4YTNB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
250
structure length
250
Chain Sequence
b'KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title New Insights into the Design of Inhibitors Targeted for Parasitic Anaerobic Energy Metabolism
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 61
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ytnB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ytnB01
2DWQA 2W54A 3ETRA 1FFVA 2KMMA 3HVZA 4YTPB 1GAQB 2QIEB 1CZPA 1FMAD 4P6VF 3AE9B 1GTEA 4C80A 2W3RA 1WGKA 3HRDD 1E7PB 1J7BA 3ZYYX 3AECB 1VLBA 2PVOD 4ITKA 3CIRB 1NYQA 1AYFA 1TKGA 1H7WA 1XO3A 3RPFC 1SIJA 1NYRA 2Q5WD 1KFYB 1F0ZA 3B9JA 2MJEA 5H92C 4A9AA 1FO4A 1JALA 3EUB2 2WDVB 2WQYB 3AE2B 4YSZB 1WXQA 3AE7B 1JW9D 3ABVB 2AX5A 1OFFA 4LTUA 3AEFB 3W5UB 3VRBB 2WU2B 2ACZB 1N61A 1JWAD 1R7SA 1T3QA 1KF6B 1EWYC 1FRRA 1IUEA 1I7HA 1NVID 1TJEA 2DBYA 3KWLA 3NVWA 3W5VB 2CJOA 1RWSA 3AE8B 3NVVA 3AE6B 1FXAA 2HTME 2QJLA 1DGJA 1JROA 2PIAA 1L0VB 1KRHA 3AH7A 5C3JB 2Y5CA 1GT8A 1JRPA 1DOYA 1FIQA 2H89B 1DOXA 1WYGA 1E0ZA 2M56B 4YSXB 1N5WA 2JQRB 3NVYA 4YXDB 3P1MA 3B2GA 1NEKB 1UWMA 4N58A 5MPOA 3AE3B 2PVGC 1FM0D 2WP9B 2WU5B 2L83A 2N0SB 5AUIA 1ZXIA 3AM9A 3AN1A 1DOIA 1WRIA 4WWMA 4YTNB 5EE0A 4C7YA 4YTMB 1TKEA 1XLPA 3DWGC 1QOGA 2H88B 1JWBD 1JQ4A 1NENB 3P4PB 1GTHA 2CU3A 3AV8A 4ZHOA 1VJKA 3P4QB 3AEBB 3AEDB 1PFDA 4HROA 5G5HA 2WDQB 4C7ZA 3L4PA 1N60A 2KAJA 3SFEB 2K5PA 3AE5B 2PKOA 4US9A 1B9RA 2BS2B 5EE1A 3SR6A 1QLBB 1ZOYB 1J7CA 4YT0B 2BS4B 1CJEA 2FBWB 1E10A 2BS3B 1N63A 1H7XA 1OQQA 2CJNA 2L52A 3B2FA 1QF6A 1ROEA 3CF4A 3P4SB 4USAA 1L6UA 4JWUC 5H8YE 1RFKA 2MJDA 3P4RB 2OHFA 1YQ4B 2WDRB 1RM6C 1XLNA 1WWTA 1NI3A 2E3TA 1YQ3B 2M19A 1QOAA 2W55A 4ZOHC 1OQRA 3BIID 1QOFA 5EE3A 3DWMA 3CWIA 2B76B 3FAHA 3NRZA 2LEKA 2K22A 1FXIA 3VR9B 2JX5A 1YJJA 1ZUD2 3AEGB 5G5GA 1E9MA 2MJ3A 1J7AA 3VRAB 3AMZA 1V97A 1QOBA 4N6EB 5EE9A 1N5XA 3PO0A 1FFUA 3LB8C 4WQMA 4HRSA 2G1EA 1FRDA 2MH7A 4N59A 1GPXA 1XLOA 1VDVA 3AE1B 1E6EB 4YSYB 1ZP0B 1PUTA 4KX6B 1TKYA 4IDIA 4JWSC 5AUKA 1RYJA 1QT9A 3LXFA 1SF0A 1XLQA 1YJIA 3AB5A 3FC4A 3VR8B 4JX1C 1AWDA 3AEAB 1A70A 1L5PA 2BT6A 2EKIA 2K9XA 2W3SA 2WLBA 5GXGB 1PDXA 1SB3C 3SFDB 4US8A 3AE4B 1N62A 1V8CA 3W9CB 1L6VA 4ZHPA 3NVZA 3WCQA 3P63A 3NS1A 3AEEB 1TYGB 2WS3B 5C2TB 4FXCA 3HUIA
chains in the Genus database with same CATH superfamily
3BVMA 1IP9A 2JWZA 2JXXA 3P2BA 2V3NA 5CX3A 1E7PB 3AECB 4OZAA 5D7GA 3IVFA 1K50A 2WNMA 2J0MA 1J8CA 2MJEA 2WXQA 4RF1A 4ICVA 2JT4B 1STEA 5CTRC 1WXQA 2XNAC 4RH6A 4ZRJA 3UQBA 1M4VA 3SD5A 1IUEA 4GDKA 1RWSA 3MC8A 3EA6A 1L4DB 3AE6B 2K8CA 4FJVB 1I4RA 3PSEB 3PLUA 5AZHA 2NTSA 3DBLI 4FA6A 1TS4A 4W9FA 1E8YA 1WFYA 2SAKA 4PT5A 1FM0D 2LRUA 4HVBA 5IN7A 1DOIA 3UQAA 1V9JA 5DCNA 4II2B 2L0FA 4HJGE 4GXBA 1I42A 3AV8A 2LVOA 3RD2A 1VZ7A 2DAFA 4W9EA 3T9LA 3TMPB 3GB1A 3ALBA 2MP2A 3MC0B 1WR1A 5CHWA 2NVUI 5LXHA 3P4SB 1H4RA 2RDGA 5H8YE 2LUEA 3ECIA 3O65B 2DLBA 2MBQA 2N9PC 4ANUA 1P7FA 5EE9A 1FCLA 3PO0A 2ZJDA 4HRSA 1GB1A 2WXMA 2MH7A 1XLOA 4XX5A 4IDIA 5DPTA 4GSWA 1Z2MA 5FR3A 2FE8A 2EKIA 3AXCA 2K9XA 2N1VA 3L10B 4WWNA 4A6QA 3W9CB 3NVZA 1UGMA 1T5XD 1KLGD 1EUVB 2BWFA 2BB6A 3MC9A 4WAFA 3A1QA 3AE9B 1FNWA 2ZW0A 4MELA 2K8HA 1HE8A 2X8XX 3NUHB 1SE3A 2ZPYA 5H92C 4FLHA 4K3CA 5BYQA 3ABVB 1D5ZC 2QCZA 5TSSA 2KMAA 1FNVA 2KT7A 3ONSA 2WGSA 4NNJB 2J0JA 2C5LC 2D5GA 5JHAA 1TT5B 3MJ5A 4IWPA 2D2QA 3DOWA 3AE3B 2L83A 4NAMA 3RNFC 2ZW1A 3X23A 2G4SA 2L76A 2RPVA 3P4PB 2QC8A 5D6JB 1IGDA 3AEDB 4WQOB 4DXFA 1V5TA 2AYOB 2PKOA 2ICIA 3EFCA 1C77A 3V3XA 1QLBB 3PZ8A 4NAWB 1GJZA 5BO4B 2REXA 4IM2A 3GP7A 1RFKA 4HEA1 1WGHA 1QOAA 4F1SA 2C7HA 1ZUD2 1WRDB 2N7DA 3VRAB 4C56C 3NZUA 2KFKB 4K7UA 1V81A 1E8WA 3WALA 3RFZB 4CO7A 5GXGB 2BYVE 3I57A 1SB3C 1WE6A 1N62A 4AOFA 2BQQA 5IA7A 5HFYA 3JSVB 3PVLA 4DHZB 4BVUC 4WJOA 1IGCA 1C4CA 4II3B 2KMMA 5IO9A 1M94A 1YNTE 2LVPA 4M0WB 2X38A 3RULA 1FPYA 1MG4A 2MHJA 3ZNID 1XQQA 2NBWB 1P3QU 4RFBA 1WX8A 4I6NB 3HM3A 4MGKE 4YSZB 3DHGC 4RGTA 1JW9D 2SEBD 2QMTA 1JWAD 3A9KA 2MEKA 3AE8B 4GLSC 1FXAA 4XGAB 1QILA 3H8HA 2INCC 2JU6X 2H89B 3TUOA 2FCQA 2KQSA 2C60A 4MGZE 3DQVA 1WIAA 2WHIA 2KDIA 2J52A 4W9CA 2XK5B 3DWGC 1CK1A 1ZPSA 4EFOA 3R8BA 2BTEA 2Y3AA 4IKGA 3UINB 1B9RA 2FNJB 1XT9B 4YT0B 5J17A 1SJED 4USAA 1TS5A 3P4RB 2M0XA 2IJ0A 3DWMA 1ACCA 4FADA 2MJ3A 3AULA 2DNFA 4ARIA 3KUCB 4FN2A 3WA0A 2GBKA 2IGGA 3RNAC 3K9PB 3R2TA 3V62A 1E8ZA 1YJIA 1AWDA 1L5PA 4XZ4A 1FD6A 1VD2A 2BVCA 4A8XC 2LGSA 4AUQC 1YX5B 2DWQA 5BMHA 3VH4B 1E90A 4YTPB 4ZRKA 2XN9C 3RMKC 2LI5A 1TY0A 4GDLB 1TKGA 1TTNA 1SIJA 4DBGA 1HTQA 1WXAA 3EUB2 2K8BA 5JH5C 1WH3A 2HJ8A 3MHSD 2AX5A 3AEFB 1HXYD 1S3SG 4LJOB 3UI3A 1TJEA 3UF8A 2KD0A 2O2VA 1C9FA 4M01A 1R4NI 1KRHA 1V2YA 1OGWA 2JQRB 4ICUA 3EFUA 2L0TA 2L05A 4LDTB 4NJ6A 3URYA 5AUIA 4WURA 3AN1A 1F9JA 4YTMB 1TKEA 3CSFA 4FHJA 1QOGA 5BYSA 1UBQA 3LJ3A 4WJPA 3SDLC 1PFDA 2MWSB 5LXIB 2KAJA 2DHZA 3AE5B 2JXTA 2IDYA 4RGOS 2KJ6A 2JRIB 4RCOA 1LGRA 3M3JA 4ZDVA 1D5MC 1T6BX 2L52A 3L16A 2CHWA 1J19A 1XLNA 4BAXA 2E3TA 3CWIA 1WSPA 1ZXHA 2K22A 2KX3A 5D94A 1J7AA 4N6EB 5HG2A 2LMCA 1XCTL 2L32A 2KTRB 2LZ6A 3GZNB 1PUTA 3DBSA 3EHVA 3QHTA 3VR8B 1L0XB 5D3DA 2WLBA 2KOXA 3NY5A 4GDKB 3DHIC 1WJUA 3R3MA 2WYQA 2PPHA 2IGHA 3ZVVA 1L2NA 3U30A 1D5XC 3R7QA 4GOCA 4RM8A 4JGHB 3AU4A 3I5JC 2JF5A 5C23A 2KZRA 2DX5B 3Q69A 2KJHB 2C7MB 1R4MB 1EO6A 4LLGM 2PVOD 2CHXA 2B3AA 1F0ZA 4LCDE 1FO4A 3E56A 1TIFA 4EE2A 1WJNA 1GC7A 3TSSA 1ZW7A 3KWLA 1I7HA 4CYEA 2MP2B 2PJHA 3BVZA 2HTME 2RDHA 3A33B 1QZEA 3ZRCA 1DOYA 1FIQA 2GBMA 3IHPC 3C19A 3DDCB 4DHJD 2K25A 4PS8A 4KIKA 1IBXA 3D32A 2PVGC 3BVGA 3Q6BA 4IC7B 4YTNB 2MBEA 2NCNA 5G55A 4L23A 4IWQA 1V1OA 4KZCA 1SBBB 1VJKA 1EWCA 2G4DB 5G5HA 1PYWD 2IPKD 2KK8A 2MRPA 4AJYB 4IUMB 4OHJA 2GBNA 2V9HA 2BS4B 4LNFA 2GLSA 2DYMA 1TS2A 4L1BA 4IG7B 5EE3A 2INPE 3VTUA 2JX5A 2UWQA 3AMZA 1C4AA 4EOYA 2WXNA 4J6IA 1ZP0B 1EU3A 1RYJA 3PV1A 3UIOB 3AB5A 4KV2A 2DAJA 3PZ7A 1IPGA 5AZGA 1PDXA 2LFIA 4NPNA 4HLEA 2D3CA 4RGMA 2KJRA 3U7ZA 1QKZA 1ET9A 2QEJC 5C2TB 3HUIA 1P98A 3K9OB 2EMSA 4JE3B 4TQ0A 4C4VA 5GMVA 2YLMA 4P16A 2LGIA 1XO3A 2V1YA 1C79A 2YVCA 2A4ZA 1C3TA 4M8NA 2WDVB 3GS2A 4BBNF 2NBUA 3ML8A 4EZJA 2RR9A 5KHOA 4EZLA 1WMHA 3MFGA 2WXRA 1WX9A 4JQWC 1P1AA 3A4RA 1JROA 3VDZA 4KGSA 4YSXB 4EKUA 1WY8A 2G45B 1Q5WB 4N58A 4H2AA 2N4FA 4DXAB 2KC2A 3N9YC 4JLCA 3P4QB 3NHEB 1SE2A 3RI7C 1QQRA 2WDQB 4C7ZA 2R2QA 1WX7A 3WAMA 1GNUA 3C8YA 3PTFC 3SHQA 3Q2AC 3X0WA 3R66C 3M63B 2KWUB 1L6UA 2WDTB 3VUYA 2LRWA 3U2SC 3QJZA 2BGFA 4OVUA 4W9LA 4EZKA 1TGZB 1QOFA 2KLCA 2B76B 5IOIA 2D3GA 3ZW3A 4MT5A 2K0PA 4MEMA 1VDVA 3DVGX 1TKYA 3IT4B 1MFWA 2I2YA 3LXFA 3PLVA 4MGYE 2IO1B 2GBJA 1UGJA 1ZGUB 4KDLB 4ANVA 3WCQA 3P63A 3RNGC 2KFJA 4NQLB 3NZSA 2JYTA 3KYCD 2WWZA 2V3PA 2GB1A 4NJ7A 2M0AA 3VAWA 1KTKA 4KKIA 1EF1A 2JWUA 3L17A 4ITKA 4P1BC 1HZ6A 3ZTDA 3AE2B 1FXTB 4LNOA 2O6VA 3L0WB 1SE9A 1NVID 3TCAA 3APCA 2LJ5A 1G6JA 3RNEC 1JRPA 2JYEA 4TKNA 4R3DA 3TEXA 1NBFC 4GMVA 4G50A 3P1MA 1UWMA 2KVZA 1SJHD 2RGFA 2M8SA 1WXMA 3ZO5B 4M8MA 1XLPA 5JZEB 4W9DA 3PZDA 1NENB 1LFDA 2BB5A 2MW5A 1FCCC 1YN5A 2VZKB 1L0YB 1TS3A 5EE1A 4TUUA 4AS1A 2BS3B 1EM7A 1H7XA 1OQQA 2VH2A 2PW9A 3NOBA 1QF6A 1ROEA 1T0YA 3QK0A 3RN9C 3BIID 2WX1A 5LNK1 3NRZA 5IAAC 2HD5B 3DVNV 3QARA 4A55A 1RFAA 4ZYNA 3PHWB 3OG5A 1SXTA 1BMLC 1V80A 2JUOA 3DCGA 2WX0A 2KKCA 3VVWB 1SF0A 1I35A 5HHDG 1V1PB 2W3SA 4B95A 2FCSA 2KXJA 1F52A 4BKSD 4URKA 4ZRQA 2PMVA 2BPSA 2O2VB 1E7VA 4EEWA 1I4PA 3HVZA 4C00A 1C76A 4F8CB 4BKTA 2QIEB 1VRAB 3H1UA 2W3RA 2QSDA 2ZCCA 2VRRB 4I6LB 1VLBA 2PE6B 3PRZA 1YX6B 2R61A 3R2IA 4LTUA 3W5UB 1T3QA 1UBIA 3AI5A 1KF6B 1EWYC 1ZDVA 3NVWA 4MH8A 3W5VB 5KHQA 1OTRB 2QJLA 1DGJA 3Q3FA 2C7NB 4K1RB 2N9LA 1P9DU 1DOXA 2Z8LA 3MHZA 2QILA 3GZNI 5LLIA 4ZRPA 2WXLA 2WXIA 4C7YA 2ZEQA 5J2RA 3ZDTA 3AEBB 3DBLB 4W9IA 1WXVA 2I38A 3TBLD 4BBNC 1GB4A 3DHHC 2JZPA 3VQIA 2FUG1 3FILA 4A3OA 4K3BA 2LVQA 3FAHA 2N9KA 2LEKA 1IYFA 4HCPB 4WJNA 3VXWA 1EF5A 1V97A 1QOBA 1N5XA 3KWVA 2KWDA 4ANWA 3IT6B 5BMGA 5T8IA 3IG3A 3VUXA 1XD3B 2V4IB 3N20C 2K1FA 1PGXA 2O6VD 3ZNGC 5IP4D 2N1WA 3TEZA 2AWTA 4K81A 1E7UA 3TL5A 1GAQB 3N1ZC 4GGQA 4C80A 2XEWA 1WGKA 1IBXB 2QHOA 1YOVB 3A4SC 2FIFA 1NYQA 4RM9A 2Q5WD 2D07B 4A9AA 2KDBA 4DWFA 4REZA 4PK1A 4XDDA 1WI0A 4NZLB 4M00A 1YN3A 2ACZB 1I4XA 1Y8RC 1JWUD 3GE3C 3QX1A 4HPLB 2JVCA 1WJ6A 2FCNA 1L0VB 2LJIA 1GT8A 3H6NA 3KLSX 1E0ZA 2CKHB 5IKCM 1JCKB 4ASWC 1K8RB 4AWJA 1TBEA 3PREA 2N0SB 2HJ1A 1Y56A 4B0EA 1SEBD 1SE4A 1EU4A 4HROA 1AW7A 2JY6A 3GOEA 2GRIA 3QA8A 1K51A 2L7RA 1BT0A 2K5PA 3WAOA 4KKJA 1CJEA 1YMHE 2CJNA 3EGRA 4W9HA 2PE9A 2BBCA 3MP9A 3C0RB 1MI0A 3QAQA 4MM3A 1DYQA 2AL3A 2FIDA 3OWEB 5L95C 2KWVB 1YJJA 5CHVC 3AEGB 1UF0A 4A3PA 1HQRD 4XE0A 1FEHA 3M62B 3PRPB 4MSMB 2G1EA 2JSVX 4BOZB 4HWIB 4TSSA 2DZJA 1OEYJ 1Q1OA 1XF5L 4FBJB 2WXFA 1H8CA 1L6VA 2UU7A 1SIFA 4IM0A 1WM3A 3DBHB 4G3XB 3Q3MC 1KOTA 2MX2A 5D3IB 4ANXA 2PLPA 4LNIA 1CZPA 1YQBA 4IOIE 4OVZA 1KLUD 2N7EA 3ZNZB 4M0WA 3DVGY 5C1ZA 5DPSA 1AYFA 1L4ZB 1ZE3D 1MPEA 3H7SA 3BYYB 2HDEA 5CHFA 2Z59B 1V49A 4WAAA 2MBOA 3VRBB 2WU2B 3TIXA 2WXKA 3L54A 4Q2JA 4RMAA 4MGIE 4A90A 3NZ3A 3VUWA 2M56B 1J0GA 1HZ5A 2LHEA 1Q0WB 3ENEA 2IGDA 4JL9A 3B2GA 2HTHA 1NEKB 1KLVA 1XCQL 2QDFA 3BYTB 4XWTA 1MHXA 2R2OA 4HPMB 4FULA 4HDOA 2H88B 3BZDB 4LJPB 2XK5A 4UDUC 2JRHA 4AP4C 3SEBA 4YL8A 3IXSA 4US9A 3ZTCA 2DZKA 3RZWC 3VTVA 3Q8EA 1YQ4B 2Y5BB 3W1YA 2ZNVB 3HK0A 4ARCA 1NI2A 4KGTA 4FJYA 4EUTA 1PQSA 4WJQA 3O13A 3V05A 4KVGB 4YSYB 4JWSC 1QT9A 4E74A 1YIWA 4S17A 1A70A 2UYZB 1E8XA 4MACA 4CQNA 3A1QB 3ETRA 1UWXA 4KDIC 3QIJA 1FMAD 3SU8X 3M95A 4AQ7A 3VH3B 1AN8A 3ZYYX 1WZ3A 3CIRB 2FUHB 3Q3NC 4ACFA 2KANA 2ZVOA 3B9JA 3BWUD 2KN4A 3U7DA 3N1YC 3ZLZA 1SSNA 5E6NA 4XC2A 2CJOA 3E9SA 4HPPA 3NVVA 2INDC 2YEPB 2MA9B 3RCZA 3V60A 1WGRA 1D4BA 2PIAA 1WGDA 5G2NA 2BYTA 5D2MB 1WF9A 2NS5A 1C1YB 2NPTA 3BINA 3V6CB 3H7PA 1UELA 4M02A 4BKSA 1JWBD 3AU5A 1F2RI 3QQ8B 4DHZE 2CU3A 1GTHA 4HCNB 3ZUNA 2LXAA 4MDKE 3ZXVA 3NJTA 3RNCC 2INNE 5FK9C 2GOWA 1J7CA 1BUIC 1RLFA 4GU2A 1N63A 2GI9A 2J53A 2N7JA 3CF4A 1WGYA 3N30A 2L8JA 3ZKJC 1RM6C 1I4QA 2KTFA 3U52E 1SGHA 1WJ4A 1YJ1A 1FFUA 1S1QB 3BK2A 3JW0X 1CQVA 1PGBA 2KTRA 1P0RA 3V6EB 2M17A 4MH0E 5AZFA 2BT6A 3U4EG 3WAPA 3R7RA 4BOSC 1JWMD 4OW0A 1TY2A 2WS3B 3ZIMA 3TEWA 1WM2A 2W9NA 3N1XC 1N6ZA 4MJSA 4KSLC 3UGBB 4P6VF 3BY4B 4NJCA 3HRDD 1J7BA 3RPFC 3ZJUA 1E5WA 1T0SC 4B0MA 3APFA 3ZRFA 3KW5B 1NYRA 3KH0A 1WR6E 3ZDMC 3A9KB 2HE7A 2W54A 1HA5A 1WZ0A 1AARA 3I3TB 2KHWB 2LASA 1HEZE 3QWZB 4HXDA 1TZ1A 1UUPA 2WXHA 2NR2A 3CSTA 1GC6A 4HKQA 2JZZA 3FILB 2DYBA 1TZOA 1ZXIA 3DBRB 2WXGA 4KGRA 2AQ2B 3MTNB 4GIVA 4BKGA 3S2AA 1JRUA 2L3ZA 4DHJB 1E10A 4TQ1A 4X57B 2MCNB 2LXCA 2V0GA 2MJDA 1V86A 2L00B 4ZOHC 1C4PA 3Q8AA 3LB8C 4HK2A 3AE1B 1XXGA 1MHHE 2FAZA 1I4GA 4GN1A 1VCBA 1FNUA 5AUKA 3Q8CA 2K39A 3JVZX 3ZGZA 2CU1A 3IFWB 3KUZA 5TR5A 4GB9A 4P1CC 4PYZA 4S0RA 3J9CA 2EKEC 2ZVNA 4RF0A 2NTTA 4KSKC 1H7WA 5E6OA 1BXTA 4KZ0A 1K52A 3A9JA 1D6EC 5AEKB 4LDTD 2BYEA 2WQYB 2IY1B 2KACA 2KDMA 3QCAA 4K7SA 2KC1A 4G0NB 5JXVA 2LHDA 2N9EB 3CMMB 4DK5A 3NS8A 4ZYSA 3T3OA 5I4DA 3KYDD 1V5OA 3N3KB 4W9GA 5J18A 3NVYA 1NDDA 5BMIA 2BW2A 3ML9A 4MM3B 1F2RC 2PTLA 4N9F4 3RUIB 3AM9A 4IW0A 1F77A 4HDQA 1MG8A 5EDSA 2L1AA 3DBHI 2AQ1B 1ZDXA 2J7QB 4LK0M 3IBEA 3QC8B 4W9JA 1ZOYB 2J0KA 1C78A 2NBVB 4JWUC 2OJRA 1PGAA 3HHMA 2WDRB 3KUDB 1WWTA 1YQ3B 2W55A 2Y5PA 3ZXRA 1MVKA 3VR9B 2KNBA 4LNKA 4AJWA 2EMTA 1GUAB 4PS3A 2CHZA 3LYYA 3PRMB 2N9XA 3RZFA 3W1SC 4WWOA 1LQBA 1XLQA 2K6QA 2FCMA 3CF6E 4XYCA 2RMMA 4F7ZA 3IAS1 3SFDB 1R4MI 4RGNA 4ZHPA 4XDCA 4ZRIA 3DVNU 2D10A 1GTEA 4DQOC 2KVRA 1UD7A 2AEHA 2W82A 1OQYA 1ZKHA 3DPDA 2BYFA 4E3CA 4E71A 3PT2B 1JALA 1WXSA 2ZPNA 3WIMA 4XWWA 4PYUA 2JZ3B 1I4HA 2BF8B 1FRRA 4D2KA 2MLBA 2JPHA 1K53A 1V6EA 4JIOU 3APDA 2BKFA 4G11A 5C3JB 1KM7A 4KIKB 4CHKA 3HIZA 1N5WA 3EC8A 4YXDB 3KVFB 3TEYA 2YEPF 3LDZE 2RPQA 5EE0A 1WRIA 4WWMA 4J3OD 3Q14C 3WANA 2KX0A 3L4PA 4WH4A 1N60A 2LGXA 3VHTC 4B6WA 2DZMA 2IO2B 2BS2B 3I63C 2GMIC 5E6JA 2WXJA 4JPSA 3B2FA 1L7YA 3BK1A 4IWOA 3ZNHB 2AL6A 5DPWA 1JMLA 2OHFA 1KJTA 1ENFA 1OQRA 3RNBC 1FXIA 3ZQ4A 3L08A 5G5GA 2M4NA 4OZCA 4DDID 1X1MA 4WQMA 3KQ4A 2CR5A 4YWGG 4N59A 1GPXA 1ESFA 2MSED 1Z5SB 3ZJVA 1U4AA 2LGYA 3FC4A 2DYOA 3T3NA 4NAWA 2K3UA 1UZXB 1V1PA 3N32A 3RYTA 1ET6A 1TYGB 3Q8FA 5BYRA 3FKYA 1WGGA 4C4VB 2Z0DB 2KO3A 4BFRA 1VZ6A 1KH0A 2D3BA 3HM6X 3PPAA 1T0RC 2IO3B 2NPTB 3RT3B 2KFKA 1HTOA 4W9KA 1YN4A 3H7PB 1UH6A 1GG3A 4FHKA 1KFYB 3Q3JA 2BWES 3OJ3A 3B0AA 2KQ7A 2OJWA 2LUMA 5HI1A 1N61A 1R7SA 1WMHB 2DBYA 4HKZE 3JSVA 4MSQB 2LD9A 3UIPB 2Y5CA 1A5RA 2KYWA 2WXOA 4FJZA 1WYGA 4RNAA 2ASQA 1JWSD 3W1SA 2OEDA 1MJDA 4TMAB 2WU5B 3JYUA 3VFKA 2IZVB 3W2DA 1YD8U 3PHXB 4NY0A 1JQ4A 3Q8BA 3B08A 1T0QC 3VTWA 5E6PA 2VH1A 3SFEB 3OLMD 3T8MA 3SR6A 4OZBA 2PEAA 2IO0B 2OOBB 2KDEB 2IY0B 3OAWA 3Q3OC 1NI3A 4OVVA 2XBBC 4MJSB 2LGDA 3I9V1 4IM3A 2Z0EB 2KLGA 4BZAA 3MJWA 3EECA 1FRDA 2ZZPB 1E6EB 4NQKE 4KX6B 1LM8B 5FKAC 5JHBA 1UNSA 1LXDA 3PS6A 2EELA 1CMXB 2V3SA 3U8ZA 5DPRA 5MPOA 3IAM1 1FFVA 3DBRI 2RSUA 5HKHA 4A20A 4O1NA 2MQJA 2K6DB 1GOZA 4P7IA 2RDBC 1WE7A 2I1JA 2O6VB 2KQ4X 2CS4A 2KMCA 4QAYA 3NG0A 1P7EA 2J42A 2ON8A 2ZNVC 2I1KA 3AE7B 3P42A 1ISNA 1OFFA 2A5UA 5FR6A 2IYDB 2GBRA 2D11A 4WWPA 2TSSA 2VZKD 5L83A 2NMQA 2M1MA 2MBHA 4I6PA 3AH7A 2DZIA 4HJKA 2MBBB 2BKRB 2V4LA 2RD0A 3ZJTA 3PGEA 4GDLA 2WP9B 2AQ3B 2KN5A 1Q10A 1XEEA 2J4XA 3V61A 2WXPA 2G9HD 2ONQA 4WIPA 4ZHOA 2ZCBA 1VZ8A 4DDGD 4PS7A 4TV3A 2FBWB 2KDFB 1WYWB 3OJ4B 3TJPA 4LNNA 4L2YA 2G3QB 2M19A 3L13A 4K7WA 1RAXA 1R4NB 1D3ZA 1E9MA 2DENB 2D3AA 3A9JB 1RRBA 3HVDA 2IBIB 2C9WB 3H9DA 4B9KA 4JX1C 3B1LX 3AEAB 1F1HA 1OEYA 2LWPA 1LO5D 4US8A 3AE4B 1V8CA 4DXGA 1B1ZA 2E6XA 1VR9A 3NS1A 3AEEB 2KWCA 3GE8C 4FXCA
chains in the Genus database with same CATH topology
1D5XC 3BVMA 1GAQB 3J9CA 3Q69A 2V3NA 4RF0A 4C80A 1WGKA 1IBXB 2NTTA 1E7PB 4LLGM 3AECB 2PVOD 4OZAA 5D7GA 1NYQA 1H7WA 1K50A 2WNMA 1BXTA 1K52A 2Q5WD 1D6EC 1F0ZA 2MJEA 4A9AA 1FO4A 3E56A 2WQYB 4REZA 2WXQA 4RF1A 2KACA 4EE2A 2KDMA 1STEA 4XDDA 1WXQA 2XNAC 4RH6A 4NZLB 1M4VA 3TSSA 5JXVA 2LHDA 1YN3A 2ACZB 1I4XA 3KWLA 1I7HA 1IUEA 1JWUD 1RWSA 3EA6A 1L4DB 3AE6B 3BVZA 4ZYSA 3T3OA 2HTME 2RDHA 5I4DA 1L0VB 2LJIA 1I4RA 1GT8A 1DOYA 3KLSX 1FIQA 1E0ZA 2NTSA 1JCKB 3NVYA 1TS4A 5BMIA 2SAKA 1IBXA 2BW2A 4MM3B 4PT5A 2PVGC 1F2RC 1FM0D 2N0SB 2PTLA 3BVGA 3AM9A 1DOIA 4YTNB 1F77A 1Y56A 4HJGE 4B0EA 1SEBD 4L23A 1SE4A 1EU4A 1V1OA 3AV8A 1SBBB 1VJKA 4HROA 1EWCA 1VZ7A 1AW7A 2L1AA 5G5HA 1PYWD 2IPKD 2AQ1B 2GRIA 1K51A 2K5PA 3GB1A 1ZDXA 4LK0M 4OHJA 4KKJA 1ZOYB 3MC0B 2BS4B 1CJEA 1C78A 1YMHE 2CJNA 3EGRA 3P4SB 2RDGA 2BBCA 5H8YE 4JWUC 1PGAA 3MP9A 2DYMA 1MI0A 1TS2A 2WDRB 4L1BA 1WWTA 1YQ3B 1DYQA 2DLBA 2W55A 2Y5PA 5EE3A 1MVKA 2INPE 3OWEB 3VR9B 2JX5A 1YJJA 3AEGB 1HQRD 3AMZA 1P7FA 1C4AA 4XE0A 5EE9A 1FEHA 3PO0A 1FCLA 4HRSA 3LYYA 2WXMA 1GB1A 2G1EA 2JSVX 2MH7A 2WXNA 1XLOA 1ZP0B 4IDIA 1EU3A 1RYJA 1XLQA 3AB5A 5FR3A 2FE8A 2EKIA 2RMMA 4TSSA 1XF5L 2K9XA 3PZ7A 4A6QA 1PDXA 2LFIA 3IAS1 3SFDB 2WXFA 3W9CB 1L6VA 4RGNA 4RGMA 3U7ZA 4ZHPA 3NVZA 1QKZA 1T5XD 1ET9A 1KLGD 2QEJC 4XDCA 5C2TB 3HUIA 2BB6A 5D3IB 4WAFA 2PLPA 1CZPA 4JE3B 4TQ0A 4IOIE 3AE9B 1FNWA 1KLUD 4OVZA 2ZW0A 1GTEA 4M0WA 4P16A 4DQOC 2W82A 2LGIA 1AYFA 1XO3A 1L4ZB 3NUHB 1SE3A 1MPEA 1C79A 1ZE3D 3BYYB 5H92C 2HDEA 1JALA 2WDVB 3GS2A 5BYQA 4XWWA 3ABVB 1D5ZC 5TSSA 3VRBB 2WU2B 1I4HA 1FNVA 1FRRA 4D2KA 3MFGA 2WXKA 4Q2JA 1K53A 2WXRA 1JROA 2D5GA 3MJ5A 4A90A 5C3JB 4KGSA 3NZ3A 2M56B 4YSXB 1HZ5A 1N5WA 4YXDB 2LHEA 2IGDA 3TEYA 3B2GA 1NEKB 1XCQL 4N58A 3AE3B 2YEPF 4H2AA 2L83A 3BYTB 4NAMA 5EE0A 4XWTA 1WRIA 4WWMA 4FXCA 1MHXA 2H88B 2ZW1A 3BZDB 2RPVA 4J3OD 3P4PB 3N9YC 4UDUC 3P4QB 1IGDA 3AEDB 1SE2A 1QQRA 4DXFA 3SEBA 2WDQB 4C7ZA 3L4PA 4WH4A 1N60A 2PKOA 2ICIA 3IXSA 4US9A 2BS2B 3C8YA 1C77A 3V3XA 1QLBB 3PZ8A 4NAWB 5E6JA 2WXJA 4JPSA 3B2FA 3GP7A 3BK1A 3Q8EA 1L6UA 1JMLA 1RFKA 4HEA1 2OHFA 1YQ4B 3U2SC 1ENFA 1QOAA 1OQRA 1QOFA 4ARCA 2B76B 1FXIA 1ZUD2 5G5GA 3ZQ4A 4MT5A 3VRAB 4OZCA 2K0PA 4C56C 4KGTA 4WQMA 3KQ4A 4YWGG 4N59A 1GPXA 1VDVA 1ESFA 3O13A 3V05A 4YSYB 4JWSC 1TKYA 3IT4B 2I2YA 1QT9A 3LXFA 3ZJVA 3FC4A 2DYOA 3RFZB 5GXGB 1A70A 3T3NA 2K3UA 3I57A 1SB3C 1UGJA 1V1PA 1N62A 4MACA 1ET6A 3WCQA 3P63A 5HFYA 4CQNA 1TYGB 3Q8FA 5BYRA 1IGCA 1C4CA 3ETRA 2KMMA 2JYTA 1UWXA 1YNTE 1VZ6A 1FMAD 2V3PA 1KH0A 2GB1A 2X38A 2M0AA 1KTKA 4KKIA 4AQ7A 2JWUA 1AN8A 3ZYYX 4ITKA 1YN4A 3CIRB 4RFBA 1HZ6A 1KFYB 3B9JA 3BWUD 3AE2B 4YSZB 2KN4A 4RGTA 1JW9D 2SEBD 2LUMA 2QMTA 5HI1A 1N61A 1R7SA 1JWAD 1SSNA 1NVID 2DBYA 2MEKA 2CJOA 4HKZE 3E9SA 3AE8B 3NVVA 4GLSC 2YEPB 1FXAA 1D4BA 1QILA 2PIAA 3H8HA 2JU6X 2Y5CA 1JRPA 2JYEA 2WXOA 2H89B 2BYTA 1WYGA 4RNAA 3TUOA 4R3DA 1JWSD 3TEXA 2OEDA 3W1SA 3P1MA 1UWMA 4TMAB 2WU5B 1SJHD 3W2DA 2J52A 1XLPA 3DWGC 1JWBD 1CK1A 1F2RI 1ZPSA 1JQ4A 1NENB 2CU3A 1GTHA 3Q8BA 2BB5A 3R8BA 2BTEA 1FCCC 2Y3AA 1YN5A 2VZKB 4IKGA 1L0YB 3SFEB 1B9RA 1TS3A 2INNE 5FK9C 5EE1A 3SR6A 1J7CA 4YT0B 1BUIC 4OZBA 4AS1A 2BS3B 1EM7A 1H7XA 1N63A 1OQQA 2GI9A 2J53A 1SJED 2N7JA 2PW9A 1ROEA 1QF6A 3CF4A 1TS5A 4USAA 3P4RB 1RM6C 1I4QA 1NI3A 2IJ0A 3BIID 3U52E 3DWMA 5LNK1 1ACCA 3NRZA 4A55A 3I9V1 2MJ3A 4ARIA 1FFUA 3BK2A 1SXTA 1BMLC 1FRDA 1CQVA 1E6EB 1PGBA 4KX6B 2IGGA 3R2TA 1SF0A 1YJIA 5FKAC 5HHDG 1AWDA 1V1PB 2W3SA 1L5PA 2BT6A 1UNSA 1FD6A 3U4EG 4A8XC 2EELA 4ZRQA 2PMVA 1JWMD 4OW0A 1TY2A 2WS3B 1I4PA 5MPOA 2DWQA 3IAM1 5BMHA 3TEWA 3HVZA 1FFVA 1C76A 4YTPB 2XN9C 2QIEB 1VRAB 4P6VF 4O1NA 2W3RA 1TY0A 4NJCA 2QSDA 3HRDD 1J7BA 1GOZA 4GDLB 1VLBA 3RPFC 3ZJUA 1TKGA 4B0MA 1SIJA 1NYRA 2R61A 2KQ4X 3EUB2 3R2IA 1P7EA 2J42A 2ON8A 3AE7B 3P42A 2AX5A 1OFFA 4LTUA 3AEFB 1HXYD 3W5UB 1T3QA 2W54A 1HA5A 1KF6B 1EWYC 1ZDVA 3NVWA 4MH8A 1TJEA 3UI3A 3W5VB 2TSSA 2VZKD 1C9FA 2QJLA 2NMQA 1DGJA 1KRHA 3AH7A 1HEZE 2N9LA 1DOXA 1UUPA 2Z8LA 2WXHA 2JQRB 3ZJTA 3MHZA 2QILA 4HKQA 3FILB 2WP9B 1TZOA 2AQ3B 5AUIA 4ZRPA 2WXLA 3URYA 4WURA 1ZXIA 3AN1A 2WXIA 4C7YA 1Q10A 1XEEA 2J4XA 4YTMB 1TKEA 2WXPA 1QOGA 2WXGA 4KGRA 5BYSA 2G9HD 2ONQA 4WIPA 2AQ2B 4ZHOA 3AEBB 1PFDA 1VZ8A 2KAJA 3AE5B 2I38A 2JXTA 2IDYA 4RGOS 1GB4A 4RCOA 2FBWB 1E10A 4TQ1A 1D5MC 1T6BX 2L52A 2V0GA 2MJDA 2JZPA 3VQIA 4L2YA 1XLNA 2FUG1 2E3TA 2M19A 3FILA 4ZOHC 3CWIA 3FAHA 1WSPA 1ZXHA 2N9KA 1C4PA 2LEKA 2K22A 3Q8AA 1E9MA 1J7AA 1V97A 1QOBA 4N6EB 2LMCA 5HG2A 1N5XA 1XCTL 3KWVA 2KWDA 3LB8C 2L32A 3IT6B 5BMGA 3AE1B 5T8IA 1PUTA 1XXGA 1MHHE 1I4GA 3HVDA 1FNUA 5AUKA 3Q8CA 3VR8B 2V4IB 4JX1C 1L0XB 5D3DA 3AEAB 2WLBA 1PGXA 1LO5D 4US8A 3ZGZA 3AE4B 1V8CA 4DXGA 3TEZA 1B1ZA 2E6XA 1VR9A 4GDKB 3NS1A 3AEEB 2IGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWQ A;  2W54 A;  3ETR A;  1FFV A;  2KMM A;  3HVZ A;  4YTP B;  1GAQ B;  2QIE B;  1CZP A;  1FMA D;  4P6V F;  3AE9 B;  1GTE A;  4C80 A;  2W3R A;  1WGK A;  3HRD D;  1E7P B;  1J7B A;  3ZYY X;  3AEC B;  1VLB A;  2PVO D;  4ITK A;  3CIR B;  1NYQ A;  1AYF A;  1TKG A;  1H7W A;  1XO3 A;  3RPF C;  1SIJ A;  1NYR A;  2Q5W D;  1KFY B;  1F0Z A;  3B9J A;  2MJE A;  5H92 C;  4A9A A;  1FO4 A;  1JAL A;  3EUB 2;  2WDV B;  2WQY B;  3AE2 B;  4YSZ B;  1WXQ A;  3AE7 B;  1JW9 D;  3ABV B;  2AX5 A;  1OFF A;  4LTU A;  3AEF B;  3W5U B;  3VRB B;  2WU2 B;  2ACZ B;  1N61 A;  1JWA D;  1R7S A;  1T3Q A;  1KF6 B;  1EWY C;  1FRR A;  1IUE A;  1I7H A;  1NVI D;  1TJE A;  2DBY A;  3KWL A;  3NVW A;  3W5V B;  2CJO A;  1RWS A;  3AE8 B;  3NVV A;  3AE6 B;  1FXA A;  2HTM E;  2QJL A;  1DGJ A;  1JRO A;  2PIA A;  1L0V B;  1KRH A;  3AH7 A;  5C3J B;  2Y5C A;  1GT8 A;  1JRP A;  1DOY A;  1FIQ A;  2H89 B;  1DOX A;  1WYG A;  1E0Z A;  2M56 B;  4YSX B;  1N5W A;  2JQR B;  3NVY A;  4YXD B;  3P1M A;  3B2G A;  1NEK B;  1UWM A;  4N58 A;  5MPO A;  3AE3 B;  2PVG C;  1FM0 D;  2WP9 B;  2WU5 B;  2L83 A;  2N0S B;  5AUI A;  1ZXI A;  3AM9 A;  3AN1 A;  1DOI A;  1WRI A;  4WWM A;  4YTN B;  5EE0 A;  4C7Y A;  4YTM B;  1TKE A;  1XLP A;  3DWG C;  1QOG A;  2H88 B;  1JWB D;  1JQ4 A;  1NEN B;  3P4P B;  1GTH A;  2CU3 A;  3AV8 A;  4ZHO A;  1VJK A;  3P4Q B;  3AEB B;  3AED B;  1PFD A;  4HRO A;  5G5H A;  2WDQ B;  4C7Z A;  3L4P A;  1N60 A;  2KAJ A;  3SFE B;  2K5P A;  3AE5 B;  2PKO A;  4US9 A;  1B9R A;  2BS2 B;  5EE1 A;  3SR6 A;  1QLB B;  1ZOY B;  1J7C A;  4YT0 B;  2BS4 B;  1CJE A;  2FBW B;  1E10 A;  2BS3 B;  1N63 A;  1H7X A;  1OQQ A;  2CJN A;  2L52 A;  3B2F A;  1QF6 A;  1ROE A;  3CF4 A;  3P4S B;  4USA A;  1L6U A;  4JWU C;  5H8Y E;  1RFK A;  2MJD A;  3P4R B;  2OHF A;  1YQ4 B;  2WDR B;  1RM6 C;  1XLN A;  1WWT A;  1NI3 A;  2E3T A;  1YQ3 B;  2M19 A;  1QOA A;  2W55 A;  4ZOH C;  1OQR A;  3BII D;  1QOF A;  5EE3 A;  3DWM A;  3CWI A;  2B76 B;  3FAH A;  3NRZ A;  2LEK A;  2K22 A;  1FXI A;  3VR9 B;  2JX5 A;  1YJJ A;  1ZUD 2;  3AEG B;  5G5G A;  1E9M A;  2MJ3 A;  1J7A A;  3VRA B;  3AMZ A;  1V97 A;  1QOB A;  4N6E B;  5EE9 A;  1N5X A;  3PO0 A;  1FFU A;  3LB8 C;  4WQM A;  4HRS A;  2G1E A;  1FRD A;  2MH7 A;  4N59 A;  1GPX A;  1XLO A;  1VDV A;  3AE1 B;  1E6E B;  4YSY B;  1ZP0 B;  1PUT A;  4KX6 B;  1TKY A;  4IDI A;  4JWS C;  5AUK A;  1RYJ A;  1QT9 A;  3LXF A;  1SF0 A;  1XLQ A;  1YJI A;  3AB5 A;  3FC4 A;  3VR8 B;  4JX1 C;  1AWD A;  3AEA B;  1A70 A;  1L5P A;  2BT6 A;  2EKI A;  2K9X A;  2W3S A;  2WLB A;  5GXG B;  1PDX A;  1SB3 C;  3SFD B;  4US8 A;  3AE4 B;  1N62 A;  1V8C A;  3W9C B;  1L6V A;  4ZHP A;  3NVZ A;  3WCQ A;  3P63 A;  3NS1 A;  3AEE B;  1TYG B;  2WS3 B;  5C2T B;  4FXC A;  3HUI A; 
#chains in the Genus database with same CATH topology
 3BVM A;  1IP9 A;  2JWZ A;  2JXX A;  3P2B A;  2V3N A;  5CX3 A;  1E7P B;  3AEC B;  4OZA A;  5D7G A;  3IVF A;  1K50 A;  2WNM A;  2J0M A;  1J8C A;  2MJE A;  2WXQ A;  4RF1 A;  4ICV A;  2JT4 B;  1STE A;  5CTR C;  1WXQ A;  2XNA C;  4RH6 A;  4ZRJ A;  3UQB A;  1M4V A;  3SD5 A;  1IUE A;  4GDK A;  1RWS A;  3MC8 A;  3EA6 A;  1L4D B;  3AE6 B;  2K8C A;  4FJV B;  1I4R A;  3PSE B;  3PLU A;  5AZH A;  2NTS A;  3DBL I;  4FA6 A;  1TS4 A;  4W9F A;  1E8Y A;  1WFY A;  2SAK A;  4PT5 A;  1FM0 D;  2LRU A;  4HVB A;  5IN7 A;  1DOI A;  3UQA A;  1V9J A;  5DCN A;  4II2 B;  2L0F A;  4HJG E;  4GXB A;  1I42 A;  3AV8 A;  2LVO A;  3RD2 A;  1VZ7 A;  2DAF A;  4W9E A;  3T9L A;  3TMP B;  3GB1 A;  3ALB A;  2MP2 A;  3MC0 B;  1WR1 A;  5CHW A;  2NVU I;  5LXH A;  3P4S B;  1H4R A;  2RDG A;  5H8Y E;  2LUE A;  3ECI A;  3O65 B;  2DLB A;  2MBQ A;  2N9P C;  4ANU A;  1P7F A;  5EE9 A;  1FCL A;  3PO0 A;  2ZJD A;  4HRS A;  1GB1 A;  2WXM A;  2MH7 A;  1XLO A;  4XX5 A;  4IDI A;  5DPT A;  4GSW A;  1Z2M A;  5FR3 A;  2FE8 A;  2EKI A;  3AXC A;  2K9X A;  2N1V A;  3L10 B;  4WWN A;  4A6Q A;  3W9C B;  3NVZ A;  1UGM A;  1T5X D;  1KLG D;  1EUV B;  2BWF A;  2BB6 A;  3MC9 A;  4WAF A;  3A1Q A;  3AE9 B;  1FNW A;  2ZW0 A;  4MEL A;  2K8H A;  1HE8 A;  2X8X X;  3NUH B;  1SE3 A;  2ZPY A;  5H92 C;  4FLH A;  4K3C A;  5BYQ A;  3ABV B;  1D5Z C;  2QCZ A;  5TSS A;  2KMA A;  1FNV A;  2KT7 A;  3ONS A;  2WGS A;  4NNJ B;  2J0J A;  2C5L C;  2D5G A;  5JHA A;  1TT5 B;  3MJ5 A;  4IWP A;  2D2Q A;  3DOW A;  3AE3 B;  2L83 A;  4NAM A;  3RNF C;  2ZW1 A;  3X23 A;  2G4S A;  2L76 A;  2RPV A;  3P4P B;  2QC8 A;  5D6J B;  1IGD A;  3AED B;  4WQO B;  4DXF A;  1V5T A;  2AYO B;  2PKO A;  2ICI A;  3EFC A;  1C77 A;  3V3X A;  1QLB B;  3PZ8 A;  4NAW B;  1GJZ A;  5BO4 B;  2REX A;  4IM2 A;  3GP7 A;  1RFK A;  4HEA 1;  1WGH A;  1QOA A;  4F1S A;  2C7H A;  1ZUD 2;  1WRD B;  2N7D A;  3VRA B;  4C56 C;  3NZU A;  2KFK B;  4K7U A;  1V81 A;  1E8W A;  3WAL A;  3RFZ B;  4CO7 A;  5GXG B;  2BYV E;  3I57 A;  1SB3 C;  1WE6 A;  1N62 A;  4AOF A;  2BQQ A;  5IA7 A;  5HFY A;  3JSV B;  3PVL A;  4DHZ B;  4BVU C;  4WJO A;  1IGC A;  1C4C A;  4II3 B;  2KMM A;  5IO9 A;  1M94 A;  1YNT E;  2LVP A;  4M0W B;  2X38 A;  3RUL A;  1FPY A;  1MG4 A;  2MHJ A;  3ZNI D;  1XQQ A;  2NBW B;  1P3Q U;  4RFB A;  1WX8 A;  4I6N B;  3HM3 A;  4MGK E;  4YSZ B;  3DHG C;  4RGT A;  1JW9 D;  2SEB D;  2QMT A;  1JWA D;  3A9K A;  2MEK A;  3AE8 B;  4GLS C;  1FXA A;  4XGA B;  1QIL A;  3H8H A;  2INC C;  2JU6 X;  2H89 B;  3TUO A;  2FCQ A;  2KQS A;  2C60 A;  4MGZ E;  3DQV A;  1WIA A;  2WHI A;  2KDI A;  2J52 A;  4W9C A;  2XK5 B;  3DWG C;  1CK1 A;  1ZPS A;  4EFO A;  3R8B A;  2BTE A;  2Y3A A;  4IKG A;  3UIN B;  1B9R A;  2FNJ B;  1XT9 B;  4YT0 B;  5J17 A;  1SJE D;  4USA A;  1TS5 A;  3P4R B;  2M0X A;  2IJ0 A;  3DWM A;  1ACC A;  4FAD A;  2MJ3 A;  3AUL A;  2DNF A;  4ARI A;  3KUC B;  4FN2 A;  3WA0 A;  2GBK A;  2IGG A;  3RNA C;  3K9P B;  3R2T A;  3V62 A;  1E8Z A;  1YJI A;  1AWD A;  1L5P A;  4XZ4 A;  1FD6 A;  1VD2 A;  2BVC A;  4A8X C;  2LGS A;  4AUQ C;  1YX5 B;  2DWQ A;  5BMH A;  3VH4 B;  1E90 A;  4YTP B;  4ZRK A;  2XN9 C;  3RMK C;  2LI5 A;  1TY0 A;  4GDL B;  1TKG A;  1TTN A;  1SIJ A;  4DBG A;  1HTQ A;  1WXA A;  3EUB 2;  2K8B A;  5JH5 C;  1WH3 A;  2HJ8 A;  3MHS D;  2AX5 A;  3AEF B;  1HXY D;  1S3S G;  4LJO B;  3UI3 A;  1TJE A;  3UF8 A;  2KD0 A;  2O2V A;  1C9F A;  4M01 A;  1R4N I;  1KRH A;  1V2Y A;  1OGW A;  2JQR B;  4ICU A;  3EFU A;  2L0T A;  2L05 A;  4LDT B;  4NJ6 A;  3URY A;  5AUI A;  4WUR A;  3AN1 A;  1F9J A;  4YTM B;  1TKE A;  3CSF A;  4FHJ A;  1QOG A;  5BYS A;  1UBQ A;  3LJ3 A;  4WJP A;  3SDL C;  1PFD A;  2MWS B;  5LXI B;  2KAJ A;  2DHZ A;  3AE5 B;  2JXT A;  2IDY A;  4RGO S;  2KJ6 A;  2JRI B;  4RCO A;  1LGR A;  3M3J A;  4ZDV A;  1D5M C;  1T6B X;  2L52 A;  3L16 A;  2CHW A;  1J19 A;  1XLN A;  4BAX A;  2E3T A;  3CWI A;  1WSP A;  1ZXH A;  2K22 A;  2KX3 A;  5D94 A;  1J7A A;  4N6E B;  5HG2 A;  2LMC A;  1XCT L;  2L32 A;  2KTR B;  2LZ6 A;  3GZN B;  1PUT A;  3DBS A;  3EHV A;  3QHT A;  3VR8 B;  1L0X B;  5D3D A;  2WLB A;  2KOX A;  3NY5 A;  4GDK B;  3DHI C;  1WJU A;  3R3M A;  2WYQ A;  2PPH A;  2IGH A;  3ZVV A;  1L2N A;  3U30 A;  1D5X C;  3R7Q A;  4GOC A;  4RM8 A;  4JGH B;  3AU4 A;  3I5J C;  2JF5 A;  5C23 A;  2KZR A;  2DX5 B;  3Q69 A;  2KJH B;  2C7M B;  1R4M B;  1EO6 A;  4LLG M;  2PVO D;  2CHX A;  2B3A A;  1F0Z A;  4LCD E;  1FO4 A;  3E56 A;  1TIF A;  4EE2 A;  1WJN A;  1GC7 A;  3TSS A;  1ZW7 A;  3KWL A;  1I7H A;  4CYE A;  2MP2 B;  2PJH A;  3BVZ A;  2HTM E;  2RDH A;  3A33 B;  1QZE A;  3ZRC A;  1DOY A;  1FIQ A;  2GBM A;  3IHP C;  3C19 A;  3DDC B;  4DHJ D;  2K25 A;  4PS8 A;  4KIK A;  1IBX A;  3D32 A;  2PVG C;  3BVG A;  3Q6B A;  4IC7 B;  4YTN B;  2MBE A;  2NCN A;  5G55 A;  4L23 A;  4IWQ A;  1V1O A;  4KZC A;  1SBB B;  1VJK A;  1EWC A;  2G4D B;  5G5H A;  1PYW D;  2IPK D;  2KK8 A;  2MRP A;  4AJY B;  4IUM B;  4OHJ A;  2GBN A;  2V9H A;  2BS4 B;  4LNF A;  2GLS A;  2DYM A;  1TS2 A;  4L1B A;  4IG7 B;  5EE3 A;  2INP E;  3VTU A;  2JX5 A;  2UWQ A;  3AMZ A;  1C4A A;  4EOY A;  2WXN A;  4J6I A;  1ZP0 B;  1EU3 A;  1RYJ A;  3PV1 A;  3UIO B;  3AB5 A;  4KV2 A;  2DAJ A;  3PZ7 A;  1IPG A;  5AZG A;  1PDX A;  2LFI A;  4NPN A;  4HLE A;  2D3C A;  4RGM A;  2KJR A;  3U7Z A;  1QKZ A;  1ET9 A;  2QEJ C;  5C2T B;  3HUI A;  1P98 A;  3K9O B;  2EMS A;  4JE3 B;  4TQ0 A;  4C4V A;  5GMV A;  2YLM A;  4P16 A;  2LGI A;  1XO3 A;  2V1Y A;  1C79 A;  2YVC A;  2A4Z A;  1C3T A;  4M8N A;  2WDV B;  3GS2 A;  4BBN F;  2NBU A;  3ML8 A;  4EZJ A;  2RR9 A;  5KHO A;  4EZL A;  1WMH A;  3MFG A;  2WXR A;  1WX9 A;  4JQW C;  1P1A A;  3A4R A;  1JRO A;  3VDZ A;  4KGS A;  4YSX B;  4EKU A;  1WY8 A;  2G45 B;  1Q5W B;  4N58 A;  4H2A A;  2N4F A;  4DXA B;  2KC2 A;  3N9Y C;  4JLC A;  3P4Q B;  3NHE B;  1SE2 A;  3RI7 C;  1QQR A;  2WDQ B;  4C7Z A;  2R2Q A;  1WX7 A;  3WAM A;  1GNU A;  3C8Y A;  3PTF C;  3SHQ A;  3Q2A C;  3X0W A;  3R66 C;  3M63 B;  2KWU B;  1L6U A;  2WDT B;  3VUY A;  2LRW A;  3U2S C;  3QJZ A;  2BGF A;  4OVU A;  4W9L A;  4EZK A;  1TGZ B;  1QOF A;  2KLC A;  2B76 B;  5IOI A;  2D3G A;  3ZW3 A;  4MT5 A;  2K0P A;  4MEM A;  1VDV A;  3DVG X;  1TKY A;  3IT4 B;  1MFW A;  2I2Y A;  3LXF A;  3PLV A;  4MGY E;  2IO1 B;  2GBJ A;  1UGJ A;  1ZGU B;  4KDL B;  4ANV A;  3WCQ A;  3P63 A;  3RNG C;  2KFJ A;  4NQL B;  3NZS A;  2JYT A;  3KYC D;  2WWZ A;  2V3P A;  2GB1 A;  4NJ7 A;  2M0A A;  3VAW A;  1KTK A;  4KKI A;  1EF1 A;  2JWU A;  3L17 A;  4ITK A;  4P1B C;  1HZ6 A;  3ZTD A;  3AE2 B;  1FXT B;  4LNO A;  2O6V A;  3L0W B;  1SE9 A;  1NVI D;  3TCA A;  3APC A;  2LJ5 A;  1G6J A;  3RNE C;  1JRP A;  2JYE A;  4TKN A;  4R3D A;  3TEX A;  1NBF C;  4GMV A;  4G50 A;  3P1M A;  1UWM A;  2KVZ A;  1SJH D;  2RGF A;  2M8S A;  1WXM A;  3ZO5 B;  4M8M A;  1XLP A;  5JZE B;  4W9D A;  3PZD A;  1NEN B;  1LFD A;  2BB5 A;  2MW5 A;  1FCC C;  1YN5 A;  2VZK B;  1L0Y B;  1TS3 A;  5EE1 A;  4TUU A;  4AS1 A;  2BS3 B;  1EM7 A;  1H7X A;  1OQQ A;  2VH2 A;  2PW9 A;  3NOB A;  1QF6 A;  1ROE A;  1T0Y A;  3QK0 A;  3RN9 C;  3BII D;  2WX1 A;  5LNK 1;  3NRZ A;  5IAA C;  2HD5 B;  3DVN V;  3QAR A;  4A55 A;  1RFA A;  4ZYN A;  3PHW B;  3OG5 A;  1SXT A;  1BML C;  1V80 A;  2JUO A;  3DCG A;  2WX0 A;  2KKC A;  3VVW B;  1SF0 A;  1I35 A;  5HHD G;  1V1P B;  2W3S A;  4B95 A;  2FCS A;  2KXJ A;  1F52 A;  4BKS D;  4URK A;  4ZRQ A;  2PMV A;  2BPS A;  2O2V B;  1E7V A;  4EEW A;  1I4P A;  3HVZ A;  4C00 A;  1C76 A;  4F8C B;  4BKT A;  2QIE B;  1VRA B;  3H1U A;  2W3R A;  2QSD A;  2ZCC A;  2VRR B;  4I6L B;  1VLB A;  2PE6 B;  3PRZ A;  1YX6 B;  2R61 A;  3R2I A;  4LTU A;  3W5U B;  1T3Q A;  1UBI A;  3AI5 A;  1KF6 B;  1EWY C;  1ZDV A;  3NVW A;  4MH8 A;  3W5V B;  5KHQ A;  1OTR B;  2QJL A;  1DGJ A;  3Q3F A;  2C7N B;  4K1R B;  2N9L A;  1P9D U;  1DOX A;  2Z8L A;  3MHZ A;  2QIL A;  3GZN I;  5LLI A;  4ZRP A;  2WXL A;  2WXI A;  4C7Y A;  2ZEQ A;  5J2R A;  3ZDT A;  3AEB B;  3DBL B;  4W9I A;  1WXV A;  2I38 A;  3TBL D;  4BBN C;  1GB4 A;  3DHH C;  2JZP A;  3VQI A;  2FUG 1;  3FIL A;  4A3O A;  4K3B A;  2LVQ A;  3FAH A;  2N9K A;  2LEK A;  1IYF A;  4HCP B;  4WJN A;  3VXW A;  1EF5 A;  1V97 A;  1QOB A;  1N5X A;  3KWV A;  2KWD A;  4ANW A;  3IT6 B;  5BMG A;  5T8I A;  3IG3 A;  3VUX A;  1XD3 B;  2V4I B;  3N20 C;  2K1F A;  1PGX A;  2O6V D;  3ZNG C;  5IP4 D;  2N1W A;  3TEZ A;  2AWT A;  4K81 A;  1E7U A;  3TL5 A;  1GAQ B;  3N1Z C;  4GGQ A;  4C80 A;  2XEW A;  1WGK A;  1IBX B;  2QHO A;  1YOV B;  3A4S C;  2FIF A;  1NYQ A;  4RM9 A;  2Q5W D;  2D07 B;  4A9A A;  2KDB A;  4DWF A;  4REZ A;  4PK1 A;  4XDD A;  1WI0 A;  4NZL B;  4M00 A;  1YN3 A;  2ACZ B;  1I4X A;  1Y8R C;  1JWU D;  3GE3 C;  3QX1 A;  4HPL B;  2JVC A;  1WJ6 A;  2FCN A;  1L0V B;  2LJI A;  1GT8 A;  3H6N A;  3KLS X;  1E0Z A;  2CKH B;  5IKC M;  1JCK B;  4ASW C;  1K8R B;  4AWJ A;  1TBE A;  3PRE A;  2N0S B;  2HJ1 A;  1Y56 A;  4B0E A;  1SEB D;  1SE4 A;  1EU4 A;  4HRO A;  1AW7 A;  2JY6 A;  3GOE A;  2GRI A;  3QA8 A;  1K51 A;  2L7R A;  1BT0 A;  2K5P A;  3WAO A;  4KKJ A;  1CJE A;  1YMH E;  2CJN A;  3EGR A;  4W9H A;  2PE9 A;  2BBC A;  3MP9 A;  3C0R B;  1MI0 A;  3QAQ A;  4MM3 A;  1DYQ A;  2AL3 A;  2FID A;  3OWE B;  5L95 C;  2KWV B;  1YJJ A;  5CHV C;  3AEG B;  1UF0 A;  4A3P A;  1HQR D;  4XE0 A;  1FEH A;  3M62 B;  3PRP B;  4MSM B;  2G1E A;  2JSV X;  4BOZ B;  4HWI B;  4TSS A;  2DZJ A;  1OEY J;  1Q1O A;  1XF5 L;  4FBJ B;  2WXF A;  1H8C A;  1L6V A;  2UU7 A;  1SIF A;  4IM0 A;  1WM3 A;  3DBH B;  4G3X B;  3Q3M C;  1KOT A;  2MX2 A;  5D3I B;  4ANX A;  2PLP A;  4LNI A;  1CZP A;  1YQB A;  4IOI E;  4OVZ A;  1KLU D;  2N7E A;  3ZNZ B;  4M0W A;  3DVG Y;  5C1Z A;  5DPS A;  1AYF A;  1L4Z B;  1ZE3 D;  1MPE A;  3H7S A;  3BYY B;  2HDE A;  5CHF A;  2Z59 B;  1V49 A;  4WAA A;  2MBO A;  3VRB B;  2WU2 B;  3TIX A;  2WXK A;  3L54 A;  4Q2J A;  4RMA A;  4MGI E;  4A90 A;  3NZ3 A;  3VUW A;  2M56 B;  1J0G A;  1HZ5 A;  2LHE A;  1Q0W B;  3ENE A;  2IGD A;  4JL9 A;  3B2G A;  2HTH A;  1NEK B;  1KLV A;  1XCQ L;  2QDF A;  3BYT B;  4XWT A;  1MHX A;  2R2O A;  4HPM B;  4FUL A;  4HDO A;  2H88 B;  3BZD B;  4LJP B;  2XK5 A;  4UDU C;  2JRH A;  4AP4 C;  3SEB A;  4YL8 A;  3IXS A;  4US9 A;  3ZTC A;  2DZK A;  3RZW C;  3VTV A;  3Q8E A;  1YQ4 B;  2Y5B B;  3W1Y A;  2ZNV B;  3HK0 A;  4ARC A;  1NI2 A;  4KGT A;  4FJY A;  4EUT A;  1PQS A;  4WJQ A;  3O13 A;  3V05 A;  4KVG B;  4YSY B;  4JWS C;  1QT9 A;  4E74 A;  1YIW A;  4S17 A;  1A70 A;  2UYZ B;  1E8X A;  4MAC A;  4CQN A;  3A1Q B;  3ETR A;  1UWX A;  4KDI C;  3QIJ A;  1FMA D;  3SU8 X;  3M95 A;  4AQ7 A;  3VH3 B;  1AN8 A;  3ZYY X;  1WZ3 A;  3CIR B;  2FUH B;  3Q3N C;  4ACF A;  2KAN A;  2ZVO A;  3B9J A;  3BWU D;  2KN4 A;  3U7D A;  3N1Y C;  3ZLZ A;  1SSN A;  5E6N A;  4XC2 A;  2CJO A;  3E9S A;  4HPP A;  3NVV A;  2IND C;  2YEP B;  2MA9 B;  3RCZ A;  3V60 A;  1WGR A;  1D4B A;  2PIA A;  1WGD A;  5G2N A;  2BYT A;  5D2M B;  1WF9 A;  2NS5 A;  1C1Y B;  2NPT A;  3BIN A;  3V6C B;  3H7P A;  1UEL A;  4M02 A;  4BKS A;  1JWB D;  3AU5 A;  1F2R I;  3QQ8 B;  4DHZ E;  2CU3 A;  1GTH A;  4HCN B;  3ZUN A;  2LXA A;  4MDK E;  3ZXV A;  3NJT A;  3RNC C;  2INN E;  5FK9 C;  2GOW A;  1J7C A;  1BUI C;  1RLF A;  4GU2 A;  1N63 A;  2GI9 A;  2J53 A;  2N7J A;  3CF4 A;  1WGY A;  3N30 A;  2L8J A;  3ZKJ C;  1RM6 C;  1I4Q A;  2KTF A;  3U52 E;  1SGH A;  1WJ4 A;  1YJ1 A;  1FFU A;  1S1Q B;  3BK2 A;  3JW0 X;  1CQV A;  1PGB A;  2KTR A;  1P0R A;  3V6E B;  2M17 A;  4MH0 E;  5AZF A;  2BT6 A;  3U4E G;  3WAP A;  3R7R A;  4BOS C;  1JWM D;  4OW0 A;  1TY2 A;  2WS3 B;  3ZIM A;  3TEW A;  1WM2 A;  2W9N A;  3N1X C;  1N6Z A;  4MJS A;  4KSL C;  3UGB B;  4P6V F;  3BY4 B;  4NJC A;  3HRD D;  1J7B A;  3RPF C;  3ZJU A;  1E5W A;  1T0S C;  4B0M A;  3APF A;  3ZRF A;  3KW5 B;  1NYR A;  3KH0 A;  1WR6 E;  3ZDM C;  3A9K B;  2HE7 A;  2W54 A;  1HA5 A;  1WZ0 A;  1AAR A;  3I3T B;  2KHW B;  2LAS A;  1HEZ E;  3QWZ B;  4HXD A;  1TZ1 A;  1UUP A;  2WXH A;  2NR2 A;  3CST A;  1GC6 A;  4HKQ A;  2JZZ A;  3FIL B;  2DYB A;  1TZO A;  1ZXI A;  3DBR B;  2WXG A;  4KGR A;  2AQ2 B;  3MTN B;  4GIV A;  4BKG A;  3S2A A;  1JRU A;  2L3Z A;  4DHJ B;  1E10 A;  4TQ1 A;  4X57 B;  2MCN B;  2LXC A;  2V0G A;  2MJD A;  1V86 A;  2L00 B;  4ZOH C;  1C4P A;  3Q8A A;  3LB8 C;  4HK2 A;  3AE1 B;  1XXG A;  1MHH E;  2FAZ A;  1I4G A;  4GN1 A;  1VCB A;  1FNU A;  5AUK A;  3Q8C A;  2K39 A;  3JVZ X;  3ZGZ A;  2CU1 A;  3IFW B;  3KUZ A;  5TR5 A;  4GB9 A;  4P1C C;  4PYZ A;  4S0R A;  3J9C A;  2EKE C;  2ZVN A;  4RF0 A;  2NTT A;  4KSK C;  1H7W A;  5E6O A;  1BXT A;  4KZ0 A;  1K52 A;  3A9J A;  1D6E C;  5AEK B;  4LDT D;  2BYE A;  2WQY B;  2IY1 B;  2KAC A;  2KDM A;  3QCA A;  4K7S A;  2KC1 A;  4G0N B;  5JXV A;  2LHD A;  2N9E B;  3CMM B;  4DK5 A;  3NS8 A;  4ZYS A;  3T3O A;  5I4D A;  3KYD D;  1V5O A;  3N3K B;  4W9G A;  5J18 A;  3NVY A;  1NDD A;  5BMI A;  2BW2 A;  3ML9 A;  4MM3 B;  1F2R C;  2PTL A;  4N9F 4;  3RUI B;  3AM9 A;  4IW0 A;  1F77 A;  4HDQ A;  1MG8 A;  5EDS A;  2L1A A;  3DBH I;  2AQ1 B;  1ZDX A;  2J7Q B;  4LK0 M;  3IBE A;  3QC8 B;  4W9J A;  1ZOY B;  2J0K A;  1C78 A;  2NBV B;  4JWU C;  2OJR A;  1PGA A;  3HHM A;  2WDR B;  3KUD B;  1WWT A;  1YQ3 B;  2W55 A;  2Y5P A;  3ZXR A;  1MVK A;  3VR9 B;  2KNB A;  4LNK A;  4AJW A;  2EMT A;  1GUA B;  4PS3 A;  2CHZ A;  3LYY A;  3PRM B;  2N9X A;  3RZF A;  3W1S C;  4WWO A;  1LQB A;  1XLQ A;  2K6Q A;  2FCM A;  3CF6 E;  4XYC A;  2RMM A;  4F7Z A;  3IAS 1;  3SFD B;  1R4M I;  4RGN A;  4ZHP A;  4XDC A;  4ZRI A;  3DVN U;  2D10 A;  1GTE A;  4DQO C;  2KVR A;  1UD7 A;  2AEH A;  2W82 A;  1OQY A;  1ZKH A;  3DPD A;  2BYF A;  4E3C A;  4E71 A;  3PT2 B;  1JAL A;  1WXS A;  2ZPN A;  3WIM A;  4XWW A;  4PYU A;  2JZ3 B;  1I4H A;  2BF8 B;  1FRR A;  4D2K A;  2MLB A;  2JPH A;  1K53 A;  1V6E A;  4JIO U;  3APD A;  2BKF A;  4G11 A;  5C3J B;  1KM7 A;  4KIK B;  4CHK A;  3HIZ A;  1N5W A;  3EC8 A;  4YXD B;  3KVF B;  3TEY A;  2YEP F;  3LDZ E;  2RPQ A;  5EE0 A;  1WRI A;  4WWM A;  4J3O D;  3Q14 C;  3WAN A;  2KX0 A;  3L4P A;  4WH4 A;  1N60 A;  2LGX A;  3VHT C;  4B6W A;  2DZM A;  2IO2 B;  2BS2 B;  3I63 C;  2GMI C;  5E6J A;  2WXJ A;  4JPS A;  3B2F A;  1L7Y A;  3BK1 A;  4IWO A;  3ZNH B;  2AL6 A;  5DPW A;  1JML A;  2OHF A;  1KJT A;  1ENF A;  1OQR A;  3RNB C;  1FXI A;  3ZQ4 A;  3L08 A;  5G5G A;  2M4N A;  4OZC A;  4DDI D;  1X1M A;  4WQM A;  3KQ4 A;  2CR5 A;  4YWG G;  4N59 A;  1GPX A;  1ESF A;  2MSE D;  1Z5S B;  3ZJV A;  1U4A A;  2LGY A;  3FC4 A;  2DYO A;  3T3N A;  4NAW A;  2K3U A;  1UZX B;  1V1P A;  3N32 A;  3RYT A;  1ET6 A;  1TYG B;  3Q8F A;  5BYR A;  3FKY A;  1WGG A;  4C4V B;  2Z0D B;  2KO3 A;  4BFR A;  1VZ6 A;  1KH0 A;  2D3B A;  3HM6 X;  3PPA A;  1T0R C;  2IO3 B;  2NPT B;  3RT3 B;  2KFK A;  1HTO A;  4W9K A;  1YN4 A;  3H7P B;  1UH6 A;  1GG3 A;  4FHK A;  1KFY B;  3Q3J A;  2BWE S;  3OJ3 A;  3B0A A;  2KQ7 A;  2OJW A;  2LUM A;  5HI1 A;  1N61 A;  1R7S A;  1WMH B;  2DBY A;  4HKZ E;  3JSV A;  4MSQ B;  2LD9 A;  3UIP B;  2Y5C A;  1A5R A;  2KYW A;  2WXO A;  4FJZ A;  1WYG A;  4RNA A;  2ASQ A;  1JWS D;  3W1S A;  2OED A;  1MJD A;  4TMA B;  2WU5 B;  3JYU A;  3VFK A;  2IZV B;  3W2D A;  1YD8 U;  3PHX B;  4NY0 A;  1JQ4 A;  3Q8B A;  3B08 A;  1T0Q C;  3VTW A;  5E6P A;  2VH1 A;  3SFE B;  3OLM D;  3T8M A;  3SR6 A;  4OZB A;  2PEA A;  2IO0 B;  2OOB B;  2KDE B;  2IY0 B;  3OAW A;  3Q3O C;  1NI3 A;  4OVV A;  2XBB C;  4MJS B;  2LGD A;  3I9V 1;  4IM3 A;  2Z0E B;  2KLG A;  4BZA A;  3MJW A;  3EEC A;  1FRD A;  2ZZP B;  1E6E B;  4NQK E;  4KX6 B;  1LM8 B;  5FKA C;  5JHB A;  1UNS A;  1LXD A;  3PS6 A;  2EEL A;  1CMX B;  2V3S A;  3U8Z A;  5DPR A;  5MPO A;  3IAM 1;  1FFV A;  3DBR I;  2RSU A;  5HKH A;  4A20 A;  4O1N A;  2MQJ A;  2K6D B;  1GOZ A;  4P7I A;  2RDB C;  1WE7 A;  2I1J A;  2O6V B;  2KQ4 X;  2CS4 A;  2KMC A;  4QAY A;  3NG0 A;  1P7E A;  2J42 A;  2ON8 A;  2ZNV C;  2I1K A;  3AE7 B;  3P42 A;  1ISN A;  1OFF A;  2A5U A;  5FR6 A;  2IYD B;  2GBR A;  2D11 A;  4WWP A;  2TSS A;  2VZK D;  5L83 A;  2NMQ A;  2M1M A;  2MBH A;  4I6P A;  3AH7 A;  2DZI A;  4HJK A;  2MBB B;  2BKR B;  2V4L A;  2RD0 A;  3ZJT A;  3PGE A;  4GDL A;  2WP9 B;  2AQ3 B;  2KN5 A;  1Q10 A;  1XEE A;  2J4X A;  3V61 A;  2WXP A;  2G9H D;  2ONQ A;  4WIP A;  4ZHO A;  2ZCB A;  1VZ8 A;  4DDG D;  4PS7 A;  4TV3 A;  2FBW B;  2KDF B;  1WYW B;  3OJ4 B;  3TJP A;  4LNN A;  4L2Y A;  2G3Q B;  2M19 A;  3L13 A;  4K7W A;  1RAX A;  1R4N B;  1D3Z A;  1E9M A;  2DEN B;  2D3A A;  3A9J B;  1RRB A;  3HVD A;  2IBI B;  2C9W B;  3H9D A;  4B9K A;  4JX1 C;  3B1L X;  3AEA B;  1F1H A;  1OEY A;  2LWP A;  1LO5 D;  4US8 A;  3AE4 B;  1V8C A;  4DXG A;  1B1Z A;  2E6X A;  1VR9 A;  3NS1 A;  3AEE B;  2KWC A;  3GE8 C;  4FXC A; 
#chains in the Genus database with same CATH homology
 1D5X C;  3BVM A;  1GAQ B;  3J9C A;  3Q69 A;  2V3N A;  4RF0 A;  4C80 A;  1WGK A;  1IBX B;  2NTT A;  1E7P B;  4LLG M;  3AEC B;  2PVO D;  4OZA A;  5D7G A;  1NYQ A;  1H7W A;  1K50 A;  2WNM A;  1BXT A;  1K52 A;  2Q5W D;  1D6E C;  1F0Z A;  2MJE A;  4A9A A;  1FO4 A;  3E56 A;  2WQY B;  4REZ A;  2WXQ A;  4RF1 A;  2KAC A;  4EE2 A;  2KDM A;  1STE A;  4XDD A;  1WXQ A;  2XNA C;  4RH6 A;  4NZL B;  1M4V A;  3TSS A;  5JXV A;  2LHD A;  1YN3 A;  2ACZ B;  1I4X A;  3KWL A;  1I7H A;  1IUE A;  1JWU D;  1RWS A;  3EA6 A;  1L4D B;  3AE6 B;  3BVZ A;  4ZYS A;  3T3O A;  2HTM E;  2RDH A;  5I4D A;  1L0V B;  2LJI A;  1I4R A;  1GT8 A;  1DOY A;  3KLS X;  1FIQ A;  1E0Z A;  2NTS A;  1JCK B;  3NVY A;  1TS4 A;  5BMI A;  2SAK A;  1IBX A;  2BW2 A;  4MM3 B;  4PT5 A;  2PVG C;  1F2R C;  1FM0 D;  2N0S B;  2PTL A;  3BVG A;  3AM9 A;  1DOI A;  4YTN B;  1F77 A;  1Y56 A;  4HJG E;  4B0E A;  1SEB D;  4L23 A;  1SE4 A;  1EU4 A;  1V1O A;  3AV8 A;  1SBB B;  1VJK A;  4HRO A;  1EWC A;  1VZ7 A;  1AW7 A;  2L1A A;  5G5H A;  1PYW D;  2IPK D;  2AQ1 B;  2GRI A;  1K51 A;  2K5P A;  3GB1 A;  1ZDX A;  4LK0 M;  4OHJ A;  4KKJ A;  1ZOY B;  3MC0 B;  2BS4 B;  1CJE A;  1C78 A;  1YMH E;  2CJN A;  3EGR A;  3P4S B;  2RDG A;  2BBC A;  5H8Y E;  4JWU C;  1PGA A;  3MP9 A;  2DYM A;  1MI0 A;  1TS2 A;  2WDR B;  4L1B A;  1WWT A;  1YQ3 B;  1DYQ A;  2DLB A;  2W55 A;  2Y5P A;  5EE3 A;  1MVK A;  2INP E;  3OWE B;  3VR9 B;  2JX5 A;  1YJJ A;  3AEG B;  1HQR D;  3AMZ A;  1P7F A;  1C4A A;  4XE0 A;  5EE9 A;  1FEH A;  3PO0 A;  1FCL A;  4HRS A;  3LYY A;  2WXM A;  1GB1 A;  2G1E A;  2JSV X;  2MH7 A;  2WXN A;  1XLO A;  1ZP0 B;  4IDI A;  1EU3 A;  1RYJ A;  1XLQ A;  3AB5 A;  5FR3 A;  2FE8 A;  2EKI A;  2RMM A;  4TSS A;  1XF5 L;  2K9X A;  3PZ7 A;  4A6Q A;  1PDX A;  2LFI A;  3IAS 1;  3SFD B;  2WXF A;  3W9C B;  1L6V A;  4RGN A;  4RGM A;  3U7Z A;  4ZHP A;  3NVZ A;  1QKZ A;  1T5X D;  1ET9 A;  1KLG D;  2QEJ C;  4XDC A;  5C2T B;  3HUI A;  2BB6 A;  5D3I B;  4WAF A;  2PLP A;  1CZP A;  4JE3 B;  4TQ0 A;  4IOI E;  3AE9 B;  1FNW A;  1KLU D;  4OVZ A;  2ZW0 A;  1GTE A;  4M0W A;  4P16 A;  4DQO C;  2W82 A;  2LGI A;  1AYF A;  1XO3 A;  1L4Z B;  3NUH B;  1SE3 A;  1MPE A;  1C79 A;  1ZE3 D;  3BYY B;  5H92 C;  2HDE A;  1JAL A;  2WDV B;  3GS2 A;  5BYQ A;  4XWW A;  3ABV B;  1D5Z C;  5TSS A;  3VRB B;  2WU2 B;  1I4H A;  1FNV A;  1FRR A;  4D2K A;  3MFG A;  2WXK A;  4Q2J A;  1K53 A;  2WXR A;  1JRO A;  2D5G A;  3MJ5 A;  4A90 A;  5C3J B;  4KGS A;  3NZ3 A;  2M56 B;  4YSX B;  1HZ5 A;  1N5W A;  4YXD B;  2LHE A;  2IGD A;  3TEY A;  3B2G A;  1NEK B;  1XCQ L;  4N58 A;  3AE3 B;  2YEP F;  4H2A A;  2L83 A;  3BYT B;  4NAM A;  5EE0 A;  4XWT A;  1WRI A;  4WWM A;  4FXC A;  1MHX A;  2H88 B;  2ZW1 A;  3BZD B;  2RPV A;  4J3O D;  3P4P B;  3N9Y C;  4UDU C;  3P4Q B;  1IGD A;  3AED B;  1SE2 A;  1QQR A;  4DXF A;  3SEB A;  2WDQ B;  4C7Z A;  3L4P A;  4WH4 A;  1N60 A;  2PKO A;  2ICI A;  3IXS A;  4US9 A;  2BS2 B;  3C8Y A;  1C77 A;  3V3X A;  1QLB B;  3PZ8 A;  4NAW B;  5E6J A;  2WXJ A;  4JPS A;  3B2F A;  3GP7 A;  3BK1 A;  3Q8E A;  1L6U A;  1JML A;  1RFK A;  4HEA 1;  2OHF A;  1YQ4 B;  3U2S C;  1ENF A;  1QOA A;  1OQR A;  1QOF A;  4ARC A;  2B76 B;  1FXI A;  1ZUD 2;  5G5G A;  3ZQ4 A;  4MT5 A;  3VRA B;  4OZC A;  2K0P A;  4C56 C;  4KGT A;  4WQM A;  3KQ4 A;  4YWG G;  4N59 A;  1GPX A;  1VDV A;  1ESF A;  3O13 A;  3V05 A;  4YSY B;  4JWS C;  1TKY A;  3IT4 B;  2I2Y A;  1QT9 A;  3LXF A;  3ZJV A;  3FC4 A;  2DYO A;  3RFZ B;  5GXG B;  1A70 A;  3T3N A;  2K3U A;  3I57 A;  1SB3 C;  1UGJ A;  1V1P A;  1N62 A;  4MAC A;  1ET6 A;  3WCQ A;  3P63 A;  5HFY A;  4CQN A;  1TYG B;  3Q8F A;  5BYR A;  1IGC A;  1C4C A;  3ETR A;  2KMM A;  2JYT A;  1UWX A;  1YNT E;  1VZ6 A;  1FMA D;  2V3P A;  1KH0 A;  2GB1 A;  2X38 A;  2M0A A;  1KTK A;  4KKI A;  4AQ7 A;  2JWU A;  1AN8 A;  3ZYY X;  4ITK A;  1YN4 A;  3CIR B;  4RFB A;  1HZ6 A;  1KFY B;  3B9J A;  3BWU D;  3AE2 B;  4YSZ B;  2KN4 A;  4RGT A;  1JW9 D;  2SEB D;  2LUM A;  2QMT A;  5HI1 A;  1N61 A;  1R7S A;  1JWA D;  1SSN A;  1NVI D;  2DBY A;  2MEK A;  2CJO A;  4HKZ E;  3E9S A;  3AE8 B;  3NVV A;  4GLS C;  2YEP B;  1FXA A;  1D4B A;  1QIL A;  2PIA A;  3H8H A;  2JU6 X;  2Y5C A;  1JRP A;  2JYE A;  2WXO A;  2H89 B;  2BYT A;  1WYG A;  4RNA A;  3TUO A;  4R3D A;  1JWS D;  3TEX A;  2OED A;  3W1S A;  3P1M A;  1UWM A;  4TMA B;  2WU5 B;  1SJH D;  3W2D A;  2J52 A;  1XLP A;  3DWG C;  1JWB D;  1CK1 A;  1F2R I;  1ZPS A;  1JQ4 A;  1NEN B;  2CU3 A;  1GTH A;  3Q8B A;  2BB5 A;  3R8B A;  2BTE A;  1FCC C;  2Y3A A;  1YN5 A;  2VZK B;  4IKG A;  1L0Y B;  3SFE B;  1B9R A;  1TS3 A;  2INN E;  5FK9 C;  5EE1 A;  3SR6 A;  1J7C A;  4YT0 B;  1BUI C;  4OZB A;  4AS1 A;  2BS3 B;  1EM7 A;  1H7X A;  1N63 A;  1OQQ A;  2GI9 A;  2J53 A;  1SJE D;  2N7J A;  2PW9 A;  1ROE A;  1QF6 A;  3CF4 A;  1TS5 A;  4USA A;  3P4R B;  1RM6 C;  1I4Q A;  1NI3 A;  2IJ0 A;  3BII D;  3U52 E;  3DWM A;  5LNK 1;  1ACC A;  3NRZ A;  4A55 A;  3I9V 1;  2MJ3 A;  4ARI A;  1FFU A;  3BK2 A;  1SXT A;  1BML C;  1FRD A;  1CQV A;  1E6E B;  1PGB A;  4KX6 B;  2IGG A;  3R2T A;  1SF0 A;  1YJI A;  5FKA C;  5HHD G;  1AWD A;  1V1P B;  2W3S A;  1L5P A;  2BT6 A;  1UNS A;  1FD6 A;  3U4E G;  4A8X C;  2EEL A;  4ZRQ A;  2PMV A;  1JWM D;  4OW0 A;  1TY2 A;  2WS3 B;  1I4P A;  5MPO A;  2DWQ A;  3IAM 1;  5BMH A;  3TEW A;  3HVZ A;  1FFV A;  1C76 A;  4YTP B;  2XN9 C;  2QIE B;  1VRA B;  4P6V F;  4O1N A;  2W3R A;  1TY0 A;  4NJC A;  2QSD A;  3HRD D;  1J7B A;  1GOZ A;  4GDL B;  1VLB A;  3RPF C;  3ZJU A;  1TKG A;  4B0M A;  1SIJ A;  1NYR A;  2R61 A;  2KQ4 X;  3EUB 2;  3R2I A;  1P7E A;  2J42 A;  2ON8 A;  3AE7 B;  3P42 A;  2AX5 A;  1OFF A;  4LTU A;  3AEF B;  1HXY D;  3W5U B;  1T3Q A;  2W54 A;  1HA5 A;  1KF6 B;  1EWY C;  1ZDV A;  3NVW A;  4MH8 A;  1TJE A;  3UI3 A;  3W5V B;  2TSS A;  2VZK D;  1C9F A;  2QJL A;  2NMQ A;  1DGJ A;  1KRH A;  3AH7 A;  1HEZ E;  2N9L A;  1DOX A;  1UUP A;  2Z8L A;  2WXH A;  2JQR B;  3ZJT A;  3MHZ A;  2QIL A;  4HKQ A;  3FIL B;  2WP9 B;  1TZO A;  2AQ3 B;  5AUI A;  4ZRP A;  2WXL A;  3URY A;  4WUR A;  1ZXI A;  3AN1 A;  2WXI A;  4C7Y A;  1Q10 A;  1XEE A;  2J4X A;  4YTM B;  1TKE A;  2WXP A;  1QOG A;  2WXG A;  4KGR A;  5BYS A;  2G9H D;  2ONQ A;  4WIP A;  2AQ2 B;  4ZHO A;  3AEB B;  1PFD A;  1VZ8 A;  2KAJ A;  3AE5 B;  2I38 A;  2JXT A;  2IDY A;  4RGO S;  1GB4 A;  4RCO A;  2FBW B;  1E10 A;  4TQ1 A;  1D5M C;  1T6B X;  2L52 A;  2V0G A;  2MJD A;  2JZP A;  3VQI A;  4L2Y A;  1XLN A;  2FUG 1;  2E3T A;  2M19 A;  3FIL A;  4ZOH C;  3CWI A;  3FAH A;  1WSP A;  1ZXH A;  2N9K A;  1C4P A;  2LEK A;  2K22 A;  3Q8A A;  1E9M A;  1J7A A;  1V97 A;  1QOB A;  4N6E B;  2LMC A;  5HG2 A;  1N5X A;  1XCT L;  3KWV A;  2KWD A;  3LB8 C;  2L32 A;  3IT6 B;  5BMG A;  3AE1 B;  5T8I A;  1PUT A;  1XXG A;  1MHH E;  1I4G A;  3HVD A;  1FNU A;  5AUK A;  3Q8C A;  3VR8 B;  2V4I B;  4JX1 C;  1L0X B;  5D3D A;  3AEA B;  2WLB A;  1PGX A;  1LO5 D;  4US8 A;  3ZGZ A;  3AE4 B;  1V8C A;  4DXG A;  3TEZ A;  1B1Z A;  2E6X A;  1VR9 A;  4GDK B;  3NS1 A;  3AEE B;  2IGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...