4YTPD

Crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
102
structure length
102
Chain Sequence
b'SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGIGQVVTDYVRGDALQKVAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLWKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 42
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05328 CybS CybS, succinate dehydrogenase cytochrome B small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 4ytpD00
2H89C 4YT0D 5C3JD 3AEBC 2H88D 3AEDC 3AE3D 3AE1D 2BS2C 1E7PC 2WS3C 1L0VC 4YXDC 2BS4C 2WDVC 3AE4C 4YTPD 1KF6D 1YQ3C 2WU2C 2WDRD 2WDQD 4YSYD 3AE7C 1NEKD 3CIRD 3P4QC 3VR8C 2ACZC 2H89D 3AEBD 3AEDD 2WU5C 2B76C 3AE9C 2WS3D 3SFDC 3ABVC 1L0VD 4YXDD 1NENC 2WDVD 3AE4D 3AEAC 2WU2D 1YQ3D 1KFYC 3AE7D 2WP9C 3AE8C 3P4QD 3VR8D 4YSZC 2ACZD 3AECC 2WU5D 2WQYC 2B76D 4YSXC 4YTNC 3AE9D 3P4PC 3P4RC 3VRBC 1QLBC 3SFDD 3ABVD 1NEND 3AEAD 2BS3C 5C2TC 1ZOYC 2FBWC 1KFYD 4KX6C 3AE6C 3P4SC 2WP9D 3AEGC 3AEEC 3AE8D 3AE2C 4YSZD 3SFEC 3AE5C 3AECD 4YTMC 2WQYD 4YSXD 1YQ4C 4YTND 3P4PD 3P4RD 3VRAC 3VRBD 5C2TD 1ZOYD 2FBWD 3AEFC 4KX6D 3AE6D 3VR9C 3P4SD 4YT0C 3AEGD 3AEED 5C3JC 3AE2D 2H88C 3AE1C 3AE3C 3SFED 3AE5D 1ZP0D 4YTMD 1YQ4D 4YTPC 3VRAD 1KF6C 1ZP0C 2WDRC 2WDQC 4YSYC 1NEKC 3AEFD 3VR9D 3CIRC
chains in the Genus database with same CATH superfamily
2H89C 4YT0D 5C3JD 3AEBC 2H88D 3AEDC 3AE3D 3AE1D 2BS2C 3VONA 1E7PC 4DHIB 2WS3C 1L0VC 4YXDC 2BS4C 2WDVC 3AE4C 4YTPD 1KF6D 1YQ3C 2WU2C 4FJVA 2WDRD 2WDQD 4YSYD 3AE7C 1NEKD 3CIRD 3P4QC 3VR8C 2ACZC 2H89D 3AEBD 3AEDD 2WU5C 2B76C 3AE9C 2WS3D 4LDTA 3SFDC 3ABVC 1L0VD 4YXDD 1NENC 2WDVD 3AE4D 3AEAC 2WU2D 1YQ3D 4I6LA 1KFYC 3AE7D 2WP9C 4DDGA 3AE8C 3P4QD 3VR8D 4YSZC 2ACZD 3AECC 2WU5D 2WQYC 2B76D 4YSXC 4DDIA 4YTNC 3AE9D 3P4PC 3P4RC 3VRBC 1QLBC 3SFDD 3ABVD 2ZFYA 1NEND 3AEAD 2BS3C 5C2TC 1ZOYC 2FBWC 1KFYD 4KX6C 3AE6C 3P4SC 2WP9D 3AEGC 3AEEC 3AE8D 3AE2C 4YSZD 3SFEC 3AE5C 4DHJA 3AECD 4YTMC 2WQYD 4YSXD 1YQ4C 4YTND 3P4PD 3P4RD 3VRAC 3VRBD 5C2TD 1ZOYD 2FBWD 3AEFC 4KX6D 3AE6D 4DHZA 3VR9C 3P4SD 4YT0C 3AEGD 3AEED 5C3JC 3AE2D 2H88C 3AE1C 3AE3C 3SFED 3AE5D 1ZP0D 4YTMD 1YQ4D 4YTPC 1TFFA 3VRAD 1KF6C 1ZP0C 2WDRC 2WDQC 4YSYC 1NEKC 3AEFD 3VR9D 3CIRC
chains in the Genus database with same CATH topology
2H89C 4YT0D 5C3JD 3AEBC 2H88D 3AEDC 3AE3D 3AE1D 2BS2C 1E7PC 2WS3C 1L0VC 4YXDC 2BS4C 2WDVC 3AE4C 4YTPD 1KF6D 1YQ3C 2WU2C 2WDRD 2WDQD 4YSYD 3AE7C 1NEKD 3CIRD 3P4QC 3VR8C 2ACZC 2H89D 3AEBD 3AEDD 2WU5C 2B76C 3AE9C 2WS3D 3SFDC 3ABVC 1L0VD 4YXDD 1NENC 2WDVD 3AE4D 3AEAC 2WU2D 1YQ3D 1KFYC 3AE7D 2WP9C 3AE8C 3P4QD 3VR8D 4YSZC 2ACZD 3AECC 2WU5D 2WQYC 2B76D 4YSXC 4YTNC 3AE9D 3P4PC 3P4RC 3VRBC 1QLBC 3SFDD 3ABVD 1NEND 3AEAD 2BS3C 5C2TC 1ZOYC 2FBWC 1KFYD 4KX6C 3AE6C 3P4SC 2WP9D 3AEGC 3AEEC 3AE8D 3AE2C 4YSZD 3SFEC 3AE5C 3AECD 4YTMC 2WQYD 4YSXD 1YQ4C 4YTND 3P4PD 3P4RD 3VRAC 3VRBD 5C2TD 1ZOYD 2FBWD 3AEFC 4KX6D 3AE6D 3VR9C 3P4SD 4YT0C 3AEGD 3AEED 5C3JC 3AE2D 2H88C 3AE1C 3AE3C 3SFED 3AE5D 1ZP0D 4YTMD 1YQ4D 4YTPC 3VRAD 1KF6C 1ZP0C 2WDRC 2WDQC 4YSYC 1NEKC 3AEFD 3VR9D 3CIRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H89 C;  4YT0 D;  5C3J D;  3AEB C;  2H88 D;  3AED C;  3AE3 D;  3AE1 D;  2BS2 C;  1E7P C;  2WS3 C;  1L0V C;  4YXD C;  2BS4 C;  2WDV C;  3AE4 C;  4YTP D;  1KF6 D;  1YQ3 C;  2WU2 C;  2WDR D;  2WDQ D;  4YSY D;  3AE7 C;  1NEK D;  3CIR D;  3P4Q C;  3VR8 C;  2ACZ C;  2H89 D;  3AEB D;  3AED D;  2WU5 C;  2B76 C;  3AE9 C;  2WS3 D;  3SFD C;  3ABV C;  1L0V D;  4YXD D;  1NEN C;  2WDV D;  3AE4 D;  3AEA C;  2WU2 D;  1YQ3 D;  1KFY C;  3AE7 D;  2WP9 C;  3AE8 C;  3P4Q D;  3VR8 D;  4YSZ C;  2ACZ D;  3AEC C;  2WU5 D;  2WQY C;  2B76 D;  4YSX C;  4YTN C;  3AE9 D;  3P4P C;  3P4R C;  3VRB C;  1QLB C;  3SFD D;  3ABV D;  1NEN D;  3AEA D;  2BS3 C;  5C2T C;  1ZOY C;  2FBW C;  1KFY D;  4KX6 C;  3AE6 C;  3P4S C;  2WP9 D;  3AEG C;  3AEE C;  3AE8 D;  3AE2 C;  4YSZ D;  3SFE C;  3AE5 C;  3AEC D;  4YTM C;  2WQY D;  4YSX D;  1YQ4 C;  4YTN D;  3P4P D;  3P4R D;  3VRA C;  3VRB D;  5C2T D;  1ZOY D;  2FBW D;  3AEF C;  4KX6 D;  3AE6 D;  3VR9 C;  3P4S D;  4YT0 C;  3AEG D;  3AEE D;  5C3J C;  3AE2 D;  2H88 C;  3AE1 C;  3AE3 C;  3SFE D;  3AE5 D;  1ZP0 D;  4YTM D;  1YQ4 D;  4YTP C;  3VRA D;  1KF6 C;  1ZP0 C;  2WDR C;  2WDQ C;  4YSY C;  1NEK C;  3AEF D;  3VR9 D;  3CIR C; 
#chains in the Genus database with same CATH topology
 2H89 C;  4YT0 D;  5C3J D;  3AEB C;  2H88 D;  3AED C;  3AE3 D;  3AE1 D;  2BS2 C;  3VON A;  1E7P C;  4DHI B;  2WS3 C;  1L0V C;  4YXD C;  2BS4 C;  2WDV C;  3AE4 C;  4YTP D;  1KF6 D;  1YQ3 C;  2WU2 C;  4FJV A;  2WDR D;  2WDQ D;  4YSY D;  3AE7 C;  1NEK D;  3CIR D;  3P4Q C;  3VR8 C;  2ACZ C;  2H89 D;  3AEB D;  3AED D;  2WU5 C;  2B76 C;  3AE9 C;  2WS3 D;  4LDT A;  3SFD C;  3ABV C;  1L0V D;  4YXD D;  1NEN C;  2WDV D;  3AE4 D;  3AEA C;  2WU2 D;  1YQ3 D;  4I6L A;  1KFY C;  3AE7 D;  2WP9 C;  4DDG A;  3AE8 C;  3P4Q D;  3VR8 D;  4YSZ C;  2ACZ D;  3AEC C;  2WU5 D;  2WQY C;  2B76 D;  4YSX C;  4DDI A;  4YTN C;  3AE9 D;  3P4P C;  3P4R C;  3VRB C;  1QLB C;  3SFD D;  3ABV D;  2ZFY A;  1NEN D;  3AEA D;  2BS3 C;  5C2T C;  1ZOY C;  2FBW C;  1KFY D;  4KX6 C;  3AE6 C;  3P4S C;  2WP9 D;  3AEG C;  3AEE C;  3AE8 D;  3AE2 C;  4YSZ D;  3SFE C;  3AE5 C;  4DHJ A;  3AEC D;  4YTM C;  2WQY D;  4YSX D;  1YQ4 C;  4YTN D;  3P4P D;  3P4R D;  3VRA C;  3VRB D;  5C2T D;  1ZOY D;  2FBW D;  3AEF C;  4KX6 D;  3AE6 D;  4DHZ A;  3VR9 C;  3P4S D;  4YT0 C;  3AEG D;  3AEE D;  5C3J C;  3AE2 D;  2H88 C;  3AE1 C;  3AE3 C;  3SFE D;  3AE5 D;  1ZP0 D;  4YTM D;  1YQ4 D;  4YTP C;  1TFF A;  3VRA D;  1KF6 C;  1ZP0 C;  2WDR C;  2WDQ C;  4YSY C;  1NEK C;  3AEF D;  3VR9 D;  3CIR C; 
#chains in the Genus database with same CATH homology
 2H89 C;  4YT0 D;  5C3J D;  3AEB C;  2H88 D;  3AED C;  3AE3 D;  3AE1 D;  2BS2 C;  1E7P C;  2WS3 C;  1L0V C;  4YXD C;  2BS4 C;  2WDV C;  3AE4 C;  4YTP D;  1KF6 D;  1YQ3 C;  2WU2 C;  2WDR D;  2WDQ D;  4YSY D;  3AE7 C;  1NEK D;  3CIR D;  3P4Q C;  3VR8 C;  2ACZ C;  2H89 D;  3AEB D;  3AED D;  2WU5 C;  2B76 C;  3AE9 C;  2WS3 D;  3SFD C;  3ABV C;  1L0V D;  4YXD D;  1NEN C;  2WDV D;  3AE4 D;  3AEA C;  2WU2 D;  1YQ3 D;  1KFY C;  3AE7 D;  2WP9 C;  3AE8 C;  3P4Q D;  3VR8 D;  4YSZ C;  2ACZ D;  3AEC C;  2WU5 D;  2WQY C;  2B76 D;  4YSX C;  4YTN C;  3AE9 D;  3P4P C;  3P4R C;  3VRB C;  1QLB C;  3SFD D;  3ABV D;  1NEN D;  3AEA D;  2BS3 C;  5C2T C;  1ZOY C;  2FBW C;  1KFY D;  4KX6 C;  3AE6 C;  3P4S C;  2WP9 D;  3AEG C;  3AEE C;  3AE8 D;  3AE2 C;  4YSZ D;  3SFE C;  3AE5 C;  3AEC D;  4YTM C;  2WQY D;  4YSX D;  1YQ4 C;  4YTN D;  3P4P D;  3P4R D;  3VRA C;  3VRB D;  5C2T D;  1ZOY D;  2FBW D;  3AEF C;  4KX6 D;  3AE6 D;  3VR9 C;  3P4S D;  4YT0 C;  3AEG D;  3AEE D;  5C3J C;  3AE2 D;  2H88 C;  3AE1 C;  3AE3 C;  3SFE D;  3AE5 D;  1ZP0 D;  4YTM D;  1YQ4 D;  4YTP C;  3VRA D;  1KF6 C;  1ZP0 C;  2WDR C;  2WDQ C;  4YSY C;  1NEK C;  3AEF D;  3VR9 D;  3CIR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...