FM0 D;  3LXF A;  2BT6 A;  1OQR A;  3B9J A;  1H7X A;  1JW9 D;  1JRO A;  2W55 A;  2FBW B;  3B2G A;  4HRO A;  3AEA B;  1KRH A;  3CWI A;  4YTN B;  2WDQ B;  2WU2 B;  3AE6 B;  1N5W A;  1L6U A;  1QOG A;  2L52 A;  1N61 A;  4N59 A;  3HUI A;  3SFD B;  2WQY B;  4USA A;  1B9R A;  2WS3 B;  1OQQ A;  1ZOY B;  1FFU A;  1NVI D;  3CF4 A;  1PUT A;  1E9M A;  1TYG B;  2CJN A;  5G5G A;  3AB5 A;  3RPF C;  1AYF A;  1ZXI A;  3P4S B;  1N63 A;  3NS1 A;  4JWU C;  1TKY A;  2DBY A;  4P6V F;  1RWS A;  4US9 A;  1GT8 A;  3VR9 B;  2MJ3 A;  3W9C B;  1JWA D;  2ACZ B;  1WWT A;  4ZHO A;  3AM9 A;  1L6V A;  3NVZ A;  2E3T A;  1OFF A;  2AX5 A;  2PVO D;  4ZHP A;  3AED B;  4YSX B;  1DOI A;  3HRD D;  3VRB B;  2M19 A;  1SIJ A;  1XO3 A;  1NEK B;  1JAL A;  1PFD A;  2PIA A;  4WQM A;  1VLB A;  1F0Z A;  1JRP A;  2PVG C;  3AE8 B;  2K5P A;  1N62 A;  4YSZ B;  4N58 A;  3NVY A;  1TKG A;  1I7H A;  5AUI A;  2N0S B;  3FC4 A;  4ZOH C;  2L83 A;  3P4P B;  1PDX A;  3AE9 B;  3AN1 A;  4WWM A;  1E0Z A;  2CU3 A;  1KF6 B;  1XLQ A;  1RM6 C;  1FFV A;  1XLN A;  1DGJ A;  1QOB A;  1NYQ A;  5H92 C;  1UWM A;  1N5X A;  1EWY C;  1E6E B;  3SFE B;  1WGK A;  4LTU A;  1ZUD 2;  5G5H A;  5EE9 A;  3AEF B;  3NVV A;  1CZP A;  1FRR A;  3AE5 B;  2H89 B;  1N60 A;  1JQ4 A;  5C2T B;  2MJE A;  1E7P B;  2WU5 B;  1AWD A;  5EE0 A;  1QT9 A;  2OHF A;  1YJI A;  5EE3 A;  1J7C A;  2G1E A;  1J7A A;  3B2F A;  3AE2 B;  2BS4 B; 
#chains in the Genus database with same CATH topology
 2JVC A;  5EE1 A;  3N3K B;  4WUR A;  2AYO B;  4ARC A;  3BYY B;  2V1Y A;  3IAM 1;  1YNT E;  3Q8F A;  4HDQ A;  5HG2 A;  4CHK A;  1QOA A;  2BGF A;  3R7R A;  2Y5B B;  2N1W A;  4BZA A;  1T3Q A;  5JXV A;  5MPO A;  3TBL D;  5T8I A;  3R3M A;  3AV8 A;  2KLC A;  2K39 A;  3P4R B;  3QC8 B;  1HEZ E;  4N6E B;  1TBE A;  1FXA A;  1E8Z A;  1HXY D;  1FEH A;  1I4H A;  2Q5W D;  2L8J A;  3HM3 A;  2OOB B;  3ZO5 B;  3IBE A;  3Q69 A;  4XZ4 A;  2JQR B;  2OJW A;  2NBW B;  1L0X B;  4M8N A;  2WP9 B;  5IP4 D;  4HRS A;  3TJP A;  4K3C A;  2PLP A;  2MX2 A;  4HRO A;  2KYW A;  3AEA B;  1MHH E;  4FJY A;  1IPG A;  3TIX A;  3SFD B;  3SDL C;  2DNF A;  2WXQ A;  1PUT A;  3RPF C;  2KD0 A;  2KJH B;  1D5X C;  3GB1 A;  3Q6B A;  5LXH A;  3VR9 B;  4NJ6 A;  4OVV A;  5G2N A;  4KDI C;  2MQJ A;  3AE8 B;  1UF0 A;  1R4N I;  1TZO A;  2MRP A;  2WYQ A;  3UQA A;  4ANW A;  2ASQ A;  1G6J A;  1KF6 B;  4ASW C;  4LNO A;  2N9K A;  2KWD A;  3C0R B;  1N5X A;  1T0S C;  4II2 B;  2KKC A;  5C2T B;  2M17 A;  5EE3 A;  3UIO B;  4ANU A;  1V81 A;  3V6E B;  2JXT A;  2FCM A;  1LO5 D;  4EEW A;  1A70 A;  2O6V B;  3VXW A;  3R2T A;  4ARI A;  1SSN A;  3P63 A;  3Q3J A;  4HJK A;  1QKZ A;  2O2V B;  2M0X A;  1AW7 A;  2XK5 A;  4TSS A;  3W1S C;  2HTH A;  2ZJD A;  4IM3 A;  1WXQ A;  3RZF A;  3VH4 B;  1D4B A;  2DX5 B;  3KWL A;  1SXT A;  4HK2 A;  4W9D A;  2PE9 A;  1UEL A;  1CMX B;  2V3N A;  4AQ7 A;  3N1Z C;  4MJS A;  3ZNZ B;  1TS4 A;  1F77 A;  4B0M A;  1H7X A;  1YOV B;  2FBW B;  1HE8 A;  4PYZ A;  5KHQ A;  2ICI A;  2LGS A;  3V05 A;  1UH6 A;  1FNU A;  1B9R A;  1AAR A;  1E9M A;  3C19 A;  4K7W A;  2WXK A;  1J0G A;  3A9J A;  3ZDM C;  1BUI C;  2MJ3 A;  1WWT A;  2E3T A;  2MW5 A;  4K1R B;  3M3J A;  3TSS A;  3PLV A;  2KFJ A;  3PS6 A;  2R2Q A;  4A55 A;  4L23 A;  1P1A A;  4WQM A;  3BK2 A;  3D32 A;  4ZYN A;  4TMA B;  1IYF A;  3OG5 A;  5BO4 B;  1OTR B;  1E8W A;  1XLQ A;  3TEX A;  1IBX B;  3DHH C;  2JXX A;  2WX1 A;  2H89 B;  2W9N A;  2YLM A;  3VTU A;  3T3N A;  1TIF A;  3PZ8 A;  1WXA A;  2MWS B;  1V5O A;  3AMZ A;  4IM2 A;  2V3S A;  3GP7 A;  1KOT A;  1FNV A;  1ISN A;  2KK8 A;  1L0V B;  4NNJ B;  2K9X A;  3WCQ A;  4ZRQ A;  3AU4 A;  1TS3 A;  3KYC D;  2X8X X;  3U7D A;  2IGD A;  1XLO A;  3OAW A;  5D2M B;  4KGR A;  3K9O B;  3ZTD A;  4W9F A;  3PHX B;  3W1Y A;  5HFY A;  3VQI A;  4MM3 B;  3T3O A;  1GC7 A;  3LB8 C;  3AI5 A;  3PV1 A;  1P9D U;  4IW0 A;  3HK0 A;  4RMA A;  2K6Q A;  1GC6 A;  1WGD A;  1QLB B;  2JZZ A;  3RD2 A;  1P7F A;  2KWV B;  1E7U A;  3WAP A;  3MHS D;  4GIV A;  3TCA A;  2IO2 B;  2KQ4 X;  2SEB D;  4WJQ A;  4EZJ A;  1P98 A;  3DBH B;  1C4A A;  1WXV A;  4GDL B;  3U2S C;  1CQV A;  4OHJ A;  1RRB A;  1FNW A;  3QJZ A;  1M4V A;  2L7R A;  1F2R C;  3VDZ A;  2KC1 A;  1K51 A;  3T8M A;  2IY1 B;  3RNE C;  3R7Q A;  1AN8 A;  3MP9 A;  1HTO A;  4IWP A;  1EF1 A;  1NEK B;  4FN2 A;  4W9E A;  2N4F A;  2DZM A;  1I4R A;  2HD5 B;  3WAN A;  4FBJ B;  3AE9 B;  1PQS A;  3M95 A;  4LK0 M;  2PTL A;  3K9P B;  4MDK E;  2IBI B;  3W1S A;  3UF8 A;  3SFE B;  2JWU A;  4MH0 E;  4E74 A;  2ZPN A;  3N30 A;  2LVP A;  4MGZ E;  1LFD A;  2MBO A;  1YN3 A;  3ZLZ A;  3MTN B;  4TQ0 A;  1FCC C;  2LUE A;  4DHJ D;  2KTF A;  2HTM E;  1A5R A;  2LEK A;  4GMV A;  4A90 A;  2H88 B;  3RNC C;  4EZK A;  3ZYY X;  1FXT B;  3IT6 B;  1TKE A;  3EFC A;  1Z2M A;  2L3Z A;  1DYQ A;  1V1P A;  4GN1 A;  3P42 A;  1BML C;  4MH8 A;  1C4C A;  4LJO B;  4YXD B;  2FIF A;  1TGZ B;  4BKS A;  2UYZ B;  4AOF A;  4HXD A;  4RCO A;  2ZCB A;  4W9C A;  3NS8 A;  1WJU A;  1YJ1 A;  4WQO B;  2BWF A;  2LHD A;  4HDO A;  3URY A;  2XNA C;  4FA6 A;  1ZOY B;  4KGT A;  3N1Y C;  3ZQ4 A;  2L1A A;  2EKE C;  2I38 A;  1RWS A;  2QCZ A;  4JL9 A;  3MC9 A;  1GT8 A;  3ZUN A;  2K3U A;  1P7E A;  3ML9 A;  1DOI A;  3OJ3 A;  3O65 B;  2MEK A;  2BWE S;  2MBQ A;  3QIJ A;  1F0Z A;  3DBR I;  2PVG C;  1SEB D;  4C4V B;  4N58 A;  4XDD A;  3KUD B;  2XBB C;  3DBL B;  3AN1 A;  4WJO A;  2KN5 A;  2O6V A;  5D94 A;  3ZNH B;  2V0G A;  4B0E A;  1CZP A;  1FRR A;  2QSD A;  2J42 A;  1JQ4 A;  1AWD A;  2O2V A;  4A20 A;  5LXI B;  2LXC A;  3TEW A;  2CHW A;  2FE8 A;  2KFK B;  2V4L A;  1YN4 A;  3H9D A;  2J4X A;  4G50 A;  3J9C A;  1I35 A;  2EEL A;  1DOX A;  1WXS A;  2DYO A;  3AEG B;  3PSE B;  2LGD A;  2BYF A;  2K8C A;  1QOF A;  2ONQ A;  3PLU A;  4AUQ C;  4A6Q A;  1VDV A;  2R61 A;  4YTP B;  1WJ4 A;  4C00 A;  3LJ3 A;  2ZVN A;  5GMV A;  5AZF A;  1WRD B;  3MJW A;  4KKJ A;  2BBC A;  4C7Y A;  3DVN U;  4YL8 A;  1IUE A;  2DYB A;  1ENF A;  4W9K A;  1WE6 A;  3W5V B;  4C7Z A;  5E6O A;  3NG0 A;  4M0W B;  5H8Y E;  3RN9 C;  1UBQ A;  1XXG A;  1UBI A;  1MG8 A;  3IXS A;  2LGY A;  3M63 B;  1N6Z A;  4LDT D;  1WXM A;  3RZW C;  4USA A;  1KM7 A;  3PZD A;  4II3 B;  1IBX A;  2CU1 A;  2LXA A;  2GI9 A;  2LI5 A;  2ZZP B;  2JY6 A;  3BYT B;  2LZ6 A;  4MGI E;  1WX7 A;  2JYE A;  3PRP B;  2DZI A;  1VLB A;  1YIW A;  5E6N A;  3DVG X;  4RGM A;  2CKH B;  2KNB A;  1XF5 L;  2IO3 B;  3NVY A;  2GBK A;  4WWN A;  4M00 A;  2Z59 B;  1L0Y B;  5C1Z A;  4L2Y A;  2M4N A;  1WGK A;  2HJ1 A;  3UIN B;  1JML A;  2V9H A;  4A8X C;  1E7P B;  2BPS A;  5D3I B;  3RYT A;  3EA6 A;  3RMK C;  1ZE3 D;  4WJN A;  4ZYS A;  4W9H A;  3PHW B;  1R7S A;  2JPH A;  3VAW A;  3L0W B;  2WXP A;  3ZTC A;  2I2Y A;  2HE7 A;  1L2N A;  1PGA A;  3ZJV A;  3A9K B;  2ZPY A;  2Y3A A;  1YQ3 B;  1YD8 U;  1L5P A;  2EMS A;  1NYR A;  4DXF A;  1VCB A;  2WXF A;  1RFA A;  4GDL A;  1YQ4 B;  1FMA D;  4KIK B;  1WH3 A;  1WY8 A;  1YMH E;  2NCN A;  1S3S G;  3IVF A;  5AEK B;  3U30 A;  1SB3 C;  2W54 A;  2L76 A;  2MHJ A;  1Q1O A;  1WGR A;  1VD2 A;  4LLG M;  3TUO A;  3AU5 A;  3N1X C;  2FAZ A;  4D2K A;  3Q3M C;  1E8Y A;  1VZ6 A;  1E8X A;  2IGH A;  1XD3 B;  2IJ0 A;  1TY2 A;  4W9L A;  1TYG B;  3GE8 C;  5FKA C;  3AM9 A;  1KLU D;  3CST A;  2KJR A;  1V1P B;  2CHZ A;  1SIJ A;  3L17 A;  5E6P A;  1WX8 A;  5AUI A;  3SU8 X;  2L83 A;  2C7M B;  1J19 A;  3APF A;  1DGJ A;  3NZU A;  1KTK A;  2WDT B;  3O13 A;  4X57 B;  1QT9 A;  1WE7 A;  1J7C A;  3VTV A;  1MVK A;  3QHT A;  4BVU C;  2JRI B;  1YX6 B;  2KAN A;  2CHX A;  2B3A A;  1C4P A;  1SF0 A;  1V8C A;  1RYJ A;  3CMM B;  3KUC B;  1VRA B;  4HPL B;  3IG3 A;  4IDI A;  1QZE A;  4C80 A;  3WAO A;  2J0J A;  2INP E;  4FJV B;  1WX9 A;  3Q3F A;  2KWC A;  2QDF A;  1FIQ A;  4ZRJ A;  3I5J C;  1JWM D;  1T5X D;  3TEY A;  2MJD A;  2BQQ A;  3PGE A;  3ETR A;  2QEJ C;  3NOB A;  1K50 A;  3CIR B;  4QAY A;  4NAW B;  1SE4 A;  3ALB A;  4HJG E;  2IY0 B;  2MBB B;  3KH0 A;  2LVO A;  2A5U A;  1ZPS A;  2KQS A;  2KVZ A;  5KHO A;  3OJ4 B;  4PS7 A;  1MHX A;  3CWI A;  4C4V A;  5L95 C;  2WU2 B;  1EM7 A;  3KW5 B;  2KDB A;  4W9I A;  1OFF A;  3AED B;  3V3X A;  4WIP A;  1WGY A;  2PPH A;  1QQR A;  2KFK A;  2KT7 A;  3TL5 A;  2WXL A;  3VUY A;  3FIL B;  2ZEQ A;  1HA5 A;  2WXI A;  2VZK D;  1RM6 C;  1QOB A;  2BW2 A;  3NUH B;  5IOI A;  5IA7 A;  5CX3 A;  1UNS A;  3KQ4 A;  4RF1 A;  3PRM B;  3B2F A;  2I1K A;  2JU6 X;  5IAA C;  5C23 A;  2RD0 A;  2ZW1 A;  3UI3 A;  2DWQ A;  4ITK A;  2MH7 A;  2FID A;  4FUL A;  4DHZ E;  1VR9 A;  1QIL A;  4BKS D;  4XWT A;  4YT0 B;  2SAK A;  4B95 A;  4KZC A;  5C3J B;  1C79 A;  2KMM A;  4M0W A;  3QAQ A;  1CJE A;  4JWS C;  4JX1 C;  4K7S A;  4XE0 A;  1JWS D;  2KX0 A;  3ABV B;  3IAS 1;  4HCN B;  2BS3 B;  2OED A;  1NEN B;  3L08 A;  1KLV A;  3C8Y A;  5CTR C;  4LNN A;  5BYR A;  1ET6 A;  2WDV B;  3MHZ A;  4EKU A;  3A1Q B;  4AP4 C;  3BVM A;  1L4Z B;  2IDY A;  5BMG A;  1SE2 A;  1FM0 D;  3ZRC A;  2ZNV C;  2BT6 A;  3T9L A;  4WAF A;  1L6U A;  2J0K A;  3HUI A;  4PT5 A;  2WQY B;  2WX0 A;  3ZDT A;  3V6C B;  1OQQ A;  2O6V D;  3MC0 B;  3EGR A;  2QC8 A;  4ZRK A;  4CO7 A;  4CQN A;  4JWU C;  4EOY A;  2KX3 A;  3ML8 A;  5HKH A;  2GMI C;  3N9Y C;  4AJY B;  2ACZ B;  3PTF C;  4TUU A;  2KO3 A;  1E90 A;  1K8R B;  1WM2 A;  1F2R I;  1V80 A;  1WIA A;  2FCQ A;  2DAJ A;  2CU3 A;  5LLI A;  1XLN A;  2PJH A;  4HPM B;  3A9K A;  2J0M A;  3NHE B;  2A4Z A;  1V9J A;  1UGJ A;  2UU7 A;  4OVZ A;  1ZGU B;  1WF9 A;  4DXG A;  2WLB A;  3AH7 A;  1GTH A;  2WWZ A;  3I57 A;  4KIK A;  4HWI B;  1J7B A;  1VZ8 A;  1Z5S B;  3DHG C;  4R3D A;  4I6N B;  1C77 A;  1UZX B;  2LWP A;  3DWM A;  5J2R A;  4XGA B;  1KH0 A;  4JGH B;  1VZ7 A;  3AE3 B;  2EMT A;  2QJL A;  2RGF A;  1H4R A;  3QA8 A;  1J8C A;  3W5U B;  1FO4 A;  4K3B A;  4F7Z A;  2GOW A;  2QIE B;  3AEB B;  4S17 A;  1V49 A;  4WWP A;  3JYU A;  4EE2 A;  4KX6 B;  1XQQ A;  3SD5 A;  4RM8 A;  3QK0 A;  3R66 C;  3QCA A;  4LNI A;  3GS2 A;  3GZN B;  2XEW A;  1GB1 A;  4EZL A;  5BMI A;  2DZJ A;  2DAF A;  3ZXV A;  4TQ1 A;  1EF5 A;  2ON8 A;  4XC2 A;  5JZE B;  1LXD A;  2JT4 B;  4FXC A;  3NRZ A;  3LXF A;  5LNK 1;  5L83 A;  2RSU A;  2KDM A;  3R8B A;  4KDL B;  1WZ3 A;  2LAS A;  1C3T A;  4KKI A;  1Y56 A;  3NVZ A;  4HKQ A;  3ZGZ A;  4YSX B;  4GSW A;  2M19 A;  2AEH A;  4ANV A;  3H7S A;  3H7P B;  3DBH I;  3DQV A;  1R4M B;  1TKG A;  1WR6 E;  4ZOH C;  2MSE D;  3EHV A;  1E0Z A;  2NR2 A;  1LQB A;  1F1H A;  2KVR A;  3E56 A;  1I4Q A;  2JSV X;  2ZCC A;  4FJZ A;  3JW0 X;  3NVV A;  3AE5 B;  2N9X A;  3ZNG C;  3BVZ A;  3MC8 A;  4RM9 A;  2IO0 B;  2DYM A;  1QF6 A;  3EC8 A;  4RGN A;  3WIM A;  1YQB A;  2R2O A;  4JPS A;  2IO1 B;  2KWU B;  3SR6 A;  4PYU A;  3APC A;  1MPE A;  2BYV E;  4NAW A;  3SHQ A;  2LJI A;  4ZDV A;  2NS5 A;  3VVW B;  4OW0 A;  1TY0 A;  1RFK A;  1NI2 A;  2BB5 A;  3QQ8 B;  2N7E A;  3BK1 A;  3PT2 B;  1GOZ A;  4KSK C;  3R2I A;  4F1S A;  1FPY A;  1WMH B;  3KYD D;  3JVZ X;  4DDG D;  1FRD A;  1GAQ B;  2VH1 A;  1V1O A;  5DPW A;  2I1J A;  2KTR B;  2LUM A;  2D10 A;  3BIN A;  4DQO C;  3QX1 A;  4GU2 A;  3H1U A;  1PGB A;  5G55 A;  3BY4 B;  1KRH A;  4I6P A;  4IWO A;  1N5W A;  3FIL A;  5JHB A;  1NVI D;  5DPT A;  3CF4 A;  1JWU D;  5G5G A;  3AB5 A;  2AQ2 B;  1D3Z A;  3SEB A;  3P4S B;  1N63 A;  4P6V F;  4TKN A;  1OEY A;  1I4X A;  1LGR A;  2KAC A;  3I9V 1;  5CHW A;  3W9C B;  3VUW A;  1P3Q U;  4ZHP A;  5E6J A;  5BYQ A;  3UQB A;  3PVL A;  5JH5 C;  3V61 A;  1WJN A;  1EWC A;  1FD6 A;  4N9F 4;  1JAL A;  1UWX A;  4KV2 A;  1JRP A;  1C78 A;  1NDD A;  1I42 A;  4YSZ B;  4LNK A;  2N0S B;  4P1C C;  1R4M I;  2K0P A;  2Y5P A;  1FFV A;  1IGD A;  3A4R A;  3KUZ A;  3AEF B;  2MJE A;  3E9S A;  3TEZ A;  4FHJ A;  1T0R C;  1BT0 A;  3X0W A;  3AE2 B;  2G4S A;  3RNA C;  4IM0 A;  1PYW D;  2N9E B;  4M02 A;  5AUK A;  3LDZ E;  2BKF A;  3DBL I;  4DBG A;  1V86 A;  2RMM A;  1P0R A;  1ESF A;  1OEY J;  3A1Q A;  1WYG A;  3L16 A;  3DWG C;  1GB4 A;  1K52 A;  5FR6 A;  3Q14 C;  1WZ0 A;  4BBN C;  2PEA A;  2MBE A;  3UIP B;  1JWB D;  2J53 A;  2JWZ A;  1YN5 A;  3VUX A;  4NQL B;  1MFW A;  1U4A A;  2K1F A;  4IUM B;  3GOE A;  1PGX A;  2G4D B;  2KDE B;  2IND C;  3Q8B A;  4RF0 A;  4P1B C;  2EKI A;  1R4N B;  3RNF C;  2W55 A;  4MGK E;  4BOS C;  2NBU A;  1JRU A;  4HLE A;  2INC C;  1ACC A;  4ACF A;  5I4D A;  1SGH A;  1QOG A;  4KVG B;  1F52 A;  2WS3 B;  1FFU A;  2MP2 B;  3Q8A A;  4RGO S;  4BBN F;  3WA0 A;  4K81 A;  2K8B A;  2WHI A;  5BYS A;  4ZHO A;  2DEN B;  1T0Y A;  3B0A A;  2L0T A;  4JLC A;  2D3B A;  4FLH A;  1H8C A;  3V60 A;  1FCL A;  4G0N B;  4ANX A;  1I7H A;  2WXJ A;  3OWE B;  2D2Q A;  4EFO A;  3Q2A C;  4IWQ A;  4W9J A;  4CYE A;  5G5H A;  5EE9 A;  3FKY A;  1EO6 A;  2LGI A;  4DDI D;  4W9G A;  2LMC A;  3ZJT A;  2G1E A;  1SJE D;  2BS4 B;  4P16 A;  2W82 A;  3BII D;  1DOY A;  2KLG A;  2Z0E B;  2WNM A;  2BTE A;  3RNB C;  3NZS A;  2D3C A;  2BKR B;  2VZK B;  3Q8E A;  2UWQ A;  2INN E;  2PW9 A;  4A3P A;  4BFR A;  1FXI A;  3DOW A;  4MEM A;  1XEE A;  2RDG A;  4GDK B;  2K8H A;  1I4G A;  3FAH A;  3HM6 X;  2WXM A;  2HDE A;  2GLS A;  4NAM A;  3BZD B;  4DHZ B;  5DPR A;  1D5Z C;  1XT9 B;  1IP9 A;  3QAR A;  2JX5 A;  4URK A;  2BYE A;  1XLP A;  4L1B A;  2B76 B;  1SJH D;  3EUB 2;  1YX5 B;  1V97 A;  3DCG A;  1HZ5 A;  1WM3 A;  1JW9 D;  1JRO A;  2KQ7 A;  1TT5 B;  4YTN B;  2RDB C;  3H7P A;  5HI1 A;  4GLS C;  1K53 A;  3AE6 B;  2L52 A;  1N61 A;  2D07 B;  4FAD A;  4BAX A;  5D3D A;  4RH6 A;  4LNF A;  2VH2 A;  2ZNV B;  3NS1 A;  4M8M A;  4K7U A;  3I3T B;  2V3P A;  1SE9 A;  3RUI B;  5J18 A;  2C9W B;  1JWA D;  2L00 B;  1L7Y A;  1OGW A;  3VRB B;  1RLF A;  1EUV B;  2IZV B;  2G45 B;  3ZXR A;  3H6N A;  2JZP A;  1C76 A;  3RNG C;  1ZKH A;  2KXJ A;  3NJT A;  3TMP B;  2DZK A;  2WXG A;  3L54 A;  4OZB A;  5IO9 A;  2MA9 B;  4TV3 A;  5H92 C;  2DHZ A;  2LRW A;  1ZUD 2;  3WAL A;  1MG4 A;  3KVF B;  3NZ3 A;  4NZL B;  5EE0 A;  2Z8L A;  2D3G A;  3JSV B;  2HJ8 A;  3RFZ B;  2NBV B;  3KLS X;  3VTW A;  1WYW B;  2JYT A;  4RNA A;  1WMH A;  2BS2 B;  2JRH A;  3U4E G;  3RCZ A;  4WH4 A;  4Q2J A;  3W2D A;  2KTR A;  1HTQ A;  2WXN A;  1C1Y B;  4OZA A;  5AZG A;  5GXG B;  1E10 A;  1UD7 A;  5EDS A;  2KMC A;  4US8 A;  2FUH B;  2PKO A;  1D5M C;  2NPT B;  4M01 A;  1Q10 A;  2G3Q B;  3ONS A;  2QIL A;  2GB1 A;  2JZ3 B;  1E7V A;  2ZW0 A;  3V62 A;  1WRI A;  2PE6 B;  4A9A A;  4PK1 A;  3HIZ A;  2KDI A;  2GRI A;  1GTE A;  1NI3 A;  3N32 A;  1X1M A;  4OZC A;  2REX A;  2D11 A;  1Q0W B;  4B6W A;  3B9J A;  1CK1 A;  4HVB A;  4DHJ B;  3B2G A;  3P2B A;  1E5W A;  5CHF A;  4C56 C;  1MI0 A;  5FR3 A;  2NTS A;  2GBN A;  2D3A A;  4XX5 A;  3BWU D;  1ZDX A;  2XN9 C;  1ZXI A;  1GUA B;  1T0Q C;  2VRR B;  3MJ5 A;  3ZVV A;  2KN4 A;  3IT4 B;  3RT3 B;  4MSM B;  1NBF C;  3DDC B;  1OQY A;  2AX5 A;  2PVO D;  5HHD G;  1T6B X;  2ZVO A;  2L05 A;  2K5P A;  2DLB A;  3HVD A;  3APD A;  4WWO A;  4ZRP A;  1WGH A;  2MCN B;  3MFG A;  1NYQ A;  4J6I A;  1E6E B;  1UUP A;  3ZW3 A;  3VFK A;  1ZW7 A;  2K6D B;  2LHE A;  2AWT A;  3L10 B;  4ICU A;  1V6E A;  2MBH A;  1S1Q B;  3DHI C;  3IHP C;  1L4D B;  2K25 A;  2AQ3 B;  4MAC A;  2D5G A;  1TJE A;  1ROE A;  2N7J A;  5BMH A;  1WGG A;  4BKG A;  2AL3 A;  2LD9 A;  2LVQ A;  3VRA B;  3AE7 B;  2QHO A;  4IG7 B;  2W3R A;  2FUG 1;  2M0A A;  2X38 A;  2C5L C;  2MLB A;  1GPX A;  4HKZ E;  2KOX A;  2RPQ A;  4I6L B;  2KMA A;  3AEE B;  3AEC B;  2MP2 A;  4YTM B;  4WAA A;  4E3C A;  2QMT A;  1VJK A;  4IKG A;  3P1M A;  2Y5C A;  3U52 E;  3ENE A;  1HQR D;  2NMQ A;  3AXC A;  1I4P A;  2AL6 A;  3DBR B;  2N7D A;  2W3S A;  2M1M A;  1OQR A;  4NJC A;  2J52 A;  3L13 A;  4NJ7 A;  4DWF A;  2WDQ B;  1WSP A;  2NVU I;  2WXO A;  1EU3 A;  4RGT A;  2C7N B;  4BOZ B;  2WGS A;  2LRU A;  4KZ0 A;  4LCD E;  1EU4 A;  4MEL A;  2DBY A;  2CR5 A;  4XDC A;  4MGY E;  1V5T A;  2KDF B;  4JE3 B;  2N9L A;  1GNU A;  2L0F A;  5D7G A;  4P7I A;  1L6V A;  3VH3 B;  4REZ A;  4YWG G;  5D6J B;  3HRD D;  3I63 C;  3RUL A;  1SIF A;  3PRE A;  1UGM A;  3HHM A;  4S0R A;  3FC4 A;  3P4P B;  4IOI E;  5FK9 C;  1SBB B;  3DBS A;  2FNJ B;  3U8Z A;  1M94 A;  1MJD A;  4GB9 A;  4FHK A;  4XYC A;  5J17 A;  3B08 A;  3ZNI D;  3A33 B;  4GDK A;  3BVG A;  3Q3N C;  4O1N A;  3Q3O C;  1KFY B;  3LYY A;  4AWJ A;  1HZ6 A;  2YEP B;  3NVW A;  1B1Z A;  4LDT B;  1ZDV A;  2RDH A;  1WFY A;  3Q8C A;  1V2Y A;  1XCQ L;  2BVC A;  2KZR A;  3B1L X;  2YVC A;  1GJZ A;  3L4P A;  5CHV C;  2FCS A;  4NQK E;  4GXB A;  2C60 A;  4KSL C;  2FCN A;  2E6X A;  4MT5 A;  1YJJ A;  2G9H D;  2L32 A;  2KC2 A;  1TTN A;  2CJO A;  3VHT C;  3UGB B;  3ZJU A;  4A3O A;  2M8S A;  1H7W A;  4NPN A;  1SE3 A;  3DPD A;  3S2A A;  2K22 A;  4J3O D;  3DVN V;  2OJR A;  2KAJ A;  2XK5 B;  5TSS A;  3ECI A;  4G11 A;  3RI7 C;  2IYD B;  3AUL A;  2BYT A;  4MSQ B;  4NY0 A;  4N59 A;  2LGX A;  1WI0 A;  3GZN I;  2PMV A;  4DXA B;  2LFI A;  2IPK D;  4IC7 B;  4US9 A;  2TSS A;  1Y8R C;  4GGQ A;  4MJS B;  2J7Q B;  3JSV A;  4H2A A;  3PZ7 A;  3CSF A;  1Q5W B;  3WAM A;  1TZ1 A;  1PDX A;  1XCT L;  4WWM A;  3KWV A;  2JF5 A;  3EFU A;  3ZIM A;  1RAX A;  2IGG A;  4LTU A;  3A9J B;  5DPS A;  4B9K A;  1WR1 A;  3H8H A;  1D6E C;  2RPV A;  1ZXH A;  1YJI A;  3PPA A;  3GE3 C;  2C7H A;  4E71 A;  2N9P C;  1F9J A;  2CS4 A;  2LJ5 A;  2NPT A;  2JUO A;  2M56 B;  3AE1 B;  4BKT A;  5JHA A;  2V4I B;  2GBM A;  4ZRI A;  4DK5 A;  3PO0 A;  2WDR B;  4KGS A;  5IN7 A;  3IFW B;  3AE4 B;  2RR9 A;  5DCN A;  1KJT A;  3VR8 B;  2KHW B;  4XWW A;  4LJP B;  2WXH A;  4ICV A;  4WJP A;  1ET9 A;  4PS8 A;  2KJ6 A;  4HPP A;  3DVG Y;  1GG3 A;  1C9F A;  4YSY B;  3P4Q B;  1ZP0 B;  4G3X B;  3M62 B;  3HVZ A;  1IGC A;  1LM8 B;  4UDU C;  1TS2 A;  4OVU A;  3A4S C;  1JCK B;  4PS3 A;  2AQ1 B;  4HEA 1;  2NTT A;  4RFB A;  4AS1 A;  5AZH A;  2YEP F;  2BB6 A;  3N20 C;  4JQW C;  2GBR A;  2CJN A;  3ZKJ C;  4EUT A;  1AYF A;  1TKY A;  3U7Z A;  3ZRF A;  3QWZ B;  1KLG D;  4AJW A;  2GBJ A;  3NY5 A;  4JIO U;  1TS5 A;  4GOC A;  1XO3 A;  5IKC M;  1PFD A;  2PIA A;  3PRZ A;  3CF6 E;  1N62 A;  4MM3 A;  5TR5 A;  3X23 A;  3OLM D;  2Z0D B;  2BF8 B;  4HCP B;  1BXT A;  1UWM A;  1EWY C;  2WXR A;  3EEC A;  4F8C B;  1N60 A;  2WU5 B;  1STE A;  2OHF A;  1WJ6 A;  1J7A A;  2N1V A; 
#chains in the Genus database with same CATH homology
 3KLS X;  4DXG A;  2WLB A;  3AH7 A;  5EE1 A;  1GTH A;  1YN4 A;  3I57 A;  2JYT A;  4WUR A;  4RNA A;  1J7B A;  1VZ8 A;  2J4X A;  4ARC A;  3BYY B;  4R3D A;  3J9C A;  1C77 A;  2BS2 B;  3DWM A;  3IAM 1;  3U4E G;  1YNT E;  4WH4 A;  4Q2J A;  3Q8F A;  3W2D A;  2EEL A;  5HG2 A;  1KH0 A;  1DOX A;  2WXN A;  2DYO A;  1VZ7 A;  3AE3 B;  3AEG B;  4OZA A;  5GXG B;  1E10 A;  2QJL A;  1QOA A;  1QOF A;  2ONQ A;  3W5U B;  4OVZ A;  1T3Q A;  5JXV A;  1FO4 A;  4A6Q A;  1VDV A;  5MPO A;  2R61 A;  5T8I A;  2QIE B;  4YTP B;  3AV8 A;  4US8 A;  3AEB B;  1D5M C;  2PKO A;  3P4R B;  1Q10 A;  4EE2 A;  1HEZ E;  4N6E B;  4KX6 B;  2QIL A;  2GB1 A;  2ZW0 A;  3GS2 A;  4KKJ A;  1FXA A;  2BBC A;  4C7Y A;  1HXY D;  1WRI A;  1FEH A;  1IUE A;  1I4H A;  2Q5W D;  1GB1 A;  1ENF A;  4A9A A;  5BMI A;  3Q69 A;  2JQR B;  4TQ1 A;  2ON8 A;  3W5V B;  2GRI A;  1GTE A;  1L0X B;  1NI3 A;  4C7Z A;  2WP9 B;  4HRS A;  4OZC A;  4FXC A;  5H8Y E;  3NRZ A;  1XXG A;  3LXF A;  2PLP A;  3B9J A;  1CK1 A;  5LNK 1;  3B2G A;  4HRO A;  3AEA B;  1MHH E;  2KDM A;  3R8B A;  3IXS A;  4C56 C;  1MI0 A;  5FR3 A;  3SFD B;  2NTS A;  4USA A;  2WXQ A;  1IBX A;  1PUT A;  3BWU D;  1ZDX A;  2XN9 C;  2GI9 A;  3RPF C;  1ZXI A;  3MJ5 A;  3BYT B;  2KN4 A;  1D5X C;  3IT4 B;  3GB1 A;  3VR9 B;  4KKI A;  1Y56 A;  3NVZ A;  2PVO D;  2AX5 A;  4HKQ A;  3ZGZ A;  4YSX B;  2M19 A;  5HHD G;  1T6B X;  2JYE A;  1VLB A;  3AE8 B;  4RGM A;  2K5P A;  1TZO A;  2DLB A;  1XF5 L;  3NVY A;  1TKG A;  3HVD A;  4ZOH C;  4ZRP A;  1E0Z A;  1KF6 B;  1L0Y B;  3MFG A;  4L2Y A;  2N9K A;  2KWD A;  1NYQ A;  3E56 A;  1I4Q A;  1N5X A;  1E6E B;  1UUP A;  1WGK A;  2JSV X;  1JML A;  3NVV A;  3AE5 B;  5C2T B;  4A8X C;  1E7P B;  5D3I B;  2LHE A;  5EE3 A;  3EA6 A;  1ZE3 D;  3BVZ A;  2JXT A;  2DYM A;  1L4D B;  1QF6 A;  4ZYS A;  1R7S A;  4RGN A;  2AQ3 B;  2WXP A;  4MAC A;  2D5G A;  1LO5 D;  2I2Y A;  1A70 A;  1TJE A;  1PGA A;  4JPS A;  1ROE A;  2N7J A;  3R2T A;  5BMH A;  3ZJV A;  4ARI A;  3SR6 A;  1SSN A;  1MPE A;  2Y3A A;  3P63 A;  1YQ3 B;  2LJI A;  3VRA B;  1L5P A;  1NYR A;  4DXF A;  4OW0 A;  1TY0 A;  3AE7 B;  2WXF A;  1QKZ A;  1RFK A;  2BB5 A;  1AW7 A;  4TSS A;  3BK1 A;  2W3R A;  2FUG 1;  2M0A A;  2X38 A;  1GOZ A;  1YQ4 B;  1FMA D;  1GPX A;  1WXQ A;  4HKZ E;  3R2I A;  1FRD A;  1GAQ B;  1YMH E;  3AEE B;  3AEC B;  1V1O A;  1D4B A;  4YTM B;  3KWL A;  1SXT A;  2LUM A;  2QMT A;  1SB3 C;  2W54 A;  1VJK A;  4IKG A;  3P1M A;  2Y5C A;  2V3N A;  3U52 E;  4DQO C;  4AQ7 A;  1HQR D;  2NMQ A;  1I4P A;  4LLG M;  1TS4 A;  2W3S A;  3TUO A;  1F77 A;  4B0M A;  1OQR A;  1H7X A;  1PGB A;  4D2K A;  2FBW B;  4NJC A;  1KRH A;  1VZ6 A;  2ICI A;  2J52 A;  2WDQ B;  2IGH A;  3V05 A;  1WSP A;  1N5W A;  3FIL A;  2WXO A;  2IJ0 A;  1TY2 A;  1EU3 A;  1FNU A;  1B9R A;  1NVI D;  1TYG B;  3CF4 A;  4RGT A;  1E9M A;  1JWU D;  5G5G A;  3AB5 A;  2AQ2 B;  3SEB A;  3P4S B;  1N63 A;  1EU4 A;  2WXK A;  2DBY A;  4P6V F;  4XDC A;  1BUI C;  1I4X A;  2KAC A;  3I9V 1;  4JE3 B;  2N9L A;  3W9C B;  2MJ3 A;  5D7G A;  5FKA C;  1WWT A;  3AM9 A;  1L6V A;  4ZHP A;  2E3T A;  4REZ A;  5E6J A;  4YWG G;  1KLU D;  5BYQ A;  3TSS A;  3HRD D;  1V1P B;  1EWC A;  4L23 A;  1SIJ A;  4A55 A;  1FD6 A;  1JAL A;  1UWX A;  4WQM A;  1JRP A;  1C78 A;  3BK2 A;  4YSZ B;  5AUI A;  2N0S B;  4TMA B;  3FC4 A;  2L83 A;  3P4P B;  4IOI E;  5FK9 C;  2K0P A;  1SBB B;  1XLQ A;  2Y5P A;  3TEX A;  1IBX B;  1FFV A;  1IGD A;  1DGJ A;  3AEF B;  1KTK A;  2H89 B;  3O13 A;  2MJE A;  1QT9 A;  3E9S A;  3TEZ A;  3T3N A;  3PZ8 A;  3BVG A;  1J7C A;  3AE2 B;  1MVK A;  4O1N A;  1KFY B;  3AMZ A;  3LYY A;  1PYW D;  3GP7 A;  1FNV A;  1HZ6 A;  2YEP B;  3NVW A;  1B1Z A;  1ZDV A;  1C4P A;  1L0V B;  1SF0 A;  1V8C A;  2RDH A;  5AUK A;  1RYJ A;  2K9X A;  3WCQ A;  3Q8C A;  1XCQ L;  1VRA B;  2RMM A;  4IDI A;  4ZRQ A;  4C80 A;  2INP E;  1TS3 A;  1ESF A;  1WYG A;  3L4P A;  3DWG C;  1GB4 A;  2IGD A;  1K52 A;  1XLO A;  1FIQ A;  1JWB D;  4KGR A;  2E6X A;  4MT5 A;  2J53 A;  1YJJ A;  2G9H D;  2L32 A;  5HFY A;  1JWM D;  1YN5 A;  1T5X D;  3VQI A;  2CJO A;  4MM3 B;  3T3O A;  3TEY A;  3LB8 C;  3ZJU A;  2MJD A;  1H7W A;  3ETR A;  2QEJ C;  1SE3 A;  1K50 A;  1PGX A;  3CIR B;  1QLB B;  4NAW B;  1SE4 A;  2K22 A;  4J3O D;  1P7F A;  4HJG E;  3Q8B A;  2KAJ A;  4RF0 A;  2KQ4 X;  1ZPS A;  2EKI A;  2SEB D;  5TSS A;  2W55 A;  1C4A A;  4GDL B;  3U2S C;  1CQV A;  1MHX A;  3CWI A;  4OHJ A;  1ACC A;  2BYT A;  5I4D A;  1FNW A;  2WU2 B;  1QOG A;  4N59 A;  1M4V A;  1F2R C;  2WS3 B;  1FFU A;  3Q8A A;  1K51 A;  4RGO S;  1EM7 A;  2PMV A;  2LFI A;  2IPK D;  5BYS A;  4US9 A;  2TSS A;  1AN8 A;  4ZHO A;  3MP9 A;  1OFF A;  3AED B;  3V3X A;  4WIP A;  4H2A A;  1NEK B;  1QQR A;  1FCL A;  3PZ7 A;  2WXL A;  1I4R A;  3FIL B;  1I7H A;  1HA5 A;  2WXJ A;  3OWE B;  1PDX A;  1XCT L;  3AE9 B;  2WXI A;  3KWV A;  4LK0 M;  4WWM A;  2VZK D;  2PTL A;  1RM6 C;  1QOB A;  3W1S A;  2IGG A;  4LTU A;  3SFE B;  2BW2 A;  3NUH B;  5G5H A;  2JWU A;  5EE9 A;  1UNS A;  3H8H A;  2LGI A;  3KQ4 A;  1D6E C;  2RPV A;  4RF1 A;  1ZXH A;  1YJI A;  2LMC A;  3ZJT A;  1YN3 A;  2G1E A;  3B2F A;  1SJE D;  2BS4 B;  4TQ0 A;  1FCC C;  2JU6 X;  4P16 A;  2W82 A;  3BII D;  1DOY A;  2WNM A;  2BTE A;  2HTM E;  2M56 B;  3AE1 B;  2ZW1 A;  2LEK A;  3UI3 A;  2VZK B;  3Q8E A;  4A90 A;  2DWQ A;  2V4I B;  4ITK A;  2INN E;  2H88 B;  2PW9 A;  2MH7 A;  1VR9 A;  1QIL A;  3ZYY X;  3PO0 A;  2WDR B;  4XWT A;  4YT0 B;  1FXI A;  2SAK A;  3IT6 B;  4KGS A;  1XEE A;  1TKE A;  2RDG A;  4GDK B;  5C3J B;  3AE4 B;  1C79 A;  2KMM A;  3VR8 B;  4M0W A;  1I4G A;  1DYQ A;  1V1P A;  4XWW A;  3FAH A;  1CJE A;  4JWS C;  4JX1 C;  4XE0 A;  3P42 A;  2WXM A;  1BML C;  1JWS D;  2WXH A;  2HDE A;  3ABV B;  1ET9 A;  3IAS 1;  4NAM A;  3BZD B;  2BS3 B;  4MH8 A;  2OED A;  1NEN B;  1C4C A;  4YXD B;  1C9F A;  3C8Y A;  1D5Z C;  5BYR A;  4YSY B;  3P4Q B;  1ET6 A;  1ZP0 B;  2WDV B;  3MHZ A;  2JX5 A;  3HVZ A;  1XLP A;  1IGC A;  4L1B A;  2B76 B;  4UDU C;  1TS2 A;  1SJH D;  3EUB 2;  4RCO A;  3BVM A;  1V97 A;  1L4Z B;  2IDY A;  5BMG A;  1HZ5 A;  1SE2 A;  1FM0 D;  1JCK B;  2BT6 A;  1JW9 D;  1JRO A;  4WAF A;  2AQ1 B;  4YTN B;  4HEA 1;  2LHD A;  4GLS C;  5HI1 A;  1K53 A;  3AE6 B;  2L52 A;  2NTT A;  1L6U A;  4RFB A;  4AS1 A;  1N61 A;  2YEP F;  3HUI A;  3URY A;  4PT5 A;  2WQY B;  2XNA C;  2BB6 A;  1OQQ A;  5D3D A;  2CJN A;  1ZOY B;  4KGT A;  4RH6 A;  3MC0 B;  3EGR A;  3ZQ4 A;  2L1A A;  1AYF A;  4CQN A;  3NS1 A;  4JWU C;  1TKY A;  2I38 A;  3U7Z A;  1RWS A;  2V3P A;  1GT8 A;  1JWA D;  3N9Y C;  2ACZ B;  1KLG D;  2K3U A;  1P7E A;  1DOI A;  3VRB B;  1TS5 A;  2MEK A;  1F2R I;  1XO3 A;  1F0Z A;  1PFD A;  2PIA A;  2PVG C;  1SEB D;  1N62 A;  2JZP A;  4N58 A;  4XDD A;  1C76 A;  3AN1 A;  2CU3 A;  2WXG A;  4OZB A;  1XLN A;  1BXT A;  2V0G A;  5H92 C;  1UWM A;  1EWY C;  2WXR A;  1ZUD 2;  4B0E A;  1CZP A;  1FRR A;  2QSD A;  1N60 A;  2J42 A;  1JQ4 A;  3NZ3 A;  2WU5 B;  1AWD A;  4NZL B;  5EE0 A;  1STE A;  1UGJ A;  2Z8L A;  2OHF A;  3TEW A;  1J7A A;  2FE8 A;  3RFZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...