4YTSA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy 3-keto d-galactitol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
294
structure length
294
Chain Sequence
b'MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 116
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ytsA00
2NQ9A 9XIMA 3M0VA 1XIJA 3JU2A 1S5NA 1XLJA 4LNCA 3KCLA 4XSLA 2QW5A 3IUDA 1XYCA 3CQKA 4ZB5A 8XIMA 1YX1A 3KCJA 4KW2A 5AVHA 1BXBA 3C0SA 2QUMA 1O1HA 1XLKA 1XP3A 3BANA 4YTQA 4YTUA 1DXIA 3NGFA 5FA5A 3KBJA 3LMZA 1XLGA 3UU0A 3UXIA 4QEEA 4A8RA 1QT1A 3OBEA 2NQJA 3M0XA 4E3VA 4EAYA 3CWHA 4X61A 5EMMA 2HK0A 2GUBA 1XIIA 1XIHA 3XISA 4QDWA 4ZB2A 3GNXA 1MNZA 4DUOA 3KTCA 3U0HA 3BZGA 4OVXA 3VNJA 3ITLA 3U3HA 3C0LA 1XLEA 5TNVA 1XYAA 1CLKA 4GJIA 4Q7IA 4QE1A 3AYVA 3ITVA 3KBWA 3KCOA 4K3ZA 5I7GA 5C9ZA 1S5MA 3CNYA 5H6HA 4HNOA 1XLAA 4EACA 4US6A 2GVEA 1K77A 3M0HA 3VNKA 2HCVA 4QE4A 1DIDA 4DVOA 1XYMA 3UA4A 1XLHA 3KBSA 1XYBA 1DE5A 3FVMA 3KBNA 4J4KA 3P6LA 2I56A 4XSMA 3TVAA 1XIDA 3M0MA 4XIMA 1XIMA 3BZJA 3M0LA 4HHLA 3VNMA 1XIFA 3CQIA 3XIMA 4HGXA 1XICA 7XIMA 4GLEA 4PFHA 5XIMA 1OADA 4YTTA 1XLIA 3DBNA 3N4AA 3QXBA 4W4QA 4GQBA 4QEHA 4YTRA 1A0CA 3DX5A 2OU4A 2G4JA 1BXCA 6XIAA 2G0WA 3M0YA 3ITOA 4PGLA 3VYLA 5J8LA 3ITTA 2I57A 2GLKA 1XIBA 2HK1A 1TZ9A 1XLBA 3ITYA 1QTWA 3VNIA 4K1GA 1XLCA 3L23A 2X7VA 3BWWA 3VNLA 1I60A 3UVAA 4A8NA 5EMJA 5B7ZA 4ZBCA 3P14A 2XISA 5B7YA 3IUIA 3ITXA 3KBVA 3KBMA 8XIAA 4X63A 2X7WA 4QDPA 3QC0A 1D8WA 1MUWA 6XIMA 3WQOA 4A8LA 5H1WA 4X60A 5XINA 1XINA 3QYSA 3BDKA 1XLMA 1XISA 3AAMA 1XIGA 2QUNA 5B80A 1DE6A 3QZAA 3CQJA 1DIEA 3TC3A 4YTSA 2NQHA 2XINA 2QULA 5EMKA 2Q02A 3AALA 4XISA 4A8IA 5XIAA 1QUMA 1A0EA 1XLDA 2J6VA 4GJJA 4QE5A 9XIAA 3C0QA 3KWSA 1A0DA 4G56A 2GYIA 1XLFA 1XLLA 1GW9A 2ZVRA 1XIEA 2XIMA 2ZDSA 3IUHA 4ZB0A 3XINA 1I6NA 1XYLA 4XIAA 5AVNA 3AYTA 3CQHA 5EMLA 4HHMA 3UA3A 4XKMA
chains in the Genus database with same CATH superfamily
3FY1A 1TSIA 4GINA 3KL0A 1F6YA 3MUZ1 3LM3A 2VWSA 4DEFA 1YPIA 3NQBA 1RXOB 4Q8WA 5HWNA 8TIMA 1HJSA 2C0HA 3BAIA 4C7FA 1YXDA 5IDIA 4UNLA 1G94A 2PEVA 4E6MA 4B4FA 1V0MA 4B92A 4RW3A 1EWEA 1UD3A 2OEKA 3S5ZA 3LCIA 3N73A 1KFLA 3DFPA 4GCAA 1M7XA 1UWRA 1DL3A 5M1TA 3V1PA 3BZJA 4L65A 1OB0A 1M5WA 2ALDA 4KCWA 4QJ1A 3VOIA 2XZ9A 4CNUA 3R8RA 5G4EA 1H60A 4GUFA 4M24A 2BHYA 1K9TA 4DJFA 1B54A 5FJTA 1P0BA 3V3WA 1SM9A 3UVIA 3NQMA 3B8DA 4C6QA 5K3VA 1CGWA 5K4XA 3F5LA 2PI6A 4X63A 3HGSA 1TKKA 3HQPA 3MQTA 2WLYA 3MUAA 4D8LA 3VOCA 3ARUA 2PCQA 2ZZ7A 2WHJA 4OOZA 2P53A 1MSSA 1U83A 3W85A 1B3VA 4EPKA 3GW3A 4FX6M 3TR2A 1AQMA 4Y9MA 3TU9A 1H2JA 3UXDA 1Q8JA 4UNKA 3BPWA 4JTSA 4EOUA 4ACYA 5TQLA 4GXPA 3TUUA 3I3DA 5KITA 3NQ7A 4LH8A 1WKDA 3E38A 5AECA 5DRCA 1SMDA 1QXLA 3VOGA 1PEZA 2E68A 1UD8A 2XFYA 4IFKB 3K4WA 3WLMA 2VEKA 2KAUC 2R1MA 1RPKA 1DWJM 4RE3A 3ZIZA 4HYRA 1GWJA 1TE6A 4LVAA 2O0TA 1U30A 1XYFA 2AGTA 3L9CA 1JZ5A 4R7WA 4I5UA 4PFHA 1PS9A 2TSYA 1PDYA 1LORA 1JJKA 1IQ8A 3AXIA 6A3HA 1YRRA 5CC7A 3TROA 1JULA 1TMQA 3URAA 4GQGA 1ADSA 2JGQA 4GY7A 2B7OA 3PZVA 2ESCA 4WGXA 2GVGA 3WL1A 3KBMA 2REQA 4PTMA 3WLJA 4O1DA 4PCTA 4KWWA 3GHRA 3J7HA 5E09A 1UQZA 4RNHA 1VC4A 3LTPA 1HP5A 1H51A 3WQDA 2PDIA 3NO5A 3O63A 4MKSA 1R85A 2ZKMX 4ES4A 3KP1A 5I78A 4Z2GA 1XBZA 2J7HA 1ITQA 2ZA3A 1O5XA 1DWAM 3CMJA 3LMYA 3UT0A 2DGAA 5CKSA 2R1NA 3KRUA 4Q8TA 5MHBA 1XGDA 3R58A 5GJNA 4P2VA 1WDSA 3SGGA 3FA3A 2OWCA 2GK1A 2DQXA 2IS7A 3REQB 5I09A 2WV8A 2VD8A 1UZDA 1GCYA 1GHSA 4E4FA 1TRIA 3B0XA 5EFFA 3QF0A 4HA4A 5CBIA 4B90A 4AZIA 3AUJA 1GEQA 2R94A 5MF5A 1W8GA 4PMYA 1R7OA 3EWBX 4ECLA 2O9OA 2VCCA 3LCXA 1LRNA 3PPFA 3I4KA 1B57A 2Y5EA 3SO7A 4GY0A 1P0EA 3W7PA 4EWJA 2BY2A 3TNOA 4L80A 2WNQA 3W2MA 2WJDA 3L21A 4D6EA 4UFKA 4LBSA 3WQWA 3NYDA 1N82A 4D6DA 3KZSA 2RHGA 3CAQA 4JTFA 1PZ1A 1X96A 1RVKA 1D2KA 4QROA 2G3JA 4GXWA 4G7EA 3S5SA 3E0WA 4PUWA 1A5OC 3BAJA 1ME7A 3NA8A 3PVFA 3QHMA 3LDVA 1QI2A 4EIVA 1WAWA 2VNCA 4XUYA 4GUIA 3S83A 4UFMA 1XC4A 1O12A 3ABOA 5FJIA 5TBOA 2CLPA 2WPBA 3AJXA 1OZMA 3KBJA 3MKVA 3LN3A 3F2CA 4DB7A 3WF4A 2XVNA 2YL5A 1OC7A 1VJIA 3T07A 3S6TA 3IIVA 1H7RA 2C6QA 3CHFA 5KETA 1UPPA 3E0FA 4PCFA 3PUDA 2X1IA 2ZOXA 2PDQA 2HS8A 5KEZA 4EPEC 3E12A 3CPUA 2EPOA 4ORMA 4GUHA 1YDNA 1O5KA 3IJ9A 4ZQMA 1YXYA 3JVAA 3FA4A 4GQRA 3EEZA 4UQBA 3H8AA 3ZM8A 1REQA 1UUQA 4EXQA 1OFAA 4NAFB 3ZVIA 3LG3A 1AQ0A 1XH1A 2OO6A 2DZWA 3EOUA 2YDAA 1KV5A 3P3BA 4UIOA 2BHUA 3PUOA 5TAOA 3VZYA 2HBXA 4GJ1A 1WDQA 1ICPA 4A22A 4O52A 1F4HA 3Q4DA 4XZWA 1UQYA 3HJEA 5G2HA 1ICSA 1UC5A 3GR4A 1VPYA 3VNYA 2Y62A 5D02A 4M6UA 3VUSA 2O4QA 4CN4A 1S2TA 2CLHA 3W27A 3CPRA 4UTTC 2BMBA 2GZXA 3W84A 3UZJA 1JDDA 1B2YA 3KP0A 4OKDA 2GOKA 1C93A 1KWGA 2XPKA 2QLYA 2PDHA 1GW9A 2ACRA 4QS6A 3PZ9A 4JFWA 4JX5A 2XM1A 2CFFA 3CQHA 2QV5A 2G3MA 3BGAA 1BRLB 4J35A 3EEGA 5H8MA 3GK0A 4LB4A 4WDXA 5JBDA 2PGFA 1O60A 3LMZA 4R34A 3T8LA 4JDBA 4LOCA 1T6MA 3VNZA 1XSIA 2Y5SA 1KQZA 3AHZA 3E2VA 4JN6A 1LQAA 3KL3A 2WM0A 3HMCA 3KTXA 2JEPA 3TJXA 1POJA 2BGQA 1EL3A 2PUZA 1EZWA 4BI7A 3SCNA 4NZ1A 1XIMA 4EKJA 2AL2B 2V2DA 5A95A 1POKA 1YEYA 2VFEA 1J6OA 4FMVA 4YS1A 1HJUA 3GDMA 1YNPA 4NNCA 4I6KA 2VX4A 4HB7A 3PPCA 3QR1A 1TPC1 3SFWA 2W79A 5T9CE 3OODA 4ZXOA 3GTNA 1EC8A 5EBAA 1D3HA 4N42A 2XHYA 4KWVA 5XINA 6ENLA 2FH8A 1RD6A 2BV9A 4IMGA 3OBAA 5D30A 2FQIA 1EJWC 3NPXA 3W7NA 3S5YA 2P88A 2WK2A 4NF7A 4LNYA 1IXNA 3O16A 1FVPA 4PB3A 4WF7A 4CU8A 2DV0A 2TMDA 3T08A 1V08A 4K2SA 4US5D 4DI9A 1BXBA 4JTGA 2WWCA 1XP3A 2PP3A 4XO7A 2WAGA 1SR0A 4NZJA 1ISXA 4CCZA 4Z2JA 5AHFA 1DWHM 3GR7A 4ZO8A 3ZVHA 4JHZA 3GNPA 2R14A 2GOUA 4X3ZA 1G4EA 1KBBA 4K3ZA 2FGBA 4U10A 3QN3A 1UWTA 3RGTA 4QE4A 1ZRQA 4NXSA 4OUEA 4J4KA 1U5HA 1FWAC 5DT5A 2FZ9A 4DJED 3WMCA 4WVXA 1AQFA 1EKOA 1VLWA 2W6RA 2CWXA 3NUKA 4UNIA 4I7VA 3C2OA 4RV8A 4AMCA 1QI0A 3ITOA 2V5JA 3L4TA 4LU0A 3N19B 3EWUA 4BWLA 4KETA 5EMUA 2DSVA 4HOZA 4JGDA 3H21A 5BOOA 3WL0A 1KC7A 5HMSA 3OG2A 4AQLA 4XKYA 2FDSA 5HBFA 3CGTA 3N9SA 1TJPA 1K3UA 4ENLA 2BHZA 3C4UA 4JL2A 3USBA 3KFTA 1CT5A 2Q02A 3VGHA 4G1NA 2DVUA 2HS6A 4ORIA 3QEZA 3MSYA 1UG6A 1IEWA 2IPWA 3PN8A 5TF0A 4LPCA 3SN4A 1CXFA 4ZEPA 4MWAC 1RBOB 4HA3A 3UW6A 3TTEA 3H12A 4A3RA 5HNTA 3SCSA 3TC7A 4AD3A 1GG1A 3EA1A 2RGMA 3EMQA 3KEHA 4ONVA 1JCLA 4IGMA 3R6IA 1OFQA 2PU0A 1TV8A 5LA2A 1GZJA 3DFTA 3FJNA 4RE4A 2V3EA 1V6WA 4MGGA 2YW3A 2DZXA 4F0LA 3H2EA 5IOBA 4X2PA 1TV3A 3AZRA 5LGZA 4DF1A 5JH2A 4CNNA 3TFCA 4TXEA 2NV9A 1TWDA 3W37A 3VX0A 2QMJA 4EVZA 3T81A 1QI5A 3E9AA 2AMGA 4F66A 2ODOA 3V4BA 1F3TA 2F2KA 3TDFA 3U6WA 1QPQA 5CLTA 5CPTA 1EGVA 2I16A 4GBUA 4I9JA 3NZQA 1XGZA 3E5PA 2TPSA 3VKKA 4ML4A 1MRAA 3VDCA 1NF0A 3WYZA 3W2NA 2FZNA 4ADTA 4AWUA 3M9YA 4A29A 3URBA 2PDNA 3PZOA 5CBJA 2Z0IA 3QQ1A 2D0HA 4LRSA 1FXPA 3ZLHA 1KCZA 3CS2A 2MNRA 2XN1A 1NFPA 4EP8C 1TQXA 4FPSA 5E9AA 3P80A 3GXDA 3GW0A 3WD1A 3B03A 3DHUA 3A5VA 2AMXA 3WNOA 1VHNA 1CGTA 4ROQA 2W66A 3TJ4A 4LBRA 3QY8A 4PYSA 1FWNA 1L6SA 1P0KA 1Q5MA 3SURA 4KERA 4JTLA 2HPMA 3M0HA 4D2JA 5K7JA 3RK8A 1XRFA 1E55A 4NASA 3NFUA 3FFSA 3GTFA 3WD4A 1TREA 2OX1A 1FCVA 2AAMA 2BX7A 3NL6A 2J74A 3S0CA 2EGZA 1P1XA 2OSWA 3WMLA 1A4LA 1RVGA 4OBTA 4QCEA 1DTUA 1QO5A 3N3MA 1W9UA 1PL9A 2CXGA 2DSUA 1FP8A 2FH6A 1WAUA 2WVUA 1HW6A 4KEVA 1V0KA 1DWIM 4FF5A 5E1QA 5HOSA 3AAMA 2NVDA 4ZSTA 3LS9A 3SUVA 4ZO6A 5CH9A 2P3ZA 4XAYA 2YCKX 3L0KA 1MXSA 4QNEA 3MV11 4N9DA 3ZR4A 3CUXA 2VOMA 1AMYA 3KCLA 1BVWA 4WY0A 3WK0A 1MZRA 4N9CA 1VYSX 3GH7A 1XLGA 1S3TC 3OBEA 4NL1A 5AC6A 3C2VA 3TN3A 4JTDA 2C71A 1OIFA 1Q66A 3ZJ7A 2CKSA 4XAFA 1JZ4A 1DYSA 3C8NA 4Z2HA 1KV8A 4ZOCA 3PZMA 1LDCA 4QE1A 1YBQB 1Z89A 1JI1A 1LQ2A 4JTJA 1F4AA 4DWDA 1ODUA 3P0WA 4MYAA 3FDGA 1OX6A 3W7MA 3P6LA 1GHRA 3VD4A 5C54A 1E6ZA 3N6JA 1IZCA 2IKGA 4MY1A 5CGTA 1FKXA 1QWKA 3EDFA 5FAJA 1B9ZA 4M81A 3B9EA 3PPGA 1H50A 3HPXA 4GC4A 2GDVA 1W1TA 1BLIA 5IXEA 1R86A 4HNNA 2VKZG 4TV6A 3VGGA 4IMCA 1ZU8A 4ZBCA 3PBYA 2OWXA 2J7BA 5HXMA 3B8VA 6XIMA 2ZICA 2BSLA 2H9AB 3W0KA 1IXQA 1XDJA 1CXKA 5A6JA 4Y9OA 3IJQA 1ITCA 3GHSA 4DBUA 1A0EA 1YDVA 2GYIA 3P5YA 4KMQA 4B9YA 2PDJA 1HGYA 1Z3NA 2X0HA 2OEMA 3B9NA 2TAAA 3EXSA 2AKMA 1FWFC 1TIWA 4JIPA 4PSRA 1UB3A 4DUWA 3WQ6A 1KM5A 1SZGA 3O2LA 4DJDA 1SZEA 4WD0A 1TYGA 3CTTA 4CD7A 2ATSA 2RUSA 2VGFA 3GXPA 1VEMA 1CX9A 1KTBA 2R1PA 1UH3A 1WDRA 1W54A 3H24A 2SFPA 1TX0A 3CLMA 2I5IA 2VX6A 2NZLA 4PCNA 3I3BA 1GYNA 2FPYA 4HU3A 2FLIA 2D20A 1J2WA 1ZAJA 4DWSD 4HGXA 1AZ1A 2OGYA 1TV4A 3UZXA 3ALGA 4JYFA 3GIPA 3ITTA 4O1CA 2Y7GA 4RNFA 5CPNA 2C13A 3HU7A 3OW1A 3VNLA 3AIRA 4AVFA 3QOKA 4W7WA 1R47A 2V82A 1PZ2A 3L66A 1NDYA 3E1F1 1R9ZA 4AY1A 3MS8A 3QR0A 4HMDA 5LIKX 1XSKA 4FLRA 1DHPA 1WYIA 2YX0A 3LOTA 2YR1A 4ERAA 2E8ZA 4O15A 2RFGA 3AALA 4PUNA 3EA3A 4XISA 4B5VA 1I2NA 1N8WA 3FA5A 1UWIA 3CV2A 2J9YA 3ANVA 2CIPA 3PWAA 3BCJA 1C3FA 5LIWX 1P5BA 3VC5A 1SFSA 1XRVA 5CLWA 2GWNA 5AOUA 2WOQA 1XYCA 1U1HA 4MLJA 4IMDA 3WNNA 3BANA 2C1IA 3EOOA 2XVKA 3PB0A 4EAYA 4FSAA 4UQDA 5BMWA 4MY8A 3FKKA 3D5HA 3IVSA 5EU9A 1X8CA 1HG3A 5CG0A 1VQTA 1SZNA 2FFCA 3BLPX 5EL1A 3IK2A 4JTTA 1LBFA 2YCJA 1M01A 1M65A 4L64A 4P8VA 1QPKA 3L5MA 2W91A 3VIJA 4DF2A 1XIFA 3LCLA 2VC7A 4J3WA 4LSBA 1CGUA 1IWPA 7XIMA 3E2RA 4P7RA 2ZX6A 4LAZA 3KOFA 2V6AA 4GRSA 4LS0A 1SVDA 2GFTA 5FEXA 3LGDA 1XS2A 3M43A 4DZIA 2PWGA 4AYSA 4OFCA 1B31A 2D22A 3N4EA 1ZCCA 4LXFA 4AF0A 4PUMA 3VUPA 2PTYA 1VYRA 1BPLB 1QOXA 1KRCC 1XYZA 1QUMA 4GZ7A 2LLEA 3EX4A 3DBPA 3KUMA 2WZMA 3RRAA 4AYGA 3VABA 2BZNA 1RJRA 2VDHA 2GPTA 1KFJA 3T0DA 4WJEA 1HL9A 4YTUA 3NGFA 4NJIA 1S38A 3F4VA 2JKAA 3OVRA 3WNKA 2W62A 4FAMA 4MFDA 3B8IA 1FXQA 2J8GA 1IZJA 2QJIA 3E6EA 4J28A 1MYRA 2QDGA 1CB7B 4LC6A 3W1NA 5AZ0A 3NNTA 2V2CA 3OVPA 4YWSA 4FNTA 4YLWA 3PTDA 3VDBA 3H22A 3D0CA 5C55A 1A5BA 4BEQA 3SGZA 2PTDA 1J0HA 2CBUA 4K36A 3URNA 4AFYA 4YJ5A 3G8EA 1X6NA 1TELA 2ZA2A 1J01A 1OFRA 5U4NA 5I06A 1L2QA 1THFD 3MSDA 1OF6A 4NAEA 2G97A 3HQNA 3A3HA 4GPNA 4H6RA 4AWEA 2HVOA 1TPDA 1Q6FA 2EPLX 3A24A 5CSYA 1O7AA 2ZA1A 1JCNA 2DSZA 4ZGYA 3K8KA 3FAWA 3OOQA 1Q6DA 2OZ0A 1J93A 4C6MA 1B0IA 1R7AA 4JQAA 5EMLA 2YA2A 3W25A 3LTYA 3MV01 4HJWA 3KRZA 4LAKA 1E1EA 5H8PA 1WDPA 4PCSA 1R46A 4QLJA 1M7PA 3TR9A 3S1GA 4YU1A 3QHNA 1E9IA 1A5CA 1PUDA 1DOSA 4J3XA 4WK9A 4IJCA 1V6YA 4AD1A 1J8VA 8A3HA 5CBBA 4E3VA 3DG6A 4Z42C 2NX3A 1EH9A 4AD4A 3PZTA 3RU6A 5HPCA 4H9UA 5HNNA 1W9VA 3H26A 3H2CA 1W5NA 4F48A 3M6YA 2ZC8A 3QV7A 3F4NA 4NIRA 1RD5A 1EEXA 4M5PA 2Q8XA 4AHQA 2XVLA 4BFAA 5E9XA 5EY5A 1JF5A 3QHOA 4W88A 3JZUA 3LLXA 4PTXA 6REQB 2EPMX 4P5UA 4DLFA 3IGSA 3LPPA 3N6HA 2O4MA 4UZSA 4YWIA 5C2GA 3B0VC 5BCAA 4C5ZA 4AG0A 1D8WA 4H2HA 1XBYA 4FR6A 3NQAA 3FHAA 3GM8A 4FZIA 4AZCA 1QMLA 2YL9A 3LQLA 3N2OA 2PGEA 1QNOA 3O0FA 3WNLA 3ZYZA 9XIAA 2HE8A 4F9JA 1J0ZA 2TODA 4MB3A 2XWEA 3PUEA 3KLLA 4R85A 2PRLA 5D32A 2A3BA 2JE8A 1V3IA 2J4GA 1MQQA 3M0IA 4I3GA 4KESA 3UPMA 2QCEA 3SQLA 2QIIA 2OOGA 4FIRA 2FKPA 1QFEA 3NXFA 3VNJA 2QT3A 2ZZ1A 3PHAA 5I23A 1G4SA 4ZOAA 2UV8G 3HIJA 3S2JA 1VYPX 2QCMA 4IGHA 3AZSA 4JCMA 1GVEA 4HHLA 1UYQA 2PZ0A 5D9MA 1RA0A 2UBPC 5BRPA 4K8GA 3BJFA 2ZRVA 3P5ZA 3OBKA 4O16A 3GDLA 4P7NA 2HVNA 2NWSA 1VIZA 2I57A 1S5WA 4A8NA 2V3GA 4HK5A 4DYKA 1UR8A 1HO1A 2Y8KA 4DJFD 2WWDA 3IUIA 3GHUA 4I8YA 4CQCA 2UY3A 1Y5VA 2PWFA 2VVSA 2ZWYA 3F4WA 3U5UA 2FGZA 2QJNA 1UR9A 4Z1BA 4JL1A 4P7QA 2NV1A 3P61A 4LUTA 4QS5A 3BGJA 1WZAA 3QV8A 1LOQA 1UR1A 2FMNA 1W1VA 2QV4A 4M3PA 4JICA 1UBSA 4CVUA 3MW7A 3OYZA 3C86A 2EG6A 3USZA 1C92A 1YPXA 4H8VA 5IM51 1U1UA 4EPBC 4JIRA 4IFKA 3U48A 3PJWA 5F2GA 1OCJA 1WKEA 3WLOA 5FI8A 3CV6A 4K1WA 4HNUA 3WH9A 1D7KA 1LP6A 2E40A 4RW5A 1LOLA 4C6BA 3MJYA 4U2ZA 3ES7A 3VZZA 1R3QA 5BWFA 3COTA 1GKQA 3PF3A 3TYZA 9RUBA 1TTQA 2WW5A 4I5XA 1JD7A 2DIKA 1GJUA 3GY1A 3QV6A 1Q3NA 1UKSA 5C70A 3ALFA 4LEQA 1EBGA 1R3YA 3QGKC 4KCVA 4BR1A 3WD3A 5LXEA 1N7KA 3CHVA 2BDQA 3BICA 5KZDA 1S2WA 2I17A 4DNHA 1ZS2A 1NAL1 5HINA 3SSJA 3WJYA 3LNMA 2WJEA 3APTA 3M5ZA 1W3HA 3W2LA 2W3ZA 7REQB 3VNDA 5EMKA 1AW5A 3PP7A 4ZQNA 1A0DA 3W26A 4MLRA 3GBDA 4FB7A 1JCJA 4UTWC 1GOMA 1EJ7L 3WFZA 3RPDA 3REQA 4C6LA 3GVVA 5AVHA 3FKRA 4I5RA 5F1VA 3WQ8A 2JALA 3I7SA 3DFHA 3AIUA 3CO8A 3QMTA 3CWHA 3DIPA 3EPMA 1PCKA 5DT7A 4G6CA 4U5IA 1JUKA 1PO9A 2CWNA 3M47A 1CCWB 4WCJA 3DYMA 1FCQA 4UOZA 3ITLA 3S9YA 3PFMA 4Y8EA 2CBJA 3HFTA 3LLDA 3MMDA 3FEQA 3SCVA 4HQVA 1JYNA 2INFA 1ZLPA 2CBIA 4Q6JA 2J7EA 3F4CA 3BGGA 3TONA 3LTSA 3PBWA 3AHXA 3N2MA 3VPLA 3SEPA 2D23A 2AAAA 2DUZA 4DO5A 2HDJA 4KEZA 2D2JA 3GTHA 3KLKA 3G8RA 4UTUA 4A6GA 3WH5A 3L0GA 2J7GA 1A0CA 3TAOA 3FJLA 3HN3A 2X16A 4C6DA 3UYIA 2V9DA 1VLIA 3BW4A 7TAAA 3PZUA 4FALA 3HV8A 2OO0A 4MNJA 3ZSTA 3WQOA 3NL3A 1QW9A 5FSEC 4UQ9A 2OZTA 1UUMA 3NQ2A 3HBLA 2P5NA 3UG5A 1O94A 1OSEA 3RUBL 4C6KA 4YHGA 2WBKA 1VD6A 3ISIX 7TIMA 5I0DA 4JIQA 3G1FA 2UY5A 5G4WA 3APGA 3ITGA 1B3WA 2FMOA 1A5NC 4YVVA 2PDCA 4CD4A 2IKIA 3TZFA 3TC6A 5BU6A 1X7FA 5F4WA 1QO2A 3VIHA 1TJ0A 2J66A 2AQOA 2B7QA 4ZE5A 2PF8A 4CN1A 3BJSA 1Z7AA 2F6KA 1OQFA 3AYVA 1BWVA 4IXHA 1Q8AA 3ANYA 3UNDA 4RE0A 3S6OA 3BQ5A 2ISWA 2NUWA 4NAFA 1EOMA 1Z6KA 1DE5A 4KGLA 3MC5A 1UKQA 2A5HA 4PFMA 3M64A 4J2PA 3SN0A 2I14A 4ERIA 2DZTA 3MKKA 3EB4A 2ZRZA 1EFZA 3M5XA 1EC9A 3RCMA 1QNSA 3S1WA 4DN1A 3MPGA 2X8RA 1ZJHA 5AYIA 3W28A 2PWEA 1EDTA 4GK8A 3GE7A 3MVTA 4ZQCA 3TLQA 2V5BA 4H19A 1QNQA 3MMTA 4FXRA 1EX5A 1BRLA 5KZEA 3NVDA 1ZTVA 2BGSA 2MUCA 3O06A 2QYGA 2NXGA 3N3TA 2FIQA 3NQ8A 4QSFA 1L0PA 1NU5A 2DH3A 4FXFA 3BK0A 1XW8A 4I9TA 4AHPA 3TYEA 3ZR6A 1DJQA 3NZPA 3KRBA 3VD5A 1XSJA 3GLCA 3IIPA 2GQ9A 4WQ6A 4QXIA 3LXBA 3CL8A 1HUVA 4L4LA 4DM2A 4FOUA 2ZTKA 4AEEA 2ZRYA 3WDRA 3BUVA 3CU2A 4IIDA 2PDBA 1OFEA 3F2BA 1ZPTA 3JW7A 2AQWA 2VWTA 3CNYA 1FWTA 3AWOA 1BSIA 2PAJA 2ZRWA 4L4OA 1YTDA 3S5NA 4PH6A 3KBSA 3ZR5A 4DYJA 3TCEA 4GISA 3M0MA 4BJHA 3EWXA 5CAHA 1PX3A 2DORA 3BCDA 4D1JA 3TXZA 4ZE4A 4DUXA 1J0JA 3BSMA 3WZ0E 1YQ2A 3UCQA 2PFHA 4H83A 1FHDA 1GVRA 4C91A 5CZ0A 1E9LA 1VAHA 1W5QA 2R82A 3CUFA 2OX4A 1FDZA 1JPIA 1C8QA 1UWSA 2VELA 1RCQA 4XZMX 5F2LA 5HWJA 1TTPA 3W7KA 1GQLA 5E93A 3W71A 2NWRA 3B8SA 1WQ5A 4LW7A 3Q94A 2YIHA 4KIEA 1KD0A 1S1PA 3DC0A 2XIJA 1UD4A 1PZ3A 3QGVA 3UNTA 1TFVA 3IIOA 2ZVRA 1E6QM 3BJTA 1T96A 4PCPA 2UY4A 1X6UA 2HWGA 3UWWA 4KFPA 1OX5A 3GSMA 1VGAA 5CSRA 4GYFA 1LQ0A 3GO2A 5E0KA 2XGBA 4UXDA 1Z42A 1AMKA 3LQGA 2WLZA 4AXNA 1JI2A 4WKFA 4DAIA 3ZT6A 3FAXA 3QMSA 4QP0A 1UMYA 1JDAA 1MEWA 1BD0A 3CO4A 5I3JA 1XCWA 4MJ2A 4EE9A 5EFDA 4C60A 4HN8A 1CENA 2UZ9A 1BXNA 3OLIA 1PHQA 5DEZA 4J3ZA 4DXXA 2Y63A 4KF1A 3AMCA 1TJ2A 2YYUA 2QCHA 4H8NA 1LROA 3K1DA 3F1QA 3VFLA 3ARTA 3ENLA 3CBWA 4W89A 2OEJA 4PZVA 3Q45A 3HG2A 2A3LA 3R10A 1DWGM 2RKXA 3LHZA 3WDHA 2WCAA 3R11A 2HVMA 3ZJ6A 1U33A 1T8XA 2EKCA 3VDAA 1MW2A 3OO2A 1PHWA 4QG8A 2XM2A 5H8UA 3VOFA 4QHRA 1HZYA 1ZHAA 2CLKA 1VEPA 1XIJA 2C3ZA 1J0KA 3WDQA 1BWLA 3SW6A 3T4CA 2Z25A 5U7SA 4DHGA 2IKHA 1K8YA 4Y9NA 4ZENA 1RQBA 5HAOA 4Z1CA 3CMGA 2WSYA 3B9AA 4DRSA 2H8XA 3MP4A 5BXSA 3TQ0A 5BW6A 2J9XA 4GIAA 1IR1A 1S5MA 5FJUA 4GYPA 3BL3A 6CGTA 4LGXA 3CAKA 2DZSA 3G2GA 2VD9A 1XF0A 3S2MA 2C8NA 3LXAA 4O12A 3PANA 1K9FA 4XIMA 3DFNA 1M3UA 1SZFA 3MI2A 3PBGA 3TSBA 4Q7NA 3MSRA 2BXZA 3UEQA 1KBKA 3C52A 2G41A 2XYLA 4IMAA 2OSXA 3UG8A 4S3FA 5LA1A 4CD6A 4ICNA 5KTLA 2OU4A 1BXCA 1VHCA 2J8TA 1NM9A 2ZUWA 1IEQA 3FOKA 5CJ5A 1P6CA 5D2YA 3DESA 4PRWA 3E0VA 1I45A 3NJ3A 4HPJA 3DAQA 2UWFA 2QVHA 1XIGA 4L1WA 4BQ4A 1H4PA 1KNWA 2YFOA 2IXVA 3N18A 4NG3A 4D8AA 1OG0A 4OQVA 3WJWA 3KWSA 1JAKA 4G56A 2VGBA 3LM7A 4NZFA 3T7VA 3UP8A 5M3WA 1H63A 4NZ3A 4JX6A 5E70A 3ARRA 3GD6A 3GU2A 3U8GA 1FTXA 3BLDA 4LVDA 1QT1A 1E6SM 5FJJA 4G2DA 3B9OA 2BGNE 5EMMA 3I7QA 3TMLA 3L4XA 4HYWA 1Q6OA 1OVDA 1FCBA 1L6WA 4JTHA 3D46A 2YXOA 3H6OA 1H5YA 1GEHA 4GNJA 2CKRA 3GNNA 3IEBA 2ZDRA 4PL1A 1D3GA 2E1WA 4I8DA 3LRMA 1XG4A 3ZS4A 3H4XA 3RCYA 3M4HA 2B7NA 4ADUA 2BVWA 2EPNA 1P43A 1NTHA 4LAOA 1O5RA 5MKGB 4DZAA 2AOSA 2DUAA 4S3CA 4GHRA 1TWSA 3OLDA 4REQB 1L2UA 2ZRUA 5T26A 4UMBA 1H7PA 3WUGA 1CZ1A 3BSGA 1O4UA 5LNRA 3QGAC 2BXYA 3QLDA 3W53A 2G3IA 3SUWA 2J47A 1VP5A 1W3TA 2X40A 3NL5A 4NU7A 4GJJA 1H5VA 4L1GA 3PJUA 1TO3A 1UHVA 5DANA 4JTCA 4A05A 1KTNA 4ZQPA 3F5JA 2OLAA 4QG6A 1DJXA 9XIMA 2WHLA 4FX8A 3BW3A 1ECEA 4RR4A 2DT0A 1LWIA 4KWSA 1VPXA 4YMZA 3NEVA 3GZAA 2JKPA 1YBQA 2J9ZA 2P3EA 5EYWA 2HSAA 4LYQA 3T4WA 2V5LA 4OVXA 3GG0A 2ZXBA 5DXYA 1IXPA 1T5AA 3RN6A 1LG2A 3ARQA 1BWKA 1UIPA 4LF2A 2HMCA 2OELA 1EPVA 1QVBA 3EOEA 1XYBA 2A7PA 4WEVX 2DY3A 2HPIA 1BF6A 4MDOA 2PB1A 1ZFJA 2B7PA 1R6WA 3NIYA 1F2JA 1I2QA 1JDEA 2XFWA 4L4MA 2ZX7A 4W4QA 1W1YA 1V4YA 3CHCA 4QGCA 4PUKA 3HTWA 2H9AA 1RAKA 2V30A 3VK5A 3N11A 4O57A 1G01A 3EOSA 5T91A 3W7IA 3ITXA 1V3KA 3IAPA 6PTDA 1V0NA 2J13A 5BOEA 3QY6A 2OR2A 1XLMA 3K30A 2VQUA 5M03A 4YVXA 5DELA 1YNQA 1LT7A 1GOIA 4IPPA 1V51A 4ATWA 4Q4QA 4MWAB 3WH7A 3W38A 4DZHA 2DSKA 4HA0A 1J11A 3VNIA 3H23A 2GGEA 2WXDM 1KM2A 3QM3A 4AIOA 4OGZA 4NVTA 4XSLA 3GR8A 2WHKA 1A5KC 1F76A 4JDYA 1QW7A 4ZODA 4C6NA 2XH4A 2Q6ZA 4OV9A 2J25A 1DWFM 1DJNA 3M0XA 4B5TA 2R1LA 1DQXA 2J27A 4C6OA 3IS4A 2NXHA 4MF4A 2FB2A 4DJDD 3D47A 1RQEA 4DF0A 3ERPA 2F7FA 2PDLA 1SW7A 4HU8A 3SN1A 4W84A 3F03K 1QCWA 3IPWA 2PU1A 3WMSA 4URIA 2O92A 3U4FA 3M0ZA 2ZUVA 3T42A 3RX3A 1JZ7A 1TVLA 2G4JA 3WF3A 1VKFA 1LLZA 1E43A 1JRBA 2PGRA 5FL0A 3T44A 2EF9A 1RP8A 4HSOA 4M19A 3IV3A 3W75A 2IKJA 3STCA 3G1SA 3GQYA 1Q65A 3HFYA 3WF2A 1EA0A 4L6HA 3ZXWA 4NJGA 1X39A 2J88A 3PZIA 1FKWA 4ZXLA 4OV4A 3IANA 2XFRA 3IJ6A 1AG1O 1LG1A 3TQPA 3PZNA 1EEPA 4TQTA 1UA3A 4JHOA 4HNCA 3PSVA 3HGOA 4HHMA 1WE5A 1QK2A 1RH9A 1XBVA 1YX1A 3AICA 7PTDA 3C0SA 1TTIA 5FACA 4EF8A 2FB3A 3GC4A 3EXTA 1E73M 1EDQA 4J9JA 3BLKA 1PKLA 3E74A 4X61A 5JVLA 5CGQA 1J79A 2RDWA 1CI1A 3PWIA 3FYOA 1MNZA 5AFDA 3EDEA 1DV7A 1WA3A 2XIOA 4KWOA 1V3LA 1MWOA 2INZA 1JYWA 2HCVA 3ABZA 3EX1A 1UCWA 4Q33A 2DVTA 2VDGA 2V5KA 3ZLGA 2DIEA 3DYOA 2TRSA 4S23A 2OYLA 2H6RA 5KZ6A 1JXJA 3WFLA 4IL2A 1D8CA 2NVAA 5CCZA 1TPFA 3B8UA 4F0MA 4BQ2A 2VX5A 1PBGA 4HCHA 3HGJA 5FJPA 3STFA 4IJBA 4XZHA 3TLLA 2HV5A 3NDYA 4MJMA 3W81A 1I8JA 3UXLA 4OT7A 4Q8VA 3UY7A 2D0GA 4W93A 4XWUA 5LIYX 2AL1A 1VJZA 3TJIA 4WZHA 1OABA 1XLFA 1OWQA 2PURA 4I9AA 3DI1A 3O05A 3RMJA 1JPDX 1NH6A 1GQNA 3VCCA 4Q8MA 1OHLA 2GWGA 5FA5A 2CCRA 4NZCA 1GGOA 2X0YA 2PMQA 2DIJA 4W9TA 1QPNA 1OFBA 3C2EA 1HNYA 3V0UA 5DXXA 2WNNA 2WSPA 3O3RA 1BYBA 4C1LA 1XWYA 2BBFA 2NSOA 4QX4A 4N0RA 1O68A 4F4RA 5IFPA 3VXGA 4FLOA 4H6EA 1KXVA 5CPOA 1G4PA 5IBXA 1XD1A 3NWRA 5AHEA 1R38A 3WLKX 3B9DA 2NQ5A 1ADOA 5G1YA 4KRTA 1C91A 2PD9A 5HATA 1PIIA 4NJKA 4LCRA 3BG5A 3H7VA 4MAVA 4J3VA 3BSHA 3D3AA 4JZ5A 3W4RA 1V6UA 4IX2A 4ADSA 4IIHA 4PRTA 2CNCA 2PWHA 4YTRA 3G5EA 3GC2A 4NX0A 5E0FA 4LYPA 5J8LA 4JKMA 2KZHA 2Y0FA 4FEZA 5CC5A 2DQWA 1XLBA 1YW1A 3CUHA 1LBLA 3W2KA 2GGHA 5DN1A 4NNBA 5I3KA 3DDMA 2CBVA 3H7RA 2V8ZA 4NRSA 5G1TA 1TJ1A 4ZL1A 3QZAA 5I24A 2CLEA 4XTIA 3ABSA 2VQTA 3E49A 1E1CB 4LVFA 4TVUA 3BLEA 2YBVA 2VYOA 1XPGA 3PC0A 4G7FA 4E2OA 4TVCA 2JQXA 4O8AA 4TMBA 1T40A 3BCFA 1ZGDA 3AC0A 1GW1A 5A8MA 5LHEA 3N25A 1GKPA 3SJ3A 3DFSA 1BVZA 3N29A 2HK0A 3LB0A 2V0TA 3AFBA 1ZY9A 3ELFA 4MZ8A 3IGXA 2NLYA 1JDCA 1NOFA 2R1KA 4FNQA 5I6SA 4NT0A 3MHFA 5E6ZA 5RUBA 5FL1A 1XYMA 1IXOA 5ABTA 1JRCA 3EDJA 2E67A 6REQA 4A21A 1TJRA 4AX6A 2F61A 4QCFA 2H3BA 5GNYA 3IJ8A 3ZO9A 4LQ1A 1ESWA 2Q3RA 4NAEB 4ZTYA 5A8GA 2ZRXA 5KSWA 3AWNA 4IT1A 4WX2A 4MPQA 2BODX 4O0ZA 3HV9A 4JFSA 3THUA 1F8MA 1EC7A 2V67A 3PTKA 2OJPA 4H3DA 1RA5A 1NQKA 2F9RA 4NZ4A 4J2MA 2PGWA 3LBCA 4RE2A 3TWAA 2PSNA 1DE6A 3L7RA 1TMHA 4BI5A 2FZMA 4LF1A 3IRSA 1H62A 1NARA 1W56A 4GI4A 2C79A 2YLAA 5BXTA 2Q09A 1FDYA 1RR2A 2YCEA 4LTSA 2FYMA 1ZBVA 1ADDA 2QUMA 2YCIX 1GZGA 1W5MA 2G4FA 2VUYA 3U2CA 1K1DA 1E56A 1F07A 1Q63A 1DQWA 3P8IA 3W1AA 3EDKA 3ONBA 4NJJA 4DBWA 4NYUA 2CW6A 1CLKA 4GJIA 2FJKA 4A2SA 3ITVA 4EWND 3FHQA 5DQPA 1XLAA 2BOGX 2A3CA 4AD0A 3GVGA 1EJVC 1NDVA 4J3SA 1VRXA 1TVPA 2J77A 4NI8A 1E0WA 1DTNA 3LGGA 5A69A 1XFCA 1SO6A 1ZUAX 5DFAA 3MYPA 1MEHA 4GXMA 3RJXA 2CLMA 1K6WA 4UB9A 1U5JA 3FXYA 1E51A 2I1OA 4PB4A 4O17A 2NUXA 4PTDA 3L0NA 2WSKA 2ZUUA 4RDZA 2X1TA 3W70A 1PJ9A 2QVNA 2X30A 4A8IA 3IVTA 3VE7A 3R89A 4EF9A 2NT1A 1HO4A 3CPGA 2PP1A 3VI2A 2P0OA 1VBJA 3HF3A 3ABRA 4ML9A 4E2DA 3ZMRA 2QDDA 1EZ2A 4CQ8A 3CMFA 1K9EA 3WQFA 4GX9A 3UJRA 2R6OA 1EOKA 2NSXA 4ATLA 1HGWA 4DBDA 5EBUA 2Y85A 3R0KA 5KMYA 1V03A 1DIKA 1MO0A 4PEEA 3N6QA 4H2CA 3HPZA 3LZ3A 5ECUA 3O7UA 4L9YA 2BVYA 3T0AA 3SCTA 4S3EA 1LBMA 1FBAA 3T05A 3WBYA 1UKTA 4LB3A 4EACA 3WFAA 1BSLA 4BCEA 2YCLB 5AHMA 2YBUA 1DBTA 4F3HA 3OG3A 5EKYA 4UMAA 3GVWA 3CB8A 2VXNA 4RNJA 4MJ4A 5CPQA 1PWLA 2QJHA 4DIAA 5DCDA 1KLYA 1B30A 4CLMA 5FOOA 4XO6A 3I6RA 1IHIA 3L2MA 3VGFA 2QDEA 4IOTA 4DJEC 2YA1A 2W92A 2G95A 4RX0A 2ZXAA 3RLGA 2IMRA 5A2AA 1IEVA 4KT2A 2OXNA 4FA3A 7REQA 1PKNA 4MNLA 1QASA 3KBVA 4LUTB 1AZ2A 3NXLA 5DMMA 4RLIA 4NYYA 3LSBA 4D1IA 3FJ6A 2GJNA 4LAMA 1PPIA 3N04A 4F0SA 1X6LA 2FJUB 4DBEA 3A21A 1U2YA 4GNVA 2PDWA 4B5UA 4M6QA 1CPUA 1TV7A 3NQFA 1LYXA 2HQAA 3GFYA 1OFPA 3HPAA 3LPOA 2EAWA 1E9ZB 1F73A 3Q37A 3WF1A 4XKMA 1RBLA 3STPA 1OF8A 3RLUA 4O54A 4E0CA 3KXQA 2IW0A 3EDDA 1H7XA 2XGIA 3BC9A 4LANA 1LZOA 2ACUA 3GKAA 4Q8NA 1ME9A 3WBWA 1A5AA 1QNVA 4M0XA 3GVQA 3B05A 2C1GA 2ZQ0A 3V0SA 3T0CA 3NSNA 4ZTXA 4JAWA 5TNVA 1QW8A 3W7OA 2OB3A 1UR0A 2YJQA 1I0BA 1FWCC 4H9YA 4S1FA 1Q6EA 4JIHA 3UZYA 2WMIA 1BQGA 5JBEA 4J7RA 3DG3A 2WQPA 2GDUA 2GSJA 5T9BG 3IK4A 3A4JA 5BRQA 3NPVA 3G3DA 2VZTA 1VFSA 4IMEA 2GJXB 3FX4A 5FCZA 5I3GA 4O0KA 4IIEA 4V1XA 1I60A 3MI3A 3DCPA 4LV4A 1J2BA 4H6KA 4N4PA 3P14A 1WXZA 5DRIA 3DH7A 4Y6GA 1FHUA 3DC8A 5D2WA 5C5YA 4AUBA 2VFDA 3ZT7A 3EZ4A 1KCKA 1Q45A 1CDGA 1A50A 3B0PA 3PSWA 4TU1A 2YA0A 4L1XA 3WLPA 3V35A 1W37A 2VR4A 4GZJA 3M0JA 1GJWA 3S2CA 4AEFA 3BV7A 3EWDA 1SJDA 2VC6A 4ILSA 4GYKA 1JZ3A 3VIFA 1A5LC 3PPHA 1BF2A 5JXQA 2INEA 3RLVA 1HKVA 3S9ZA 3ZLFA 3PAOA 1JIBA 1AJ0A 4CNOA 1ZENA 4XD3A 4S3JA 2V81A 1EF2A 3TQKA 4M80A 2ZX5A 2OG9A 4ZA0A 3LX9A 3PJXA 3C0LA 3BMXA 4Y7EA 2ZCGA 1US2A 5HMFA 3OIHA 3P84A 5JIWA 1J10A 1E4NA 1UPMB 3EWZA 3U9IA 3CZKA 1K77A 3RNDA 2NQLA 3G6MA 4Z0SA 1QNPA 3KBNA 1WDWA 1WNOA 2Q01A 3ICJA 4CCDA 3FEMA 4Q8QA 3NQVA 2WM1A 3A9IA 3N4AA 4H4IA 3CHDA 3GWQA 4Q32A 3S46A 5BMXA 1HXJA 3TSDA 4HNTA 1IT0A 4U4MA 1RHCA 4HD5A 4J3UA 4V2XA 3GXIA 4MUZA 1VR6A 3G18A 3T1GA 3EWCA 4IM4A 1JGMA 2Z28A 4MB5A 5KINA 1DP0A 4NNAA 2GVJA 4IP7A 2PDYA 1M41A 4WJXA 1OM0A 4DO4A 1PKYA 2ZZ4A 1YE6A 3B06A 2V69A 1GQJA 2XINA 2QULA 3WEMA 4AVOA 3PR2A 1HX0A 2J6VA 7CGTA 3VIOA 2PLKA 4U5KA 5A6AA 2E4TA 4FOJA 3EWYA 3WBEA 3IUHA 4IISA 1OBAA 5BOFA 4S3DA 3NQEA 3WQCA 3N2BA 4F40A 2Q3OA 3TIMA 1EGMA 4YPJA 1CB2A 5A8PA 4YN5A 1BQCA 3CC1A 2PC4A 3WUFA 2Y24A 3IGUA 1KM3A 1XIIA 4GZIA 5A6BA 4C6PA 1CGXA 5FSDC 2WVSA 5HQMA 2PLMA 1DJYA 4Q7IA 4O0QA 3T40A 3R94A 1Y5WA 3W6MA 4NKCA 4LCSA 1ONEA 1G7VA 1GOQA 1XLHA 2VGIA 4QJ5B 1EJRC 4FR1A 1F05A 2XVGA 2ABBA 2A3HA 1N8FA 5F4SA 4JOMA 3PG8A 4DYEA 1L8PA 2IPGA 2D3LA 3II1A 4H04A 2Z29A 4ZO7A 2X09A 1VJSA 4CQ9A 3TYCA 2VRQA 4QR6A 3S2NA 4PMZA 2PODA 4HN4A 2EEXA 1NVMA 4F2BA 3CZ8A 2C14A 8XIAA 5CXPA 2O55A 3T9PA 3BE7A 3V5CA 1C8XA 1SO3A 5HULA 2Y2WA 5SWUA 5ABGA 2WC4A 1H11A 5XIAA 1KRAC 4UFJA 1W2VA 1KWKA 1AODA 2Z1XA 4IIGA 4M51A 4IJRA 1UZHA 1KM0A 3UA3A 1WDDA 3G0UA 1NELA 3JU2A 1FWHC 3PUGA 3FK4A 2Y4SA 4K8EA 1GQIA 2XGZA 1X1OA 3T09A 1K8CA 3CZLA 1E6XM 1E15A 1XIHA 4B5XA 4ZFMA 2ZTJA 1R2RA 3DECA 2FHCA 4AX7A 1F6PA 1RLCL 4PBGA 2Z1BA 4AWSA 1M9HA 1RALA 3WNMA 1VCGA 4S3BA 2RDUA 4JNZA 1IEIA 2I5GA 1XICA 4C7GA 5A6SA 3B0UX 4ICMA 1SZRA 3EX2A 4DWSC 3MP5A 1EIBA 3PB2A 3VVGA 3M0YA 3EOLA 5JIPA 4AMAA 4CD5A 1XIBA 1VFLA 2OKOA 3S1UA 3VKCA 5K9DA 3EB2A 5BXRA 1YTEA 3KOWA 2BFGA 3E3HA 4GQQA 3PM6A 4OU1A 2DJXA 1M7JA 1XDLA 1DJWA 3R5EA 4QLLA 1EYEA 4B4HA 3BDKA 2BOEX 4XX6A 1GOKA 2OFJA 1V6XA 1R5YA 1A4MA 2NQHA 4ZOBA 2XUCA 2OWWA 4AZ7A 3LUTA 1IIHA 3HZ3A 2O9PA 3RHGA 1XIEA 4O13A 3PBVA 3GDRA 5BYWA 2ZC1A 2VEFA 4W87A 3M0VA 4TV5A 1W9XA 3TN6A 4KW2A 3R12A 1EO7A 2XDFA 3AS1A 1VIWA 5I03A 2IQ0A 2XSAA 2Z27A 4O53A 4HNLA 3KW3A 1AW2A 1UOKA 1PV8A 4KKXA 1NWTA 4Y90A 5GJMA 1V3JA 1OFDA 4G9PA 1VCVA 2C18A 2G3FA 2PA6A 4GVIA 1OJXA 4JCLA 1TA3B 3B8WA 2XH2A 2XN2A 4BF9A 3IIZA 4GKTA 1J18A 3NYZA 3KOXA 4MOZA 1ITXA 4XK2A 1KRMA 2VRJA 1KM6A 3C56A 3L2LA 3SBFA 1HQTA 3LCWA 1WKYA 3V36A 1AK5A 3S9IA 3DFOA 3JUGA 3VMNA 2GVLA 3M44A 4UTTA 1CNVA 3MZ2A 4J40A 1TR1A 4H9VA 3SUUA 1E4LA 2QCDB 1ZL1A 5L6UA 3L23A 3BAWA 2V63A 3L4UA 2A2IA 4C90A 4PB5A 4PA8A 4HA1A 1UWUA 3LBOA 3AHVA 4B5WA 4GFSA 4LVBA 1LM1A 2PP0A 3BOXA 4RCXA 3IACA 3WF0A 5GVJA 4AH7A 4A3UA 3QTPA 2V68A 4Q7BA 1CGVA 4O1AA 2V5DA 3EKLA 3UCDA 2PWDA 2RJGA 4LS1A 1E0TA 5D4YA 1MDRA 3FN9A 5HMEA 3QFWA 4JY8A 5I00A 3ATYA 3TOPA 5G1MA 1ZALA 3AUOA 3O0KA 4JQ3A 1XYAA 1VFHA 3UR8A 1XCXA 1JYVA 3UR2A 1RK5A 3KBWA 3UWYA 2PE4A 2ZX9A 5AKQA 4A4AA 1KXHA 3NOEA 2PRHA 5DX7A 5A8NA 3V16A 5MKGA 2QAFA 3KVKA 3FVMA 4R88A 3VNMA 4REQA 3TXVA 4EK7A 2QAPA 1LLOA 3AJ7A 2ASHA 2IUZA 1RY0A 4HHHA 3UETA 3VMOA 3W01A 2J75A 4M56A 3ID7A 4O1FA 2GSEA 3ZJ8A 3OU8A 2WZHA 2YGYA 2XISA 4JKKA 4QITA 1SFJA 1OD8A 3M5YA 3I10A 4R53A 1WB0A 1OYCA 3TYBA 4AIUA 4LV9A 5B80A 4POCA 2OMAA 2ZZ2A 2VUNA 4OOUA 2P76A 4HU4A 5C9RA 4JNYA 4Q8PA 8XIMA 4FF7A 1NQ6A 3HPFA 1CECA 2GJRA 4BA0A 2CZ5A 1QI3A 2DEPA 2GGGA 2E6FA 4IIFA 1QPRA 2Z1KA 3C2RA 4WSKA 1CXEA 3WJSA 4ZOEA 1LF1A 4R27A 2BLEA 1BVNP 4HKPA 4JFTA 3OPSA 4HCDA 3EX6A 4H00A 3BW2A 2R8WA 4PR4A 3R8GA 2PDGA 5AN7A 3EBVA 3L65A 3RF9A 4K38A 3I65A 3VNKA 4XAPA 2Q8LA 3ES8A 3CM4A 3WH6A 3MZNA 3NSMA 2Z1WA 3WO8A 5DCBA 4K39A 1B4KA 3A64A 4R5EA 4DO7A 1RK6A 5A2BA 3KDOA 3GS6A 1WZMA 1E5NA 4GBDA 5LKYA 1XX1A 5LNUA 1KFEA 1GVYA 1ZP4A 1ONWA 5PTDA 2QGHA 4Y9PA 2VFIA 4KCUA 2W0UA 3QW3A 1WCGA 5ABEA 3BWWA 2DZAA 2CZDA 1HKIA 1DORA 1EHAA 3RITA 4UZUA 5BWAA 4MWAA 4MKVA 3WLSA 3QZ6A 4GE8A 2R91A 4H01A 3SAZA 4V27A 1WZKA 4D6JA 1TMLA 1JFXA 4WSHA 4AWTA 1IWAA 1LT8A 3I6TA 5I07A 1YE4A 1GORA 3N2CA 3JRKA 1V79A 3CH0A 3SZ8A 2OZ8A 4B5NA 1UROA 4PUDA 4PE8A 1NWSA 3CWNA 3BV4A 5CGMA 4CEUC 1NDZA 3DENA 3TTOA 2YFNA 2YLLA 2POZA 3SR7A 3WJXA 5CJNA 1W1ZA 3EWWA 4HTBA 1E9YB 4GC3A 3UWQA 3OQ8A 4QDWA 3MUCA 4JQ1A 1IEXA 3N17A 2QCCA 2NX9A 2QGYA 3MTWA 4ZVJA 2OSYA 4O19A 1N55A 2ZADA 2CEQA 3GG7A 3QPZA 1QK0A 4IMFA 4LFYA 1QWGA 4ZSUA 2E8YA 3VIIA 4ZO9A 4Y8FA 3NDZA 3CHEA 4KQNA 4C6CA 3CEUA 3VE9A 4S38A 5C6MA 3QSTA 3GAYA 3K8LA 5AC4A 3UZ5A 2Y89A 3VINA 1Q13A 3BG3A 1XGEA 5F2MA 2WKGA 1R3WA 1ALDA 2DH2A 3TTYA 1HJVA 4L9ZA 4P7LA 1JZ8A 3DXIA 3EKZA 3NEHA 1U22A 1W3JA 1OX4B 4D6FA 1D3CA 2CZEA 1E4IA 2L5HA 1NY1A 3W87A 4BKNA 1BGAA 1XH2A 4DJFC 4LCQA 1JZ6A 1UWAA 2YL8A 2XTKA 5F1UA 5FIPA 1Q7ZA 4XBSA 3SY8A 4Q8OA 3WEZA 4FNSA 5E0CA 2HZGA 4Z1YA 3BLFA 3GBEA 4PMVA 1X1ZA 1KR1A 3U2EA 1TB3A 3KZPA 3OLEA 2ACQA 3DI0A 2E6DA 2OT1A 1D9EA 1DJGA 4LVGA 1HKMA 3P81A 3NQDA 1FRBA 2E5BA 3VTRA 3AMGA 3GIYA 1IGSA 3HB9A 5GNXA 2Y8UA 4IHCA 4K68A 2EG8A 3RCNA 1K4HA 3U3HA 4J1OA 5K9CA 2A7NA 1P0DA 4IUOA 4BEUA 2F6UA 3AROA 1FCUA 3WKZA 3FW6A 3EGJA 4PMUA 2XVPA 2YZRA 1F3WA 1DVJA 4GKLA 3ARYA 3F2DA 1F3XA 4WJ8A 3GFZA 1A3WA 1AH3A 1GPWA 4W5ZA 2JKEA 1SO5A 3ARPA 1TV2A 4B91A 4WLCA 3SCWA 1XQLA 3SI9A 1US3A 2Q71A 3K13A 1HVXA 3IJ7A 3B4YA 5IDZA 2C16A 2HRWA 3G22A 1XINA 2YDSA 1ONRA 2CPUA 1PE1A 1XBXA 1ODZA 3BMWA 3GTIA 1XD0A 2D0FA 2EXOA 9CGTA 2PPGA 3CV7A 3I4EA 4ZQOA 3CZEA 4G8TA 2VZVA 5AC8A 3AOFA 4QJ4B 2CLIA 4CCCA 4PMNA 2XSXA 1FWBC 1JEZA 4BZYA 4UTLA 2ISDA 1VFUA 2OKTA 2RGLA 1T7LA 4D6HA 3CTLA 1S2VA 1L8NA 3H2FA 1EJSC 2EKGA 1DIOA 3NL2A 3MVIA 3RAOA 4DUOA 1MI3A 4WRHA 1FWEC 1ISVA 3GG8A 4UCFA 1ISZA 2OPJA 5AZ1A 2W27A 3NZRA 2FGLA 2I7GA 1W2PA 3QYQA 2J78A 4IZGA 5A3HA 3WLHA 1KBLA 3NTYA 3TK7A 4LC8A 4DY1A 3QXBA 1H1YA 2HROA 6XIAA 3W74A 2Y6ZA 5KZMA 4DO6A 3S2LA 4K1GA 3UJEA 1NFGA 2BVTA 3QH2A 4K6AA 2QUUA 3LRLA 2OZ3A 3UR5A 1YXCA 3CIVA 1E1CA 3R25A 3E2QA 1S2CA 4LBUA 2WCSA 3HJZA 4PRRA 3AU2A 4FIQA 3LPFA 3LD5A 5C8BB 5CG7A 1YDYA 3VD9A 1VB9A 3DZ1A 4XD5A 2R24A 3AQUA 3HA1A 3BQ6A 1KKOA 5HWMA 3N2TA 4S3GA 4PULA 1QI4A 1OYAA 3GKFA 2XIQA 2W61A 2A4AA 2YOCA 4MNMA 3NPWA 1W32A 3DYPA 1H61A 4ZB2A 4AY7A 2ZVIA 2WMJA 2FVKA 2FVMA 1HF6A 1MEIA 1BYDA 1MUCA 1FWJC 2VR2A 3UZWA 3TW7A 1W1A1 5FEPA 5H6HA 4JN8A 5HQLA 4GGHA 4IQLA 1VRDA 2QUTA 4UMCA 3UA4A 2W5FA 3CUIA 1Y65A 4XD6A 4XSMA 3SY5A 4X0NA 1K7XA 4HPHA 2CLFA 4AY8A 4UQEA 4XBJA 1TWIA 3W73A 1Z8AA 4JTEA 4MUPA 4W7UA 1CXLA 2NW0A 5DO8A 1G4TA 1ZNNA 4IP4A 2O56A 1JQXA 2ISSA 3SRHA 4PEKA 4RDYA 4H9MA 1HJWA 2QHAA 3P8JA 4FLSA 5J04A 1R2SA 3QR3A 5LA0A 7ENLA 1OGSA 1NWUA 4BY3A 2F84A 1PCWA 1QJWA 1V5XA 3VX1A 3MO4A 4HYVA 1W8SA 2QF8A 2P1FA 4GO8A 1TV5A 3C8FA 3IRDA 3BURA 2Z00A 3NG3A 3H2MA 4XZBA 2YXGA 2XIMA 1TCDA 2DT2A 1MW1A 2ALRA 2QJMA 3QPYA 1AH4A 4MKNA 4MTVA 1BYCA 4JEQA 2OYMA 2F38A 1HJQA 3EMCA 1LOSA 3QY7A 5ECVA 1F6KA 4MHBA 3THQA 2A3EA 4WXYA 1VPQA 2ZZ6A 1E3ZA 4TX9A 4F0RA 4QG9A 3W86A 4YYFA 5K4ZA 3BZGA 5AHLA 5BU9A 5FJRA 1WXJA 3MSGA 1FWSA 4GI9A 3H2NA 3U4AA 4WY0F 4E4UA 1DIDA 4WHBA 1EPXA 1WO2A 3RYSA 2PC8A 4R3UA 3UJFA 4BF5A 2ZUMA 4Q22A 2XFFA 4PTNA 1W91A 3NM1A 3DBNA 2DJLA 2F8QA 1UW9A 1KO0A 1O95A 1QHOA 1V7AA 2YB1A 2ZFAA 2HE5A 3UZZA 4N9BA 1H3GA 2BTMA 3QPEA 1CXHA 1XR2A 3CXOA 1RP9A 2CLOA 4GGBA 1Q85A 5HA7A 4UOJA 1A3XA 1S5TA 4AU0A 4GI8A 2ZBTA 3FV9A 2X1UA 5AC7A 1KBIA 4DZ5A 3QYSA 4RZ4A 1FP9A 4X22A 4IH3A 1R30A 3P7YA 4IUGA 5A5WA 2YDRA 4GYJA 4C6JA 1UJQA 3FYPA 3WQ5A 1UMLA 1R9YA 3LZ5A 1BHGA 1TWWA 1JPHA 4XIAA 2VURA 3R2GA 3V18A 1OD0A 2J7CA 1UP2A 3O6AA 3MMWA 1CXIA 2X42A 3LRKA 4A8RA 3D6NA 1FWGC 3H2AA 3STGA 1GNXA 5C7VA 3SUSA 3PZGA 2W9MA 2O9RA 2WCGA 3TA9A 4CN6A 3AISA 3NOYA 4CQDA 3FJ4A 3ME3A 2YCLA 3P67A 3FSUA 3M16A 3W2UA 1I9CB 3OZMA 3WJZA 3VA8A 1EQPA 4AB4A 2CC0A 1I4NA 3WK1A 2VFHA 1MNSA 2Y1HA 3GC5A 3TEVA 3RRXA 3W9ZA 3S3GA 2A85A 2WZEA 3T0BA 4D8ZA 5TD4A 4LAUA 2DW7A 1OK4A 5T8GA 4B3ZA 2CESA 4JEJA 4KIRA 3GNRA 3QMRA 2YKKA 3RM8A 4KH2A 4HNVA 2GLKA 4C1NB 2DP3A 1FHLA 3HMJG 1PWMA 1CTNA 4U2YA 5I2UA 1OCQA 5LNWA 4QJ3B 2FTWA 5C9WA 2OTDA 3E0IA 1TUXA 2FDMA 3THDA 1UD2A 3ZOAA 3G0SA 3NVTA 3AXHA 2EG7A 4TIMA 3P93A 3KVLA 4F9DA 1FQ0A 3DU0A 1GVSA 1QNRA 5TIMA 4BWLC 1E4MM 5AC5A 3GYEA 4GVGA 3Q67A 3LGEA 3LY0A 1SJAA 3PFRA 3R43A 5IHRA 2C91A 4GABA 4W85A 5CEWA 5A2CA 1S3HA 1XG3A 1K7FA 4QAWA 3E5BA 1AA1B 3KCJA 5F2IA 3GH5A 1CBGA 1DHKA 2OQYA 4RPPA 1Z9AA 4XD4A 2CXEA 4KGJA 5D2XA 1TG7A 4N9EA 3N14A 3ITCA 2OODA 3E02A 3ZFHA 3AXXA 1TIMA 1EP2A 3BAKA 1ZB5A 2GQAA 1W31A 3W1RA 2CETA 1UKOA 3OIXA 2YSWA 4UCGA 1BKSA 3N9KA 4JTIA 5D04C 1B3ZA 2IQDA 1LL6A 1Z69A 2YZ5A 5D9OA 4KEUA 3UWUA 5I7GA 1ZJIA 3O1NA 1XXXA 1DJIA 2E77A 5REQB 2X1RA 3LXCA 1ZBKA 4QSHA 1FFRA 4Z0JA 3N34A 4E8GA 1F9CA 5HANA 4XAZA 2GJXA 3NO1A 4AZHA 1IR2A 4DNMA 4Z2KA 4KPLA 1TVNA 3FXGA 5EGRA 3ARWA 3MKCA 1PIGA 5CC6A 3N2XA 4N7QA 4O1BA 1Z48A 5B7YA 1ZQ5A 1JG9A 1K9DA 3LLFA 3DGBA 1GOWA 1T41A 1M68A 2GVYA 4GIYA 4AD2A 3OZOA 1EJXC 3C2YA 4JFUA 3POHA 1B9BA 3C0QA 1NOUA 4M1BA 1HL2A 2QJGA 3ZWSA 3QSRA 2QR6A 2RJHA 4HVXA 5G2WA 1TZZA 3WBAA 3AXMA 4GD0A 3VOJA 2VFGA 4UQCA 3GTXA 4CD8A 3T55A 3LV6A 4IL0A 1TTJA 1JYXA 3MJMA 4QFUA 5HK4A 4WDTA 1ML1A 3W2JA 3WQVA 3CJPA 4JQ4A 2WMIB 3QLLA 4TX8A 4PODA 1MVYA 2Z24A 3V5OA 1RY8A 4IPJA 3L68A 1CWYA 1A3HA 4X9YA 4V33A 4LUSA 4EXAA 3RX4A 2YBTA 2NQZA 1Q4NX 4IWWA 1LRQA 1HT6A 1E1FA 1OADA 2A6NA 3S5OA 5I3FA 1BG9A 4YNGA 4U28A 2G0WA 3VZXA 2F2HA 3RR4A 2CHNA 3UQNA 1MXDA 1QHZA 4GUJA 3K4DA 1QU4A 3UVAA 5B7ZA 3A4XA 2H3DA 2FPVA 1W6TA 1AFSA 4H1ZA 3PNUA 4DI8A 5LZLA 3WCZA 3DUGA 4MB1A 3W1UA 1DIEA 1GK8A 2VEMA 4E8DA 5ENLA 2KX9A 1MMFA 3L4VA 3QZEA 5JUVA 3VKAA 1Z32X 2JBMA 5I77A 1T0OA 1J6PA 2Q8ZA 5BRBA 3S47A 4HSNA 4LALA 4JNMA 1U1JA 4EX4A 2WMHA 1KCXA 1GVQA 1SSGA 4RNIA 4HK6A 4CU6A 3N4FA 5J5RA 5D2TA 1AUSL 3UBPC 5CZJA 3V75A 1SYTA 4R7OA 3C6CA 4IFOA 2QKFA 2EHHA 5FF0A 3CYVA 4LRTA 4GH3A 5A6BD 4D6GA 1TPH1 3ONCA 3IJLA 3KS6A 5AYZA 5D8ZA 3MU7A 3M0LA 1XPYA 3L4ZA 1YIXA 2PD5A 3QQWA 1UKPA 3W83A 3UPWA 4S3AA 1FWWA 3UERA 4G5DA 3VYLA 2Z2BA 3M46A 5HJYA 3AO0A 4JTUA 3PK7A 1WXYA 5D9NA 1EWDA 4UTWA 4MZ1A 4GUGA 4IGNA 3SIMA 5AHIA 3A13A 4GVFA 4KWUA 1ZAHA 2G37A 5M5DA 3CUZA 5FD0A 4P7OA 3WK3A 2YDQA 3A9BA 5AHNA 2AGKA 3LENA 1SQ7A 5DF0A 3JS3A 4R7JA 4P8XA 3KWXA 4UTFA 1IT8A 1UR4A 4XUGA 4JIEA 3GDBA 3RX2A 4XBKA 3L12A 1Z41A 2QZRA 4ASTA 4PN2A 2PTXA 3U5YA 1AQHA 1MQRA 3C5QA 5G5IA 1G9HA 1MUMA 1QHPA 1H41A 2ZX8A 2FTYA 3TZNA 3IARA 3MYOA 3ZT5A 1VF8A 3N1AA 1AH0A 4MNKA 3W1TA 1E71M 4N6EA 3S6DA 4BHYA 4LY8A 2D3NA 3TCSA 2WB5A 4QM1A 3SSZA 3VM7A 4DJDC 1VFFA 4OIFA 1XIDA 2JGYA 4L6OA 4TOQA 4FNPA 3UXAA 1WOBA 3WG6A 4AXKA 3W3OA 1ONXA 5CQ1A 3P62A 3UG3A 3EAUA 3CAVA 4JPGA 1AD4A 2GUUA 3VIKA 1SJBA 4ICCX 1JL8A 1NWRA 4GNKB 1QRQA 2BS9A 3OA5A 1YKWA 3LI1A 1W1IE 5AYYA 2GUYA 4BI6A 4Q4MA 3UR7A 2WSQA 2XU2A 2D2OA 3RIKA 4JTQA 2Z2UA 4O11A 1SJCA 4DLMA 4B2DA 2OQHA 3K5XA 3WLLA 4IPIA 1JCTA 1AVAA 1BKHA 1CLXA 2WJFA 2EJAA 1XYLA 1UZ1A 2VHLA 3NURA 1DJHA 3SECA 1FA2A 3BLOA 4AHOA 5DMYA 1TE1A 2C7FA 1ICQA 2EQDA 2XN0A 1JQVA 2W67A 2G3NA 4DQWA 2YW4A 4MDPA 3PJTA 1FH7A 3P74A 4K7YA 4D6CA 4HIBA 1TA3A 3XISA 4AZ5A 2DT3A 5DBUA 4MB4A 2G5WA 3DKLA 2VEPA 5I02A 3BAYA 1JUBA 5FAGA 4HK7A 4UFLA 4HMCA 1OCNA 2Y7FA 3D3FA 2E7FA 3RM4A 2HBVA 3UF9A 3MHUA 1SFLA 1Q6CA 3QJAA 2GGIA 2XJ7A 3F4DA 4B3KA 4Y9AA 3VD3A 3DOPA 4IPNB 2UY2A 2DZVA 4PMXA 3M0KA 5CZSA 2QCDA 4OBRA 1Q6LA 4H8HA 4XTDA 1GQKA 4GIRA 4CNTA 3DX5A 3ANUA 1FY6A 1RJQA 2QXWA 3RPMA 1SFTA 3R4IA 3WMBA 4CKQA 3LEPA 1UH2A 1KKRA 1DPMA 1HP4A 3S42A 2PTZA 1BTCA 3WELA 2O7QA 2X7WA 1Y8BA 3IAQA 1TQJA 3NQGA 4QTGA 1FWRA 4YHEA 1B3OA 3CUGA 1IWBA 4CUCA 1W1B1 4JN7A 2WNZA 3TN5A 4D71A 3K46A 4HOWA 1XLLA 1L6FA 4NHVA 4L61A 1KXQA 2Y5JA 5AVNA 4OZOA 3O8AA 1R3VA 4W86A 1TPUA 3SRFA 2XIIA 2X2YA 3DERA 3FSTA 3SQSA 1FHVA 1ZJBA 3RLHA 5HNUA 2C19A 4AISA 3VOHA 1E0XA 3OB8A 3GNXA 3W7CA 1A5SA 3WH8A 3OZPA 3I68A 1MFVA 6ALDA 3L5LA 3PBUA 3TSMA 3EPNA 3B8TA 4PBEA 2WZIA 4NILA 5JQ9A 1OGBA 4QNWA 4MG4A 4W7VA 1CEOA 3R13A 4CQBA 2G8ZA 3GU1A 1GONA 2WMGA 4GZEA 1LJYA 2AQVA 5XIMA 2WMKA 3MBDA 4MMWA 2VDIA 4W8AA 1SMAA 4ACZA 3KS5A 2WVVB 1EXPA 2GGJA 2QF7A 3W02A 1VFOA 3FGCB 3S1XA 3WUBA 3VDGA 4QBXA 1IGWA 3K1GA 3LBMA 2QCLA 4IPLA 1H1NA 2PCEA 3MCNA 2WKLA 1V02E 4FXSA 3WDJA 1J5TA 4GWEA 3FIGA 4M1RA 2V38A 4XVDA 3V0TA 2NUYA 2OLHA 1G67A 1UA7A 2A21A 4O4WA 3UWVA 2YYTA 5EB8A 2YB4A 2W4XA 3GDKA 4Q4KA 3TFXA 1O5QA 5G2IA 3VILA 1I6NA 3PULA 3HG3A 4IQJA 1PIFA 1EYWA 4MIMA 5M2FX 1WUFA 1BFNA 3HO8A 2DUXA 2Z26A 4HMNA 2PBOA 3G1XA 4M7SA 1UBPC 1LCOA 3GUGA 2Y88A 1EBHA 3RILA 2CERA 3OVGA 2C15A 5A6LA 1FH8A 1YMYA 1GVIA 4RV3A 3CL7A 3UCCA 4RJEA 3LV5A 1FUYA 2PTWA 2E5DA 3OGVA 4QDMA 4I6VA 4US6A 4TX6A 3VD7A 3QOMA 1CLVA 3LERA 5CAKA 4I90A 1AD1A 1E6PA 4DWSB 4N4QA 3RR1A 5C7HA 2GL5A 3LHUA 4E5TA 3AS0A 3GNDA 1AJZA 3W1QA 4AVNA 1JD9A 4L4PA 2VEIA 3JZEA 4GQBA 1V6VA 3L67A 3PZQA 2DT1A 2WQDA 3UJ2A 4FNRA 3VAVA 2QPSA 5CZKA 4LUJA 4IF2A 3SIZA 2B31A 3DEQA 4Z1DA 4UC5A 4KRZA 1C7SA 4HTYA 3RDKA 5A6KA 4IG2B 1XJBA 1UR3M 4B16A 4IGSA 2A79A 1XDMA 4PMRA 4OECA 5E6YA 4C6IA 4MWAD 3TTSA 4OJYA 2RDXA 1Q7MA 3NDOA 1A5MC 1XC6A 3UPBA 1K4GA 2IQTA 1EGZA 1OZQA 2A1YA 4Q6XA 4TTGA 1SGJA 1QBBA 3G77A 3WQ4A 2FVLA 1JFHA 1KW1A 3FS2A 3VMPA 3GXFA 5CZTA 4RXGA 4BS0A 4K8HA 1A49A 1VCFA 1RV8A 1WKFA 1U5VA 4XZIA 1NOWA 1BG4A 8RUCA 1TX2A 3WK2A 3SQMA 1WBHA 4CEXC 2Z1VA 5I79A 4UQAA 3SY1A 4O50A 3MMUA 1JGIA 3G24A 1OYBA 4NP7A 3G1HA 1IF2A 2Z6JA 1P7TB 4UR8A 2QCGA 3OJGA 8CGTA 1BEUA 1TRDA 3GXTA 1UP0A 1IYXA 4MPKA 4YCOA 3A3XA 1LUCB 1OX4A 1EJUC 2RAGA 3A3WA 1JF6A 1A53A 1SW3A 4E38A 3ARXA 2VO5A 4N02A 3BLIA 4Y2WA 4OHQA 4YL2A 3T2PA 2PBGA 2DU2A 4JTAA 4GMEA 2OVLA 3H2OA 1GJPA 2E5CA 1NP2A 2WC3A 3R79A 1XL9A 2PDKA 3RU8X 1GPFA 1MZHA 3C0JA 3TTQA 1Y0EA 5ABFB 2ICSA 3W00A 3QRHA 4IP5A 2NQ9A 1PYMA 3IJIA 2XSBA 1L6GA 2ON3A 4NRRA 2X41A 4XZLX 4KEMA 3W7QA 2X0SA 4UTJA 3BLLA 1US0A 3WNPA 2QEZA 3KAOA 4NX5A 5LHFA 3KOZA 3HG4A 2D1ZA 4X0VA 4JIIX 2HNEA 4ERGA 1I1XA 4BQ3A 3WLQA 1UJPA 3T0TA 1K02A 1NP0A 3C3NA 2Z4GA 1PAMA 2PF0A 5BNKA 5CSUA 2WJZA 4DVOA 1DXFA 1UD5A 3IJDA 3NQ6A 4RPQA 4JKLA 1RBAA 3R0DA 1M04A 3G1VA 2PS2A 1LL7A 3WLIA 1H49A 3DHFA 2ZE3A 3UWEA 3Q2DA 2J8FA 1ISWA 2CZFA 2HJPA 2PRMA 5A6TC 2F6XA 1CGYA 3LSCA 3MWCA 3ITYA 3R7MA 3BMVA 2G50A 1L6YA 5FF4A 3O15A 2FFIA 1EF3A 2ZZ5A 1GTHA 4AIEA 1GTEA 3W7LA 3CWOX 3NCOA 2FHFA 1QAPA 3H54A 1XLDA 3KTSA 1DJZA 1NIUA 3RPTA 3W88A 4PL2A 4DAFA 5CSSA 4XZ9A 3LNPA 5L9FA 2XH0A 1PDZA 5DCEA 3AU6A 3CUJA 4RKAA 1TPVA 5H91A 4I7UA 1X8FA 3QFEA 1XLJA 5HQEA 1YNYA 2QW5A 4HPXA 1ZJAA 3WDPP 1V7YA 2CZVA 3M41A 1M7OA 6TIMA 4HHPA 4IX0A 4W8LA 4WKHA 2WPGA 2POTA 4H7ZA 3CLWA 1UR2A 1XH0A 4DX3A 2D2HA 3WSUA 3UYCA 2VCAA 5JMUA 2PDPA 2TYSA 3GAKA 3K2GA 2VT0A 3G0XA 1P6BA 4HU0A 2D69A 4UR9A 1XI3A 3TOYA 5A6MA 2E3ZA 1XUUA 1KTCA 7A3HA 3NQCA 4FP1A 3XIMA 4HZ7A 1FFQA 4OBSA 1W1PA 1K6AA 3F5KA 1I0DA 2ABAA 2WKJA 1TUFA 2WANA 3KHJA 1W9PA 4QRNA 2FTPA 2BVDA 3GB6A 3VIMA 4PTWA 1WP6A 4TVDA 5D33A 2OGJA 3K4AA 4H7VA 2H90A 3CIWA 5EA9A 1S5VA 3UXKA 1VEOA 4PMQA 1G0CA 4I7WA 4PUEA 1SW0A 4DXVA 3SM0A 4TMCA 1V02A 4LUIA 2WSRA 2PDFA 2ZYFA 2E1DA 3IUDA 3A6OA 2J6XA 1E70M 2XZ7A 1O1HA 3UWZA 3DGRA 1K70A 4GFIA 1W3LA 3S8HA 1R3RA 2NQJA 2Y8VA 3I6EA 3V5FA 2ISFA 3LI0A 2PDXA 2HISA 1NFBA 4C1KA 1PTAA 4H9TA 2X2GA 4PBFA 1GT8A 1T99A 1Q2SA 1JPMA 4JTKA 4GA8A 4NXKA 4L9XA 1EO5A 4UFIA 4R9OA 3W7EA 1NF7A 3NM3A 1V6TA 1H7WA 1J9YA 5EPDA 3GFXA 3QTGA 4DUVA 1F8IA 1IT7A 2YXXA 5D2VA 4YIWA 1I2OA 3ATZA 1JDFA 1E0VA 4O10A 1QTWA 2AKZA 4N6FA 1RSCA 1JR1A 1OCBA 1VS1A 4NQ1A 4QQ3A 3VGBA 2GJLA 4WUIA 3MT1A 4H9ZA 4UUIA 1EA9C 3ZJKA 1WV2A 3GVRA 4Q8UA 1FWIC 1KB3A 4RXFA 3P82A 1PYFA 1JNEA 1RZMA 4FNUA 3MBFA 2XH7A 1MXGA 3O07A 4WR3A 3MP3A 4U3CA 3AIWA 2E09A 1TZ7A 1G5AA 1S2AA 1X1NA 1AL8A 2FZ8A 3DHPA 2HEJA 1DXIA 4PMDA 4FK9A 3L5AA 4HZMA 3W1MA 2HTMA 2ZIDA 3N15A 1E6NA 3EXRA 2GQ3A 5FEZA 4MAZA 4RZ5A 5GQBA 3TP4A 3URQA 3V7PA 4AIBA 3VU2A 3KCOA 1UUOA 4LUYA 1HL8A 1TPWA 1HJXA 1YPFA 3TYAA 2ANUA 3CK5A 3C2FA 3NR0A 3QKEA 3ZSSA 1JCXA 2C1HA 2JFEX 3NGJA 4PMJA 3TJLA 3NO3A 1B4EA 4LJ3A 4XAGA 1OC5A 2DZPA 3BVJA 4L7ZA 3AS2A 2ZUNA 4BK9A 1UD6A 2ISVA 5D9PA 3GDTA 1X38A 1HFBA 3M07A 3SUTA 3VKDA 3G1YA 1B3XA 3VKBA 1F3EA 3E0LA 4CNPA 4H41A 1R3TA 2ZWZA 1XLCA 4U33A 4XB3A 1EJTC 2X7VA 4GCXA 4QQUA 2Z7GA 1EQCA 5LIXX 4QDPA 3SCRA 3N12A 4X2RA 2QDHA 2VFFA 3H70A 5DLCA 3T6CA 2VCBA 1QOPA 3VIGA 1W0MA 3H55A 2E9LA 5DBTA 5D09A 4QIUA 2REQB 2VVNA 3C3UA 3DFQA 2VM8A 4PUUA 1KCLA 4Q4RA 1W5OA 2PZNA 4HZ8A 4K7VA 5A8QA 4HT3A 2VC5A 3RMEA 4C5YA 4ROPA 3VO0A 5FJOA 1XFBA 5LNSA 4WSJA 4F79A 3W22A 4WOZA 3KE0A 2YPIA 3IIXA 1DQUA 4UFHA 3MCMA 4HJFA 1LLWA 4IFRA 3LHTA 5AB3A 4AAJA 3ZZ1A 3OVQA 2VX7A 4E2VA 4C7DA 4DBSA 4M29A 1GOXA 1EP1A 1KM1A 2GK1B 4CNSA 1FH9A 1Q7QA 4U31A 3BOLA 1CIUA 3AIVA 3KM8A 2VGGA 3NSXA 3THCA 1P0NA 3LA4A 4V1YA 2I5QA 3U2OA 4P8UA 4QISA 3MWAA 3SRKA 4CU7A 1K03A 3LCFA 3TV8A 3STEA 3B97A 4C1NA 3PWGA 5HPOA 1OC6A 1RQHA 3FVDA 1ZCOA 5AYXA 4JR5A 3VGEA 1SSDA 2BWGA 3VFCA 1E6RA 1SPQA 4UWMA 5IRPA 3EA2A 5D03A 1BGGA 1JPKA 1UIOA 3EYPA 1OK6A 1XRTA 5CC3A 3UESA 4A8LA 4X60A 1C8VA 4QLKA 1XCFA 1TPB1 3CQJA 3DFYA 4O1EA 4HMEA 2QQ6A 1MW3A 4QE5A 3M1ZA 1O66A 2CU0A 1DEDA 2VENA 5JH1A 1J96A 3O9NA 3QVQA 2P50A 4G7EB 1GYLA 1S5NA 1V0LA 4GO9A 3L4WA 4GVHA 3LU2A 3UU0A 2WVTA 1G6CA 1SU5A 3LCGA 4S3KA 3AZTA 2GSHA 2OCZA 3POCA 5REQA 3WD0A 5K2ZA 1RPXA 3HM7A 3OYXA 4E8CA 4PC8A 2QJJA 2XG9A 3KVJA 4V28A 3JR2A 1ITUA 1SUXA 1OEPA 3RFAA 3WX7A 3GRIA 2GVEA 2BP1A 1WX0A 3B4UA 2EJ1A 3GXNA 4WGHA 2J79A 1UH4A 4HBKA 2PDMA 4O18A 1YYAA 2BY3A 5HNRA 1UWQA 3CASA 4YXGA 4UTMA 2Z2AA 2BASA 4QEHA 1J4EA 2AL2A 1VBGA 4GYPC 5HJLA 3AXKA 4XG1A 1WBJA 1OGGA 3LK6A 2JIEA 1REQB 3ZQ9A 1P6WA 3NZ1A 4HPGA 1UP3A 2WZTA 4XZNX 1DXEA 3HG5A 1EB3A 4N2YA 2PLCA 1MDLA 4FX7A 3RM9A 3U7VA 1WZLA 3IV8A 4PUJA 4YTSA 3TC3A 1I2PA 2BB0A 3MUIA 4UTIA 5HR7A 1FWDC 3TYDA 1V8EA 3XINA 3V1HA 1D7FA 1RLDA 2VRKA 3L4YA 2EBNA 2J7FA 3WQGA 3OZYA 4RUBA 3T78A 3CQKA 1O6IA 1C29A 2QCNA 4GY1A 1P4CA 1FDJA 1VBHA 1WUEA 4RL3A 3TKFA 2GQ8A 2RDTA 5DMLA 1ELSA 1Q6GA 1XUZA 4ZCWA 4WOQA 4KRUA 3ECQA 1H1ZA 3W76A 4ZMGA 3MHGA 3N9RA 1QPOA 3W29A 4PTVA 1VH7A 4MSSA 1OT1A 4JFVA 3B3DA 3TYUA 4B15A 1J0IA 2I56A 5HMDA 4JHMA 2O7SA 3WQEA 3CT2A 1UZ4A 2NV2A 3P60A 1LWHA 2Y70A 1UASA 3UGVA 5GJPA 4KS0A 4IQDA 3THAA 2WBGA 1H09A 3BTNA 1KR0A 4GX8A 4CCEA 2NLIA 4OE7A 4INFA 2A6LA 2QPXA 3EB3A 4WIWA 3IWPA 4GOAA 1KBJA 4M6PA 2IXUA 1PXGA 3QBUA 1H7NA 3EPOA 4US5A 4RDVA 3ABQA 3ABXA 1JXKA 1B3YA 3EMZA 4JY9A 3AYTA 2FZBA 3W23A 3CH9A 2PDUA 3TW6A 3VCRA 3APYA 4JXCA 4NI3A 4ZB5A 1UOZA 2O9TA 4XV0A 1NSJA 3LHVA 4AZGA 4YTQA 2ZUSA 2Z6IA 3PTMA 1PX4A 3OP2A 1J12A 4O4VA 3TWBA 4X9SA 2E9BA 1C7TA 4GIEA 3TX9A 2CHRA 5DY2A 2FPTA 4A3HA 5D05A 2J62A 4L56A 2RH9A 5C2CA 1AL7A 4LUSB 3BAXA 2BY0A 3CV1A 2I9UA 4DJEA 1V93A 4C65A 3AS3A 3ZVHB 1M53A 2HNHA 4EPDC 3AMKA 1PX8A 2CITA 4A35A 3AMLA 1GYMA 3TVAA 4Z17A 4FHAA 1HN1A 5LGXA 3G3MA 2QUVA 3KL5A 4FI4A 2ADAA 1KGWA 4KCTA 4ZQRA 2NX1A 3VDHA 1N8IA 4MZYA 5M17A 3PTQA 3O6YX 3RXZA 1DKWA 2VR5A 3SB0A 3W1LA 4XQ6A 4W8BA 4DPPA 3WQPA 5H1WA 1VBRA 3K8MA 4DM1A 4H9XA 4RDWA 5FEWA 4WDUA 2OYKA 2W63A 3TAKA 4B9ZA 2QNEA 1NEYA 4XKYB 1YTKA 1S39A 4H7CA 2E6YA 4L5ZA 5I3HA 4R33A 3BH4A 2D2GA 4NUWA 3TA6A 5I3IA 2VEGA 1KXTA 4LY4A 3UG4A 3VGDA 4JX4A 3M5VA 3OGRA 1P1MA 1XLKA 1P48A 2FHBA 1OT2A 1OY0A 4L6DA 3AIBA 3Q65A 5GPRA 3G1AA 1Q6RA 5LNVA 1L9WA 1WPCA 1YLVA 4V15A 3OLGA 3AHTA 2YL6A 2JF7A 3LYEA 3KTCA 4JTRA 4MWAE 1GVFA 2GJPA 3CZGA 4J3TA 5LIUX 1OG6A 4EXBA 2P0IA 1X97A 3R8HA 3FNDA 1MQPA 4XVEA 3GU9A 3O6CA 3MDWA 4MM1A 1Y5XA 1J0YA 1ECQA 1E5JA