4YTND

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[3-(pentafluorophenoxy)phenyl]-2-(trifluoromethyl)benzamide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
129
structure length
129
Chain Sequence
b'TSAAVTGAAPPQFDPIAAEKGFKPLHSHGTLFKIERYFAAAMVPLIPAAYFIHGREMDLCLALALTLHVHWGVWGVVNDYGRPFVLGDTLAAAVRVGAYIFTACLLAGLLYFNEHDVGLTRAFEMVWEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title New Insights into the Design of Inhibitors Targeted for Parasitic Anaerobic Energy Metabolism
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 38
structure length 129
sequence length 129
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05328 CybS CybS, succinate dehydrogenase cytochrome B small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4ytnD00
3AE2C 3P4SD 5C3JC 2ACZD 2WDRD 2BS3C 3AE7D 1NEND 4YT0D 2H88C 4YSZC 4YTND 2WU5D 3AEGD 2WU2D 5C2TC 1ZOYC 3VRBD 1KF6D 4YSYC 3ABVC 2WDQD 3SFED 3VRAD 3P4RD 1KFYD 4YTPC 3AE3C 3P4QC 2WP9D 2BS4C 1ZP0D 4YSXC 3AEED 3P4PC 3AEDD 3AE5C 3AEAC 2WQYD 3SFDD 3AE6C 3P4PD 3AE2D 5C3JD 1L0VC 3AE9C 2FBWC 2H88D 2WS3C 4YSZD 4KX6C 3CIRC 2WDVC 4YXDC 3AECC 5C2TD 1ZOYD 3AE1C 1NEKC 4YSYD 4KX6D 3ABVD 3AEFC 2WDVD 1YQ4C 4YTPD 2BS2C 3AE3D 3AE8C 3AE4C 1YQ3C 3P4QD 3AEBC 4YSXD 2B76C 4YTMC 3AE4D 3VR8C 3AEAD 3AE5D 3AE6D 2H89C 1E7PC 3VR9C 1L0VD 3P4SC 3AE9D 2ACZC 2FBWD 2WDRC 2WS3D 3AE7C 1NENC 4YT0C 3CIRD 4YXDD 3AECD 4YTNC 3AE1D 2WU5C 1NEKD 3AEGC 2WU2C 3AEFD 3VRBC 1KF6C 1QLBC 1YQ4D 2WDQC 3SFEC 3AE8D 3VRAC 1YQ3D 3P4RC 1KFYC 3AEBD 2B76D 2WP9C 4YTMD 1ZP0C 3VR8D 3AEEC 3AEDC 2H89D 2WQYC 3SFDC 3VR9D
chains in the Genus database with same CATH superfamily
3VONA 3AE2C 3P4SD 5C3JC 2ACZD 2WDRD 2BS3C 4DDIA 3AE7D 1NEND 4YT0D 2H88C 4YSZC 4YTND 2WU5D 3AEGD 2WU2D 5C2TC 1ZOYC 3VRBD 1KF6D 4YSYC 3ABVC 2WDQD 3SFED 3VRAD 3P4RD 1KFYD 4YTPC 3AE3C 3P4QC 2WP9D 2BS4C 1ZP0D 4YSXC 3AEED 3P4PC 3AEDD 3AE5C 3AEAC 4DHIB 2WQYD 3SFDD 3AE6C 3P4PD 3AE2D 4DDGA 5C3JD 1L0VC 3AE9C 2FBWC 2H88D 2WS3C 4DHJA 4YSZD 4KX6C 3CIRC 2WDVC 4YXDC 3AECC 5C2TD 2ZFYA 1ZOYD 3AE1C 1NEKC 4YSYD 4KX6D 3ABVD 3AEFC 2WDVD 4LDTA 1YQ4C 4YTPD 2BS2C 3AE3D 3AE8C 3AE4C 1YQ3C 3P4QD 3AEBC 4YSXD 2B76C 4YTMC 3AE4D 3VR8C 3AEAD 3AE5D 4FJVA 3AE6D 2H89C 1E7PC 3VR9C 1L0VD 3P4SC 3AE9D 2ACZC 2FBWD 2WDRC 2WS3D 3AE7C 1NENC 4YT0C 3CIRD 4YXDD 3AECD 4DHZA 4YTNC 3AE1D 2WU5C 1NEKD 3AEGC 2WU2C 3AEFD 3VRBC 1KF6C 1QLBC 1YQ4D 2WDQC 3SFEC 3AE8D 3VRAC 1YQ3D 3P4RC 1KFYC 3AEBD 2B76D 4I6LA 2WP9C 4YTMD 1ZP0C 3VR8D 3AEEC 3AEDC 2H89D 2WQYC 3SFDC 3VR9D 1TFFA
chains in the Genus database with same CATH topology
3AE2C 3P4SD 5C3JC 2ACZD 2WDRD 2BS3C 3AE7D 1NEND 4YT0D 2H88C 4YSZC 4YTND 2WU5D 3AEGD 2WU2D 5C2TC 1ZOYC 3VRBD 1KF6D 4YSYC 3ABVC 2WDQD 3SFED 3VRAD 3P4RD 1KFYD 4YTPC 3AE3C 3P4QC 2WP9D 2BS4C 1ZP0D 4YSXC 3AEED 3P4PC 3AEDD 3AE5C 3AEAC 2WQYD 3SFDD 3AE6C 3P4PD 3AE2D 5C3JD 1L0VC 3AE9C 2FBWC 2H88D 2WS3C 4YSZD 4KX6C 3CIRC 2WDVC 4YXDC 3AECC 5C2TD 1ZOYD 3AE1C 1NEKC 4YSYD 4KX6D 3ABVD 3AEFC 2WDVD 1YQ4C 4YTPD 2BS2C 3AE3D 3AE8C 3AE4C 1YQ3C 3P4QD 3AEBC 4YSXD 2B76C 4YTMC 3AE4D 3VR8C 3AEAD 3AE5D 3AE6D 2H89C 1E7PC 3VR9C 1L0VD 3P4SC 3AE9D 2ACZC 2FBWD 2WDRC 2WS3D 3AE7C 1NENC 4YT0C 3CIRD 4YXDD 3AECD 4YTNC 3AE1D 2WU5C 1NEKD 3AEGC 2WU2C 3AEFD 3VRBC 1KF6C 1QLBC 1YQ4D 2WDQC 3SFEC 3AE8D 3VRAC 1YQ3D 3P4RC 1KFYC 3AEBD 2B76D 2WP9C 4YTMD 1ZP0C 3VR8D 3AEEC 3AEDC 2H89D 2WQYC 3SFDC 3VR9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE2 C;  3P4S D;  5C3J C;  2ACZ D;  2WDR D;  2BS3 C;  3AE7 D;  1NEN D;  4YT0 D;  2H88 C;  4YSZ C;  4YTN D;  2WU5 D;  3AEG D;  2WU2 D;  5C2T C;  1ZOY C;  3VRB D;  1KF6 D;  4YSY C;  3ABV C;  2WDQ D;  3SFE D;  3VRA D;  3P4R D;  1KFY D;  4YTP C;  3AE3 C;  3P4Q C;  2WP9 D;  2BS4 C;  1ZP0 D;  4YSX C;  3AEE D;  3P4P C;  3AED D;  3AE5 C;  3AEA C;  2WQY D;  3SFD D;  3AE6 C;  3P4P D;  3AE2 D;  5C3J D;  1L0V C;  3AE9 C;  2FBW C;  2H88 D;  2WS3 C;  4YSZ D;  4KX6 C;  3CIR C;  2WDV C;  4YXD C;  3AEC C;  5C2T D;  1ZOY D;  3AE1 C;  1NEK C;  4YSY D;  4KX6 D;  3ABV D;  3AEF C;  2WDV D;  1YQ4 C;  4YTP D;  2BS2 C;  3AE3 D;  3AE8 C;  3AE4 C;  1YQ3 C;  3P4Q D;  3AEB C;  4YSX D;  2B76 C;  4YTM C;  3AE4 D;  3VR8 C;  3AEA D;  3AE5 D;  3AE6 D;  2H89 C;  1E7P C;  3VR9 C;  1L0V D;  3P4S C;  3AE9 D;  2ACZ C;  2FBW D;  2WDR C;  2WS3 D;  3AE7 C;  1NEN C;  4YT0 C;  3CIR D;  4YXD D;  3AEC D;  4YTN C;  3AE1 D;  2WU5 C;  1NEK D;  3AEG C;  2WU2 C;  3AEF D;  3VRB C;  1KF6 C;  1QLB C;  1YQ4 D;  2WDQ C;  3SFE C;  3AE8 D;  3VRA C;  1YQ3 D;  3P4R C;  1KFY C;  3AEB D;  2B76 D;  2WP9 C;  4YTM D;  1ZP0 C;  3VR8 D;  3AEE C;  3AED C;  2H89 D;  2WQY C;  3SFD C;  3VR9 D; 
#chains in the Genus database with same CATH topology
 3VON A;  3AE2 C;  3P4S D;  5C3J C;  2ACZ D;  2WDR D;  2BS3 C;  4DDI A;  3AE7 D;  1NEN D;  4YT0 D;  2H88 C;  4YSZ C;  4YTN D;  2WU5 D;  3AEG D;  2WU2 D;  5C2T C;  1ZOY C;  3VRB D;  1KF6 D;  4YSY C;  3ABV C;  2WDQ D;  3SFE D;  3VRA D;  3P4R D;  1KFY D;  4YTP C;  3AE3 C;  3P4Q C;  2WP9 D;  2BS4 C;  1ZP0 D;  4YSX C;  3AEE D;  3P4P C;  3AED D;  3AE5 C;  3AEA C;  4DHI B;  2WQY D;  3SFD D;  3AE6 C;  3P4P D;  3AE2 D;  4DDG A;  5C3J D;  1L0V C;  3AE9 C;  2FBW C;  2H88 D;  2WS3 C;  4DHJ A;  4YSZ D;  4KX6 C;  3CIR C;  2WDV C;  4YXD C;  3AEC C;  5C2T D;  2ZFY A;  1ZOY D;  3AE1 C;  1NEK C;  4YSY D;  4KX6 D;  3ABV D;  3AEF C;  2WDV D;  4LDT A;  1YQ4 C;  4YTP D;  2BS2 C;  3AE3 D;  3AE8 C;  3AE4 C;  1YQ3 C;  3P4Q D;  3AEB C;  4YSX D;  2B76 C;  4YTM C;  3AE4 D;  3VR8 C;  3AEA D;  3AE5 D;  4FJV A;  3AE6 D;  2H89 C;  1E7P C;  3VR9 C;  1L0V D;  3P4S C;  3AE9 D;  2ACZ C;  2FBW D;  2WDR C;  2WS3 D;  3AE7 C;  1NEN C;  4YT0 C;  3CIR D;  4YXD D;  3AEC D;  4DHZ A;  4YTN C;  3AE1 D;  2WU5 C;  1NEK D;  3AEG C;  2WU2 C;  3AEF D;  3VRB C;  1KF6 C;  1QLB C;  1YQ4 D;  2WDQ C;  3SFE C;  3AE8 D;  3VRA C;  1YQ3 D;  3P4R C;  1KFY C;  3AEB D;  2B76 D;  4I6L A;  2WP9 C;  4YTM D;  1ZP0 C;  3VR8 D;  3AEE C;  3AED C;  2H89 D;  2WQY C;  3SFD C;  3VR9 D;  1TFF A; 
#chains in the Genus database with same CATH homology
 3AE2 C;  3P4S D;  5C3J C;  2ACZ D;  2WDR D;  2BS3 C;  3AE7 D;  1NEN D;  4YT0 D;  2H88 C;  4YSZ C;  4YTN D;  2WU5 D;  3AEG D;  2WU2 D;  5C2T C;  1ZOY C;  3VRB D;  1KF6 D;  4YSY C;  3ABV C;  2WDQ D;  3SFE D;  3VRA D;  3P4R D;  1KFY D;  4YTP C;  3AE3 C;  3P4Q C;  2WP9 D;  2BS4 C;  1ZP0 D;  4YSX C;  3AEE D;  3P4P C;  3AED D;  3AE5 C;  3AEA C;  2WQY D;  3SFD D;  3AE6 C;  3P4P D;  3AE2 D;  5C3J D;  1L0V C;  3AE9 C;  2FBW C;  2H88 D;  2WS3 C;  4YSZ D;  4KX6 C;  3CIR C;  2WDV C;  4YXD C;  3AEC C;  5C2T D;  1ZOY D;  3AE1 C;  1NEK C;  4YSY D;  4KX6 D;  3ABV D;  3AEF C;  2WDV D;  1YQ4 C;  4YTP D;  2BS2 C;  3AE3 D;  3AE8 C;  3AE4 C;  1YQ3 C;  3P4Q D;  3AEB C;  4YSX D;  2B76 C;  4YTM C;  3AE4 D;  3VR8 C;  3AEA D;  3AE5 D;  3AE6 D;  2H89 C;  1E7P C;  3VR9 C;  1L0V D;  3P4S C;  3AE9 D;  2ACZ C;  2FBW D;  2WDR C;  2WS3 D;  3AE7 C;  1NEN C;  4YT0 C;  3CIR D;  4YXD D;  3AEC D;  4YTN C;  3AE1 D;  2WU5 C;  1NEK D;  3AEG C;  2WU2 C;  3AEF D;  3VRB C;  1KF6 C;  1QLB C;  1YQ4 D;  2WDQ C;  3SFE C;  3AE8 D;  3VRA C;  1YQ3 D;  3P4R C;  1KFY C;  3AEB D;  2B76 D;  2WP9 C;  4YTM D;  1ZP0 C;  3VR8 D;  3AEE C;  3AED C;  2H89 D;  2WQY C;  3SFD C;  3VR9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...