4YTNB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title New Insights into the Design of Inhibitors Targeted for Parasitic Anaerobic Energy Metabolism
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 61
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ytnB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ytnB01
1JW9D 3NVZA 2W55A 4IDIA 1WXQA 1WYGA 1FM0D 1GTEA 2ACZB 4US9A 4US8A 4YTNB 4YSYB 3AN1A 1OQQA 3AH7A 1E0ZA 2CJOA 5AUKA 2HTME 3NS1A 3AE8B 3CIRB 2PVOD 3LB8C 4C7ZA 1WGKA 4HROA 3AE3B 1QT9A 1YQ3B 1AWDA 1J7BA 1QOGA 1JRPA 1DOXA 1JQ4A 4ZHOA 4ZHPA 1XLPA 1OFFA 1QOBA 1L6VA 1SB3C 3PO0A 1R7SA 2MJ3A 3AE5B 3AEEB 3DWGC 3B9JA 1FXIA 1V97A 1NEKB 3ABVB 2PVGC 1KF6B 2QJLA 1RWSA 1PDXA 1SF0A 3AM9A 3HUIA 1H7WA 2L83A 3AE7B 3AE9B 2H89B 3AEGB 1N5XA 1TKEA 2MJDA 3BIID 4JWUC 2K22A 3ETRA 3B2FA 3NVYA 3VR8B 2WP9B 1FIQA 2Y5CA 3AB5A 2WU5B 4KX6B 1A70A 1I7HA 3HVZA 5EE0A 3CF4A 1DOIA 1FO4A 1YJIA 3AEBB 3L4PA 4ITKA 1QLBB 3AE4B 2M56B 2MH7A 2E3TA 4JX1C 1FFVA 1ZOYB 2DWQA 4C7YA 1JROA 1YQ4B 1YJJA 5EE9A 5C2TB 4YSZB 1TYGB 3AV8A 2W54A 3W9CB 2B76B 2AX5A 5EE3A 2M19A 1F0ZA 2W3RA 1RFKA 3NVVA 1AYFA 1GT8A 4A9AA 1GAQB 3CWIA 1EWYC 2KMMA 5C3JB 3W5UB 4FXCA 1IUEA 3P4SB 1KFYB 3SFDB 3B2GA 1UWMA 2FBWB 2K5PA 3RPFC 3AMZA 2L52A 1JALA 4LTUA 1T3QA 1CJEA 1XLOA 2OHFA 1GPXA 2DBYA 3AE1B 4YXDB 1E10A 2BS3B 1PUTA 5AUIA 1VDVA 1QF6A 1FMAD 3AE2B 2CU3A 3NRZA 1DOYA 3AEDB 1L0VB 1RM6C 1VJKA 1NI3A 5EE1A 1FRRA 4YTPB 3SR6A 2PIAA 2G1EA 3P4QB 5G5GA 3P63A 3AECB 1XO3A 1DGJA 1ROEA 3NVWA 1N5WA 2LEKA 2QIEB 3FC4A 2BS2B 3VR9B 2BT6A 1E9MA 5MPOA 1JWBD 1TKGA 2BS4B 3P1MA 2K9XA 2MJEA 1J7CA 1E6EB 2JX5A 3KWLA 2W3SA 1E7PB 3SFEB 4WQMA 5H8YE 2WQYB 1H7XA 2WU2B 1TJEA 2JQRB 2N0SB 5G5HA 1NVID 1VLBA 4N59A 1TKYA 4YSXB 2WS3B 1JWAD 1FRDA 1KRHA 1CZPA 1N63A 4YTMB 2H88B 1N61A 1OQRA 1XLNA 3P4RB 2WDQB 1L6UA 1N60A 4N58A 5GXGB 3WCQA 1ZXIA 1PFDA 2CJNA 1ZUD2 4YT0B 3EUB2 3ZYYX 2EKIA 1WWTA 1B9RA 3VRAB 3W5VB 2Q5WD 3VRBB 1QOFA 1FXAA 1WRIA 1QOAA 4USAA 4HRSA 3AEFB 2KAJA 3AEAB 5H92C 1RYJA 1FFUA 2PKOA 1SIJA 2WLBA 1V8CA 3LXFA 1NYRA 3DWMA 1NYQA 1NENB 4WWMA 4N6EB 1N62A 1GTHA 2WDVB 2WDRB 1L5PA 3P4PB 3FAHA 4JWSC 4ZOHC 3HRDD 4P6VF 1ZP0B 4C80A 1J7AA 1XLQA 3AE6B
chains in the Genus database with same CATH superfamily
1JW9D 4ZRKA 3VVWB 2GBJA 1FM0D 4J6IA 2AL6A 4US9A 4HCNB 4YSYB 2ONQA 3VAWA 2LWPA 1L7YA 3V05A 3ZTDA 3MJ5A 3CMMB 3I9V1 1OFFA 3PO0A 2JSVX 2RMMA 4G3XB 2L0TA 2WYQA 3ZNHB 1UH6A 2IYDB 3MC8A 4DQOC 2Y5PA 3PHXB 3AE4B 4JX1C 2MH7A 5LNK1 2RDBC 1MVKA 1YJ1A 4HPMB 2Y5BB 4NNJB 2JWUA 1FEHA 2WX1A 3CWIA 1IUEA 4WJNA 1KFYB 2KNBA 3B2GA 2IY1B 4DHJD 5HHDG 2I38A 3A9JA 2KQ7A 3PZDA 2IGGA 1D5MC 3BYTB 2HE7A 1WJNA 4FBJB 5EE1A 2KMAA 4I6PA 1FRRA 2D3BA 5HI1A 2K39A 1GB1A 3AECB 2LEKA 1UF0A 1SE9A 2C9WB 2XBBC 2V4LA 3FC4A 3QJZA 5L95C 4TSSA 1V2YA 2KANA 3L16A 3ZJVA 2Z0DB 4GSWA 3N3KB 2RDGA 4ARCA 5IOIA 3PRPB 4AWJA 1ET6A 4WJOA 1OQRA 3BWUD 2MQJA 4ZDVA 4HPPA 4GIVA 3ZJTA 2KJRA 4DHJB 3GB1A 4HRSA 2BYVE 4WURA 1EWCA 3DWMA 1NYQA 2KJ6A 3EC8A 3PPAA 2SEBD 5EDSA 3KUZA 1WX9A 5E6NA 2OJWA 3AH7A 5FR6A 1E0ZA 3LB8C 1ET9A 3VDZA 1YQ3B 1V1PB 2V3PA 4X57B 4IWQA 2ICIA 1SB3C 4FHJA 3B9JA 3DPDA 1OEYJ 1Y56A 3U52E 4R3DA 1V81A 3WAMA 4NQKE 4PYUA 4KDIC 2JXTA 2VRRB 1IYFA 4W9FA 4P7IA 2GBKA 5AEKB 2CKHB 5C3JB 4PS7A 3LJ3A 2FIDA 1WF9A 3Q6BA 4IM0A 2XEWA 4II3B 2CU3A 1Z5SB 5CTRC 5E6PA 3DVNV 4YTPB 3DBHI 2L0FA 1UUPA 4GB9A 2L3ZA 4FULA 1RAXA 2C5LC 2K6QA 3HK0A 1ZPSA 3V3XA 5AZHA 2NTSA 4LDTD 1MI0A 1PGBA 4N59A 2MBEA 1M94A 4P1BC 1L0XB 2WXQA 3A9KA 3AI5A 1F9JA 1B9RA 4WJQA 3VRAB 4IM2A 1E8XA 1I4RA 3I3TB 2L1AA 4RGOS 2NBVB 3O65B 3A1QB 5BMHA 1IPGA 1ZE3D 1TY2A 4IDIA 1WXQA 1WYGA 4US8A 1F2RI 4HK2A 4S0RA 3FILA 5AZGA 4HROA 3AE3B 3NY5A 5HFYA 3W1SC 1UGJA 4EZKA 2MJ3A 2L7RA 3ABVB 3NZSA 1XEEA 2QJLA 1KF6B 4DK5A 1UZXB 4LDTB 3AXCA 2BWFA 3QARA 2KFJA 1JRUA 1HE8A 4A6QA 2WU5B 1YN4A 3ENEA 4KZCA 3VQIA 3WAPA 5C2TB 1TYGB 1AN8A 2FUG1 3RNGC 2KACA 3NVVA 3IT6B 5IKCM 1WH3A 4LTUA 2WXLA 3W2DA 2JF5A 4A55A 3DBRB 1E10A 1V5TA 1UWXA 1FMAD 2L05A 3AE2B 1BXTA 3U30A 3QWZB 3X0WA 3ALBA 4TQ1A 2YLMA 3T9LA 1SE2A 2QIEB 5JHBA 1R4MI 3PRZA 1E90A 1SBBB 2WXKA 4CO7A 3HVDA 1UD7A 4FJYA 2LI5A 2A5UA 2DNFA 3IVFA 1CMXB 5GXGB 1PFDA 1YX5B 1QZEA 3EUB2 2D3CA 2D10A 3S2AA 1FXAA 2MBOA 3R2IA 2CS4A 1YQBA 2WDRB 2OEDA 3P4PB 1GJZA 1NI2A 3GE8C 3V62A 1GTEA 1PGXA 2MBHA 4DDID 1XCTL 1OQQA 2V0GA 2KDMA 1QKZA 3N1YC 4GU2A 2KTRA 3CSFA 3ZNZB 2GOWA 1WI0A 3ZIMA 4E3CA 2O6VD 2XNAC 1T6BX 3VTUA 4NJCA 2RPQA 3ML9A 2LXAA 2ZNVC 4GOCA 1ACCA 2MEKA 2NVUI 1HTOA 2NR2A 3AEBB 4KGTA 2M56B 3ZLZA 4MGKE 2WXMA 5D2MB 2BVCA 4NJ7A 4IWPA 4NAWA 4E71A 4WIPA 2M1MA 2K8HA 4E74A 2FBWB 2K8CA 1F52A 4XE0A 2D2QA 2N9LA 2N7JA 1GC6A 1SGHA 1DOYA 5GMVA 1VR9A 1IBXA 1TS3A 2JRHA 3N9YC 3MHZA 2G4DB 3OLMD 2KKCA 1VRAB 2FUHB 2O6VB 1L0YB 4EKUA 2G4SA 2W82A 4M01A 1WMHB 3Q14C 2IBIB 2JQRB 3LDZE 4C4VA 3ZJUA 4YSXB 2DLBA 2QDFA 1T5XD 1JWUD 2WDQB 3RCZA 3TCAA 4K3BA 2ZEQA 3PZ8A 4ZRJA 1C4AA 4LCDE 2MP2A 5IA7A 1YN5A 3SU8X 1QOAA 4G0NB 1LM8B 4ZRIA 2UWQA 2GB1A 2LVQA 4IKGA 5KHQA 1WXAA 4I6NB 3ZXRA 1NDDA 1C3TA 2V3NA 1XD3B 3B0AA 3L08A 1CK1A 1SSNA 3IG3A 1HZ6A 1J8CA 3OWEB 4M00A 3AE5B 3AEEB 3KVFB 4EUTA 2JUOA 3AM9A 1HA5A 3AE9B 2R61A 3BIID 4HKQA 4CYEA 3ZW3A 1FIQA 4ICUA 3VFKA 3VTWA 1DOIA 1WM2A 1YJIA 1LXDA 2IPKD 3L4PA 4ANXA 4XC2A 4C00A 2N4FA 3JYUA 1KLVA 4IG7B 3SDLC 2W3RA 3RD2A 1EWYC 3QA8A 2JRIB 2PEAA 3QQ8B 1GPXA 1WIAA 2WWZA 4MDKE 1NI3A 5D94A 5FR3A 2KC1A 1ROEA 3GZNB 2M17A 1V49A 5DPRA 2ZNVB 3A4RA 4FLHA 1OGWA 1TKGA 3P1MA 3VXWA 1EU4A 1J7CA 1E7VA 3VH3B 2G3QB 3R7RA 4BKSD 1GUAB 3IT4B 4A20A 3L10B 1VCBA 3QHTA 4W9JA 3ZYYX 2GLSA 2NPTA 4RF1A 1R4NB 4BZAA 5J18A 4P16A 2KFKB 4EE2A 1V80A 4EFOA 3ZNGC 2WX0A 1STEA 3FAHA 1X1MA 4KV2A 2TSSA 1UNSA 4TMAB 2MP2B 4IC7B 4ZYNA 3NZUA 1WX8A 3NS1A 4C7ZA 3V60A 2IO3B 2IZVB 5L83A 2C60A 4XYCA 1BUIC 3VHTC 4K7SA 3MJWA 1FPYA 1Z2MA 4HCPB 1V1PA 2KHWB 3L13A 3PTFC 3DQVA 2AQ1B 4WAAA 1YQ4B 3W9CB 1YX6B 1AYFA 4KZ0A 4OZBA 2AL3A 2RSUA 3B1LX 3RNCC 1BT0A 1WZ0A 4FXCA 1UWMA 2K1FA 2BS3B 3TL5A 3Q8BA 3APDA 2NTTA 4MSQB 4KSLC 4RM8A 1XT9B 4LNNA 4GDLB 3EGRA 2MBQA 4RM9A 3QCAA 4BOSC 4K81A 2WU2B 2J0JA 3JSVB 1VLBA 1JWAD 3KLSX 1F77A 1KRHA 1BMLC 2O2VB 1WGDA 2PTLA 2GBRA 1MFWA 5IO9A 4DHZB 2KK8A 4PS8A 1TS2A 4BFRA 2IJ0A 3Q8AA 2JXXA 1SIJA 2IO1B 3SEBA 3U7ZA 1N62A 3HRDD 3NS8A 3NVZA 2NPTB 4BVUC 4GLSC 4KKIA 1J0GA 3A1QA 1MHXA 1TS5A 2JYEA 4OZCA 3RZWC 1D5ZC 1AWDA 1QOGA 1YNTE 3PS6A 4MGZE 2LGXA 1TTNA 3BVZA 1SF0A 5CHVC 4PK1A 1H7WA 2LRUA 1N5XA 2WP9B 2KDEB 1A70A 3A33B 3RFZB 3Q3MC 3RT3B 5BO4B 1JROA 2C7MB 3WANA 3AULA 4CHKA 5D3IB 2LGSA 1RFKA 2MA9B 1GT8A 1GAQB 1UGMA 4MJSA 3TSSA 1TZ1A 2G9HD 3GOEA 4ASWC 2D07B 4NJ6A 4CQNA 1AW7A 4B6WA 2KWDA 2BYEA 2ZZPB 3TEWA 1XCQL 1VD2A 2EMSA 4IM3A 2KQ4X 5HKHA 4DWFA 4MGIE 3JVZX 1D4BA 5KHOA 1P0RA 3RI7C 4JQWC 1IGDA 2NMQA 1P9DU 4JPSA 1E8WA 3ZNID 2BT6A 4AQ7A 2GBNA 4TKNA 2DYBA 2IGDA 3OG5A 3SFEB 3R7QA 1TJEA 5I4DA 3DBRI 2ASQA 3WAOA 3DBLB 4YTMB 3K9OB 2YEPF 4C56C 2ZCBA 1GB4A 3GS2A 4W9LA 1EU3A 2MCNB 5G2NA 2WXOA 2D11A 2WXIA 4WWNA 3IXSA 3DVGY 5BYQA 1K50A 1C4CA 2WDVB 1L5PA 1VZ7A 3PLUA 2FIFA 3AE6B 2ZPNA 1HXYD 2KTFA 5AUKA 3ECIA 3CIRB 2DZKA 1L6VA 3BY4B 3C19A 1PDXA 2WXJA 1M4VA 4RFBA 1WX7A 4LNFA 4NPNA 3AB5A 4KSKC 3Q8FA 2LVOA 3WA0A 3P42A 3RUIB 1YJJA 2L76A 2B76B 4PYZA 1YIWA 2VH2A 4QAYA 3H7PB 3PLVA 4A9AA 5CX3A 2YVCA 1G6JA 3N32A 1WXVA 1EM7A 4GMVA 3Q3NC 1QQRA 2KDIA 4HJGE 2OHFA 4YXDB 4A90A 3H9DA 4W9EA 5AUIA 2LASA 3UF8A 4MJSB 1VJKA 2IO0B 4JE3B 2KC2A 1Q0WB 2BPSA 2GMIC 3RULA 1LFDA 3U2SC 2KX3A 5BYSA 3W1SA 3KWLA 1E7PB 1WR6E 3HM3A 1GC7A 1WYWB 2I1JA 4W9GA 2O6VA 3QAQA 4NAMA 4WJPA 2KLCA 2KXJA 1N61A 3EECA 5IAAC 1PGAA 5BYRA 1WMHA 5LXIB 3VUXA 2A4ZA 3W5VB 4WAFA 2DHZA 1RYJA 1MG4A 1V8CA 3UI3A 2AQ2B 5HG2A 4GDKB 4WWPA 2INDC 1ZP0B 3ZVVA 1EO6A 4LNIA 1P98A 3URYA 4IW0A 4XWTA 1J7BA 1JQ4A 2PE6B 1QOBA 3UQBA 2I2YA 3MC0B 2J52A 2L8JA 4MH0E 1S3SG 1I7HA 3TIXA 1K53A 3DVGX 3IFWB 3UIPB 2N1VA 4BKTA 4YSZB 2W54A 1KH0A 3W1YA 2AYOB 4F7ZA 4HWIB 2AQ3B 3R3MA 2DZMA 4OVUA 3RPFC 2LMCA 5JHAA 2ZPYA 1XLOA 4IWOA 1TZOA 3DOWA 3UINB 3MHSD 5IP4D 1KLGD 1DYQA 3SD5A 2JT4B 1WJ4A 1WGHA 5E6JA 1GG3A 2G1EA 1GNUA 2KN5A 3OJ3A 2LJIA 2JU6X 5E6OA 1FXTB 4AJYB 4MM3B 2Z8LA 2N9KA 2ZCCA 3N1XC 2NS5A 4S17A 1E8YA 4K3CA 1ZW7A 3RMKC 2RD0A 2FCQA 1TY0A 3HHMA 4YT0B 2N9EB 2EKIA 2R2QA 3PSEB 3GZNI 2CU1A 4RH6A 3L54A 2PKOA 3LXFA 1NYRA 1I4PA 1RFAA 2KQSA 2W55A 4JIOU 2G45B 2KFKA 3R2TA 1E5WA 4RCOA 3AN1A 2CJOA 3KH0A 3AE8B 2PVOD 3Q8CA 4DBGA 2HJ1A 4YWGG 1TBEA 2KN4A 4MEMA 1R4MB 2ZW1A 1R4NI 3UGBB 1NEKB 2LGIA 1K52A 3WIMA 1TKEA 3B2FA 4DHZE 4EOYA 4KX6B 2ON8A 3T3NA 1FFVA 3ZO5B 4BKSA 3D32A 3ZKJC 5EE9A 4FJZA 2MX2A 5TSSA 3M3JA 2J0KA 1AARA 4BAXA 3W5UB 1L4ZB 4ZRPA 2QC8A 2J0MA 4M02A 4LLGM 1A5RA 2DBYA 3ZRFA 3HIZA 1CQVA 4L1BA 3NRZA 1C79A 1SJED 3RYTA 2YEPB 2PIAA 3IAS1 3TEXA 3NVWA 4AOFA 2WXHA 3TJPA 2BGFA 4TUUA 4TV3A 1C78A 4KIKB 1UBQA 4FADA 5DPWA 1LGRA 4II2B 2PLPA 4WQMA 4BBNC 5H8YE 2WQYB 4G50A 3DDCB 2INNE 2NBWB 3M62B 2N0SB 1SE3A 1E8ZA 4HDQA 4GDLA 3A4SC 3NOBA 2VH1A 2EMTA 1OTRB 2H88B 1EF1A 5C1ZA 3AU5A 3K9PB 1ZXIA 1PQSA 3JSVA 1YN3A 3UIOB 1ZGUB 1WY8A 1L4DB 1QOFA 2M8SA 3V6EB 2O2VA 4USAA 1FFUA 4A8XC 1D6EC 2BYFA 3EFCA 4ZOHC 1FNWA 5FK9C 1XLQA 2V9HA 4M0WB 1WGKA 2AWTA 2L00B 4NZLB 4ZHOA 1XLPA 3C0RB 1R7SA 4EZLA 3RNFC 2QILA 2LD9A 3APFA 1RWSA 5FKAC 2MRPA 2MHJA 2KLGA 2L83A 3NHEB 1EUVB 3H6NA 3IHPC 2MWSB 1YOVB 3KUCB 3ZRCA 1SE4A 3KQ4A 4PS3A 3TUOA 3CF4A 4B95A 4F1SA 2DYOA 3NZ3A 3MTNB 5JZEB 5DPTA 3WALA 2LGYA 2LHDA 1WGGA 2M19A 4KKJA 3H1UA 2J53A 1V9JA 3QIJA 1I4HA 2BWES 4UDUC 3CF6E 3PREA 2Z59B 2L52A 2KJHB 2UYZB 2WXPA 1PUTA 4HPLB 3KYCD 3DHGC 1RM6C 1RLFA 2JZPA 2BTEA 3P4QB 5G5GA 1WXSA 2FE8A 3X23A 1EF5A 5J17A 2IGHA 3VR9B 1E7UA 1K51A 2JY6A 1E6EB 2J4XA 3RNAC 2K8BA 4KGSA 4FHKA 5CHFA 1I42A 1FRDA 1NBFC 2HD5B 4KGRA 3N30A 4N58A 2KMCA 2BW2A 3IAM1 2DZIA 2VZKD 3IBEA 3Q3FA 1C77A 2INPE 1I35A 2QMTA 2BQQA 4KDLB 2KWUB 1K8RB 1TGZB 3BK1A 1C76A 2FCNA 3M63B 4M8MA 1J7AA 1ZUD2 2MBBB 4XGAB 4GN1A 1OEYA 3DBLI 2HTME 4WWOA 1MHHE 4P1CC 3O13A 1ISNA 2JPHA 4ZHPA 1TS4A 2BBCA 2AEHA 2LVPA 3Q8EA 2PVGC 2KWCA 4HVBA 1RRBA 3Q69A 1WXMA 3AU4A 1HTQA 2NBUA 3HUIA 2WDTB 2H89B 2LJ5A 4XX5A 2DAJA 1WGRA 3J9CA 3VR8B 2WNMA 3T8MA 1TT5B 2KDFB 4HJKA 4ITKA 4C7YA 4JL9A 1ZXHA 3I63C 4MH8A 2VZKB 2AX5A 1N6ZA 3EA6A 2OJRA 2QSDA 1T0YA 5DCNA 3SFDB 3H7SA 2HJ8A 3AMZA 2FAZA 4TQ0A 2JZZA 1Q5WB 3AE1B 3H7PA 1KLUD 5J2RA 4B0EA 2JWZA 4OW0A 1Y8RC 4N9F4 2N9PC 2KZRA 3SR6A 3RNEC 1WM3A 2DYMA 3P63A 1XO3A 3ZDTA 5D7GA 1J19A 1P1AA 1JCKB 3TBLD 2BKRB 3T3OA 2J7QB 1JWBD 2JX5A 2M4NA 2W3SA 4O1NA 5BMIA 3MC9A 1ENFA 5D6JB 4FN2A 3PV1A 1CZPA 4A3OA 3Q2AC 2Y3AA 3P4RB 2E6XA 3OAWA 4RNAA 2KVZA 1L6UA 2KWVB 1C1YB 4LK0M 3WCQA 4DXFA 2V3SA 3V61A 1SJHD 1Q10A 1WRIA 2MW5A 4ICVA 2X38A 1HEZE 2N7DA 3RZFA 4JWSC 2KDBA 2W9NA 2PE9A 4JGHB 2MLBA 4MGYE 4YTNB 3R8BA 3UQAA 2REXA 1IGCA 3N20C 2ZJDA 4GDKA 2K0PA 4HKZE 4AP4C 2D5GA 1JRPA 1KM7A 2LUEA 5IN7A 4K7UA 2K6DB 4L23A 3DWGC 2WXNA 1V1OA 1HQRD 3ML8A 1FD6A 3GE3C 4EZJA 4LJOB 4BOZB 4EEWA 5EE3A 1F2RC 3A9JB 3P4SB 1PYWD 1P7FA 3NJTA 1WRDB 1H4RA 1JALA 3TEYA 1OQYA 2DENB 2NCNA 2PJHA 4OHJA 1F1HA 3AEDB 1L0VB 2FCMA 4ANUA 2BYTA 1L2NA 5C23A 1I4XA 3JW0X 1N5WA 2BB6A 2CHXA 2BS2B 1WZ3A 2WXFA 2JVCA 1ZKHA 3DCGA 4RF0A 2K9XA 2D3GA 2MJEA 5D3DA 3GP7A 4MM3A 1TKYA 2K3UA 5CHWA 1WR1A 1N63A 2R2OA 1N60A 4W9CA 3L17A 4IUMB 2Q5WD 3VRBB 3PZ7A 2KOXA 4L2YA 3PHWB 2LRWA 1I4QA 1JWSD 1NENB 2RGFA 2LUMA 4P6VF 2DAFA 2N9XA 4C80A 2WGSA 2LXCA 2ACZB 2Z0EB 3BVGA 4IOIE 1C4PA 4B9KA 1XQQA 1QT9A 3VH4B 4XDDA 2C7NB 1FNVA 2BKFA 1DOXA 5T8IA 3I5JC 4JLCA 3APCA 2ZVNA 1WJ6A 3AE7B 2LHEA 2MJDA 2DX5B 3ETRA 2RR9A 1T0QC 3HVZA 1XF5L 3DBHB 4NQLB 2ZW0A 2INCC 3LYYA 5BMGA 2D3AA 4LNOA 3CSTA 1JMLA 3ZXVA 1FCLA 2FNJB 3PRMB 2PMVA 2QEJC 3EFUA 4DDGD 5DPSA 4I6LB 3U4EG 1QF6A 4FA6A 2QCZA 2J42A 3ONSA 1UELA 4F8CB 1KTKA 2KVRA 5G55A 3U8ZA 1MJDA 2JZ3B 2N7EA 3R66C 1DGJA 4BBNF 3NUHB 2WXGA 3MP9A 5MPOA 2GBMA 1V5OA 3A9KB 1KOTA 1D5XC 3BYYB 1NVID 4KIKA 2WS3B 3VUYA 1T0RC 2KO3A 1FNUA 4DXAB 2CJNA 1S1QB 1WWTA 2OOBB 2HTHA 2CHZA 2KD0A 2ZVOA 4W9HA 1H8CA 2N1WA 4WQOB 3AEAB 1D3ZA 3FILB 4WWMA 4N6EB 1T0SC 4Q2JA 1GTHA 3PVLA 2K5PA 2EKEC 4AJWA 3DVNU 1KJTA 3PT2B 4HEA1 3V6CB 1WE7A 4J3OD 3ZGZA 4LNKA 4HLEA 1WSPA 2KX0A 5JH5C 4M0WA 1B1ZA 2CHWA 1WE6A 5AZFA 2K22A 1P7EA 3NVYA 1MG8A 1MPEA 1FO4A 1IP9A 4ZRQA 1QLBB 3BK2A 3KW5B 2JYTA 1P3QU 1HZ5A 3AV8A 3PGEA 4ANWA 3QC8B 4GXBA 1FCCC 1ZDXA 2XK5A 3C8YA 3KUDB 4ACFA 1T3QA 1CJEA 3ZDMC 3E56A 4REZA 4URKA 2BF8B 4RGMA 1U4AA 2FCSA 4W9IA 4RGNA 2DZJA 3I57A 2B3AA 3EHVA 1V6EA 2WHIA 2I1KA 3SHQA 2IO2B 3HM6X 3TMPB 3RN9C 2QHOA 1YD8U 2PPHA 1E9MA 3NG0A 1JWMD 4ARIA 3DBSA 4MELA 5LXHA 4D2KA 3TEZA 3B08A 4ZYSA 3N1ZC 2RDHA 3U7DA 4DXGA 3Q3JA 4OZAA 1VZ6A 3L0WB 4ANVA 2LGDA 3QX1A 3BINA 3KWVA 4W9DA 2M0AA 3AEFB 2KAJA 5H92C 1WGYA 3P2BA 4BKGA 3MFGA 3BVMA 2BB5A 2HDEA 3E9SA 2KTRB 2LZ6A 2IDYA 2K25A 4XDCA 3FKYA 1GOZA 3Q3OC 1WJUA 2M0XA 4AS1A 2KT7A 1LO5D 4HDOA 3QK0A 2V4IB 1SIFA 1FXIA 1V97A 2PW9A 2RPVA 1ZDVA 4XZ4A 3AEGB 4JWUC 4NAWB 4NY0A 2Y5CA 1XXGA 4M8NA 3OJ4B 5EE0A 4YL8A 4W9KA 1YMHE 2E3TA 4PT5A 1ZOYB 2DWQA 1LQBA 5TR5A 5JXVA 3H8HA 1F0ZA 4AUQC 4KVGB 3VTVA 2KMMA 3ZUNA 4MT5A 4GGQA 4HXDA 1IBXB 3VUWA 2IY0B 3M95A 2UU7A 2C7HA 4MSMB 3ZTCA 4OVZA 2GRIA 1VDVA 2EELA 4G11A 4WH4A 4H2AA 2V1YA 2XK5B 1Q1OA 1VZ8A 4C4VB 2L32A 2XN9C 1SEBD 4B0MA 2SAKA 4K7WA 1I4GA 4RMAA 2BS4B 3DHHC 2KYWA 4RGTA 5LLIA 2CR5A 2MSED 4MACA 1H7XA 1SXTA 3DHIC 5G5HA 4FJVB 2X8XX 3BZDB 1XLNA 4OVVA 1UBIA 1TIFA 4K1RB 2GI9A 1C9FA 2LFIA 1QILA 4XWWA 3ZQ4A 4A3PA 1V86A 1ESFA 2WXRA 2WLBA 3RNBC 3KYDD 4LJPB 1WFYA
chains in the Genus database with same CATH topology
1JW9D 1FM0D 4US9A 4YTNB 4YSYB 3R8BA 2ONQA 2V3NA 4IKGA 3URYA 3V05A 1IGCA 4XWTA 1CK1A 1SSNA 2K0PA 4HKZE 1HZ6A 3MJ5A 1J7BA 2D5GA 1JRPA 3I9V1 1JQ4A 3OWEB 1OFFA 1QOBA 3PO0A 2I2YA 2JSVX 2RMMA 3AE5B 3AEEB 2J52A 3MC0B 3DWGC 4L23A 2WXNA 3AM9A 1HA5A 1V1OA 3AE9B 2R61A 3BIID 1HQRD 4HKQA 1FD6A 1FIQA 4DQOC 2Y5PA 1I7HA 1DOIA 1YJIA 1K53A 2IPKD 3L4PA 3AE4B 4JX1C 2MH7A 5LNK1 1MVKA 4YSZB 2W54A 1KH0A 5EE3A 1F2RC 2W3RA 2JWUA 1FEHA 2AQ3B 3CWIA 1EWYC 1IUEA 3P4SB 1PYWD 1KFYB 1P7FA 3B2GA 3RPFC 2LMCA 1JALA 3TEYA 5HHDG 1XLOA 2I38A 1GPXA 1TZOA 2IGGA 1KLGD 1D5MC 3BYTB 1DYQA 4OHJA 3AEDB 1L0VB 5EE1A 1NI3A 5E6JA 1FRRA 2BYTA 5HI1A 1GB1A 2G1EA 3AECB 1I4XA 5FR3A 1ROEA 2LJIA 2JU6X 1N5WA 2LEKA 2BB6A 3FC4A 2Z8LA 2BS2B 2N9KA 4MM3B 2WXFA 1TKGA 3P1MA 4RF0A 2K9XA 1EU4A 4TSSA 2MJEA 1J7CA 3ZJVA 2RDGA 5D3DA 3IT4B 4ARCA 3GP7A 1TKYA 2K3UA 1ET6A 1N63A 1OQRA 3BWUD 1N60A 1TY0A 4YT0B 3ZYYX 2EKIA 4RF1A 2Q5WD 3ZJTA 4P16A 3VRBB 3PZ7A 4L2YA 4EE2A 4RH6A 3GB1A 4HRSA 4WURA 1I4QA 2PKOA 1EWCA 3LXFA 1JWSD 1NYRA 1NYQA 1NENB 3DWMA 2LUMA 1STEA 3FAHA 1I4PA 2SEBD 4P6VF 4C80A 2W55A 2TSSA 1UNSA 4TMAB 3R2TA 2ACZB 4RCOA 3AN1A 3AH7A 1E0ZA 2CJOA 3BVGA 3NS1A 3AE8B 2PVOD 4IOIE 1C4PA 3LB8C 4C7ZA 1ET9A 1QT9A 3Q8CA 1YQ3B 1V1PB 2V3PA 4XDDA 1FNVA 4YWGG 1DOXA 2KN4A 2ICIA 1SB3C 2ZW1A 5T8IA 1BUIC 3B9JA 1NEKB 2LGIA 1K52A 3AE7B 1TKEA 2LHEA 2MJDA 1V1PA 3ETRA 3B2FA 1Y56A 3U52E 4KX6B 2ON8A 3HVZA 4R3DA 1XF5L 2AQ1B 3T3NA 1FFVA 2ZW0A 1YQ4B 5EE9A 3LYYA 2JXTA 5BMGA 3W9CB 1AYFA 5TSSA 1JMLA 4OZBA 1FCLA 5C3JB 3W5UB 4FXCA 1L4ZB 2PMVA 4ZRPA 2QEJC 1UWMA 4LLGM 2DBYA 2BS3B 3U4EG 1QF6A 1CQVA 4L1BA 2CU3A 3NRZA 2J42A 1C79A 1SJED 4YTPB 1KTKA 3Q8BA 2YEPB 2PIAA 3IAS1 3TEXA 1DGJA 1UUPA 3NVWA 2NTTA 2WXHA 3NUHB 1C78A 2WXGA 4GDLB 3EGRA 3MP9A 5MPOA 1ZPSA 2PLPA 4WQMA 3V3XA 2NTSA 5H8YE 2WQYB 2WU2B 2INNE 1D5XC 2N0SB 1SE3A 1NVID 1MI0A 1PGBA 1VLBA 3BYYB 4N59A 2WS3B 1JWAD 3KLSX 1F77A 1KRHA 2H88B 1BMLC 2PTLA 1FNUA 1ZXIA 2CJNA 1L0XB 2WXQA 1WWTA 1B9RA 1YN3A 3VRAB 1I4RA 1TS2A 1L4DB 1QOFA 2L1AA 2IJ0A 4RGOS 3Q8AA 4USAA 3AEAB 1FFUA 3FILB 1SIJA 4WWMA 4A8XC 5BMHA 3SEBA 4N6EB 3U7ZA 1D6EC 1N62A 4Q2JA 1GTHA 4ZOHC 1ZE3D 1FNWA 3HRDD 5FK9C 1XLQA 2K5PA 3NVZA 1TY2A 4IDIA 1WXQA 4GLSC 1WYGA 4KKIA 4US8A 1F2RI 3FILA 1MHXA 1TS5A 2JYEA 4HEA1 4OZCA 1WGKA 4HROA 3AE3B 4J3OD 1D5ZC 1AWDA 1QOGA 1YNTE 4NZLB 4ZHOA 1XLPA 3ZGZA 5HFYA 1UGJA 1R7SA 1WSPA 2MJ3A 2QILA 4M0WA 3ABVB 1XEEA 2QJLA 1KF6B 3BVZA 1B1ZA 1RWSA 1SF0A 5FKAC 1H7WA 2L83A 1N5XA 2K22A 1SE4A 1P7EA 3NVYA 2WP9B 3KQ4A 4A6QA 2WU5B 1A70A 1MPEA 3TUOA 1FO4A 3CF4A 1YN4A 4ZRQA 3RFZB 1QLBB 2DYOA 3NZ3A 3BK2A 1JROA 2JYTA 3VQIA 1HZ5A 5C2TB 1TYGB 3AV8A 2LHDA 5D3IB 1AN8A 2FUG1 2M19A 4KKJA 2KACA 1RFKA 3NVVA 2J53A 1GT8A 1GAQB 3IT6B 1FCCC 1I4HA 3TSSA 4UDUC 2G9HD 1ZDXA 3C8YA 4CQNA 4LTUA 2L52A 1AW7A 1T3QA 1CJEA 2WXLA 3W2DA 3E56A 4REZA 4A55A 4RGMA 2KWDA 2WXPA 3TEWA 1E10A 4RGNA 1PUTA 3I57A 1XCQL 1UWXA 1FMAD 3AE2B 1BXTA 2KQ4X 1RM6C 2JZPA 4TQ1A 2BTEA 1D4BA 3P4QB 5G5GA 2FE8A 1IGDA 1SE2A 2NMQA 2QIEB 4JPSA 2IGHA 3VR9B 2BT6A 1E9MA 4AQ7A 1JWMD 1K51A 4ARIA 2IGDA 1E6EB 2J4XA 3SFEB 4D2KA 4KGSA 3TEZA 2WXKA 1SBBB 4ZYSA 3HVDA 1TJEA 5I4DA 2RDHA 1FRDA 4YTMB 2YEPF 4KGRA 4C56C 4DXGA 1GB4A 4OZAA 3GS2A 4N58A 5GXGB 1VZ6A 1EU3A 1PFDA 3EUB2 2BW2A 3IAM1 2WXOA 2VZKD 2WXIA 3IXSA 1C77A 2INPE 1FXAA 2QMTA 3KWVA 2M0AA 3AEFB 2KAJA 3R2IA 5H92C 5BYQA 3BK1A 1K50A 1C76A 1C4CA 3MFGA 3BVMA 2BB5A 2WDVB 2WDRB 1L5PA 3P4PB 2HDEA 2OEDA 1VZ7A 3E9SA 2IDYA 1J7AA 1ZUD2 3AE6B 4XDCA 1GOZA 1GTEA 1PGXA 4AS1A 1XCTL 1OQQA 1HXYD 2V0GA 5AUKA 2HTME 3CIRB 1MHHE 1LO5D 2KDMA 1QKZA 3O13A 2V4IB 4ZHPA 1TS4A 1L6VA 2BBCA 1FXIA 1V97A 2XNAC 2PVGC 3Q8EA 1T6BX 2PW9A 3Q69A 1PDXA 2WXJA 2RPVA 1ZDVA 3HUIA 4NJCA 1M4VA 2H89B 3AEGB 4JWUC 4RFBA 4NAWB 3J9CA 1ACCA 3VR8B 2Y5CA 2MEKA 1XXGA 2WNMA 3AB5A 5EE0A 3Q8FA 3AEBB 1YMHE 4ITKA 4KGTA 2M56B 2E3TA 4C7YA 4PT5A 1ZOYB 2DWQA 2WXMA 1ZXHA 3P42A 1YJJA 4MH8A 5JXVA 2VZKB 2B76B 2AX5A 3EA6A 3H8HA 1F0ZA 4WIPA 4A9AA 2QSDA 2KMMA 4MT5A 1IBXB 3SFDB 1EM7A 2FBWB 1QQRA 3AMZA 4HJGE 4XE0A 4TQ0A 2N9LA 2OHFA 4OVZA 3AE1B 4YXDB 4A90A 2GRIA 5AUIA 1VDVA 2N7JA 1KLUD 4B0EA 2EELA 4OW0A 1DOYA 1VJKA 1VR9A 4WH4A 1IBXA 4H2AA 4JE3B 1TS3A 3N9YC 3SR6A 3MHZA 2DYMA 3P63A 1XO3A 1VRAB 5D7GA 1VZ8A 2L32A 2XN9C 1SEBD 4B0MA 1JCKB 2SAKA 3T3OA 3U2SC 5BYSA 1I4GA 1L0YB 1JWBD 2BS4B 3W1SA 3KWLA 2JX5A 2W3SA 1E7PB 4O1NA 4RGTA 5BMIA 2W82A 4MACA 1H7XA 1SXTA 2JQRB 1ENFA 5G5HA 3ZJUA 4YSXB 2DLBA 4NAMA 3BZDB 1CZPA 1T5XD 1N61A 1JWUD 1XLNA 3P4RB 2E6XA 2Y3AA 2WDQB 4RNAA 1L6UA 4LK0M 1PGAA 3WCQA 5BYRA 2GI9A 4DXFA 2LFIA 1C9FA 3PZ8A 1C4AA 3W5VB 1QILA 4WAFA 1SJHD 4XWWA 1YN5A 3ZQ4A 1Q10A 1WRIA 1QOAA 2X38A 1ESFA 1HEZE 1RYJA 2WXRA 2WLBA 1V8CA 3UI3A 2AQ2B 5HG2A 2GB1A 4GDKB 4JWSC 1ZP0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JW9 D;  3NVZ A;  2W55 A;  4IDI A;  1WXQ A;  1WYG A;  1FM0 D;  1GTE A;  2ACZ B;  4US9 A;  4US8 A;  4YTN B;  4YSY B;  3AN1 A;  1OQQ A;  3AH7 A;  1E0Z A;  2CJO A;  5AUK A;  2HTM E;  3NS1 A;  3AE8 B;  3CIR B;  2PVO D;  3LB8 C;  4C7Z A;  1WGK A;  4HRO A;  3AE3 B;  1QT9 A;  1YQ3 B;  1AWD A;  1J7B A;  1QOG A;  1JRP A;  1DOX A;  1JQ4 A;  4ZHO A;  4ZHP A;  1XLP A;  1OFF A;  1QOB A;  1L6V A;  1SB3 C;  3PO0 A;  1R7S A;  2MJ3 A;  3AE5 B;  3AEE B;  3DWG C;  3B9J A;  1FXI A;  1V97 A;  1NEK B;  3ABV B;  2PVG C;  1KF6 B;  2QJL A;  1RWS A;  1PDX A;  1SF0 A;  3AM9 A;  3HUI A;  1H7W A;  2L83 A;  3AE7 B;  3AE9 B;  2H89 B;  3AEG B;  1N5X A;  1TKE A;  2MJD A;  3BII D;  4JWU C;  2K22 A;  3ETR A;  3B2F A;  3NVY A;  3VR8 B;  2WP9 B;  1FIQ A;  2Y5C A;  3AB5 A;  2WU5 B;  4KX6 B;  1A70 A;  1I7H A;  3HVZ A;  5EE0 A;  3CF4 A;  1DOI A;  1FO4 A;  1YJI A;  3AEB B;  3L4P A;  4ITK A;  1QLB B;  3AE4 B;  2M56 B;  2MH7 A;  2E3T A;  4JX1 C;  1FFV A;  1ZOY B;  2DWQ A;  4C7Y A;  1JRO A;  1YQ4 B;  1YJJ A;  5EE9 A;  5C2T B;  4YSZ B;  1TYG B;  3AV8 A;  2W54 A;  3W9C B;  2B76 B;  2AX5 A;  5EE3 A;  2M19 A;  1F0Z A;  2W3R A;  1RFK A;  3NVV A;  1AYF A;  1GT8 A;  4A9A A;  1GAQ B;  3CWI A;  1EWY C;  2KMM A;  5C3J B;  3W5U B;  4FXC A;  1IUE A;  3P4S B;  1KFY B;  3SFD B;  3B2G A;  1UWM A;  2FBW B;  2K5P A;  3RPF C;  3AMZ A;  2L52 A;  1JAL A;  4LTU A;  1T3Q A;  1CJE A;  1XLO A;  2OHF A;  1GPX A;  2DBY A;  3AE1 B;  4YXD B;  1E10 A;  2BS3 B;  1PUT A;  5AUI A;  1VDV A;  1QF6 A;  1FMA D;  3AE2 B;  2CU3 A;  3NRZ A;  1DOY A;  3AED B;  1L0V B;  1RM6 C;  1VJK A;  1NI3 A;  5EE1 A;  1FRR A;  4YTP B;  3SR6 A;  2PIA A;  2G1E A;  3P4Q B;  5G5G A;  3P63 A;  3AEC B;  1XO3 A;  1DGJ A;  1ROE A;  3NVW A;  1N5W A;  2LEK A;  2QIE B;  3FC4 A;  2BS2 B;  3VR9 B;  2BT6 A;  1E9M A;  5MPO A;  1JWB D;  1TKG A;  2BS4 B;  3P1M A;  2K9X A;  2MJE A;  1J7C A;  1E6E B;  2JX5 A;  3KWL A;  2W3S A;  1E7P B;  3SFE B;  4WQM A;  5H8Y E;  2WQY B;  1H7X A;  2WU2 B;  1TJE A;  2JQR B;  2N0S B;  5G5H A;  1NVI D;  1VLB A;  4N59 A;  1TKY A;  4YSX B;  2WS3 B;  1JWA D;  1FRD A;  1KRH A;  1CZP A;  1N63 A;  4YTM B;  2H88 B;  1N61 A;  1OQR A;  1XLN A;  3P4R B;  2WDQ B;  1L6U A;  1N60 A;  4N58 A;  5GXG B;  3WCQ A;  1ZXI A;  1PFD A;  2CJN A;  1ZUD 2;  4YT0 B;  3EUB 2;  3ZYY X;  2EKI A;  1WWT A;  1B9R A;  3VRA B;  3W5V B;  2Q5W D;  3VRB B;  1QOF A;  1FXA A;  1WRI A;  1QOA A;  4USA A;  4HRS A;  3AEF B;  2KAJ A;  3AEA B;  5H92 C;  1RYJ A;  1FFU A;  2PKO A;  1SIJ A;  2WLB A;  1V8C A;  3LXF A;  1NYR A;  3DWM A;  1NYQ A;  1NEN B;  4WWM A;  4N6E B;  1N62 A;  1GTH A;  2WDV B;  2WDR B;  1L5P A;  3P4P B;  3FAH A;  4JWS C;  4ZOH C;  3HRD D;  4P6V F;  1ZP0 B;  4C80 A;  1J7A A;  1XLQ A;  3AE6 B; 
#chains in the Genus database with same CATH topology
 1JW9 D;  4ZRK A;  3VVW B;  2GBJ A;  1FM0 D;  4J6I A;  2AL6 A;  4US9 A;  4HCN B;  4YSY B;  2ONQ A;  3VAW A;  2LWP A;  1L7Y A;  3V05 A;  3ZTD A;  3MJ5 A;  3CMM B;  3I9V 1;  1OFF A;  3PO0 A;  2JSV X;  2RMM A;  4G3X B;  2L0T A;  2WYQ A;  3ZNH B;  1UH6 A;  2IYD B;  3MC8 A;  4DQO C;  2Y5P A;  3PHX B;  3AE4 B;  4JX1 C;  2MH7 A;  5LNK 1;  2RDB C;  1MVK A;  1YJ1 A;  4HPM B;  2Y5B B;  4NNJ B;  2JWU A;  1FEH A;  2WX1 A;  3CWI A;  1IUE A;  4WJN A;  1KFY B;  2KNB A;  3B2G A;  2IY1 B;  4DHJ D;  5HHD G;  2I38 A;  3A9J A;  2KQ7 A;  3PZD A;  2IGG A;  1D5M C;  3BYT B;  2HE7 A;  1WJN A;  4FBJ B;  5EE1 A;  2KMA A;  4I6P A;  1FRR A;  2D3B A;  5HI1 A;  2K39 A;  1GB1 A;  3AEC B;  2LEK A;  1UF0 A;  1SE9 A;  2C9W B;  2XBB C;  2V4L A;  3FC4 A;  3QJZ A;  5L95 C;  4TSS A;  1V2Y A;  2KAN A;  3L16 A;  3ZJV A;  2Z0D B;  4GSW A;  3N3K B;  2RDG A;  4ARC A;  5IOI A;  3PRP B;  4AWJ A;  1ET6 A;  4WJO A;  1OQR A;  3BWU D;  2MQJ A;  4ZDV A;  4HPP A;  4GIV A;  3ZJT A;  2KJR A;  4DHJ B;  3GB1 A;  4HRS A;  2BYV E;  4WUR A;  1EWC A;  3DWM A;  1NYQ A;  2KJ6 A;  3EC8 A;  3PPA A;  2SEB D;  5EDS A;  3KUZ A;  1WX9 A;  5E6N A;  2OJW A;  3AH7 A;  5FR6 A;  1E0Z A;  3LB8 C;  1ET9 A;  3VDZ A;  1YQ3 B;  1V1P B;  2V3P A;  4X57 B;  4IWQ A;  2ICI A;  1SB3 C;  4FHJ A;  3B9J A;  3DPD A;  1OEY J;  1Y56 A;  3U52 E;  4R3D A;  1V81 A;  3WAM A;  4NQK E;  4PYU A;  4KDI C;  2JXT A;  2VRR B;  1IYF A;  4W9F A;  4P7I A;  2GBK A;  5AEK B;  2CKH B;  5C3J B;  4PS7 A;  3LJ3 A;  2FID A;  1WF9 A;  3Q6B A;  4IM0 A;  2XEW A;  4II3 B;  2CU3 A;  1Z5S B;  5CTR C;  5E6P A;  3DVN V;  4YTP B;  3DBH I;  2L0F A;  1UUP A;  4GB9 A;  2L3Z A;  4FUL A;  1RAX A;  2C5L C;  2K6Q A;  3HK0 A;  1ZPS A;  3V3X A;  5AZH A;  2NTS A;  4LDT D;  1MI0 A;  1PGB A;  4N59 A;  2MBE A;  1M94 A;  4P1B C;  1L0X B;  2WXQ A;  3A9K A;  3AI5 A;  1F9J A;  1B9R A;  4WJQ A;  3VRA B;  4IM2 A;  1E8X A;  1I4R A;  3I3T B;  2L1A A;  4RGO S;  2NBV B;  3O65 B;  3A1Q B;  5BMH A;  1IPG A;  1ZE3 D;  1TY2 A;  4IDI A;  1WXQ A;  1WYG A;  4US8 A;  1F2R I;  4HK2 A;  4S0R A;  3FIL A;  5AZG A;  4HRO A;  3AE3 B;  3NY5 A;  5HFY A;  3W1S C;  1UGJ A;  4EZK A;  2MJ3 A;  2L7R A;  3ABV B;  3NZS A;  1XEE A;  2QJL A;  1KF6 B;  4DK5 A;  1UZX B;  4LDT B;  3AXC A;  2BWF A;  3QAR A;  2KFJ A;  1JRU A;  1HE8 A;  4A6Q A;  2WU5 B;  1YN4 A;  3ENE A;  4KZC A;  3VQI A;  3WAP A;  5C2T B;  1TYG B;  1AN8 A;  2FUG 1;  3RNG C;  2KAC A;  3NVV A;  3IT6 B;  5IKC M;  1WH3 A;  4LTU A;  2WXL A;  3W2D A;  2JF5 A;  4A55 A;  3DBR B;  1E10 A;  1V5T A;  1UWX A;  1FMA D;  2L05 A;  3AE2 B;  1BXT A;  3U30 A;  3QWZ B;  3X0W A;  3ALB A;  4TQ1 A;  2YLM A;  3T9L A;  1SE2 A;  2QIE B;  5JHB A;  1R4M I;  3PRZ A;  1E90 A;  1SBB B;  2WXK A;  4CO7 A;  3HVD A;  1UD7 A;  4FJY A;  2LI5 A;  2A5U A;  2DNF A;  3IVF A;  1CMX B;  5GXG B;  1PFD A;  1YX5 B;  1QZE A;  3EUB 2;  2D3C A;  2D10 A;  3S2A A;  1FXA A;  2MBO A;  3R2I A;  2CS4 A;  1YQB A;  2WDR B;  2OED A;  3P4P B;  1GJZ A;  1NI2 A;  3GE8 C;  3V62 A;  1GTE A;  1PGX A;  2MBH A;  4DDI D;  1XCT L;  1OQQ A;  2V0G A;  2KDM A;  1QKZ A;  3N1Y C;  4GU2 A;  2KTR A;  3CSF A;  3ZNZ B;  2GOW A;  1WI0 A;  3ZIM A;  4E3C A;  2O6V D;  2XNA C;  1T6B X;  3VTU A;  4NJC A;  2RPQ A;  3ML9 A;  2LXA A;  2ZNV C;  4GOC A;  1ACC A;  2MEK A;  2NVU I;  1HTO A;  2NR2 A;  3AEB B;  4KGT A;  2M56 B;  3ZLZ A;  4MGK E;  2WXM A;  5D2M B;  2BVC A;  4NJ7 A;  4IWP A;  4NAW A;  4E71 A;  4WIP A;  2M1M A;  2K8H A;  4E74 A;  2FBW B;  2K8C A;  1F52 A;  4XE0 A;  2D2Q A;  2N9L A;  2N7J A;  1GC6 A;  1SGH A;  1DOY A;  5GMV A;  1VR9 A;  1IBX A;  1TS3 A;  2JRH A;  3N9Y C;  3MHZ A;  2G4D B;  3OLM D;  2KKC A;  1VRA B;  2FUH B;  2O6V B;  1L0Y B;  4EKU A;  2G4S A;  2W82 A;  4M01 A;  1WMH B;  3Q14 C;  2IBI B;  2JQR B;  3LDZ E;  4C4V A;  3ZJU A;  4YSX B;  2DLB A;  2QDF A;  1T5X D;  1JWU D;  2WDQ B;  3RCZ A;  3TCA A;  4K3B A;  2ZEQ A;  3PZ8 A;  4ZRJ A;  1C4A A;  4LCD E;  2MP2 A;  5IA7 A;  1YN5 A;  3SU8 X;  1QOA A;  4G0N B;  1LM8 B;  4ZRI A;  2UWQ A;  2GB1 A;  2LVQ A;  4IKG A;  5KHQ A;  1WXA A;  4I6N B;  3ZXR A;  1NDD A;  1C3T A;  2V3N A;  1XD3 B;  3B0A A;  3L08 A;  1CK1 A;  1SSN A;  3IG3 A;  1HZ6 A;  1J8C A;  3OWE B;  4M00 A;  3AE5 B;  3AEE B;  3KVF B;  4EUT A;  2JUO A;  3AM9 A;  1HA5 A;  3AE9 B;  2R61 A;  3BII D;  4HKQ A;  4CYE A;  3ZW3 A;  1FIQ A;  4ICU A;  3VFK A;  3VTW A;  1DOI A;  1WM2 A;  1YJI A;  1LXD A;  2IPK D;  3L4P A;  4ANX A;  4XC2 A;  4C00 A;  2N4F A;  3JYU A;  1KLV A;  4IG7 B;  3SDL C;  2W3R A;  3RD2 A;  1EWY C;  3QA8 A;  2JRI B;  2PEA A;  3QQ8 B;  1GPX A;  1WIA A;  2WWZ A;  4MDK E;  1NI3 A;  5D94 A;  5FR3 A;  2KC1 A;  1ROE A;  3GZN B;  2M17 A;  1V49 A;  5DPR A;  2ZNV B;  3A4R A;  4FLH A;  1OGW A;  1TKG A;  3P1M A;  3VXW A;  1EU4 A;  1J7C A;  1E7V A;  3VH3 B;  2G3Q B;  3R7R A;  4BKS D;  1GUA B;  3IT4 B;  4A20 A;  3L10 B;  1VCB A;  3QHT A;  4W9J A;  3ZYY X;  2GLS A;  2NPT A;  4RF1 A;  1R4N B;  4BZA A;  5J18 A;  4P16 A;  2KFK B;  4EE2 A;  1V80 A;  4EFO A;  3ZNG C;  2WX0 A;  1STE A;  3FAH A;  1X1M A;  4KV2 A;  2TSS A;  1UNS A;  4TMA B;  2MP2 B;  4IC7 B;  4ZYN A;  3NZU A;  1WX8 A;  3NS1 A;  4C7Z A;  3V60 A;  2IO3 B;  2IZV B;  5L83 A;  2C60 A;  4XYC A;  1BUI C;  3VHT C;  4K7S A;  3MJW A;  1FPY A;  1Z2M A;  4HCP B;  1V1P A;  2KHW B;  3L13 A;  3PTF C;  3DQV A;  2AQ1 B;  4WAA A;  1YQ4 B;  3W9C B;  1YX6 B;  1AYF A;  4KZ0 A;  4OZB A;  2AL3 A;  2RSU A;  3B1L X;  3RNC C;  1BT0 A;  1WZ0 A;  4FXC A;  1UWM A;  2K1F A;  2BS3 B;  3TL5 A;  3Q8B A;  3APD A;  2NTT A;  4MSQ B;  4KSL C;  4RM8 A;  1XT9 B;  4LNN A;  4GDL B;  3EGR A;  2MBQ A;  4RM9 A;  3QCA A;  4BOS C;  4K81 A;  2WU2 B;  2J0J A;  3JSV B;  1VLB A;  1JWA D;  3KLS X;  1F77 A;  1KRH A;  1BML C;  2O2V B;  1WGD A;  2PTL A;  2GBR A;  1MFW A;  5IO9 A;  4DHZ B;  2KK8 A;  4PS8 A;  1TS2 A;  4BFR A;  2IJ0 A;  3Q8A A;  2JXX A;  1SIJ A;  2IO1 B;  3SEB A;  3U7Z A;  1N62 A;  3HRD D;  3NS8 A;  3NVZ A;  2NPT B;  4BVU C;  4GLS C;  4KKI A;  1J0G A;  3A1Q A;  1MHX A;  1TS5 A;  2JYE A;  4OZC A;  3RZW C;  1D5Z C;  1AWD A;  1QOG A;  1YNT E;  3PS6 A;  4MGZ E;  2LGX A;  1TTN A;  3BVZ A;  1SF0 A;  5CHV C;  4PK1 A;  1H7W A;  2LRU A;  1N5X A;  2WP9 B;  2KDE B;  1A70 A;  3A33 B;  3RFZ B;  3Q3M C;  3RT3 B;  5BO4 B;  1JRO A;  2C7M B;  3WAN A;  3AUL A;  4CHK A;  5D3I B;  2LGS A;  1RFK A;  2MA9 B;  1GT8 A;  1GAQ B;  1UGM A;  4MJS A;  3TSS A;  1TZ1 A;  2G9H D;  3GOE A;  4ASW C;  2D07 B;  4NJ6 A;  4CQN A;  1AW7 A;  4B6W A;  2KWD A;  2BYE A;  2ZZP B;  3TEW A;  1XCQ L;  1VD2 A;  2EMS A;  4IM3 A;  2KQ4 X;  5HKH A;  4DWF A;  4MGI E;  3JVZ X;  1D4B A;  5KHO A;  1P0R A;  3RI7 C;  4JQW C;  1IGD A;  2NMQ A;  1P9D U;  4JPS A;  1E8W A;  3ZNI D;  2BT6 A;  4AQ7 A;  2GBN A;  4TKN A;  2DYB A;  2IGD A;  3OG5 A;  3SFE B;  3R7Q A;  1TJE A;  5I4D A;  3DBR I;  2ASQ A;  3WAO A;  3DBL B;  4YTM B;  3K9O B;  2YEP F;  4C56 C;  2ZCB A;  1GB4 A;  3GS2 A;  4W9L A;  1EU3 A;  2MCN B;  5G2N A;  2WXO A;  2D11 A;  2WXI A;  4WWN A;  3IXS A;  3DVG Y;  5BYQ A;  1K50 A;  1C4C A;  2WDV B;  1L5P A;  1VZ7 A;  3PLU A;  2FIF A;  3AE6 B;  2ZPN A;  1HXY D;  2KTF A;  5AUK A;  3ECI A;  3CIR B;  2DZK A;  1L6V A;  3BY4 B;  3C19 A;  1PDX A;  2WXJ A;  1M4V A;  4RFB A;  1WX7 A;  4LNF A;  4NPN A;  3AB5 A;  4KSK C;  3Q8F A;  2LVO A;  3WA0 A;  3P42 A;  3RUI B;  1YJJ A;  2L76 A;  2B76 B;  4PYZ A;  1YIW A;  2VH2 A;  4QAY A;  3H7P B;  3PLV A;  4A9A A;  5CX3 A;  2YVC A;  1G6J A;  3N32 A;  1WXV A;  1EM7 A;  4GMV A;  3Q3N C;  1QQR A;  2KDI A;  4HJG E;  2OHF A;  4YXD B;  4A90 A;  3H9D A;  4W9E A;  5AUI A;  2LAS A;  3UF8 A;  4MJS B;  1VJK A;  2IO0 B;  4JE3 B;  2KC2 A;  1Q0W B;  2BPS A;  2GMI C;  3RUL A;  1LFD A;  3U2S C;  2KX3 A;  5BYS A;  3W1S A;  3KWL A;  1E7P B;  1WR6 E;  3HM3 A;  1GC7 A;  1WYW B;  2I1J A;  4W9G A;  2O6V A;  3QAQ A;  4NAM A;  4WJP A;  2KLC A;  2KXJ A;  1N61 A;  3EEC A;  5IAA C;  1PGA A;  5BYR A;  1WMH A;  5LXI B;  3VUX A;  2A4Z A;  3W5V B;  4WAF A;  2DHZ A;  1RYJ A;  1MG4 A;  1V8C A;  3UI3 A;  2AQ2 B;  5HG2 A;  4GDK B;  4WWP A;  2IND C;  1ZP0 B;  3ZVV A;  1EO6 A;  4LNI A;  1P98 A;  3URY A;  4IW0 A;  4XWT A;  1J7B A;  1JQ4 A;  2PE6 B;  1QOB A;  3UQB A;  2I2Y A;  3MC0 B;  2J52 A;  2L8J A;  4MH0 E;  1S3S G;  1I7H A;  3TIX A;  1K53 A;  3DVG X;  3IFW B;  3UIP B;  2N1V A;  4BKT A;  4YSZ B;  2W54 A;  1KH0 A;  3W1Y A;  2AYO B;  4F7Z A;  4HWI B;  2AQ3 B;  3R3M A;  2DZM A;  4OVU A;  3RPF C;  2LMC A;  5JHA A;  2ZPY A;  1XLO A;  4IWO A;  1TZO A;  3DOW A;  3UIN B;  3MHS D;  5IP4 D;  1KLG D;  1DYQ A;  3SD5 A;  2JT4 B;  1WJ4 A;  1WGH A;  5E6J A;  1GG3 A;  2G1E A;  1GNU A;  2KN5 A;  3OJ3 A;  2LJI A;  2JU6 X;  5E6O A;  1FXT B;  4AJY B;  4MM3 B;  2Z8L A;  2N9K A;  2ZCC A;  3N1X C;  2NS5 A;  4S17 A;  1E8Y A;  4K3C A;  1ZW7 A;  3RMK C;  2RD0 A;  2FCQ A;  1TY0 A;  3HHM A;  4YT0 B;  2N9E B;  2EKI A;  2R2Q A;  3PSE B;  3GZN I;  2CU1 A;  4RH6 A;  3L54 A;  2PKO A;  3LXF A;  1NYR A;  1I4P A;  1RFA A;  2KQS A;  2W55 A;  4JIO U;  2G45 B;  2KFK A;  3R2T A;  1E5W A;  4RCO A;  3AN1 A;  2CJO A;  3KH0 A;  3AE8 B;  2PVO D;  3Q8C A;  4DBG A;  2HJ1 A;  4YWG G;  1TBE A;  2KN4 A;  4MEM A;  1R4M B;  2ZW1 A;  1R4N I;  3UGB B;  1NEK B;  2LGI A;  1K52 A;  3WIM A;  1TKE A;  3B2F A;  4DHZ E;  4EOY A;  4KX6 B;  2ON8 A;  3T3N A;  1FFV A;  3ZO5 B;  4BKS A;  3D32 A;  3ZKJ C;  5EE9 A;  4FJZ A;  2MX2 A;  5TSS A;  3M3J A;  2J0K A;  1AAR A;  4BAX A;  3W5U B;  1L4Z B;  4ZRP A;  2QC8 A;  2J0M A;  4M02 A;  4LLG M;  1A5R A;  2DBY A;  3ZRF A;  3HIZ A;  1CQV A;  4L1B A;  3NRZ A;  1C79 A;  1SJE D;  3RYT A;  2YEP B;  2PIA A;  3IAS 1;  3TEX A;  3NVW A;  4AOF A;  2WXH A;  3TJP A;  2BGF A;  4TUU A;  4TV3 A;  1C78 A;  4KIK B;  1UBQ A;  4FAD A;  5DPW A;  1LGR A;  4II2 B;  2PLP A;  4WQM A;  4BBN C;  5H8Y E;  2WQY B;  4G50 A;  3DDC B;  2INN E;  2NBW B;  3M62 B;  2N0S B;  1SE3 A;  1E8Z A;  4HDQ A;  4GDL A;  3A4S C;  3NOB A;  2VH1 A;  2EMT A;  1OTR B;  2H88 B;  1EF1 A;  5C1Z A;  3AU5 A;  3K9P B;  1ZXI A;  1PQS A;  3JSV A;  1YN3 A;  3UIO B;  1ZGU B;  1WY8 A;  1L4D B;  1QOF A;  2M8S A;  3V6E B;  2O2V A;  4USA A;  1FFU A;  4A8X C;  1D6E C;  2BYF A;  3EFC A;  4ZOH C;  1FNW A;  5FK9 C;  1XLQ A;  2V9H A;  4M0W B;  1WGK A;  2AWT A;  2L00 B;  4NZL B;  4ZHO A;  1XLP A;  3C0R B;  1R7S A;  4EZL A;  3RNF C;  2QIL A;  2LD9 A;  3APF A;  1RWS A;  5FKA C;  2MRP A;  2MHJ A;  2KLG A;  2L83 A;  3NHE B;  1EUV B;  3H6N A;  3IHP C;  2MWS B;  1YOV B;  3KUC B;  3ZRC A;  1SE4 A;  3KQ4 A;  4PS3 A;  3TUO A;  3CF4 A;  4B95 A;  4F1S A;  2DYO A;  3NZ3 A;  3MTN B;  5JZE B;  5DPT A;  3WAL A;  2LGY A;  2LHD A;  1WGG A;  2M19 A;  4KKJ A;  3H1U A;  2J53 A;  1V9J A;  3QIJ A;  1I4H A;  2BWE S;  4UDU C;  3CF6 E;  3PRE A;  2Z59 B;  2L52 A;  2KJH B;  2UYZ B;  2WXP A;  1PUT A;  4HPL B;  3KYC D;  3DHG C;  1RM6 C;  1RLF A;  2JZP A;  2BTE A;  3P4Q B;  5G5G A;  1WXS A;  2FE8 A;  3X23 A;  1EF5 A;  5J17 A;  2IGH A;  3VR9 B;  1E7U A;  1K51 A;  2JY6 A;  1E6E B;  2J4X A;  3RNA C;  2K8B A;  4KGS A;  4FHK A;  5CHF A;  1I42 A;  1FRD A;  1NBF C;  2HD5 B;  4KGR A;  3N30 A;  4N58 A;  2KMC A;  2BW2 A;  3IAM 1;  2DZI A;  2VZK D;  3IBE A;  3Q3F A;  1C77 A;  2INP E;  1I35 A;  2QMT A;  2BQQ A;  4KDL B;  2KWU B;  1K8R B;  1TGZ B;  3BK1 A;  1C76 A;  2FCN A;  3M63 B;  4M8M A;  1J7A A;  1ZUD 2;  2MBB B;  4XGA B;  4GN1 A;  1OEY A;  3DBL I;  2HTM E;  4WWO A;  1MHH E;  4P1C C;  3O13 A;  1ISN A;  2JPH A;  4ZHP A;  1TS4 A;  2BBC A;  2AEH A;  2LVP A;  3Q8E A;  2PVG C;  2KWC A;  4HVB A;  1RRB A;  3Q69 A;  1WXM A;  3AU4 A;  1HTQ A;  2NBU A;  3HUI A;  2WDT B;  2H89 B;  2LJ5 A;  4XX5 A;  2DAJ A;  1WGR A;  3J9C A;  3VR8 B;  2WNM A;  3T8M A;  1TT5 B;  2KDF B;  4HJK A;  4ITK A;  4C7Y A;  4JL9 A;  1ZXH A;  3I63 C;  4MH8 A;  2VZK B;  2AX5 A;  1N6Z A;  3EA6 A;  2OJR A;  2QSD A;  1T0Y A;  5DCN A;  3SFD B;  3H7S A;  2HJ8 A;  3AMZ A;  2FAZ A;  4TQ0 A;  2JZZ A;  1Q5W B;  3AE1 B;  3H7P A;  1KLU D;  5J2R A;  4B0E A;  2JWZ A;  4OW0 A;  1Y8R C;  4N9F 4;  2N9P C;  2KZR A;  3SR6 A;  3RNE C;  1WM3 A;  2DYM A;  3P63 A;  1XO3 A;  3ZDT A;  5D7G A;  1J19 A;  1P1A A;  1JCK B;  3TBL D;  2BKR B;  3T3O A;  2J7Q B;  1JWB D;  2JX5 A;  2M4N A;  2W3S A;  4O1N A;  5BMI A;  3MC9 A;  1ENF A;  5D6J B;  4FN2 A;  3PV1 A;  1CZP A;  4A3O A;  3Q2A C;  2Y3A A;  3P4R B;  2E6X A;  3OAW A;  4RNA A;  2KVZ A;  1L6U A;  2KWV B;  1C1Y B;  4LK0 M;  3WCQ A;  4DXF A;  2V3S A;  3V61 A;  1SJH D;  1Q10 A;  1WRI A;  2MW5 A;  4ICV A;  2X38 A;  1HEZ E;  2N7D A;  3RZF A;  4JWS C;  2KDB A;  2W9N A;  2PE9 A;  4JGH B;  2MLB A;  4MGY E;  4YTN B;  3R8B A;  3UQA A;  2REX A;  1IGC A;  3N20 C;  2ZJD A;  4GDK A;  2K0P A;  4HKZ E;  4AP4 C;  2D5G A;  1JRP A;  1KM7 A;  2LUE A;  5IN7 A;  4K7U A;  2K6D B;  4L23 A;  3DWG C;  2WXN A;  1V1O A;  1HQR D;  3ML8 A;  1FD6 A;  3GE3 C;  4EZJ A;  4LJO B;  4BOZ B;  4EEW A;  5EE3 A;  1F2R C;  3A9J B;  3P4S B;  1PYW D;  1P7F A;  3NJT A;  1WRD B;  1H4R A;  1JAL A;  3TEY A;  1OQY A;  2DEN B;  2NCN A;  2PJH A;  4OHJ A;  1F1H A;  3AED B;  1L0V B;  2FCM A;  4ANU A;  2BYT A;  1L2N A;  5C23 A;  1I4X A;  3JW0 X;  1N5W A;  2BB6 A;  2CHX A;  2BS2 B;  1WZ3 A;  2WXF A;  2JVC A;  1ZKH A;  3DCG A;  4RF0 A;  2K9X A;  2D3G A;  2MJE A;  5D3D A;  3GP7 A;  4MM3 A;  1TKY A;  2K3U A;  5CHW A;  1WR1 A;  1N63 A;  2R2O A;  1N60 A;  4W9C A;  3L17 A;  4IUM B;  2Q5W D;  3VRB B;  3PZ7 A;  2KOX A;  4L2Y A;  3PHW B;  2LRW A;  1I4Q A;  1JWS D;  1NEN B;  2RGF A;  2LUM A;  4P6V F;  2DAF A;  2N9X A;  4C80 A;  2WGS A;  2LXC A;  2ACZ B;  2Z0E B;  3BVG A;  4IOI E;  1C4P A;  4B9K A;  1XQQ A;  1QT9 A;  3VH4 B;  4XDD A;  2C7N B;  1FNV A;  2BKF A;  1DOX A;  5T8I A;  3I5J C;  4JLC A;  3APC A;  2ZVN A;  1WJ6 A;  3AE7 B;  2LHE A;  2MJD A;  2DX5 B;  3ETR A;  2RR9 A;  1T0Q C;  3HVZ A;  1XF5 L;  3DBH B;  4NQL B;  2ZW0 A;  2INC C;  3LYY A;  5BMG A;  2D3A A;  4LNO A;  3CST A;  1JML A;  3ZXV A;  1FCL A;  2FNJ B;  3PRM B;  2PMV A;  2QEJ C;  3EFU A;  4DDG D;  5DPS A;  4I6L B;  3U4E G;  1QF6 A;  4FA6 A;  2QCZ A;  2J42 A;  3ONS A;  1UEL A;  4F8C B;  1KTK A;  2KVR A;  5G55 A;  3U8Z A;  1MJD A;  2JZ3 B;  2N7E A;  3R66 C;  1DGJ A;  4BBN F;  3NUH B;  2WXG A;  3MP9 A;  5MPO A;  2GBM A;  1V5O A;  3A9K B;  1KOT A;  1D5X C;  3BYY B;  1NVI D;  4KIK A;  2WS3 B;  3VUY A;  1T0R C;  2KO3 A;  1FNU A;  4DXA B;  2CJN A;  1S1Q B;  1WWT A;  2OOB B;  2HTH A;  2CHZ A;  2KD0 A;  2ZVO A;  4W9H A;  1H8C A;  2N1W A;  4WQO B;  3AEA B;  1D3Z A;  3FIL B;  4WWM A;  4N6E B;  1T0S C;  4Q2J A;  1GTH A;  3PVL A;  2K5P A;  2EKE C;  4AJW A;  3DVN U;  1KJT A;  3PT2 B;  4HEA 1;  3V6C B;  1WE7 A;  4J3O D;  3ZGZ A;  4LNK A;  4HLE A;  1WSP A;  2KX0 A;  5JH5 C;  4M0W A;  1B1Z A;  2CHW A;  1WE6 A;  5AZF A;  2K22 A;  1P7E A;  3NVY A;  1MG8 A;  1MPE A;  1FO4 A;  1IP9 A;  4ZRQ A;  1QLB B;  3BK2 A;  3KW5 B;  2JYT A;  1P3Q U;  1HZ5 A;  3AV8 A;  3PGE A;  4ANW A;  3QC8 B;  4GXB A;  1FCC C;  1ZDX A;  2XK5 A;  3C8Y A;  3KUD B;  4ACF A;  1T3Q A;  1CJE A;  3ZDM C;  3E56 A;  4REZ A;  4URK A;  2BF8 B;  4RGM A;  1U4A A;  2FCS A;  4W9I A;  4RGN A;  2DZJ A;  3I57 A;  2B3A A;  3EHV A;  1V6E A;  2WHI A;  2I1K A;  3SHQ A;  2IO2 B;  3HM6 X;  3TMP B;  3RN9 C;  2QHO A;  1YD8 U;  2PPH A;  1E9M A;  3NG0 A;  1JWM D;  4ARI A;  3DBS A;  4MEL A;  5LXH A;  4D2K A;  3TEZ A;  3B08 A;  4ZYS A;  3N1Z C;  2RDH A;  3U7D A;  4DXG A;  3Q3J A;  4OZA A;  1VZ6 A;  3L0W B;  4ANV A;  2LGD A;  3QX1 A;  3BIN A;  3KWV A;  4W9D A;  2M0A A;  3AEF B;  2KAJ A;  5H92 C;  1WGY A;  3P2B A;  4BKG A;  3MFG A;  3BVM A;  2BB5 A;  2HDE A;  3E9S A;  2KTR B;  2LZ6 A;  2IDY A;  2K25 A;  4XDC A;  3FKY A;  1GOZ A;  3Q3O C;  1WJU A;  2M0X A;  4AS1 A;  2KT7 A;  1LO5 D;  4HDO A;  3QK0 A;  2V4I B;  1SIF A;  1FXI A;  1V97 A;  2PW9 A;  2RPV A;  1ZDV A;  4XZ4 A;  3AEG B;  4JWU C;  4NAW B;  4NY0 A;  2Y5C A;  1XXG A;  4M8N A;  3OJ4 B;  5EE0 A;  4YL8 A;  4W9K A;  1YMH E;  2E3T A;  4PT5 A;  1ZOY B;  2DWQ A;  1LQB A;  5TR5 A;  5JXV A;  3H8H A;  1F0Z A;  4AUQ C;  4KVG B;  3VTV A;  2KMM A;  3ZUN A;  4MT5 A;  4GGQ A;  4HXD A;  1IBX B;  3VUW A;  2IY0 B;  3M95 A;  2UU7 A;  2C7H A;  4MSM B;  3ZTC A;  4OVZ A;  2GRI A;  1VDV A;  2EEL A;  4G11 A;  4WH4 A;  4H2A A;  2V1Y A;  2XK5 B;  1Q1O A;  1VZ8 A;  4C4V B;  2L32 A;  2XN9 C;  1SEB D;  4B0M A;  2SAK A;  4K7W A;  1I4G A;  4RMA A;  2BS4 B;  3DHH C;  2KYW A;  4RGT A;  5LLI A;  2CR5 A;  2MSE D;  4MAC A;  1H7X A;  1SXT A;  3DHI C;  5G5H A;  4FJV B;  2X8X X;  3BZD B;  1XLN A;  4OVV A;  1UBI A;  1TIF A;  4K1R B;  2GI9 A;  1C9F A;  2LFI A;  1QIL A;  4XWW A;  3ZQ4 A;  4A3P A;  1V86 A;  1ESF A;  2WXR A;  2WLB A;  3RNB C;  3KYD D;  4LJP B;  1WFY A; 
#chains in the Genus database with same CATH homology
 1JW9 D;  1FM0 D;  4US9 A;  4YTN B;  4YSY B;  3R8B A;  2ONQ A;  2V3N A;  4IKG A;  3URY A;  3V05 A;  1IGC A;  4XWT A;  1CK1 A;  1SSN A;  2K0P A;  4HKZ E;  1HZ6 A;  3MJ5 A;  1J7B A;  2D5G A;  1JRP A;  3I9V 1;  1JQ4 A;  3OWE B;  1OFF A;  1QOB A;  3PO0 A;  2I2Y A;  2JSV X;  2RMM A;  3AE5 B;  3AEE B;  2J52 A;  3MC0 B;  3DWG C;  4L23 A;  2WXN A;  3AM9 A;  1HA5 A;  1V1O A;  3AE9 B;  2R61 A;  3BII D;  1HQR D;  4HKQ A;  1FD6 A;  1FIQ A;  4DQO C;  2Y5P A;  1I7H A;  1DOI A;  1YJI A;  1K53 A;  2IPK D;  3L4P A;  3AE4 B;  4JX1 C;  2MH7 A;  5LNK 1;  1MVK A;  4YSZ B;  2W54 A;  1KH0 A;  5EE3 A;  1F2R C;  2W3R A;  2JWU A;  1FEH A;  2AQ3 B;  3CWI A;  1EWY C;  1IUE A;  3P4S B;  1PYW D;  1KFY B;  1P7F A;  3B2G A;  3RPF C;  2LMC A;  1JAL A;  3TEY A;  5HHD G;  1XLO A;  2I38 A;  1GPX A;  1TZO A;  2IGG A;  1KLG D;  1D5M C;  3BYT B;  1DYQ A;  4OHJ A;  3AED B;  1L0V B;  5EE1 A;  1NI3 A;  5E6J A;  1FRR A;  2BYT A;  5HI1 A;  1GB1 A;  2G1E A;  3AEC B;  1I4X A;  5FR3 A;  1ROE A;  2LJI A;  2JU6 X;  1N5W A;  2LEK A;  2BB6 A;  3FC4 A;  2Z8L A;  2BS2 B;  2N9K A;  4MM3 B;  2WXF A;  1TKG A;  3P1M A;  4RF0 A;  2K9X A;  1EU4 A;  4TSS A;  2MJE A;  1J7C A;  3ZJV A;  2RDG A;  5D3D A;  3IT4 B;  4ARC A;  3GP7 A;  1TKY A;  2K3U A;  1ET6 A;  1N63 A;  1OQR A;  3BWU D;  1N60 A;  1TY0 A;  4YT0 B;  3ZYY X;  2EKI A;  4RF1 A;  2Q5W D;  3ZJT A;  4P16 A;  3VRB B;  3PZ7 A;  4L2Y A;  4EE2 A;  4RH6 A;  3GB1 A;  4HRS A;  4WUR A;  1I4Q A;  2PKO A;  1EWC A;  3LXF A;  1JWS D;  1NYR A;  1NYQ A;  1NEN B;  3DWM A;  2LUM A;  1STE A;  3FAH A;  1I4P A;  2SEB D;  4P6V F;  4C80 A;  2W55 A;  2TSS A;  1UNS A;  4TMA B;  3R2T A;  2ACZ B;  4RCO A;  3AN1 A;  3AH7 A;  1E0Z A;  2CJO A;  3BVG A;  3NS1 A;  3AE8 B;  2PVO D;  4IOI E;  1C4P A;  3LB8 C;  4C7Z A;  1ET9 A;  1QT9 A;  3Q8C A;  1YQ3 B;  1V1P B;  2V3P A;  4XDD A;  1FNV A;  4YWG G;  1DOX A;  2KN4 A;  2ICI A;  1SB3 C;  2ZW1 A;  5T8I A;  1BUI C;  3B9J A;  1NEK B;  2LGI A;  1K52 A;  3AE7 B;  1TKE A;  2LHE A;  2MJD A;  1V1P A;  3ETR A;  3B2F A;  1Y56 A;  3U52 E;  4KX6 B;  2ON8 A;  3HVZ A;  4R3D A;  1XF5 L;  2AQ1 B;  3T3N A;  1FFV A;  2ZW0 A;  1YQ4 B;  5EE9 A;  3LYY A;  2JXT A;  5BMG A;  3W9C B;  1AYF A;  5TSS A;  1JML A;  4OZB A;  1FCL A;  5C3J B;  3W5U B;  4FXC A;  1L4Z B;  2PMV A;  4ZRP A;  2QEJ C;  1UWM A;  4LLG M;  2DBY A;  2BS3 B;  3U4E G;  1QF6 A;  1CQV A;  4L1B A;  2CU3 A;  3NRZ A;  2J42 A;  1C79 A;  1SJE D;  4YTP B;  1KTK A;  3Q8B A;  2YEP B;  2PIA A;  3IAS 1;  3TEX A;  1DGJ A;  1UUP A;  3NVW A;  2NTT A;  2WXH A;  3NUH B;  1C78 A;  2WXG A;  4GDL B;  3EGR A;  3MP9 A;  5MPO A;  1ZPS A;  2PLP A;  4WQM A;  3V3X A;  2NTS A;  5H8Y E;  2WQY B;  2WU2 B;  2INN E;  1D5X C;  2N0S B;  1SE3 A;  1NVI D;  1MI0 A;  1PGB A;  1VLB A;  3BYY B;  4N59 A;  2WS3 B;  1JWA D;  3KLS X;  1F77 A;  1KRH A;  2H88 B;  1BML C;  2PTL A;  1FNU A;  1ZXI A;  2CJN A;  1L0X B;  2WXQ A;  1WWT A;  1B9R A;  1YN3 A;  3VRA B;  1I4R A;  1TS2 A;  1L4D B;  1QOF A;  2L1A A;  2IJ0 A;  4RGO S;  3Q8A A;  4USA A;  3AEA B;  1FFU A;  3FIL B;  1SIJ A;  4WWM A;  4A8X C;  5BMH A;  3SEB A;  4N6E B;  3U7Z A;  1D6E C;  1N62 A;  4Q2J A;  1GTH A;  4ZOH C;  1ZE3 D;  1FNW A;  3HRD D;  5FK9 C;  1XLQ A;  2K5P A;  3NVZ A;  1TY2 A;  4IDI A;  1WXQ A;  4GLS C;  1WYG A;  4KKI A;  4US8 A;  1F2R I;  3FIL A;  1MHX A;  1TS5 A;  2JYE A;  4HEA 1;  4OZC A;  1WGK A;  4HRO A;  3AE3 B;  4J3O D;  1D5Z C;  1AWD A;  1QOG A;  1YNT E;  4NZL B;  4ZHO A;  1XLP A;  3ZGZ A;  5HFY A;  1UGJ A;  1R7S A;  1WSP A;  2MJ3 A;  2QIL A;  4M0W A;  3ABV B;  1XEE A;  2QJL A;  1KF6 B;  3BVZ A;  1B1Z A;  1RWS A;  1SF0 A;  5FKA C;  1H7W A;  2L83 A;  1N5X A;  2K22 A;  1SE4 A;  1P7E A;  3NVY A;  2WP9 B;  3KQ4 A;  4A6Q A;  2WU5 B;  1A70 A;  1MPE A;  3TUO A;  1FO4 A;  3CF4 A;  1YN4 A;  4ZRQ A;  3RFZ B;  1QLB B;  2DYO A;  3NZ3 A;  3BK2 A;  1JRO A;  2JYT A;  3VQI A;  1HZ5 A;  5C2T B;  1TYG B;  3AV8 A;  2LHD A;  5D3I B;  1AN8 A;  2FUG 1;  2M19 A;  4KKJ A;  2KAC A;  1RFK A;  3NVV A;  2J53 A;  1GT8 A;  1GAQ B;  3IT6 B;  1FCC C;  1I4H A;  3TSS A;  4UDU C;  2G9H D;  1ZDX A;  3C8Y A;  4CQN A;  4LTU A;  2L52 A;  1AW7 A;  1T3Q A;  1CJE A;  2WXL A;  3W2D A;  3E56 A;  4REZ A;  4A55 A;  4RGM A;  2KWD A;  2WXP A;  3TEW A;  1E10 A;  4RGN A;  1PUT A;  3I57 A;  1XCQ L;  1UWX A;  1FMA D;  3AE2 B;  1BXT A;  2KQ4 X;  1RM6 C;  2JZP A;  4TQ1 A;  2BTE A;  1D4B A;  3P4Q B;  5G5G A;  2FE8 A;  1IGD A;  1SE2 A;  2NMQ A;  2QIE B;  4JPS A;  2IGH A;  3VR9 B;  2BT6 A;  1E9M A;  4AQ7 A;  1JWM D;  1K51 A;  4ARI A;  2IGD A;  1E6E B;  2J4X A;  3SFE B;  4D2K A;  4KGS A;  3TEZ A;  2WXK A;  1SBB B;  4ZYS A;  3HVD A;  1TJE A;  5I4D A;  2RDH A;  1FRD A;  4YTM B;  2YEP F;  4KGR A;  4C56 C;  4DXG A;  1GB4 A;  4OZA A;  3GS2 A;  4N58 A;  5GXG B;  1VZ6 A;  1EU3 A;  1PFD A;  3EUB 2;  2BW2 A;  3IAM 1;  2WXO A;  2VZK D;  2WXI A;  3IXS A;  1C77 A;  2INP E;  1FXA A;  2QMT A;  3KWV A;  2M0A A;  3AEF B;  2KAJ A;  3R2I A;  5H92 C;  5BYQ A;  3BK1 A;  1K50 A;  1C76 A;  1C4C A;  3MFG A;  3BVM A;  2BB5 A;  2WDV B;  2WDR B;  1L5P A;  3P4P B;  2HDE A;  2OED A;  1VZ7 A;  3E9S A;  2IDY A;  1J7A A;  1ZUD 2;  3AE6 B;  4XDC A;  1GOZ A;  1GTE A;  1PGX A;  4AS1 A;  1XCT L;  1OQQ A;  1HXY D;  2V0G A;  5AUK A;  2HTM E;  3CIR B;  1MHH E;  1LO5 D;  2KDM A;  1QKZ A;  3O13 A;  2V4I B;  4ZHP A;  1TS4 A;  1L6V A;  2BBC A;  1FXI A;  1V97 A;  2XNA C;  2PVG C;  3Q8E A;  1T6B X;  2PW9 A;  3Q69 A;  1PDX A;  2WXJ A;  2RPV A;  1ZDV A;  3HUI A;  4NJC A;  1M4V A;  2H89 B;  3AEG B;  4JWU C;  4RFB A;  4NAW B;  3J9C A;  1ACC A;  3VR8 B;  2Y5C A;  2MEK A;  1XXG A;  2WNM A;  3AB5 A;  5EE0 A;  3Q8F A;  3AEB B;  1YMH E;  4ITK A;  4KGT A;  2M56 B;  2E3T A;  4C7Y A;  4PT5 A;  1ZOY B;  2DWQ A;  2WXM A;  1ZXH A;  3P42 A;  1YJJ A;  4MH8 A;  5JXV A;  2VZK B;  2B76 B;  2AX5 A;  3EA6 A;  3H8H A;  1F0Z A;  4WIP A;  4A9A A;  2QSD A;  2KMM A;  4MT5 A;  1IBX B;  3SFD B;  1EM7 A;  2FBW B;  1QQR A;  3AMZ A;  4HJG E;  4XE0 A;  4TQ0 A;  2N9L A;  2OHF A;  4OVZ A;  3AE1 B;  4YXD B;  4A90 A;  2GRI A;  5AUI A;  1VDV A;  2N7J A;  1KLU D;  4B0E A;  2EEL A;  4OW0 A;  1DOY A;  1VJK A;  1VR9 A;  4WH4 A;  1IBX A;  4H2A A;  4JE3 B;  1TS3 A;  3N9Y C;  3SR6 A;  3MHZ A;  2DYM A;  3P63 A;  1XO3 A;  1VRA B;  5D7G A;  1VZ8 A;  2L32 A;  2XN9 C;  1SEB D;  4B0M A;  1JCK B;  2SAK A;  3T3O A;  3U2S C;  5BYS A;  1I4G A;  1L0Y B;  1JWB D;  2BS4 B;  3W1S A;  3KWL A;  2JX5 A;  2W3S A;  1E7P B;  4O1N A;  4RGT A;  5BMI A;  2W82 A;  4MAC A;  1H7X A;  1SXT A;  2JQR B;  1ENF A;  5G5H A;  3ZJU A;  4YSX B;  2DLB A;  4NAM A;  3BZD B;  1CZP A;  1T5X D;  1N61 A;  1JWU D;  1XLN A;  3P4R B;  2E6X A;  2Y3A A;  2WDQ B;  4RNA A;  1L6U A;  4LK0 M;  1PGA A;  3WCQ A;  5BYR A;  2GI9 A;  4DXF A;  2LFI A;  1C9F A;  3PZ8 A;  1C4A A;  3W5V B;  1QIL A;  4WAF A;  1SJH D;  4XWW A;  1YN5 A;  3ZQ4 A;  1Q10 A;  1WRI A;  1QOA A;  2X38 A;  1ESF A;  1HEZ E;  1RYJ A;  2WXR A;  2WLB A;  1V8C A;  3UI3 A;  2AQ2 B;  5HG2 A;  2GB1 A;  4GDK B;  4JWS C;  1ZP0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...