4YTSA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy 3-keto d-galactitol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-tagatose 3-epimerase
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
total genus 116
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ytsA00
1XIIA 1XISA 2X7WA 1XIEA 3UVAA 3L23A 3M0YA 5B80A 3DX5A 3VYLA 1XLAA 5C9ZA 3XISA 1BXCA 4QE1A 5B7ZA 4A8LA 5XIMA 1DIEA 3C0LA 3CQKA 3QXBA 1XYAA 3UA3A 3KBSA 3VNMA 2NQJA 4XKMA 2ZVRA 1QTWA 3AYTA 3ITYA 3CWHA 1XYCA 3N4AA 5EMKA 4ZB5A 4PFHA 3CQJA 4DVOA 1S5MA 4KW2A 1I6NA 1BXBA 1XLLA 3FVMA 3VNJA 3XIMA 3C0SA 4YTTA 1XINA 2HCVA 3P14A 2OU4A 4XSMA 3CQIA 1OADA 3U3HA 1XLJA 3WQOA 1XIHA 3AAMA 1CLKA 2G0WA 1A0EA 4HNOA 3P6LA 9XIAA 1MNZA 3M0XA 2GYIA 3KCJA 3BZJA 5FA5A 5EMJA 2HK1A 1A0DA 3KBNA 3GNXA 3ITLA 3M0MA 3QYSA 3AYVA 4HGXA 1O1HA 4QE5A 3BWWA 4ZBCA 3C0QA 3ITTA 1I60A 5TNVA 2J6VA 4E3VA 2XISA 1XYLA 2Q02A 2NQ9A 4G56A 4DUOA 2QUNA 3VNLA 1XIGA 4X63A 1K77A 3CNYA 8XIAA 4US6A 4HHMA 6XIAA 3CQHA 5AVNA 6XIMA 4YTSA 8XIMA 9XIMA 1YX1A 1XIJA 3M0VA 5AVHA 4A8IA 3ITXA 1TZ9A 1XIBA 4LNCA 4ZB2A 2QUMA 2XINA 4YTRA 4EAYA 4J4KA 3UA4A 2QULA 3AALA 3BDKA 1DE6A 3M0HA 5B7YA 1XLCA 4QDWA 3QZAA 3IUHA 1XLIA 1XICA 4QE4A 1MUWA 1QT1A 3M0LA 3IUDA 3ITOA 4YTQA 4ZB0A 3UXIA 3VNIA 2G4JA 3KCLA 4XSLA 5H1WA 1XLFA 4GQBA 4EACA 2GUBA 4GJIA 5H6HA 3KBVA 1QUMA 3NGFA 4A8RA 2X7VA 1XIDA 3UU0A 1XYMA 4QDPA 3TC3A 4W4QA 4XIMA 4OVXA 4K1GA 3BZGA 2GLKA 5XIAA 3OBEA 1XLMA 1XLBA 3KBJA 3TVAA 1DXIA 2I57A 3QC0A 1XLKA 4K3ZA 3VNKA 4YTUA 1XIFA 1DE5A 1XLGA 1XLEA 2XIMA 3KBMA 3KCOA 3KTCA 5J8LA 1D8WA 3XINA 3KBWA 4A8NA 4Q7IA 5XINA 4GLEA 4X61A 4XIAA 1XLDA 2ZDSA 4QEEA 4XISA 5EMMA 3LMZA 4QEHA 1DIDA 2GVEA 4PGLA 5EMLA 1S5NA 4HHLA 3DBNA 2HK0A 4GJJA 1GW9A 3BANA 5I7GA 7XIMA 3U0HA 1XP3A 3JU2A 1A0CA 2I56A 4X60A 3IUIA 2QW5A 1XLHA 1XYBA 3KWSA 3ITVA 2NQHA 1XIMA
chains in the Genus database with same CATH superfamily
2J77A 4HU4A 4GY0A 4DB7A 1TUFA 3B40A 3R94A 4ZOAA 1KBJA 3E9AA 1XKJA 3C56A 2O55A 1X97A 4HSNA 1J01A 3P82A 5EGRA 1I4NA 3RXZA 3C0SA 4US5D 4JDBA 4ZOCA 1RCXB 4IJRA 3VI2A 2E6FA 2ACUA 3CPRA 1P6BA 2VWTA 2WV8A 4WLCA 1NOWA 1BTCA 3S1XA 8CGTA 1JL8A 4Q6JA 5GNZA 1K7XA 3U4FA 3P5ZA 1CYGA 4S3KA 1WYIA 3PF3A 2XZ7A 4CEXC 1R3WA 3CZ8A 3WQCA 3OODA 3GNRA 1H50A 3AIBA 2E77A 3VIOA 1THFD 2PZNA 3AMKA 4UQCA 1GNXA 4B4HA 3OZMA 2ZICA 3L4YA 4EACA 4LVGA 3FNDA 1JRBA 4MY8A 3W82A 1NWUA 4ML9A 4E5TA 4FXFA 3SFKA 3PB2A 4QROA 3VILA 3TQ0A 1EOMA 1TYGA 4XUGA 2IKJA 5LYRA 1KGWA 1WQ5A 3I7RA 3R11A 1V7YA 2DSKA 3Q37A 3W7EA 3FJ4A 3B0PA 5B80A 4XX6A 4B16A 5FJTA 2QHAA 4G7EA 3WBYA 3ZXWA 1CEOA 1HT6A 2E5CA 4HHPA 4MB1A 5A8GA 4IGHA 4I8DA 5KSWA 4I8YA 3SIZA 1FHLA 1A3WA 2C3ZA 4FHAA 4YTTA 4JN8A 2DDXA 1UQYA 3NL6A 2G0WA 5KZEA 2P88A 1K9DA 3WQEA 3P6LA 1E6QM 1G0CA 3UYIA 1UASA 4BA0A 4KS0A 1EXBA 4S3GA 2RAGA 3G77A 2XH2A 1XH0A 3ZZ1A 3VD3A 3UZWA 4Z0SA 4DLMA 2O9TA 1GHRA 4GY7A 3W7KA 1ZQ5A 1UP2A 1SZEA 1A5UA 4LOCA 3EWWA 4F0HA 4LV9A 1VENA 1MZRA 2NSXA 3FJNA 1TVLA 4CQ8A 1XICA 4M82A 1XH1A 4LUTB 4H6QA 2YL5A 2WNZA 1UR8A 2R8WA 3B9DA 1DIKA 3WELA 2YCJA 1YE6A 4ILSA 3NVTA 2PWGA 2GVGA 2QCDA 3U2EA 1ADDA 3QV7A 2HPMA 2VZVA 1MDRA 4IMAA 1XIIA 1CNVA 3CMJA 2WVSA 3NUKA 4NAFB 4Y9AA 4BQ5A 4J2MA 3A12A 3AHVA 5FOOA 3UWQA 3C0LA 3VNMA 4GH1A 3SBFA 2G3FA 3L2MA 1NF7A 1CCWB 4O0KA 2UBPC 1Q3NA 1G6CA 5GPRA 4H7ZA 2I5IA 1W5PA 3FYYA 3T8LA 2GVLA 1XYFA 3SFWA 5FI8A 4E0CA 1EHNA 1KM2A 3GXDA 3MT1A 4ES4A 3KVMA 1EBGA 1K77A 3BAIA 3R25A 1H1YA 2Q71A 2PDCA 1EX5A 5HWJA 2ZC8A 1GVSA 1WOAA 2E8ZA 3S9YA 2UV8G 1ZBKA 3AS1A 5F4XA 4H9TA 1SW0A 5D8ZA 1UD4A 4PUUA 1V3KA 2Z1SA 1EWEA 1BGGA 3NQ2A 3AU2A 1ICQA 2WO5A 2GVJA 4GUIA 2YA1A 2OLHA 5T9BG 3RRXA 2ZDRA 4LX4A 2OMAA 2DSVA 1I2PA 3N2BA 3W2JA 3QC3A 3O7UA 2NQZA 5D9NA 2ICSA 4WEVX 4P7QA 3ZLFA 1ZBCA 2VKZG 3IVUA 4UNKA 1JIBA 1WDWA 3FJ6A 2BB0A 4QE1A 1I2NA 4KESA 2HV5A 1QU4A 3P93A 1ECEA 1KA9F 1GJWA 1MQPA 1RBLA 2PDNA 1BWLA 3NPVA 4PE8A 4D72A 1F6YA 1QPNA 4Y2WA 1UKOA 2ODOA 1X38A 4IPIA 3T2QA 1Q8AA 3TYBA 3TIMA 3EGJA 4TVUA 3MYOA 1B1YA 1EOKA 1W0MA 5EMUA 4KRUA 2G50A 1A5OC 1FOBA 3EEZA 1FHUA 3LCWA 2UZ9A 3R0KA 3J7HA 1I60A 1V03A 4UMCA 2DIKA 2VC7A 4UTFA 4OOZA 2OYMA 3OLIA 3TXZA 3ZWTA 2YDAA 2PLJA 5EFFA 3CZLA 4MOZA 5JXQA 3W1LA 2Y0FA 1JNDA 3WFZA 2XWDA 4JS3A 3W81A 4D9PA 4ZEPA 5D32A 4F0RA 1IEQA 4PSRA 4A6GA 1OIFA 1SZNA 7CGTA 5FF2A 3OTRA 2VO5A 5J8LA 1SQ7A 3WUFA 4PUNA 3WLPA 1QFEA 4GI8A 2EPKX 2W66A 3RX4A 4O16A 3R4IA 5I78A 4P5UA 7REQB 4BWLA 2WYSA 2XIIA 1R30A 2ZYFA 1QW7A 3DHUA 1SFJA 4CD7A 3PJWA 3V1PA 4CN1A 1RJPA 4QGCA 2DW7A 3TSMA 3V7PA 2W61A 1QPOA 3W53A 4JIRA 2ZXAA 4JL2A 1PZ0A 4QAIA 4RE4A 3EPNA 2OSYA 1B4KA 1KWGA 2ZTKA 3LHTA 2GDUA 3GU2A 4FNQA 4PB5A 3WQPA 3WK3A 1OFRA 1QI4A 3L67A 3TYDA 1E0UA 1X7IA 4AF0B 1LUCA 1XRVA 1OFAA 1FUYA 2PU0A 1GYNA 1XF0A 3UZ5A 4WUIA 3IK4A 4F3HA 3KRZA 2ASHA 3TTQA 2DSUA 3P80A 3RLGA 1OCQA 5DMMA 3RAOA 2BY2A 4KWVA 3T6CA 4H83A 1LBLA 5E0KA 4ZMGA 1WO2A 1IHIA 1MUWA 1MW0A 3UXIA 4H2HA 4CUCA 3NQAA 2EPLX 2NV1A 3W6MA 1KW1A 3UT0A 2DH3A 4A8RA 1HXJA 1L6WA 3I6EA 1OGGA 1U1UA 2HWGA 4E2BA 4N02A 3R12A 4G1NA 1YXCA 3CV7A 2YW4A 4TVCA 4NRRA 4B5TA 2CIPA 5F4WA 4AZBA 3S1GA 1QBBA 1UZ4A 5CZSA 3HG5A 2DIJA 2ISVA 1ML1A 1E1EA 1EQPA 4Q8WA 5U7SA 1QWGA 3PZTA 2VDGA 4PMNA 6TIMA 3W26A 2KX9A 3PSWA 3LENA 7ENLA 1WXYA 3G5EA 1RQBA 1RUSA 3NURA 5G1YA 2WCGA 3E0VA 1IXQA 4QBXA 3VZZA 5A1AA 4PFHA 2QVHA 1TV7A 5DN1A 1Y5WA 1JCMP 2ZZ2A 1J5SA 3EOLA 2EBNA 1J0KA 3E49A 3WQFA 1F2JA 4GBDA 4A3HA 1KTCA 3R8HA 4BZYA 4F0MA 1HVQA 4S23A 3TOYA 1EYWA 3MSGA 5A8OA 2DEPA 1Y8BA 3E6EA 5C6MA 1VC4A 2INEA 1Z9AA 3BXWA 1Q7MA 2QUTA 5A95A 2VUNA 3GDRA 4TXEA 4Y7EA 4W89A 1BTMA 2QJJA 4DWSD 4O14A 3RJYA 1E9ZB 3L7RA 5F4SA 3CHEA 5AYBA 2XWEA 4V33A 4D6FA 4KFOA 4LYRA 3QH2A 3U8GA 5ENLA 1IZCA 2YFNA 4JTFA 4ZO9A 3QV6A 4UTHA 1WDSA 1V4YA 1ZGDA 1KCZA 4GO9A 5CAHA 3WDJA 3EX1A 1AW5A 4J3WA 2PGEA 4JKLA 2VRQA 2POTA 5XIMA 4UFIA 2YOCA 1KGXA 3WUBA 4B2DD 1FY6A 2D2OA 3E02A 5FEXA 2GJRA 2CXGA 3GKFA 3M4HA 4NNBA 2V5LA 2E9MA 4FI4A 2CBJA 4RKAA 4XSMA 1XUUA 1I0DA 2VC9A 4G7FA 2G8ZA 3HO8A 2V6AA 3IGSA 3KP0A 5K7JA 1X96A 1DWGM 2ZX7A 2B7OA 4D8AA 5CBBA 3VZXA 3IIOA 1JF5A 4D71A 2DT0A 3L65A 2VP8A 1C8QA 1ZL1A 3QZEA 2VC5A 1UH2A 2VM8A 2Z24A 4CVUA 4LCQA 1LWIA 1W1A1 2ZWYA 1W17A 1HP5A 2REQB 4UTMA 2V38A 1HJQA 1GVFA 2IPWA 4H9YA 4XKYB 7REQA 5HMFA 1TV8A 3W23A 3M0LA 1E56A 4M6UA 4PL1A 1LBMA 4V2XA 5BXPA 1TJRA 4A05A 4LC6A 3PSVA 4WX2A 2A5HA 6TAAA 5LIYX 2D0GA 4J9JA 1GVEA 4JFUA 1DXFA 3EX6A 1VCVA 2CC0A 5BYWA 2YKKA 1RQEA 2DW6A 3GFYA 4PUWA 2PURA 3UY7A 1KM6A 3PAJA 5HQLA 2IPFA 3CLMA 1GW9A 5G2HA 5CKSA 2WVUA 1ZJHA 1B3YA 2J8TA 1M68A 3EB3A 1JPKA 1YKWA 4MWAD 1J6OA 2QF7A 2RDWA 4GGBA 1ZAHA 4QJ4B 1QRQA 4POCA 3HPAA 4ZVJA 2OT0A 4XD6A 2XIQA 5CPTA 3GHTA 3N1AA 3QKZA 1CBGA 3PPCA 4AIUA 3FVMA 3IACA 2OELA 3VKJA 1PIIA 3WLOA 3GTIA 1V0LA 3AS2A 3W24A 1KB3A 4AIOA 1Z3NA 3TC6A 8TIMA 1PKNA 2O56A 2J78A 3EWYA 5I2UA 4Z08A 4M19A 3G3MA 1UYQA 2OEMA 4BWLC 2E6AA 4HA0A 1R3VA 1R0MA 4O28A 1ZCOA 1AQMA 3M0VA 3MHGA 1ELSA 4M7TA 3GR7A 2WM0A 4YTRA 1LORA 4KPLA 1GOWA 2DFAA 3GS6A 4YXGA 1EJ7L 1DJQA 4NZFA 3H7UA 3NGJA 1B30A 3S2MA 3DESA 4FP1A 3DCPA 1Z44A 5IHRA 3NDYA 5HNNA 1K8XA 2VEIA 4JIPA 3PJUA 3FOKA 1OF6A 2YYUA 1RVGA 4QEHA 2VRJA 4C1NB 3P60A 2C19A 1X8FA 1IEXA 1E1CB 2VD8A 3BGAA 3TCSA 1XDLA 3M0ZA 2I14A 1OSEA 4Q8TA 2J47A 1H7WA 2ZUNA 5MKGB 3TMQA 1FRBA 2D1ZA 4AVFA 1FVPA 1BG4A 3AYRA 3L12A 4AHOA 3BH4A 2Q01A 5F2GA 3BGJA 3GVRA 3ABXA 4LW7A 4LY8A 4QS5A 1K7FA 3BLDA 1XX1A 1W54A 3ZR4A 3UGRA 3AQUA 1OY0A 3QOKA 2O4QA 2Y61A 2V68A 2WMIB 1OVDA 1S5VA 4N4PA 1M41A 1ICSA 8XIAA 3PK7A 1BXNA 4Q8OA 3UR2A 1UJPA 3II1A 4DPPA 2A85A 1E9YB 4LQ1A 4ADUA 1JZ8A 3THCA 3E3HA 3TK7A 3GXNA 2CCRA 1AJZA 4YVXA 1WXZA 5H6HA 2R1LA 4E8GA 2X7VA 3PZVA 4FPSA 3UU0A 2V3FA 2CERA 5I5RA 2C13A 3NM1A 3GD6A 4HMCA 3WQ4A 1U1JA 3TUUA 2CYGA 1RCQA 2Z29A 2ZC1A 1W32A 4H7CA 2XVNA 3DHDA 1ZBWA 2G5WA 4HP5A 4V15A 3GVQA 1BRLA 3DHPA 2WQDA 2E0PA 3TYEA 1ESWA 1IWAA 1UWTA 4R3UA 2C16A 1EIXA 4REQB 4C65A 1ADSA 4GFSA 1GKPA 2REQA 4DF1A 3N3MA 3S46A 4XKYA 3UBPC 1PKYA 3WK1A 1OEPA 1VBUA 1LLZA 2XM1A 3EMQA 1V5XA 2HVMA 3CAKA 3PY2A 3G1DA 4DBEA 2WW5A 2DT3A 2UY2A 3MKVA 4BQ4A 4IGNA 5BW6A 3USBA 1GVOA 3MSDA 3DOPA 4B5SA 3DFHA 1YIXA 2X05A 3O8AA 3AXHA 1H62A 1TPEA 5E0CA 5FEPA 3TE9A 4J2PA 4EXBA 2A21A 1Q65A 2F6UA 2PEVA 4ZB2A 3G6LA 1XJBA 4NZ1A 3PWAA 4C7GA 5FKYA 2Z1KA 2A6LA 3DUGA 3IUHA 4ENLA 4BS0A 4CN4A 5DCBA 1E6NA 1AL7A 1F6KA 1F73A 4U33A 3DFSA 1QK0A 1L8NA 3N4EA 4O57A 4H2CA 2V2HA 4O8RA 5K9XA 4B5UA 4Z2IA 2NXIA 3LX9A 1IT8A 1XM3A 3GYEA 4DO6A 3SRKA 1JGIA 2G37A 2QJMA 1U30A 4KEUA 4GISA 3UCCA 5J5RA 1VFMA 3O05A 3S2LA 1UIPA 3LA4A 4AYSA 5I7GA 3QV8A 1JYNA 2PMQA 3PTKA 4Q8MA 1B90A 1H7XA 3WMLA 3IJLA 1G67A 3C2RA 2G95A 4L65A 3WDQA 3K8KA 1O94A 3E2RA 1WBHA 4JTGA 3WF0A 1K70A 4H6EA 5BXSA 1LZOA 3TFXA 5EU9A 3NO1A 2DVXA 2PDWA 2QMJA 5C2XA 3AAMA 1OABA 1UIOA 3E12A 3LRKA 1IV8A 4A3YA 2C0AA 4IX0A 1E4IA 1BVWA 5T26A 3QYSA 2E09A 2YZRA 1XPGA 3ITTA 3Q58A 1TIWA 1QW9A 2PRLA 2WZMA 1D9EA 4ONVA 4IF2A 4NZJA 4HNNA 5AC4A 3T78A 4E4UA 3M0HA 3SCQA 1R47A 3KEHA 3MUAA 1H41A 1XBVA 1PX8A 4NF7A 4B92A 3TAKA 3CV6A 5EYWA 4QDPA 1AODA 2YCIX 1YE4A 2JGQA 1H51A 1KRCC 4ROPA 3BCDA 4KWUA 4V27A 2ZUTA 3WL1A 1DWHM 1ZP4A 2PI6A 3STEA 1I2OA 1GVQA 1OX4B 3RPDA 1S5TA 1Y0EA 3CGTA 1U5VA 1HKMA 2VQTA 1AQFA 4XZIA 5I24A 3UG3A 1A0CA 2WMIA 2WLZA 2SFPA 3WD4A 4Q4SA 1ONXA 1CT5A 2XGIA 1BSIA 1OX6A 4J3SA 3WQ5A 2OZ8A 3ZVHA 3A9IA 4QLLA 4C90A 3WF4A 2D3NA 1JEZA 2PODA 1R3YA 6ALDA 1MVYA 3WLHA 3CWOX 2RHGA 3DEQA 1H7RA 1OC6A 1CGYA 1KTBA 2RDXA 1TFVA 1OADA 1WE5A 3U3HA 3TYCA 3PHAA 4MZYA 1Q66A 3K8LA 4KFNA 4HU8A 3A3WA 1VJSA 2BVWA 4GG9A 3W2MA 1EF3A 1RALA 3SSJA 2XH4A 3CUJA 2VCCA 1YPIA 1ONWA 1KV8A 2CESA 4LWWA 1BGAA 2D0HA 2ZBTA 4WDTA 4L9YA 3NZ1A 1U1HA 1YADA 1FH9A 5DRIA 4EWND 3ANVA 3ZR5A 3BLKA 3BQ5A 2WJEA 3LN3A 1Q4WA 1ISXA 3CHDA 3G1VA 5GQBA 1RJQA 2AL2A 4H01A 3H54A 5JBEA 4GA8A 2W63A 1VFHA 2WC3A 3NQVA 3TN6A 2I57A 2PCQA 3EBVA 1AD4A 4X9SA 4ZFMA 4WDXA 1AZ1A 1H09A 3HTWA 1KFLA 1NWRA 2R1PA 4DM2A 4Q7IA 3WH7A 4MADA 2E9LA 1WA3A 4MJ4A 2HBVA 4ADTA 3QQ0A 1XG4A 1QR7A 3ZT6A 2DJLA 3CO8A 3GNOA 2YBUA 2PDJA 1GUVA 1J0JA 3K8MA 4AXNA 1Q8JA 4W5UA 2BMBA 3K2GA 4LXFA 1PTAA 4O1EA 2NT1A 1GTEA 3NOEA 1GTHA 2PWVA 1XINA 4DZIA 3NIYA 3QR0A 1JCJA 3RPTA 3CC1A 4IM4A 3N13A 4HNTA 2BHZA 3PZOA 2Y85A 3WYZA 3A6OA 5D2TA 3UNDA 4IGMA 5TNVA 3AXKA 3MI6A 1QBAA 2YLAA 5JQ9A 4Q8NA 4LB3A 1KFEA 2ABBA 3PBMA 4YCPA 4ZQPA 3NEHA 1VPYA 4AHPA 3M5VA 1MEHA 1ZP3A 3HPSA 1L6FA 2ZQ0A 1NFGA 2V5CA 1S2CA 2GK1B 1EXPA 3FDGA 4L4MA 3WX7A 4L80A 2V0TA 3GXMA 2Y7FA 2HVOA 3DGBA 5IRPA 1DWAM 3CM4A 1Q5MA 3VPLA 1QJWA 1AH0A 4PEEA 1ISVA 2WCAA 4KGLA 4LBSA 4MSSA 3H2EA 3JU2A 1WKDA 3TTOA 3VK5A 1XYBA 3MPGA 1E4NA 1D8CA 4PCFA 2WZEA 4PULA 1FWGC 3OGSA 2WC4A 2WNQA 2HMCA 4O1DA 4XAGA 4O4VA 1FWCC 1KC7A 4BCEA 1TWDA 3H6OA 1UROA 4WJ8A 4PMQA 3GG0A 2A7NA 3XIMA 3BSHA 4QX4A 5K9CA 5AC7A 4WXZA 3AMGA 4E8CA 2R1MA 2E1WA 4P2VA 1SPQA 1W6TA 1S2VA 2OLSA 3GR4A 1HKIA 3WUGA 2XVGA 4FNSA 2G3NA 4S3AA 5REQA 3B9AA 1M6JA 4JN7A 2F61A 1FXPA 4FXSA 1ZNNA 3NDOA 1HNYA 1TPFA 4Y8EA 1IQ8A 2E5BA 3VFCA 3U9IA 1OX4A 1SFLA 2GUYA 5AVNA 1KFCA 4Y8FA 1LOSA 5EY5A 1ISZA 1TB3A 2VX5A 4NG3A 4UWMA 1PTDA 4IPNB 3CPUA 5LXXA 3W74A 3W7RA 2NXHA 3CAWA 1KRAC 3HGRA 4U4MA 4C6KA 3E2QA 4BI6A 2VVNA 4FF7A 4GHRA 1Z6KA 3U5UA 2WPBA 1J5TA 1UW9A 1LL7A 1QI2A 4GNJA 3B97A 3AISA 1B3ZA 2OWXA 3SUWA 2QVNA 3HU7A 5DMNA 1LYXA 1TV2A 1A47A 3ELFA 4RX0A 2OSXA 3CT7A 4V1YA 3W7OA 2XDFA 3OLGA 1ZU8A 2VURA 2DT2A 1H60A 1W3LA 2NQLA 1I1XA 1XIEA 5HQMA 4AMCA 5CGTA 4A3RA 1BHGA 2OODA 4XZLX 4C6BA 4A2SA 2PBGA 1GOIA 3VU2A 2QDHA 2MUCA 2QYGA 1TPB1 4XD5A 1S2WA 1NDWA 3LPPA 4PMVA 4NJGA 1DHPA 3LCHA 3QRHA 4K8HA 3AXIA 4BEQA 2QDDA 1PCWA 1NVMA 4JTKA 4GVFA 3QTPA 2HK1A 2ALDA 5HPCA 4HIBA 5IDZA 4I9AA 4U5IA 3H4GA 1O5RA 4ZOEA 2D2JA 4JHZA 1XQLA 3TJXA 3HJZA 1G4EA 4MWAB 4IXHA 5JIPA 4J4KA 3GVVA 2O92A 4CQAA 3APTA 3MO7A 2P1FA 1G4TA 4HPHA 3RO8A 3TCEA 3W2KA 5XIAA 3L4ZA 4PFMA 5CGMA 4UR7A 4NNCA 2DSWA 1UCWA 1UR9A 2B7NA 2QJIA 1YNQA 3SY5A 4GLEA 5FF3A 3IJ7A 1NP0A 3S83A 1QAPA 3KRSA 3HB9A 1MO0A 4R9XA 1S2AA 1XP3A 1RLDA 1EHAA 4C7FA 2ZUMA 2NQHA 1M7XA 5M3WA 4MFDA 3V5FA 1ZAJA 3GXPA 1FQ0A 5AHIA 2QCMA 1JNEA 2X0HA 4Q7NA 4C6IA 3GXTA 4LVBA 2ZZ3A 1WV2A 4UMAA 4YIWA 2BOFX 1MW2A 4JOMA 5CGQA 1E6XM 5I09A 1US2A 7ODCA 1HJWA 1DQUA 3A47A 5KMYA 4C60A 3UY8A 4MLJA 3LM3A 2VGBA 3OLDA 2TRSA 3UGVA 1LBFA 1W1B1 3C0QA 4INFA 4GX9A 1K7EA 1OD8A 4CD4A 4KKXA 1KM0A 4JYEA 3CZEA 3W76A 1EYEA 4QG6A 1LJYA 1UKQA 2CHRA 4NX0A 2WJZA 1L2UA 3ISIX 1E6SM 4JIEA 3UVIA 1UA7A 1ITQA 3WLQA 3HN3A 2YGYA 1AQHA 4IMGA 5FCZA 3TP4A 3R89A 1RCOB 2FLIA 4PUJA 4D6IA 3K30A 3TX9A 2D69A 3CYVA 2OVLA 3TMLA 2OB3A 3UXKA 3CV2A 2QDGA 4ZGYA 4YHEA 3G1XA 3PTMA 4WVXA 1ZFJA 2ZX8A 1W9UA 4OOUA 4JHMA 3MMDA 3QSTA 2C14A 1XIMA 1XISA 2AGKA 3A21A 1SSDA 5CSSA 1LDCA 1UMLA 1W1IE 3ANYA 1FDZA 1ISWA 1PHWA 1V6UA 1T41A 1QI5A 3IIPA 3QMSA 3BK0A 4O11A 3A9BA 2W27A 1OM0A 3H2NA 3WNPA 2X1IA 1GQNA 1TRIA 3W00A 5U4NA 4H8VA 3NVDA 5ABHA 3LHYA 2EF9A 3RR4A 6CGTA 3S5NA 3ITLA 4HGXA 3SRHA 3SJ3A 1FH7A 4OFCA 2VRKA 4S3FA 4JTAA 3A23A 4O54A 1F6PA 3BOXA 5GNYA 1EO7A 2VFGA 1LRTA 2YCEA 1EJVC 3WMSA 1C7SA 1RY0A 1YDOA 3F03K 3V16A 3AWOA 2I7GA 3G8RA 5D37A 1TWZA 2EPMX 1EDGA 2GJLA 4C6MA 3RPMA 3RILA 2TODA 4W84A 3WNOA 3W87A 3IEBA 1OG6A 2VC6A 4KF1A 1VEPA 2BZNA 4Q32A 2PRHA 4OVXA 4M29A 4PMXA 1SJAA 1TPDA 1XIFA 2LLEA 4J28A 1F4AA 2QXWA 5D02A 5D05A 3V0TA 4O12A 1UWRA 2BV9A 1FHVA 1S5NA 2C0HA 3DBNA 4GJJA 4IMEA 1HJSA 4RDYA 3BANA 3HPXA 1DKWA 3EDJA 3NM3A 1XGEA 2J7EA 4ZENA 5ABFB 4X9YA 2VXNA 1BKHA 4I9MA 1OCNA 3ARTA 2VEFA 1CIUA 3KZPA 3W01A 1JUBA 1EO5A 1L6GA 4MNJA 4EAMA 1FWEC 3DI0A 4ZTYA 2PA6A 4C91A 4L1XA 3U4AA 2CLOA 3ABQA 4IFOA 4XVEA 4ZQNA 1R9ZA 1YNPA 4OBTA 3LBCA 1UR0A 3W25A 3VDBA 2NVCA 4I5RA 4F66A 5LNWA 1HKKA 5ABTA 2D23A 4IOTA 3WLKX 1YXYA 1ZJIA 3B8WA 4RDWA 4NJJA 2JALA 3LXCA 5A8NA 2Y7GA 2DIEA 4BKNA 5AHLA 4HCLA 2RUSA 1YX1A 3SUTA 1TE1A 1B4EA 1E4LA 3DI1A 5FJIA 1UPMB 1G1YA 1QATA 3CJPA 2J8GA 4KETA 4PSPA 2GQAA 3A3HA 3GC2A 2RKXA 2A79A 5JH2A 1SFTA 4ICNA 3VOFA 3BLIA 7PTDA 4CQCA 4EK7A 1GYMA 4FLQA 3PS7A 2POZA 4JNYA 3MHFA 3CH0A 2OEKA 3IV8A 3NL3A 5XINA 4JFVA 1FCQA 1EP1A 4GBUA 2VZUA 1HQTA 3ABRA 3PANA 4X3ZA 1OFQA 1O60A 2QW5A 2WKGA 1NU5A 1N55A 1BSLA 3IJ8A 3TDFA 3W71A 2OGJA 2Z6JA 1AL8A 4F0SA 5I23A 1JGMA 1MWOA 4H6KA 3B4YA 4XBJA 1R2TA 2F6XA 1XG3A 2V5DA 1LTDA 4LFYA 4LUSB 3SY8A 3TNOA 2CHNA 4FNTA 2C91A 3FYPA 3BW3A 2UY3A 3U7BA 1FWWA 4M51A 3KCJA 3SUVA 4YYFA 4JXCA 3MO4A 1T0OA 2IQ0A 3NZGA 1LRQA 2Z2UA 3O07A 4DUOA 4ZL1A 4HOXA 4KGJA 3CS2A 5TIMA 4CNUA 4AD1A 1H7OA 3OHIA 5DFAA 1EDQA 5L9FA 1GEHA 1T96A 2VJXA 3FA3A 3TAOA 1EGVA 4ZXLA 2Y89A 2PF8A 2RDTA 4AUBA 4JYFA 3G1RA 1NH6A 5AFDA 5GJNA 3WD1A 4LY4A 3S47A 4WIWA 4UOZA 4Z2KA 4AWUA 3KFTA 3SCSA 1WZLA 3T0AA 2CLIA 5F7UA 4MUPA 4HA3A 3ZJKA 3AIUA 3IIZA 5C2CA 5CC5A 4CGTA 5E6ZA 2QV5A 3UJEA 1RV8A 2BFGA 2BGNE 1Y5VA 1OIMA 3F2CA 5LXEA 3EOEA 1M9HA 2NUYA 4B3ZA 2Q8LA 2DQWA 2YBTA 3RF9A 4PC8A 3WDPP 1C29A 3GWQA 3FV9A 3MZNA 4UC5A 5JIWA 5FJJA 3STPA 2X1UA 5HULA 1AK5A 3ZT7A 3L5LA 2WKLA 5KINA 3VA8A 5A6MA 4V28A 1CDGA 4Z1CA 4ORIA 4DI9A 4J35A 5DRCA 4DAFA 1E0XA 1RQHA 4D6CA 1GVIA 1SW3A 3O3RA 1RK5A 2VELA 2BY1A 5H8MA 1SO6A 2DORA 3PZMA 1VFLA 1PKMA 1U22A 1QHZA 3P5YA 3DECA 3MI2A 2QJNA 1ISYA 1LL4A 1DJGA 4BF7A 4GQRA 1P48A 1LOLA 3GU9A 3WLMA 2R94A 2WWCA 1ME9A 4YTQA 5D04C 5G1MA 4P61A 4JEQA 3UZZA 4K68A 3ZJ7A 1JXJA 1WXJA 5FACA 2FMOA 3ZJ8A 3MU7A 1A49A 4C6QA 3VKKA 2BY3A 4WY0B 3Q65A 1VYPX 4OIFA 3RG6A 2ZZ7A 3UETA 3HZ3A 1FP9A 2DQXA 2DZUA 3VNDA 2Q8ZA 2YIHA 7XIMA 3L4UA 1HL8A 1S2UA 5K4ZA 5A6AA 1YDVA 2XUCA 4Q8PA 1XLAA 1XHGA 5DF0A 1PZ2A 3GDKA 1JZ4A 3LLXA 1CB7B 3BAJA 4W88A 1TX2A 4L4PA 4BI5A 1T6MA 1OB0A 2VI0A 4IH3A 4NXSA 2VFDA 2OWCA 1K6AA 2VZSA 3BMXA 5CPQA 3HV9A 3M5ZA 1MW1A 1XD0A 3BAXA 4ERAA 1VCGA 5I3GA 1EEPA 4HPJA 4E3VA 1M3UA 4XG1A 2BXVA 4X63A 4MJZA 3RR1A 2PRMA 2HZGA 4XVDA 3RFAA 2Q8XA 3RU6A 1E55A 2ALRA 2C71A 1WZAA 1MEWA 4TQTA 3COTA 2X41A 3VX0A 3CTTA 1GOXA 3ZMRA 2O7SA 4DHGA 2A3HA 2MNRA 1F4HA 4LUSA 5I3DA 3S3GA 5LKYA 3W88A 2FKPA 1HGWA 1LQ0A 1Z7AA 4NASA 3AI0A 4WK9A 5DCEA 3IIVA 3ARWA 3P67A 2OT1A 3AICA 2Y5EA 4UQAA 1MMFA 3Q45A 3ABZA 3S1VA 3S9ZA 2X7WA 1AQ0A 3DYPA 1JCNA 1DWJM 1F3EA 3EOSA 1TRDA 4JTQA 1KRBC 2IPJA 5BMWA 3AO0A 3EEGA 3M41A 1LROA 4Q8UA 4TV6A 3OO2A 5KZMA 1W2PA 4RPQA 1JYVA 3AHZA 1KFJA 2R82A 3HQOA 3TSDA 5A8PA 3FS2A 1KXVA 1XDMA 1BVZA 4JIIX 5D4YA 3MQTA 1RH9A 3R2GA 4P8WA 4I6KA 2ZTJA 2NX3A 4IMCA 1XIGA 3CNYA 3AHXA 4RR4A 2HS6A 1ECQA 5CLTA 5BNKA 4H41A 2ZZ6A 4LUYA 3EKGA 2DJXA 4A8IA 1RAKA 1YLVA 2J9XA 4UQDA 1RZMA 3GAYA 4UOQA 3INPA 1Q2SA 1XLIA 4ZB0A 3C86A 5DT7A 3VGEA 1W3JA 5MHBA 1W9BM 3QFEA 1EC8A 5BMXA 1R9YA 4M6QA 2UY4A 1XV8A 3PG8A 3WK0A 3N9KA 5AKQA 1KBIA 3NYDA 2HJPA 1RPKA 2W92A 3T81A 5HNRA 4R9OA 4FEZA 4QQ3A 3SADA 5CJ5A 1JFHA 1GWJA 2BNJA 4PUEA 1EUNA 1OT2A 2XVPA 1K8YA 3L23A 2JF6A 3NQ6A 3LCLA 5C9XA 3QJAA 5C54A 4LSBA 3EOUA 1T8QA 3B06A 5A8QA 3K1GA 3IS4A 5DX7A 5C70A 4KMQA 2WVVA 4JY8A 4GJ1A 3GYCA 1VS1A 1V6VA 5BU6A 4IIEA 3BAWA 3RU8X 2WHJA 1KQYA 1WAWA 2EJ1A 2IKIA 4YNGA 4H9UA 1R2SA 3E0FA 1YTEA 1F05A 1YYAA 1XC4A 3VIGA 3WNKA 3E0LA 4YHGA 3PJTA 5K9DA 3VVGA 4WY0A 3PZIA 2YL9A 4S3EA 5IFTA 3PAOA 1PX3A 3FYOA 4MPQA 1C7TA 3RDKA 6XIMA 4WDUA 5FD0A 2FGBA 2PLCA 3NAVA 5F2IA 2J7BA 3WQ6A 3MANA 1D7FA 4AZCB 2ZZ1A 1FDJA 3AUOA 3W4RA 2P10A 5HJYA 1ME8A 3QYQA 4N0RA 4GZJA 1MRQA 2VFHA 1FP8A 3A3XA 1XSJA 4K3ZA 3TN4A 1SFSA 2J8FA 3TC7A 2XZ9A 3KCOA 6PTDA 4U10A 1R38A 5HJXA 4FR1A 4HK6A 5D2YA 3LMZA 5LA2A 1P6WA 4UNLA 3QQ1A 2H3DA 1KKOA 2W5FA 4D6JA 3WNMA 3NJ3A 5AZ0A 3FY1A 3GB6A 5JH1A 3H2MA 3TW9A 3UWZA 1JI1A 3NFUA 4B91A 3L2IA 4XZWA 3FDKA 3ICJA 3LU2A 2Z7KA 5LIUX 2P3EA 3UCDA 2QT3A 1KCKA 1A80A 2PWFA 2BBFA 3CUFA 4FO4A 4DXVA 1OYCA 1N2VA 1JCTA 3W72A 3BO9A 4W9TA 1W2VA 4EP8C 2VR2A 2VHLA 1G9HA 1XBZA 1Q6EA 3B0UX 2WZIA 3CZKA 4IIGA 1W1YA 1TV5A 2O7QA 4M81A 2J7GA 1A4LA 1HUVA 4B5NA 4LRSA 2YXXA 1JDFA 4CNNA 3VOHA 2YX0A 1IWPA 9XIMA 1H4PA 2HEJA 1W31A 3IVTA 3KOXA 1UWQA 3OOQA 4OJYA 3I6TA 1A5AA 4NY2A 3ARXA 4QDWA 2C1IA 2J9ZA 3CQ0A 2J74A 3OZPA 3L4XA 2CXEA 4IP4A 1I1WA 3KRBA 1V02A 1V8EA 1YBQA 1P7TB 2ZUVA 3IARA 1B0IA 1V6YA 4G1KA 2WSQA 4W7UA 2J7CA 3WD3A 4O1AA 4XIAA 5HWNA 2W79A 2Y63A 1ZLPA 2A7PA 3L4VA 4MLRA 3CU2A 4DF0A 3TJ4A 5HMEA 3AMDA 4AZGA 2YYTA 3W1UA 1DTUA 2FPYA 1DIOA 4TTUA 2W0UA 1I2RA 3GXIA 3A13A 5C55A 2WBGA 2NLIA 4IQLA 3TR9A 5BRBA 2PDKA 2WPGA 3WJWA 4JFSA 1GOKA 1HN1A 3LGDA 3LI1A 2OJPA 2CBVA 4LAZA 4PMRA 2J25A 3NL2A 4DNMA 2X2YA 4IPLA 2RJGA 1VBGA 2NSOA 3HGOA 2PDLA 4AZ6A 4TTGA 4Z2GA 2FPVA 3T4WA 3CUGA 4HNUA 3JVAA 3N9SA 4JICA 3W1MA 1EZWA 1RBAA 4HCHA 3B0YA 5C8BB 2PU1A 4A2RA 3A22A 1KR0A 4AZHA 3UP8A 1VFFA 3A4WA 3JZUA 4MKSA 4NX5A 3FCPA 2JGYA 4LPCA 3OIHA 4ZA0A 2QCCA 5D33A 3VCCA 1VBHA 1RY8A 1W56A 3BCFA 3ONBA 1EA0A 4GVGA 5D2XA 3I4EA 4XISA 1WP6A 3V1HA 1EEXA 5LIWX 1BF2A 3BV4A 3KOYA 4CNSA 2E8YA 3DFPA 3WQWA 1A5KC 3MYPA 5LA0A 1OCBA 3URBA 3U7VA 4P8UA 2XN0A 4KWOA 4BR1A 3PJXA 1FWNA 1Y5XA 1X8CA 1BLIA 3IGHX 4J3XA 3GKAA 4G7EB 3CUIA 4FR6A 3GVWA 3KOZA 4ZQRA 3M0XA 5JMUA 1BYDA 1A5CA 3SCUA 4CCEA 3MV11 3JUGA 4HMNA 2P53A 4Z17A 2VR5A 5FEZA 1XH2A 1HKWA 3M43A 3VC6A 3VOJA 4F79A 3I10A 3OEXA 3URQA 4CQ9A 1NWTA 3H21A 5H8UA 5BWFA 3UA4A 3MS8A 3QZAA 2PDBA 4QE4A 3WF3A 4YCOA 2B0MA 4Q4MA 2XIOA 4XD3A 2FDSA 2VCBA 1OC5A 1CGWA 2D3LA 1NELA 1G4PA 3I7SA 4AYGA 5K2ZA 1F3WA 5JVLA 3VD5A 1Q6CA 4FNUA 4JTHA 1RD6A 3M07A 1A3XA 1H2JA 1E40A 3CO4A 2C79A 3O9NA 3FX4A 3WH6A 1G4SA 3GC4A 1W8SA 3TTYA 3VNYA 3AJXA 5FAJA 3H24A 3MP5A 1LL6A 3O15A 4OQVA 3W27A 3H2AA 3MSYA 4KRTA 3UPWA 3VYLA 5C9ZA 4MNKA 1QCWA 4PH6A 1M5WA 2WNWA 4IX2A 3NQDA 2QCDB 4C5YA 3EX4A 3RNDA 1EGZA 3GDTA 5G2WA 2WMGA 3SN1A 1OQFA 4BJHA 4NSBA 3P61A 4CN6A 4HK7A 4DVOA 4G9PA 3QTGA 4XD4A 2QCHA 2XJ7A 1A5SA 4DZ5A 3NQ7A 3IGXA 1WDQA 3I3DA 3WH8A 3KHDA 3W84A 3GK0A 2DZWA 1HZYA 3M0MA 1P7TA 3VABA 3VGDA 1UC4A 5E6YA 1S46A 1V3HA 4ZBCA 3TR2A 3MMWA 1CTNA 1Q6FA 4EXQA 3E2VA 4QLJA 3EXSA 2X16A 3D0CA 1BEUA 1JCXA 3CQHA 1JPIA 1NFBA 1OYBA 1PTGA 4UR8A 1CI1A 3W1XA 1QOXA 1TZ9A 3PFRA 3F5KA 1PPIA 3PNZA 1K1DA 2XSXA 2GJXB 3GUGA 5HA7A 4DZHA 5HUPA 2GUBA 1Z32X 1J79A 4IIBA 3TC3A 1M7JA 3NQMA 2TSYA 5AYZA 5J04A 1XLMA 1MXGA 4Z0JA 5HANA 3QMRA 3Q67A 4QS6A 3XINA 4OHQA 1D8WA 4F40A 5C71A 1JF6A 4DZAA 1P0BA 2E9BA 4MB3A 3AMLA 3D3AA 1UD2A 3OJGA 1F07A 4C6OA 4H9XA 3SO7A 3THQA 1PSCA 2RGMA 3WBAA 4DUWA 4GD0A 4RZ5A 4KBXA 3VMNA 5I03A 1VEMA 2GQ8A 2QMKA 3LBMA 3N4AA 4H8NA 4ZB5A 3KL5A 1Q85A 1S1RA 1XLJA 3WQOA 3GH4A 3NYZA 3CMGA 3B8UA 7TIMA 2JKPA 1MI3A 5AZ1A 4D2JA 4WDWA 3OGRA 1VFOA 1ZENA 2J88A 4O18A 3S1WA 1GOMA 3ZLHA 3M0IA 1UBPC 1XCFA 1QNRA 3OZYA 4DPQA 1B3XA 2RFGA 1TTIA 4JBRA 4IG2B 4LH8A 4UQEA 3V3WA 3GIYA 1OZMA 4N2YA 4D6DA 3TYAA 1UD8A 3C0JA 3GQYA 4C1KA 1B3OA 1W3TA 4G6CA 3W7NA 2CLHA 3QLDA 3WZ0E 4OBRA 1FA2A 3EB2A 4B4FA 4YWSA 1MFUA 4ATLA 3LBOA 3W1NA 4I3GA 2X1SA 4PMOA 2IXUA 1G01A 1UZHA 1TMHA 1JCYA 4RZBA 1TTQA 2FJKA 1DIDA 1TV3A 4HU0A 3CAQA 2FZ9A 3QBUA 1V7AA 4MNLA 4ZTXA 3ITVA 1O5XA 4FXJA 5EBAA 5I00A 2FH8A 1EC9A 2ISDA 3P74A 4AVOA 2ADAA 1A5NC 4JFTA 1ITUA 4WQ6A 1TPVA 3GE7A 3MVIA 4LEQA 4KW2A 3P14A 5FF4A 1QASA 1GW1A 2NV2A 2I9EA 2FJUB 4FX8A 1Q7QA 3B05A 4DYJA 4GYJA 1ODZA 1OJXA 2YZ5A 3PP7A 2DY3A 3N9RA 3DGRA 1HW6A 2CNCA 3SN4A 1YRRA 4MPKA 4C7DA 3APGA 3BURA 2XSAA 1EBHA 2AQOA 4MG4A 5TBOA 4HU3A 3VFLA 1KRMA 2PLKA 4GIRA 2BGSA 1LUCB 2NX9A 1XLCA 3NXFA 1Q2RA 3K46A 2R14A 3LTSA 5FJRA 2HDJA 3DBPA 3L5MA 2VT0A 3IRDA 4F4RA 5IHSA 1HIZA 4QTGA 3VNKA 1UWAA 1TPWA 4X0VA 4JTLA 3GTFA 2P8BA 4QEEA 3UESA 3T40A 1O68A 3LCFA 1TTJA 4EE9A 1O5QA 1VLIA 1OGSA 2ZRUA 1Q7ZA 1UMYA 3W6YA 3HURA 3SAZA 2FIQA 4LF1A 4CD6A 4QXIA 3UXDA 3UVAA 5C2GA 2UWFA 2Q09A 4DBSA 2PD5A 3WBWA 4ACZA 2QGHA 4AD2A 4OZOA 2GJXA 5CPLA 3EWZA 2BY0A 1ZAIA 3GY1A 3SSZA 3WLSA 1OFBA 1JPDX 3ZM8A 3LPGA 4H00A 2GYIA 1I2QA 2F9RA 2FFIA 4JX5A 2NT0A 1J0HA 1T99A 3BLOA 2X0SA 1E3ZA 4IIHA 3FK4A 5CSYA 1QPQA 3M64A 3ABOA 3U2CA 2IUZA 5M17A 3C4UA 5FL0A 4FIQA 1UH3A 1PDZA 1C91A 1YEYA 2Z7GA 5I07A 2G3IA 1KWKA 4OV9A 5HPOA 3LTYA 1ENUA 1V02E 2ZA3A 4ZXOA 4LGXA 3GH7A 3RLHA 3UERA 3QVQA 3GZ3A 4GQBA 3HIJA 1C92A 1KLYA 4JDYA 3WN6A 4LV4A 1PE1A 1DJZA 4ZQOA 4OWGA 5T9CE 3IJDA 3OYZA 4YTUA 2BODX 1JPHA 2OKTA 2OLAA 4RNHA 4GNKB 4H9VA 1TJ1A 2ZIDA 4IG2A 4JGDA 1MUMA 5CLWA 2GWNA 3F5JA 2NQJA 2GGEA 4MY1A 1KD0A 3RM8A 1RSCA 1RPXA 3I65A 4N9BA 3W2LA 1TV4A 3E0IA 3C8FA 5CEWA 1D3GA 1JCLA 2FVMA 4RK8A 3NO5A 1S3TC 2QLYA 4LVFA 3RHGA 1H5VA 3LHUA 2YA2A 2W91A 3KWXA 1A50A 2AGTA 2D73A 3R6IA 1NDYA 3WK2A 1CB2A 1QMLA 3GG8A 1U5HA 2DP3A 3ITXA 2GJPA 3ME3A 4C6DA 1J4EA 3IAPA 3NSNA 4N4QA 4EWJA 3O6DA 3IPWA 1F7BA 3PPFA 2QDEA 4GE8A 3C5QA 4GCAA 1XFCA 1HL9A 2NVDA 2WK2A 4NT0A 2VX7A 4GNVA 4UUIA 3N12A 4OGZA 3RX3A 1JD7A 2FDMA 3FEMA 3KUMA 1PDYA 2Z1XA 5A2BA 4F0LA 1WZMA 2XU2A 2XTKA 1GOOA 1FCVA 3G22A 5AHNA 4AY8A 1MSSA 3DHFA 3BOFA 3S2NA 3HQNA 4K7YA 2J27A 3ERPA 4H7VA 4ZE4A 4UFMA 1CENA 1QO2A 1DWIM 3KZSA 3QKEA 1UBSA 1WZKA 4JQAA 2DH2A 5A8MA 1B54A 2GGJA 1KTNA 1Q6LA 1QDSA 4QRNA 4A29A 3KRUA 3GU1A 4R7WA 9XIAA 3U5YA 3MMUA 1T40A 1UR2A 2ZFAA 2Y62A 5A6BA 3PZ9A 3PZNA 1TMQA 1UKSA 3TW7A 3ZFHA 4A4AA 3BW2A 3BJFA 1IGWA 1JFXA 3NQEA 4FZIA 4NZ4A 5CC6A 1J11A 3TWAA 1KR1A 5BZAA 3HFYA 4QAWA 4LJ3A 1J0IA 2F7FA 1KO0A 4MYXA 2RJHA 4D1IA 4H9MA 5I06A 1YNYA 3S5ZA 4JQ3A 3N2MA 1BKSA 3O0FA 2OYLA 4I9TA 2OEJA 2ZUUA 3QOMA 1OK6A 3E74A 3ZLGA 1FWHC 2J7FA 4PTWA 4XZBA 5HR7A 2ZXQA 3QW4B 1CXHA 1AMYA 1E71M 1ZS2A 3LCGA 4E8DA 3ARQA 3O2LA 1EJXC 4D6EA 4JYDA 4E38A 2YA0A 3TWBA 1KM1A 4MFEA 4GUFA 3OG3A 1XS2A 1JUKA 2PBOA 3NQBA 3MWAA 4L1WA 4G8TA 3RYSA 1GG1A 1T5AA 1P0DA 3U57A 4CKQA 3SB0A 1XKYA 1O66A 3IANA 4DYKA 3U2OA 1D2KA 3ARYA 1KLZA 1E73M 5KTLA 1JZ5A 2HRWA 4CNOA 5LSMA 2XFYA 1ZCCA 1E15A 1X6UA 2GSEA 1MNZA 4Z1BA 2W3ZA 3H55A 3URAA 1TPUA 4F0KA 3N73A 3GTHA 2ANUA 3VGHA 2QR6A 2OX4A 3L68A 4MYAA 3LCIA 4M5PA 3N18A 1DORA 4X2RA 1YPXA 4AWTA 3L2LA 5FAGA 2Z00A 3CYJA 2VWSA 3AS3A 4US6A 1NIUA 3CZJA 4HNLA 1FDYA 1TQXA 2A3CA 4HHHA 4AX7A 3F1QA 3EDDA 1FWBC 4EF8A 1W5QA 1VHNA 4JNZA 5KETA 1OHLA 4LF2A 2D24A 3PBWA 4M6VA 1W9PA 3PULA 4MNMA 3E5BA 5FSDC 4K2SA 5TQLA 4U28A 2NWSA 4GY1A 1IIHA 2XSBA 4WOZA 1EJSC 1CWYA 1DE5A 4LANA 3RCYA 1GZJA 4NVTA 1IEVA 1FWSA 4MDOA 4DJDC 5EMMA 2XIBA 2JE8A 2HXUA 4ZQMA 4WF7A 1OG0A 4O50A 1V3LA 2AKZA 2XIJA 3PBYA 3GSMA 4H4IA 4AD5A 3P62A 1TWWA 4AVNA 2CKRA 3AIEA 4A8LA 4O1CA 3HOJA 3SRDA 1BRLB 1VPXA 4HKPA 2VGFA 3ZS4A 1JYWA 1POKA 1UG6A 3AYTA 4IZGA 1A5LC 3DYMA 2PCEA 3VNJA 3HFTA 1YTDA 3RLUA 2QCFA 2PP0A 4Z2LA 3MBDA 4N9DA 4KRZA 4L9XA 4BY3A 3N04A 3QHOA 1HJUA 3R58A 4XAZA 4EX4A 3B3DA 1LQAA 3B8TA 4LVAA 1Q6GA 1TJ0A 1QNQA 6REQA 4CLMA 5DY3A 4YLWA 3GX9A 1Z89A 3R7MA 2AQWA 2I16A 1VHCA 3KVLA 1QT1A 1OINA 2OQHA 1MNSA 1PUDA 2GGIA 3TZFA 1T7LA 4OKDA 3VC5A 4JEJA 5LHEA 3UF9A 2C6QA 4ZQCA 1L8PA 1UPPA 3R43A 1NM9A 8A3HA 2V5KA 4TX6A 4Q4KA 1EB3A 3I6RA 2GJNA 2OOGA 4LRTA 1GPWA 1V08A 2D2GA 3DENA 1YXDA 4L64A 1C8VA 1RD5A 3AHTA 1XLHA 1SVDA 3BL3A 4F9JA 3RK8A 2HE5A 4PTMA 1OFPA 3AOFA 5DLCA 3UD6A 4FF5A 5HQEA 3KS5A 3EXTA 1W9DM 1IT7A 2J13A 5HMSA 4RV3A 1C9WA 3EX2A 5J5DA 5EL1A 3V36A 1UWIA 2Y7DA 4H04A 3OZOA 2ZXBA 1KBKA 4ZO8A 1F3XA 2WCSA 3P8JA 2EHHA 2EPHA 3CXOA 1B3WA 2YL6A 1FX6A 3ITGA 4FNRA 3LV6A 2NX1A 1W3NA 2JK2A 3LNMA 5I79A 4O52A 4ZSTA 2J75A 3GAKA 1IXNA 4M1BA 5LIKX 3M6YA 1HJVA 1MUCA 3B03A 5I3IA 2ONEA 4M3PA 5A2CA 3KVJA 4XZHA 8RUCA 3JRKA 2PDXA 4AIEA 2GUUA 2QNEA 5E9AA 5DXXA 5HUOA 2H90A 4OUIA 1OGBA 4I7VA 2ZRWA 2NZLA 4IMFA 4ADSA 4I5XA 4H8UA 4UFLA 3VMOA 2PWEA 1WKFA 3UQNA 2QQ6A 4HYWA 1FXQA 2V82A 1DHKA 3ARRA 1P5BA 3APYA 2WMKA 4NJHA 2IPGA 1SZGA 5FJUA 1IXOA 1WAUA 1PWMA 3IK2A 4UTJA 5AC6A 3G8EA 1ZRQA 2A0NA 4UQ9A 4NP7A 1KFBA 1KXQA 1UD5A 3UJ2A 4XO6A 1SJDA 4CCCA 1QWKA 3BCJA 1YW1A 4FOUA 3W73A 1ONRA 1W1VA 3W7GA 3ZVHB 3WEMA 4HBKA 3GBEA 2P76A 4EOUA 3QF0A 4TVDA 1MXSA 3T0DA 2QCNA 4AISA 2VEPA 2FQIA 4IPPA 1PVNA 2FZ8A 4DI8A 3B8VA 1E6RA 4PN2A 3QLLA 1CGTA 3BWWA 1NDVA 1UOKA 4UQBA 4LAOA 4LAKA 3VIHA 2BWGA 2XFRA 3HGJA 3KLKA 3FW6A 4TU1A 2J7DA 4KERA 1O6IA 3GHRA 5CPMA 3P7YA 5G4HC 4GC3A 4IP7A 1DJYA 1J12A 3W86A 2EEXA 3BSMA 5AYIA 1ALDA 3GW0A 4HOZA 1E51A 3AZSA 4K1GA 2DVTA 1SM9A 2F8QA 3VAVA 2AL2B 2ZWZA 1RP8A 3UR5A 3BG3A 3M0KA 3R79A 2NW0A 3UR8A 4LYQA 4JTRA 3SR7A 5AB3A 1X39A 4TMCA 3RX2A 3HQ1A 4AWEA 4LBUA 4MAZA 2CU0A 3B9OA 1Q6RA 3IIXA 1NEYA 3PFMA 5HK4A 1IT0A 1A53A 3BMWA 1QHPA 4RUBA 3WJXA 1PEZA 4C6CA 3LHWA 3XISA 2WVTA 2GGHA 4QCFA 3C3NA 1NDZA 4MKVA 2F84A 3TN3A 3UG8A 1IWBA 2Z25A 1EGMA 2QUUA 2VEMA 4RE3A 1ZBVA 3NTYA 1MZHA 1C93A 3CT2A 2A4AA 5E5CA 1JPMA 1PXGA 1Z48A 3GH5A 3LNPA 4GWEA 4WOQA 1MW3A 3OVQA 1D3HA 4GC4A 2B31A 1BYBA 4Z1AA 3PR2A 2PWDA 4MUZA 4AB4A 2VZTA 2OQLA 3GTXA 2DZAA 1EQCA 3WFLA 3AZTA 1CGXA 3V18A 1EX1A 3PBUA 2OFJA 2A1YA 4DBUA 4DO4A 2PTZA 3CASA 4LCSA 2D2HA 1X1OA 4BK9A 4D8ZA 4JPGA 5A6SA 1L6YA 2PSNA 3BZGA 4DXKA 5I6SA 3OBEA 3AMCA 3WBXA 2W6RA 5L6UA 3QC0A 1XLKA 5I3HA 1WUFA 1MXDA 5E09A 4Y6GA 5G4EA 4X61A 2ZADA 3MWCA 3WO8A 4WXYA 4NNAA 3ZIZA 3ZO9A 3C2FA 4PGLA 3ZSSA 4PCTA 1SR0A 3MP3A 5ECUA 4N6EA 1E6ZA 1RK6A 2I56A 1TREA 3WD2A 1UUOA 2AOSA 5FJPA 2GVYA 1MFVA 1VYSX 1ZZMA 3MDUA 5I3FA 1AVAA 4BEUA 2Q6ZA 2BHYA 5D2WA 1BYCA 4CQDA 4B9YA 3WCZA 3SGGA 3CIXA 2A3EA 1AW2A 4HQVA 1TVPA 4O0ZA 1IZJA 2OU4A 3WLRA 1SJCA 3A4JA 1CGVA 4R88A 3LK6A 4IFKA 4UNIA 4LTSA 4XAFA 1TIMA 3DC8A 3BSGA 4V1XA 2QPXA 4D6GA 3BJTA 3KLLA 4RNIA 5LGZA 4UFHA 3STCA 1XDJA 4KEZA 1VQTA 3UXAA 2E7FA 4QLKA 3HV8A 1VJZA 5G2IA 5REQB 3RLVA 1EFZA 4OUEA 2TYSA 2ISSA 2OPJA 4RNFA 3DC0A 4HMDA 4CCZA 5CAKA 1PIFA 2VTFA 5C7HA 4OU1A 1MRAA 3LLDA 2VDHA 3O0KA 2X8RA 2ISWA 5HBFA 4UCFA 3UWWA 1Q6OA 4U3CA 1FKXA 3S5OA 4IIDA 1YDNA 5AYYA 3KTCA 2P3ZA 4CU6A 3G3DA 1KBBA 1KV5A 1JZ6A 4FS9A 2QKFA 3ABSA 2IQDA 1XL9A 1OBAA 2NXGA 4JCLA 4O19A 4PTNA 1FCUA 1DBTA 5A69A 2ABAA 5BWAA 4HOWA 2WZTA 2VX4A 3T08A 1QI0A 4JTDA 1GCYA 5AY7A 2J66A 3RMJA 3V75A 4IICA 2UY5A 1JAKA 1DEDA 1BQCA 3VMPA 4XQ6A 4O17A 1HX0A 2GOKA 1XXXA 4KCUA 4R5EA 3G6MA 2Q3OA 4EKJA 1C8YA 3P0XA 1VIWA 1KXHA 5CJNA 4JCMA 3D3FA 2QPSA 4YVVA 4PUKA 3OA5A 3W7MA 4Z42C 8XIMA 2O9RA 3EZ4A 3SCWA 4EAYA 1RLCL 1Q6DA 1VGAA 4NZCA 1EJRC 1CGUA 4PMUA 1F76A 1ODUA 3PZQA 1XLFA 4K7VA 5E70A 4C6LA 1J96A 3SCOA 2WHLA 5CBIA 5M2FX 1I0BA 1AG1O 1DXIA 1YQ2A 1GOQA 4GXWA 5BRQA 2PDMA 1YDYA 1WDPA 3G24A 3DIPA 1W3HA 3OPSA 3NWRA 1E3XA 2G3JA 5FF0A 2PDYA 1XWYA 1R9XA 3T42A 3NZRA 5A94A 1QXLA 5CZTA 4BQ3A 2P0OA 3STGA 1XPYA 3WLJA 3MY9A 1V0MA 3FAXA 4PRWA 1ZB5A 4MTVA 4J3TA 3TFCA 5D8WA 1G7VA 1R5YA 4HSHA 4N7QA 4EPEC 4QSHA 1V0KA 3KE0A 4AD4A 2V8ZA 3TTEA 3N34A 3WG6A 2AAMA 3AROA 2NWRA 1YHTA 2GPTA 4GI9A 3CLWA 3H7RA 3GHUA 3LZ5A 1TCMA 2XGBA 3S0CA 1FWIC 1XYZA 5BROA 3L0KA 4MY9A 3T44A 3MA8A 1VBRA 3MP4A 3KHJA 3VNIA 5A5WA 4E3TA 5I02A 2FMNA 4PB3A 4TUFA 3F4WA 4W93A 4DJEC 4E4FA 4D1JA 1W9XA 2VGIA 4LS0A 3KTXA 3S5YA 1OYAA 4ALDA 3W38A 2AL1A 1E0WA 1SZRA 3A24A 4W8LA 3KOWA 3MCOA 1FWRA 5CG0A 1R3RA 1PWLA 4JTJA 4U3AA 3TQVA 3BUVA 3DU0A 2Y5JA 4GPNA 5D2VA 3WNNA 2A2IA 2ZUWA 1JG9A 1OD0A 2PDHA 3ZWSA 3PNUA 3QM3A 2J24A 4JR5A 5TF0A 3M16A 3KDNA 5BXTA 1GYLA 3CQKA 3DFQA 3MW7A 1NJJA 4K1WA 3HBLA 3DG3A 2FB3A 4GIEA 1NSJA 4CEUC 4WHBA 2WJDA 1GVYA 1JZ2A 4GX8A 4CVWA 1Q45A 1M03A 1W5NA 1YMYA 4OECA 3TA9A 2HPIA 4J3UA 1PHQA 3B8DA 4Q22A 5IXEA 1GPFA 1KCXA 4RXFA 3H8AA 2CZVA 4GYPA 1LP6A 5FSEC 5K3VA 2V2DA 3M44A 3D47A 1XIJA 4FNPA 4KQNA 1BQGA 2L5HA 4ZCWA 2WWDA 1EA9C 1V93A 3RJXA 3VDCA 3ES7A 4YU1A 2QF8A 4NU7A 3EWUA 2HISA 1TPC1 4JQ1A 1JZ7A 2CW6A 3TLLA 1XQKA 4GINA 3SGZA 1YTKA 3NXLA 4OBSA 1LQ2A 4PUMA 5CPSA 3VKCA 1XLEA 2V30A 1FKWA 3FIGA 1VAHA 4IJCA 1BWKA 4HA4A 4CU7A 3C2YA 1XLDA 3WJZA 5H2ZA 4GYFA 4KFPA 3FAWA 4JHOA 3ORWA 2GDVA 5FL1A 4QP0A 1SJBA 3UXLA 1IEIA 1O4UA 3GZAA 4L6HA 4X2PA 1IIGA 4UCGA 3MUY1 2QJHA 3E38A 4R34A 4XTIA 1GGOA 3KX6A 2CKSA 1QI3A 2VR4A 5A6KA 2A3BA 2GWGA 1LG1A 1KCLA 1MQQA 4PBGA 1NY1A 1WKYA 1VFSA 3IV3A 3OVGA 1J0YA 4UFJA 3KP1A 4Q4OA 4KH2A 3PUGA 1H49A 4IUOA 4F8XA 3TYZA 4GACA 4O13A 4FB7A 2XVKA 2CHOA 3L5AA 3FXGA 4TIMA 2DSZA 4NHVA 2J62A 1XYLA 3DZ1A 1NQ6A 1M1BA 1UA3A 2HNHA 2Z28A 4LYKA 4GQQA 4LUTA 2V67A 2V5JA 1FCBA 1GHSA 3T0TA 2Y88A 1W5MA 4DYEA 4R7JA 1IF2A 1AH3A 1F8IA 1V6XA 3BLPX 2PDQA 4M80A 3GFZA 1GJPA 1WDDA 4Z1DA 1DJNA 3P2VA 3BOLA 1SO4A 2OCZA 9CGTA 3NG3A 3VTRA 2E68A 1EL3A 1UZDA 3T05A 4AY7A 4K8EA 4RW5A 1O1ZA 3KW3A 2X1TA 3OLEA 1JULA 1CXIA 4NAFA 4PBEA 1JAEA 4GOAA 1EUAA 4O15A 5AHFA 3HA1A 1Z69A 1WOBA 3JZEA 5LHFA 3KWSA 4IHCA 4ZR8A 4RE0A 3ZQ9A 3QN3A 2OZTA 1TA3B 2VQUA 5CCZA 4Y9NA 3S2CA 4XWUA 1EJUC 4FSAA 4DQWA 3M9YA 1RR2A 1EP3A 1S5MA 4JTEA 1YPFA 1QO5A 2YCLB 4GMEA 4O10A 1VRDA 1W91A 2OYKA 4Q8QA 3LMYA 4NAEB 2FHFA 4LEFA 1BAGA 3I3EA 2W9MA 1ITCA 4AHQA 3O1NA 5HXMA 1QNPA 3BTNA 2ZE0A 4PEKA 4M0XA 2IKGA 3B9NA 2E3ZA 3SCPA 2OZ0A 2X09A 3BDKA 4AZ5A 1HTIA 3ARVA 4IPJA 3EDFA 4PMDA 3F4CA 1F9CA 3RN6A 4AU0A 4H6RA 3TROA 3M5XA 2PWUA 1XYMA 2TMDA 4HCDA 1R86A 1UWSA 3H2CA 1VCFA 4AC1X 1XLBA 2V63A 2DZTA 5BCAA 2PC8A 3TLQA 4A8NA 2FZDA 3N6QA 1UOZA 3OHMB 2AAAA 3DH7A 3N11A 3W7IA 3G1FA 4C1LA 1V3JA 5LIXX 2C1HA 1UR3M 4QNWA 4RXGA 3Q2DA 1DP0A 2WLYA 5A6TC 4PYSA 2FYMA 3WKZA 1RA5A 4Q6XA 3G0SA 4QQUA 1NAL1 1GG0A 2WMFA 3SCVA 4F2UA 3EWCA 3UA3A 5D9OA 1WB0A 3VZYA 3VKAA 2E40A 4K37A 1SSGA 2PTXA 3WH9A 1GVRA 4RJEA 1GQJA 1EIBA 1DV7A 1CXLA 2Y8KA 4IGSA 3EKZA 3RO6A 3H53A 2GQ3A 3QY7A 4TX9A 1KBLA 2I5GA 1EH9A 4X22A 4JL1A 4R85A 2C1GA 4P7LA 1H3GA 1KQZA 1IR2A 5LGXA 3CK5A 2FTWA 4YTSA 4JTCA 1O12A 4Z1YA 1R87A 3BQ6A 3N2TA 1S38A 1JQXA 4EANA 2DGAA 4R7OA 4WJXA 3E96A 2YCKX 2PS2A 2ZE3A 2FTYA 4JX4A 3ECQA 3NSMA 1B3VA 3EDEA 4MDPA 3N4FA 3BLLA 4QR6A 2AMXA 5C5YA 3UNTA 2JIEA 4W8BA 4S3DA 2GLKA 4QSFA 4PODA 2VZOA 2QS8A 3W28A 4GYPC 3LCXA 3DKJA 1C3FA 4YJ5A 4CCDA 1OX5A 4PTVA 2VFIA 3R5EA 1E43A 3W1QA 1WPCA 2QZRA 4L5ZA 5EMYA 2WSRA 1J0ZA 3DX5A 4TMBA 3SURA 3SQLA 4DUXA 1ZY9A 3FA4A 1BF6A 3WD0A 3PPGA 5EPDA 3CB8A 3C2EA 3CWHA 5AC8A 4WZHA 2R9RA 1BXBA 1KM4A 4J7RA 1CXFA 3VE9A 3BJSA 4AF0A 5DO8A 4HZ6A 1CLKA 4HYVA 3QV9A 5SWUA 4RLIA 1TE6A 1EWDA 4JKMA 4AD0A 1ITXA 1E4MM 4EPKA 2CITA 3C2VA 4EPBC 1DJWA 3QW3A 4Y9PA 4WRHA 4AWSA 3NQFA 4EF9A 3BMVA 2EGZA 3GG1A 3G18A 3BG9A 3THAA 2ZZ4A 2CLPA 3QR3A 1GQIA 3W1TA 1D3CA 2EAWA 2D0FA 3VGGA 2QUMA 3TXVA 2O4MA 4B9ZA 1P0KA 3SQSA 2YDQA 5HAOA 2Y8UA 1TA3A 2TPSA 3EMCA 3T0CA 1K4GA 1VFTA 4J3ZA 1XIDA 3HJEA 3LRMA 3CUZA 1PCKA 2B7QA 1UP3A 3M7WA 1H1ZA 1L6SA 1V0NA 2YCLA 2XH7A 4GI4A 1QNOA 3E2SA 1MYRA 4CD5A 4ZOBA 4DJFA 1XGZA 1WX0A 3KXQA 2G4FA 4NAEA 3OB8A 4Q4PA 4TOQA 3IWPA 4GQGA 2GVEA 3BE7A 1GONA 3RITA 1J10A 2VCAA 1X7FA 3IUIA 4PTDA 4AH7A 4N9EA 4M8UA 3L21A 1LT7A 4YYCA 5E1QA 4AZ7A 5LZLA 4LAMA 4H19A 1RXOB 4FAMA 4PCNA 4A3QA 2OQYA 3CQJA 3GNPA 4HA1A 1A5MC 2GZXA 2JKAA 1XCXA 3MHUA 3WY1A 1VRXA 4BFAA 2YLLA 4ICCX 3QPEA 2R1KA 4HPNA 2PC4A 2CBIA 2VVSA 4AEFA 3RCMA 5KITA 4LAUA 2DUXA 2OGYA 4F9DA 4ASTA 5AVHA 5LNUA 3BARA 1PJ9A 3FN9A 5B7YA 1HKJA 4Y9OA 3VUPA 3TN5A 1XI3A 3IUDA 3SDOA 6ENLA 3KCLA 4XSLA 3AIVA 3W7CA 4L6OA 3NPUA 4PUDA 1QPKA 1WKEA 3IJ9A 1RJRA 1ZTVA 1H11A 2J9YA 3ZYZA 3W2NA 3V5CA 4IQEA 3P0WA 2XGZA 3KTSA 3WH5A 1BPLB 3H12A 2RH9A 4JTSA 1PB0A 4IFRA 3ZSTA 4UBPC 2CWXA 3FSTA 3WQVA 5E0FA 2Z27A 1NFPA 5GJPA 3ZR6A 2DUZA 1H0GA 1UHVA 1GEQA 1UQZA 2BOGX 4PB4A 4DX3A 3C61A 3SUSA 3CPGA 4PCPA 3TH6A 3CEPA 1FBAA 4UIOA 4H1ZA 1QTWA 5ECVA 3CHCA 3ANUA 4DJDD 2WKJA 2QCEA 4Q3MA 4Q4QA 4QFUA 2O9OA 2EQDA 3VNZA 2P5NA 1GT8A 2VEKA 1QOPA 4FOKA 2OG9A 2WVVB 1PZ3A 1GK8A 1GZGA 3H4WA 1SR9A 2QCLA 5FEWA 4O53A 3QY6A 4DO5A 3OBAA 3MBFA 2C15A 2FHBA 2WSYA 4WGHA 3W3OA 1S3HA 3WBEA 4HNCA 5IFPA 4DO7A 2Y24A 1Q63A 1DOSA 1R6WA 3ITCA 4S2BA 3HPZA 3PVFA 4G5DA 1J2BA 4P8VA 3UG4A 2BVDA 2W4XA 2VFFA 2CZFA 3MB9A 3DFTA 4JIHA 1JYXA 4QNEA 4AAJA 1PYFA 5IBXA 1S5WA 2G41A 1CLXA 1VR6A 4Q7BA 4P7OA 1HGYA 4DLFA 3QGKC 2X40A 3MKCA 2XG9A 3QEZA 2F38A 4M6PA 1JZ3A 3DG7A 3DG6A 3KBWA 1MQRA 2FPTA 2V81A 1AA1B 3OW1A 4AMAA 1J6PA 3K1DA 5A6LA 3GDLA 2YSWA 5DMYA 3PWGA 1VYRA 3LLFA 5DBTA 4S2CA 3GC5A 2EKCA 4WY0F 5BRPA 4L9ZA 3N14A 3HG2A 2JQXA 3IJIA 2ACRA 1PKLA 1CW2A 5DANA 2PTYA 1R7OA 1XCWA 1I6NA 2XN1A 2PGRA 4JNMA 4RL3A 2INZA 3VOIA 1WUEA 2Y2WA 4WR3A 2V3EA 2AMGA 2AQVA 1H63A 1TCDA 1FWJC 1NOFA 4JQ2A 3KL3A 4RNJA 1OT1A 3I7QA 3LS9A 1P43A 3CMFA 1JUEA 4KWWA 3WQDA 1JRCA 3UG5A 1WNOA 1V6WA 2I9UA 4US5A 3UWVA 1OFDA 4HTYA 2ZX9A 5CPOA 3AALA 4Y96A 3W22A 3T09A 4CNTA 3WDHA 3ATYA 1M01A 2YJQA 2DZXA 3R10A 2YL8A 4RDVA 1QUMA 3M1ZA 4NIRA 1XRTA 2V69A 5CG7A 4QITA 4YVPA 4C1NA 3IJ6A 3K4WA 5HNTA 5G4WA 4LNYA 3T2PA 1E1CA 4MKNA 5LNVA 1NQKA 3CL7A 1M53A 3LQLA 3KBMA 1N7KA 3SECA 5G5IA 1L9WA 3A5VA 4RCXA 5MKGA 3M5YA 3MVTA 3PWIA 1YBQB 2HK0A 3U0HA 2HNEA 3HQPA 4L7ZA 1NOUA 2ZA1A 4FK9A 3NSXA 2I1OA 2PDPA 3T0BA 2CFFA 5I77A 1V51A 3N6HA 5A6BD 1BXCA 3QFWA 4C6EA 1C9DA 2ATMA 1ZJAA 4IQJA 2FB2A 2DZSA 2DU2A 1JDEA 3VIJA 4A35A 2PP1A 2Y6ZA 3W7LA 4ATWA 2PDUA 2BDQA 4DJFC 3EOOA 3PUDA 3WLTA 2QPUA 3NQGA 4NYYA 3W1AA 4HNOA 4L61A 3WQ8A 4PRRA 2HSAA 3O6YX 4YPJA 3UZXA 5FESA 3I68A 3WDRA 3V0SA 2H8ZA 3T1GA 2DZVA 4G56A 1UD3A 4UB9A 1VIZA 3REQB 3L66A 3SRFA 2KZHA 1TO3A 4URIA 2FZNA 4GYKA 1Z42A 3GUWA 4FLOA 3W1RA 3B8IA 4J27A 3R0DA 1G7UA 4ROQA 4Z2JA 5JU6A 2HROA 5DQPA 3BLFA 1O5KA 1LT8A 3NZPA 5CJMA 3GLCA 2V5BA 1F61A 4W5ZA 2ZX6A 4LU0A 2IKHA 4N9CA 1MEIA 3ZOAA 3W2UA 3EWXA 4JTIA 4DXXA 4MAVA 1P6CA 2Z26A 3FJLA 1LWJA 3NZQA 2VOMA 4NRSA 3U48A 4REQA 2B81A 2OXNA 2ZRXA 2VX6A 2BX7A 2E6DA 1W9VA 3GNNA 1GORA 3F7JA 2CZDA 4MIMA 4AIBA 4IUGA 2BXYA 2W67A 1PZ1A 3G0UA 3QQWA 4KWSA 4WSJA 3TW6A 3I3BA 1U33A 2QIIA 3OGVA 4UOJA 1UP0A 2WXDM 2ZXDA 3UZJA 4J5NA 3DXIA 2Q3RA 2WM1A 2B7PA 4K38A 4ACYA 3KVKA 1BWVA 1RHCA 5HNUA 2OX1A 3H2FA 3UZYA 1X1ZA 2JEPA 3QSRA 3CIVA 3B0XA 3G2GA 5CZJA 3ARPA 4E4PA 1UZ1A 4PMJA 3GFXA 4U2YA 2WSPA 2WJFA 3K4AA 4S39A 4AG0A 3K4DA 3PZGA 2XM2A 3UFYA 4JD4A 3MUZ1 1FFRA 4UTIA 4WKFA 4DAIA 3VDGA 4P7RA 3TJLA 3AIQA 3BAYA 5DY2A 4DIAA 5HJLA 1FWAC 1N8WA 5CH9A 3VGBA 4AEOA 5AOUA 2QEZA 5AYXA 3EPMA 3L4WA 4UMBA 3RIKA 4NJKA 4G2DA 2ACSA 4QM1A 3W7QA 2OSWA 1OWQA 5TAOA 3S6DA 4FA3A 3W75A 3WEZA 3SCTA 4JN6A 4IP5A 3VXGA 3GBDA 4F2BA 1POJA 1VFUA 2WHKA 2WSKA 1EJTC 5M5DA 4XTDA 1O95A 1WBJA 5D9PA 5IBXC 4C6NA 5C0QA 1ZHAA 4GXPA 2J6XA 2P8CA 3MCMA 3VKBA 3OYXA 2XFFA 3AXXA 3KBSA 1XW8A 2FZMA 1W37A 4I9JA 4WKHA 4N6FA 3HMCA 3MKKA 1SO3A 3UWUA 1HJXA 5E93A 2PDFA 1TG7A 1XLLA 4WSKA 3P84A 1X98A 4GH3A 4IT1A 4XZNX 1JDAA 2BG5A 2BHUA 1P4CA 3KBNA 3THUA 4NJIA 2CETA 2OO6A 3FHAA 1S39A 2Y70A 5HDRA 4DWSB 2XISA 4FLRA 4MF4A 1AW1A 4GABA 4B3KA 2EG6A 1G94A 4CNPA 4O4WA 1B9ZA 4YN5A 1IYXA 2PLMA 2FHCA 2NUXA 2EG7A 3RGTA 1KNWA 4ML4A 3FEQA 2HTMA 3ITOA 5IM51 3VIIA 1GQLA 1EC7A 4MGGA 4PBFA 2XYLA 4AZIA 1V3IA 4IL2A 5D03A 1Q13A 4NI8A 3WLIA 4JTUA 3LRLA 2DPEA 2YBVA 3M46A 5AC5A 2PAJA 3CTLA 4U5KA 3H70A 3IJQA 3LYEA 3AS0A 1FFQA 3LXBA 3MTWA 4JFWA 5K4XA 3C6CA 2BXZA 3T07A 2OTDA 4X60A 3VIMA 4PZVA 1TZZA 5CQ1A 3HM7A 4ZZ9A 1H0IA 3IAQA 5BU9A 1UKTA 3REQA 2HVNA 2HXTA 3SY1A 4DEFA 3FFSA 1I8JA 2ZVRA 2WC7A 5F1UA 4DN1A 3N17A 4HJFA 1JJKA 2EPOA 5DT5A 3THDA 3CQIA 3AYSA 3SZ8A 2VENA 4OTKA 3VD9A 1OK4A 3NNTA 1UR1A 4MZ8A 3UW6A 3QMTA 4FMVA 3UEQA 3EA1A 2FFCA 1PIGA 3T4CA 3GR8A 3OA3A 4DF2A 1SO5A 4HYRA 4LUJA 1UD6A 3QPZA 4R33A 2XINA 3UJFA 1TMLA 2D20A 2PDIA 1QPRA 2YDRA 2DZBA 3CHVA 1DWFM 3LDVA 3EXRA 4I5UA 4AQLA 3A4AA 1HG3A 4KT2A 3ZT5A 3EMZA 3H23A 3MJYA 2E67A 4W4QA 2H3BA 4JTTA 5DXYA 4HMEA 4HPXA 1AUSL 2CZ5A 3TONA 4AFYA 2Y8VA 1AD1A 1M7PA 3O6AA 4AX6A 1JVNA 1H7PA 6A3HA 1J2WA 2PD9A 4UTUA 3STFA 3OQEA 3H4XA 2CLFA 2BVYA 3PC0A 3F4NA 1HO4A 4ORMA 5BXRA 2QV4A 3S1UA 2Z6IA 3GIQA 3VINA 3P3BA 3T2OA 1EZ2A 4IQDA 3HPFA 1XYCA 3F4DA 2EPNA 1AMKA 3BG5A 4HJWA 2V2CA 4UFKA 1TJ2A 1L0PA 3TQPA 4YMZA 2Z1WA 3K13A 4O1BA 5C7VA 2X1RA 4JAWA 4KCVA 4QDMA 4GI6A 1GKRA 3Q4DA 4HB7A 4NZ3A 3MUXA 3M47A 1QHOA 3DFNA 3WQGA 3WSUA 4OE7A 1LRNA 4HN4A 3V35A 1NARA 4TO8A 4J1OA 4Y90A 1K03A 5D38A 5C9UA 3E5PA 2GK1A 4M24A 3C2OA 4Z2HA 2QGYA 1FWDC 3BV7A 5KZ6A 5CC7A 3TOPA 1US3A 3PN8A 5BOOA 1AFSA 1ZPTA 4NXKA 4UTTA 2DZPA 3NGFA 1X6LA 3F5LA 3D5HA 3POCA 4S1FA 4S3JA 2E5DA 2GOUA 2FTPA 3EX3A 4RW3A 4ERIA 1QNVA 3AXMA 3OG2A 3TVAA 1V3MA 4HZ7A 2Y4SA 2XIMA 2JIWA 4PCSA 4GIYA 1D7KA 2GGGA 4NUWA 1E6PA 3FKKA 4ZODA 1P1XA 3HG4A 4TR9A 4CU8A 4L1GA 1JDCA 4W87A 3W7JA 3LPFA 4DWSA 4QJ5B 4DJED 1FTXA 5BOFA 3KS6A 3UJSA 4AEEA 1N82A 5A6JA 1K9TA 3GW3A 5DEZA 4GIAA 2WAGA 3GRIA 4GUHA 2GDQA 5LA1A 5C9WA 3EDKA 5MF5A 1OFEA 3FKRA 2HCVA 1XIHA 4O0QA 2A3AA 3BZJA 3C8NA 1BVNP 2WBKA 2XN2A 5EMJA 5JBDA 2C8NA 4ACZB 3AYVA 4MB4A 4UZUA 4QE5A 1DPMA 5CXPA 4ICMA 4A3UA 2J6VA 4YL2A 1BFNA 4NKCA 4QG9A 2PGWA 3CBWA 2Q02A 4TV5A 3PTDA 4GKTA 1TUXA 2FVKA 4LS1A 2FH6A 4B2DA 3F2BA 2EKGA 4GK8A 3JS3A 1T8XA 3S2JA 3LHVA 3QGAC 3DAQA 2G97A 3SIMA 4GXMA 3GHSA 1HP4A 2PGFA 3NQ8A 4UZSA 3S6OA 3URNA 3W07A 3LXAA 4GZIA 4DWDA 2JF7A 1LWHA 1CLVA 1W1ZA 4HSOA 1SU5A 3W7PA 2Z1VA 1W5OA 4F2TA 1K9EA 3KBJA 4N42A 4PA8A 3LOTA 4RPPA 4JZ5A 2BP1A 3LERA 1B2YA 5DCDA 3S6TA 4ZO7A 1DVJA 4UTWA 4XUYA 4NILA 3NPWA 4M56A 2PUZA 1EJWC 2CLEA 4QJ1A 4D8LA 3HG3A 2RDUA 3CEUA 1OFOA 1XFBA 2CEQA 4GUGA 2NQ5A 5FIPA 3QXBA 4UXDA 1I75A 2ISFA 1V6TA 4IISA 1ME7A 2E4TA 3VOGA 4JKKA 4QISA 1VLWA 3PB0A 3AC0A 4WGXA 1U5JA 1A0EA 1B57A 1UWUA 3TV8A 4MWAA 1LLWA 1VF8A 2WANA 4L4LA 1H1NA 4RV8A 2PP3A 2OKOA 3KL0A 2J79A 2VL4A 3LB0A 4AW7A 4LT9A 5HWMA 1WCGA 1UUMA 3L0GA 4NYUA 4A21A 2F6KA 4H9ZA 2H6RA 3VD7A 1FWTA 1XIBA 4KIRA 1W1PA 3O63A 2C7FA 3GO2A 3RM9A 1KKRA 4DBDA 5ABGA 2G4JA 1R2RA 2E25A 1FHDA 5HATA 5HINA 4GJIA 1C90A 1K02A 2NV9A 3N3TA 7TAAA 1J93A 2J4GA 1E70M 5CSRA 3CHFA 5CZKA 1B5TA 2X30A 1P0EA 4RZ4A 1RA0A 4M1RA 1REQB 1AZ2A 1KXTA 3KM8A 2IXVA 3UWEA 4AY1A 1X1NA 3LQGA 4KEVA 3VOCA 5GNXA 3D6NA 1R8LA 3LEPA 3YPIA 3BLEA 4XBKA 3CUHA 4BF5A 3HGSA 1VD6A 1XSKA 4B5WA 2VOTA 3GM8A 1A5BA 3QGVA 3ID7A 4XKMA 4EPDC 4K39A 1XD1A 4D6HA 1AJ2A 1JDDA 5KZDA 4C6FA 2YDSA 3MC5A 3VDHA 2INFA 3SI9A 3B8SA 3MSRA 1EDTA 3W6LA 4GVHA 3WEOA 1U2YA 2ZUSA 5F2MA 1TWSA 4YWIA 3R8GA 1HF6A 2YR1A 4XB3A 1UJQA 1KGUA 1E9LA 3CWNA 1GZ1A 3QHNA 3CL6A 3OQ8A 3LTPA 3SN0A 1ICPA 3ARUA 1K8ZA 3OVRA 3BVJA 3WMCA 4LCRA 1KFWA 1M04A 3TNBA 3SCNA 1RP9A 2PTDA 3DERA 2QAPA 5H8PA 4IJBA 2DUAA 2R91A 1IR1A 4DBWA 5LNRA 4W86A 3VM7A 3B04A 1Y65A 1CX9A 2GFTA 3SQMA 4H3DA 3GDMA 3ALGA 3NO3A 4C6JA 3QR1A 4HPGA 2WOQA 4EVZA 5JBFA 2EO7A 3L0NA 4GVIA 4B3LA 2G3MA 5F2LA 1TKKA 4LUIA 4DM1A 1N8FA 3BPWA 1KM5A 1SW7A 3S5SA 1E9IA 1E72M 2Y1HA 4UTTC 4B5VA 4GO8A 1DL3A 3TTSA 1Z41A 3KDOA 4QJ3B 4OV4A 1S1PA 3ITYA 4UR9A 1C8XA 3UR7A 2PFHA 5EFDA 4ZE5A 1R3SA 4DJDA 4HT3A 4E6MA 3VCNA 4XK2A 2BGQA 3R8RA 3ENLA 4ECLA 3PPHA 5FA5A 1JD9A 4WSHA 1VBJA 3EB4A 4CD8A 4DWSC 1G69A 1CPUA 1K3UA 1JXKA 3VIKA 1TELA 1K4HA 4XAPA 1GJUA 2ZKMX 3LHZA 3TZNA 1FWFC 4XO7A 3LSBA 5ABEA 1W8GA 5EA9A 4LYPA 5E9XA 1JQVA 1TR9A 4GZEA 4KCTA 3BC9A 3U6WA 1A4MA 1PV8A 1EPXA 3NPXA 1W1TA 1EPVA 1QNSA 1HO1A 2KAUC 3EAUA 3EWDA 2CLMA 4Q4RA 3W1PA 1QK2A 3CAVA 4RE2A 5ABFA 1R3TA 3WENA 4Y9MA 1VH7A 2YFOA 4PL2A 4PMYA 1TVNA 1R85A 2MANA 4E2DA 5I0DA 1X6NA 1XSIA 2ON3A 4H8HA 3AIRA 3PUEA 2VGGA 3M0YA 4W8AA 5B7ZA 3B0VC 1I45A 1XRFA 5A3HA 4LALA 3VD4A 3FSUA 4C6PA 2ZVIA 2JFEX 5EMKA 4BF9A 4J40A 3AJ7A 2ZX5A 3RRAA 1JR1A 5FF7A 3W37A 1NF0A 3EYPA 1JI2A 3QHMA 2G96A 3VKDA 4UTWC 4FXRA 4ZFCA 3MZ2A 3NQCA