4YTSA

Crystal structure of d-tagatose 3-epimerase c66s from pseudomonas cichorii in complex with 1-deoxy 3-keto d-galactitol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
294
structure length
294
Chain Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCSIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLAGSRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of the Pseudomonas cichorii D-tagatose 3-epimerase mutant form C66S recognizing deoxy sugars as substrates
pubmed doi rcsb
source organism Pseudomonas cichorii
molecule tags Isomerase
molecule keywords D-tagatose 3-epimerase
total genus 116
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.31: D-tagatose 3-epimerase.
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ytsA00
1XIBA 4E3VA 3BANA 4K3ZA 5AVHA 3C0LA 1DIDA 3TVAA 4ZB0A 4A8IA 2XINA 4X60A 1DXIA 2I57A 3AALA 1GW9A 3L23A 1QUMA 1XIJA 3KCLA 1XLBA 4QE1A 5EMMA 2QULA 3CQIA 5FA5A 1XISA 1XLIA 3UVAA 3AYVA 3VYLA 3KBNA 5XIMA 4PGLA 8XIMA 3ITLA 3N4AA 3VNJA 1XYCA 3CQHA 3M0LA 1D8WA 3P6LA 5AVNA 1XIEA 4XKMA 3AYTA 4PFHA 3KBMA 3IUHA 3WQOA 1XLAA 2ZDSA 4XSMA 1MNZA 6XIAA 2NQJA 2HK0A 1XP3A 5XINA 3P14A 3XISA 3DBNA 9XIMA 5J8LA 4KW2A 3ITTA 3XINA 4G56A 4A8NA 4YTTA 4HGXA 4W4QA 1XLFA 2QW5A 3M0VA 4GQBA 3TC3A 3BZJA 1XIHA 3NGFA 1DIEA 3M0XA 4XISA 3LMZA 2HCVA 1DE5A 1I6NA 1XINA 2OU4A 3CQKA 4OVXA 3VNMA 2G0WA 2XISA 3QC0A 3KCOA 3KCJA 3QZAA 2NQHA 1XLGA 1XLKA 3KWSA 4EAYA 4QDPA 9XIAA 2QUMA 4ZB2A 4YTSA 2X7VA 2XIMA 1XLCA 4K1GA 1XYMA 5EMLA 3KBVA 3U0HA 2GLKA 3KBWA 1DE6A 4ZB5A 2Q02A 4QEHA 2GUBA 1XIMA 1CLKA 5H1WA 3KBSA 3QXBA 3UXIA 1XIGA 5EMKA 3U3HA 1S5NA 3OBEA 2NQ9A 3ITYA 3KTCA 3AAMA 4A8RA 1XYAA 5TNVA 1XICA 3IUIA 3BDKA 1MUWA 4GLEA 1O1HA 4YTQA 4YTRA 7XIMA 5I7GA 4A8LA 2GYIA 5B80A 3C0QA 6XIMA 4X61A 3DX5A 3ITVA 4HHMA 3ITXA 5EMJA 1XLHA 4X63A 3BWWA 3C0SA 8XIAA 1BXBA 1XLEA 1YX1A 4HNOA 3CWHA 3FVMA 2G4JA 3IUDA 3CQJA 1XLLA 4US6A 3BZGA 4Q7IA 4LNCA 1XYLA 1S5MA 1XLMA 4QE4A 2GVEA 3XIMA 4EACA 3VNKA 1K77A 1XIIA 4XIMA 1QTWA 1A0CA 3UA4A 1TZ9A 3M0YA 5B7YA 3M0MA 4DUOA 2ZVRA 3JU2A 3QYSA 2QUNA 5C9ZA 1QT1A 3UA3A 2HK1A 1BXCA 2I56A 4XIAA 4GJJA 1XIFA 2J6VA 3KBJA 4QDWA 1XIDA 4YTUA 1I60A 1A0EA 2X7WA 3ITOA 4QEEA 1A0DA 4GJIA 5B7ZA 4XSLA 5XIAA 1XYBA 3GNXA 1XLJA 1OADA 3VNLA 5H6HA 4ZBCA 4J4KA 4DVOA 4HHLA 4QE5A 3VNIA 3UU0A 3CNYA 1XLDA 3M0HA
chains in the Genus database with same CATH superfamily
1D9EA 1YE4A 3WK0A 2VEGA 3H7RA 5DCBA 1FWGC 1E9IA 2G96A 4PMUA 1XD1A 4HJWA 2QF7A 5LXXA 1E55A 2G97A 3R58A 1R3VA 3I3DA 3PZVA 2OO0A 2WK2A 3E02A 4E6MA 2FVLA 3W2NA 5LGXA 2G50A 3BW4A 3WLNA 1YBQB 3KL3A 3WK3A 4RLIA 4J3ZA 2B7OA 2YB1A 4EIVA 4LVGA 4PMVA 3GU1A 4FOKA 3CWNA 3A4WA 2IPFA 3NR0A 4HMDA 5CLTA 2OWCA 1XJBA 1CXKA 1TPUA 4H9TA 3GLCA 3TH6A 1WDSA 1DJZA 4Y9OA 1AD1A 1CLXA 4BF7A 1QAPA 2ZA2A 4UUIA 4CN4A 4XZNX 3RR1A 1EF2A 3GUWA 1SSDA 1G1YA 1AODA 4ZQNA 3LG3A 4QXIA 1ME9A 3DC0A 4CCDA 1N82A 2ZVRA 5K4ZA 5HWNA 3RRXA 2VENA 4FALA 1W32A 1JZ4A 2CETA 3HGOA 2INZA 3P74A 4GJIA 5D9PA 4Q6XA 4QISA 1Z7AA 3LHUA 4WUIA 3EDDA 4HPJA 1H09A 1XIJA 4D2JA 4DPPA 3USBA 1S38A 4QTGA 3EX4A 3VVGA 1FKWA 3MS8A 2EG6A 2GSEA 2VGIA 2CFFA 1F8MA 3OHMB 3NSMA 5GQBA 5IDZA 1TIWA 1XGZA 1Q4WA 4OVXA 3ORWA 3T55A 3D5HA 1GJWA 5AKQA 1HJWA 1L0PA 3GFZA 3BJTA 1RP8A 1LUCA 3R11A 1ZRQA 2DZXA 4GGHA 1OWQA 5I6SA 4NX5A 7CGTA 3RX2A 3WFZA 3IGUA 5EMKA 3H2CA 5EU9A 3KTCA 3RRAA 3WLSA 3W6LA 3A3XA 3KOZA 3AWNA 1P7TA 1XLHA 2WSRA 2OEJA 3L5AA 4UR9A 3W0KA 1Y65A 1TWSA 3ZR6A 4NRRA 1POJA 4KGJA 5A5WA 1Q8JA 1GPWA 1JZ7A 2PTYA 4ZO6A 1GVIA 3V35A 3BCDA 1H41A 5BWAA 3V5CA 3MBDA 1F6YA 3L66A 1W3JA 1GWJA 2P3EA 1W3KA 3LPPA 1F9CA 4ZBCA 1XCWA 1UKOA 3KVJA 1HT6A 3TW9A 3WDRA 2OQYA 4AY8A 2NQZA 3W82A 3AALA 4UCFA 4TOQA 2PB1A 1Q7ZA 4ES4A 2JE8A 1UP2A 3Q4DA 1UWAA 4PC8A 2FKPA 3AYTA 3PJUA 3WK1A 4C1NB 2J7DA 2OT0A 4K36A 5DMMA 3DBNA 1UJQA 3AIEA 2YSWA 1OJXA 1O5QA 4A35A 1CGYA 4GO8A 4KESA 1A47A 2I5GA 4PUEA 4LYRA 1OM0A 3LMYA 3SFKA 3EYPA 3QHNA 4K8EA 5DT5A 2VWTA 4F0MA 4JTCA 1YLVA 3TZFA 4Q8TA 4CCEA 3QOKA 5HR6A 4MMWA 2PDUA 3PBMA 3VIHA 2DW6A 3ZMRA 4A6GA 4PCTA 1LT8A 1XSJA 1YX1A 2A7RA 2RDUA 4AF0A 3W85A 2NV2A 2G5WA 3HQNA 4O1FA 4UCGA 4M81A 4P8WA 1GKQA 1QT1A 3HGSA 2GWGA 1B5TA 5CPLA 1T5AA 2VEKA 2QCDA 3TQVA 1FWDC 1H49A 1VIZA 2ISVA 3NPVA 2EPLX 4KETA 2PDIA 4Q33A 3M6DA 3K4DA 3SQLA 2H9AA 2VX5A 2G95A 3GDMA 4GIEA 4CQBA 2HMCA 3DFQA 3SURA 3VA8A 4GPNA 3TROA 3UZ5A 3LENA 4UTLA 1F3EA 1WX0A 3C2VA 2Z29A 1X8CA 5EGRA 1GOWA 2PBOA 2D3LA 5AC4A 4GFSA 3B3DA 4IICA 3WQ6A 1V6XA 1HQTA 2ZUNA 3PF3A 1KR0A 1E73M 2RDTA 4GUGA 4XTDA 2C91A 2PAJA 4FOJA 4OOUA 3AMLA 4KPLA 4DI9A 3G0SA 3PTKA 1UYQA 1A5MC 1OGBA 2REQA 3S46A 2FDMA 1TPEA 3JS3A 4IMAA 3REQB 1NTHA 4GOAA 3C0QA 3GFYA 1I0BA 4X3ZA 3VNYA 1B3YA 1BKHA 4QM1A 3MSYA 3BOFA 1UBPC 1F76A 2DIJA 3FA3A 2VEFA 3MHFA 4S3KA 1DWIM 3E0FA 3RCYA 3EDFA 4XZHA 5H91A 5BXTA 1F6KA 4O8AA 4Z2KA 3KUMA 4Z17A 3KBJA 1UD4A 2XM2A 4Z1CA 3IPWA 1E40A 4J9JA 4C6PA 2BXYA 1VPXA 4DVOA 3OLDA 2WKLA 3OU8A 3LCFA 4ONVA 3WL0A 2C13A 3L0KA 4DF2A 2ZX8A 2XIIA 4E0CA 3WUGA 5FSDC 1S1RA 1UP0A 3S5ZA 3SCPA 3RX4A 1QI5A 1XL9A 3P3BA 2P3ZA 1KM3A 3GH5A 3ENLA 4NZ5A 5LHFA 1GVOA 4J27A 4PBGA 5U4NA 2BP1A 4Q8PA 6XIAA 5XINA 2A3BA 1L8PA 1V3MA 2PDHA 2PS2A 4PODA 1HKJA 4WK9A 2JBMA 2WLZA 1J10A 1PWMA 3VNMA 1T41A 3WH5A 3CPUA 4WJXA 2OKOA 3KCOA 4AWUA 4JQ2A 1EJVC 3GTNA 1NJJA 4GKTA 3VKAA 4L1GA 4HNTA 2VZOA 4F8XA 3TW6A 1VYPX 3FYPA 3N4EA 3R7MA 4UFIA 3I4KA 2E6FA 4E3TA 1LJYA 5T26A 1WA3A 3VM5A 4IIEA 3L7RA 3ZT5A 4Q32A 4HZ8A 2E5BA 3SGUA 4AF0B 1I0DA 2ABBA 5KZEA 2O9OA 3BW3A 1B2YA 2ODOA 3MI3A 5HUPA 2J74A 4NYUA 3M7WA 4H6EA 4QQUA 4D6HA 3UY8A 4PMXA 3RGTA 4J4KA 1W3TA 3CNYA 2Z1SA 4ICCX 4AMAA 4AZCB 2P0OA 1WYIA 2YA2A 4NAEB 3DXIA 2FTPA 1P4CA 1TELA 3H54A 4OIFA 3N4AA 1YTKA 3GYEA 5HNNA 4B9YA 3GBDA 3BJFA 1TFVA 4UOJA 3W7CA 4I7UA 3UG4A 2VP8A 3VOJA 2YZ5A 1TR9A 4ZOEA 2DSUA 4JICA 3UZJA 3ZFHA 2F7FA 1J5TA 1I8JA 3UZYA 2XIMA 2QDHA 3KVMA 3L65A 4GBUA 3NQ2A 3QFWA 3EOLA 1T40A 4OBTA 1EUAA 4KFNA 3GXMA 2WNWA 2V82A 1TG7A 3ITXA 3E2SA 1JGMA 1UMLA 2Y24A 2DGAA 3PUDA 1P6BA 2YX0A 2OCZA 3CGTA 4ZVJA 3T9PA 4LUTA 3ABRA 3O0FA 3QR0A 1CB7B 2WJZA 1W1A1 4PMNA 3UD6A 5HJYA 1GG1A 4MFEA 3M1ZA 4S3AA 3S8HA 3C2OA 4U28A 1NEYA 3ITOA 1WAUA 3F5JA 4FOUA 1E4MM 3K13A 5D03A 4HKPA 3BSHA 1PJ9A 4B9ZA 3NO3A 1KFKA 1NDZA 3B4UA 4UQDA 4MUZA 4ZSUA 2P53A 2VGBA 3ZJ8A 3VD9A 1WKEA 1G7VA 4HQVA 3TQKA 4ROQA 3L67A 4HNUA 3RMJA 5M03A 2FJKA 3SW6A 3NUKA 4MWAA 1UWTA 4MVAA 1FHLA 2Q01A 1XI3A 3OVQA 2DVTA 1AL7A 4OT7A 2GOUA 4JTDA 4XD4A 4DXXA 3BL3A 2DSWA 2C1GA 2J6XA 4ZQMA 3RM8A 3H26A 1CLVA 4XISA 1XC4A 1VLIA 5BZAA 3FXYA 5MKGB 1XS2A 2GOKA 5D32A 4JTLA 4AHQA 3AWOA 2X1TA 2J9XA 2QIIA 1OK4A 3WX7A 1MEWA 4ZB5A 1EJSC 3WBAA 3N11A 2E6DA 5H1WA 4GA8A 2TPSA 4ZMGA 1Z42A 2I1OA 4DWSA 1Q63A 1T8XA 2BDQA 2DUZA 3AJ7A 3ZS4A 3AI0A 3WN6A 3FSUA 1JZ2A 2ZIDA 1LYXA 2WVUA 1FXPA 2ZBTA 1FH9A 1U1JA 1DWFM 1XKYA 4DAFA 1XYLA 2DJLA 2UY3A 4JYFA 4TIMA 3W7HA 3THQA 3VMOA 3ABQA 3L4YA 4QDWA 1W1TA 3EB2A 4IP5A 5A6LA 1D7KA 3HTWA 1G94A 3BV7A 4IGSA 4NILA 4WXYA 4NVTA 1HP4A 3RFAA 4G6CA 1V5XA 2KAUC 1XFCA 3A4AA 4IG2B 3BGAA 1GORA 3G1VA 4GI8A 4I8DA 3ITLA 1DP0A 2J8TA 2WMJA 3W7IA 2DT1A 4PFHA 3JRKA 2PGEA 3EDEA 3B4YA 4QJ4B 3L68A 1HGYA 3TMQA 3E3HA 3PY2A 4HGXA 3OP2A 4S39A 4Y8EA 2P10A 3OGRA 2ACRA 4F0LA 1A5CA 3LCWA 1A49A 4QSFA 3TSMA 1K7EA 1CBGA 4JYEA 3ZSTA 2Q8LA 4N42A 3W2MA 5EYWA 3WMLA 2FGBA 5FKYA 5DXYA 2BGNE 1KA9F 1JF5A 3EEZA 7REQB 1ONEA 1JFXA 4I7WA 3QTGA 2H9AB 1ZENA 1YHTA 3OGSA 1BGAA 3CEPA 4AYSA 1C92A 1ZAHA 1E0UA 1B90A 1AQHA 2YYTA 3W74A 4BA0A 2FHFA 4BFAA 2R82A 1Z48A 3VGHA 1LG1A 3PB2A 1DQUA 1FFRA 3UZZA 4O11A 5C7VA 1B1YA 4JGDA 3SN0A 1FWWA 3W1LA 3EMZA 4HOZA 3CB8A 1AW5A 1HZYA 3H8AA 4YLWA 4H7CA 1HKMA 1GHRA 4ICMA 1QUMA 4LAZA 3ZR4A 1WP6A 4C1LA 4LNYA 1DORA 1GZGA 2IQDA 3DOPA 2WV8A 3ABSA 2QIWA 1BGGA 3Q67A 3BV4A 4PRWA 3IUHA 1XH0A 2PBGA 2VFGA 3U9IA 3V0TA 1W9VA 1L2QA 2W61A 2NT0A 2WMIB 1KXQA 2X1UA 1MVYA 1R9XA 4TU1A 5HA7A 2CLOA 2WMIA 1YMYA 4FNQA 4BJHA 3ID7A 4GWEA 5A6BD 3IIPA 1KV8A 3W1RA 3FS2A 4WY0A 1TZ7A 2VWSA 2X1SA 4F0KA 4UWMA 3HGRA 3WF3A 4LX4A 4GCXA 1C9DA 4UQCA 3LK6A 1QNOA 4AUBA 4I9AA 1BD0A 4DJDD 2FYMA 4YL2A 2ONEA 2Z4GA 2V5JA 3TN3A 1YW1A 3KHDA 3EPNA 3MA8A 1HL9A 1FKXA 1TA3B 3LTSA 1W2PA 1TTJA 3DYOA 1JYWA 1EFZA 2J66A 3PAOA 2FTWA 4LWWA 3TC7A 2E09A 4Q7BA 3STEA 2AMGA 4UTIA 2DUXA 3W81A 1OCQA 2V5DA 3C8FA 3TIMA 4LV9A 1DIDA 1T7LA 3S5NA 2W6RA 3NVDA 4ZEPA 5CJ5A 4GFIA 4N6FA 4TVDA 1N8IA 3O8AA 3G1FA 3MMTA 1UUMA 2D3NA 1BRLB 3BSMA 2C1IA 5XIMA 4B4FA 3M5XA 3B9NA 4IL2A 2EKCA 1OYBA 3KLLA 2Z7KA 4LS1A 5T8GA 2Z24A 4Q4QA 1PTGA 1RCOB 1QHPA 3ZT6A 2BFGA 2OYLA 1QOXA 3MWAA 1LQ2A 3ZLGA 4V27A 2BG5A 2XIJA 2AL2A 3CUIA 1H7PA 3LCLA 1LOLA 4DBWA 3F4WA 4JN7A 4GVHA 2XISA 3SQMA 4LT9A 4HN8A 4HMNA 3O05A 1VJIA 4CN1A 4J3VA 4RXFA 1VHCA 3RF9A 1ISVA 5FESA 3NM1A 4GK8A 1UROA 1XYAA 2EPOA 4GUFA 4H6RA 2VEPA 5K2ZA 3MP4A 1UD8A 2JK2A 3L2LA 3S1UA 3B03A 3F4VA 3ALGA 3R8GA 3CO8A 2F9RA 3RU6A 1RALA 1BLIA 4ERGA 1UB3A 5LIWX 1NDYA 1A5UA 2ZFAA 5H8UA 4IL0A 4YCPA 3A4JA 4N9BA 4GG9A 1PCWA 4DBDA 3B8SA 4L5ZA 1KNWA 1Y0EA 4JIQA 3IJ9A 2EF9A 4R9OA 4D6GA 4F9JA 4TV6A 3PANA 4CQCA 3FDGA 3B97A 5CGQA 4KCWA 2Y70A 4D1IA 4R88A 1B57A 1NP0A 3RG6A 3I68A 3DG6A 3PG8A 4QQ3A 3C61A 3WLLA 2Z2UA 1FWFC 2WXDM 3PZUA 1I1XA 4IPJA 3TTOA 1R7AA 4DQWA 4J3XA 1KGWA 4ZQPA 3O9NA 3H2MA 1S1PA 4DJED 5G4EA 3U2EA 2YBVA 2CLKA 2BX7A 1KM0A 3W6YA 2OZ0A 1DIEA 1TQJA 2D20A 3UJSA 4C6OA 3T8QA 3LHZA 3U48A 1V79A 1ZP3A 3WMCA 3LZ5A 5AN7A 4B3LA 3MMDA 1E6RA 1WQ5A 2R6OA 2Y7EA 2EEXA 1WDPA 1H3GA 3AS1A 3TYDA 4IFKB 4W7WA 1J96A 2E1DA 4C6CA 1EYWA 4IQLA 1HNYA 2YL9A 3BLEA 4Q7IA 1W1B1 1JZ3A 5DFAA 3TONA 4V33A 4D8AA 1Q6DA 4MJZA 4ZZ9A 4FNPA 1PKNA 1JJKA 1ZBKA 3BLKA 1HKWA 2ZQ0A 1A0EA 3ARPA 1G5AA 1AJZA 1K6AA 2PDYA 3LPFA 2PRLA 4NIRA 2HPIA 4XAYA 3ZJKA 4O52A 1JEZA 1SMDA 3UU0A 1E0VA 1SFJA 2PTXA 2E25A 1BF2A 4K6AA 1IEQA 5FAJA 4AISA 2PU1A 3E96A 1LF1A 4JQ3A 3LYEA 2WVSA 3FJNA 3GDLA 2VR4A 2CNCA 3W4RA 3T0AA 5HMEA 3OEXA 5G2HA 4ERIA 5IDIA 3QOMA 2BVWA 1C8XA 3URBA 2BASA 4DEFA 1LBFA 1CGUA 2CU0A 2GVGA 3NZPA 3R8RA 1DE5A 3WD4A 3QKZA 3RO6A 1JDAA 4B5TA 3U2ZA 1W9PA 4K1WA 4YPJA 5EMLA 4AVFA 5EY5A 1U5HA 2NVCA 4KKXA 4WJEA 2OXNA 1QW7A 5CAHA 3FHQA 1IIGA 5GNXA 2YDQA 5I79A 2J77A 3U57A 1EP3A 3L12A 3MSGA 1U2YA 5DQPA 2FFCA 4C7FA 1LLZA 4ZGYA 1L6YA 3UGVA 5F2IA 3TN5A 1UZ4A 2R1LA 3VAVA 4N2YA 1JD7A 3O07A 4GUHA 4IX0A 2BY1A 1R3TA 1K8YA 4F66A 1UJPA 2CLIA 3UY7A 3GRIA 1CENA 3GU9A 3VDAA 2QUTA 5EBAA 5A6BA 4BQ2A 2PGRA 1QHOA 4ML9A 2WMGA 1DJGA 3E38A 3LOTA 3EBVA 1JIBA 2YDSA 2WHMA 4UTWA 4D6CA 4JD4A 4ZENA 3GUGA 4IWWA 5EMMA 2WSYA 2YYUA 3UVAA 1JUBA 1PAMA 2JF6A 4JIRA 1PZ1A 3P6LA 2P5NA 5BW6A 3LGDA 4P7OA 3RN6A 4O28A 4KMQA 1XLAA 3P5ZA 1A3WA 1ZCCA 5DF0A 1Q3NA 3WJZA 2QF8A 5I3JA 3O0KA 2YCLA 1W9DM 3M0VA 2PD9A 2NUXA 4QIUA 4LALA 1Z69A 3HPXA 2WAGA 1TSIA 2HROA 4TXEA 2ZZ2A 4DLFA 2GLKA 2UZ9A 4C6JA 4CD6A 1HTIA 2QCCA 2YFNA 4WY0B 1PZ3A 2PLKA 3MI6A 3SR7A 1YKWA 4AXKA 5JBDA 3MB9A 4O0KA 4IMFA 5E0FA 4AW7A 1XX1A 2OO6A 3WH6A 5A8QA 1DIKA 2QUNA 4QP0A 2FPVA 3VXGA 1HG3A 3VDCA 3KW3A 4JN8A 2EPNA 1HX0A 4FX8A 1B3OA 3P67A 1D2KA 4XZBA 5M1TA 5FA5A 2Y8KA 1AUSL 1IEXA 4INFA 1S5TA 1SZNA 4IP7A 4CD7A 2WNZA 1GQLA 1QK0A 3FHAA 5D2YA 3M7SA 1E3ZA 4XKMA 4BHYA 1VEMA 4UMAA 1DWGM 2Q3OA 3LCXA 3NQ6A 2RKXA 4AX6A 1SO6A 3WJYA 1ITXA 3TX9A 1F61A 4KFPA 3NO1A 4V15A 3DKLA 1IZCA 2FTYA 1Q7QA 3DYPA 4FR1A 1K03A 3UXDA 1ELSA 2OKTA 1C29A 4H8HA 3P82A 2QGYA 3N2BA 2ASHA 3CZ8A 1GEQA 2A7PA 4EXQA 2OWXA 1KD0A 2FPYA 1E72M 3PJWA 4M29A 1XICA 2WOQA 3QPYA 4D6FA 3GK0A 2BVTA 3S83A 2YFOA 3R6IA 4GNKB 2DV0A 4HA1A 3KOYA 3MANA 4GYKA 3W7RA 2X1RA 4LV4A 3GC2A 5AHFA 4H01A 4OECA 3V1HA 3V75A 5CBIA 1UZDA 1YTEA 1KQYA 1WXZA 2IS7A 3UCQA 1BQGA 3G1XA 5EPDA 4HJFA 4UC5A 1I60A 4FI4A 2QPUA 4W8AA 1OT2A 3I7QA 1U83A 2VFEA 3QN3A 1NFGA 3HJZA 1R3QA 5LHEA 3MO4A 4FXSA 1PHQA 1VEPA 5HQLA 1OT1A 4KIRA 4IXHA 1IEVA 3RMEA 4DUXA 2C71A 5I09A 1PKLA 1A53A 4V2XA 4MWAD 3ARWA 4OJYA 1J12A 4FXFA 2ZOXA 3TC6A 3LLXA 5D05A 3KBMA 1V7YA 2Z1WA 2E6YA 3U6WA 3WQOA 1R0MA 3W7DA 3A64A 3H23A 1PS9A 3WUFA 4UTTA 4DF0A 2PU0A 4Z1DA 2B4GA 3I7SA 3LMZA 1IZJA 4IMGA 1EDQA 5EKYA 1CYGA 1OYAA 3GW3A 2YA1A 3TUUA 4GC3A 3VI2A 4DI8A 4PFMA 1OC6A 2BB0A 5G4HC 3E0VA 4AEOA 5BYWA 3WQFA 1WDWA 1CLKA 1HVQA 3CM4A 2RJHA 4O57A 1XDJA 2E7FA 4CGTA 4TO8A 1GVFA 4RUBA 4AD0A 1QFEA 1QPKA 3W2LA 4JTHA 3E2VA 3U5UA 1SGJA 3MUXA 1B3WA 3R0DA 5HPCA 4CD5A 2PTDA 4PUUA 3H2EA 3BUVA 1PSCA 4W7UA 3QBUA 1P48A 5BCAA 1ISZA 4AIUA 2H3BA 4DUVA 3C0JA 3VOCA 2B0MA 1TPB1 2BY2A 3NTYA 3U4AA 4BI6A 2CLFA 5DBTA 2QJMA 2QCGA 1RCQA 2E68A 2EG8A 1YNQA 1YXCA 4U4MA 3BG9A 4C1KA 1T99A 1SPQA 2V5LA 1YBQA 3MPGA 2CLPA 2HBXA 5BXPA 2VFIA 1XPGA 4YCOA 1FWNA 2G41A 2WC3A 2QCMA 3R10A 1HL8A 1QI3A 1XRTA 3SY1A 4XUYA 3ITCA 1BYAA 1FWIC 1SO4A 3ELFA 1PX3A 2B7QA 5JIPA 2GVLA 1XR2A 3KCJA 1QNPA 3M6YA 3SCWA 1IEIA 1LL6A 1QPRA 2YBTA 3TR2A 2DDXA 3VKCA 5CC6A 4N9CA 3PBGA 4AD2A 4Z2GA 3UYIA 4XZIA 2R1KA 5D04C 5J04A 3TYZA 3O16A 5M3WA 5GVJA 2O56A 3B0PA 4PUJA 4HN4A 4S3FA 1RP9A 2Y85A 4Y96A 3QM3A 3F03K 5K3VA 1VAHA 3PTQA 1MDLA 3A5FA 1A0CA 1QO5A 5L6UA 2QCDB 4S38A 4DJFD 3M41A 1YEYA 2A3HA 2Y7DA 3GKAA 4NUWA 5I23A 1VR6A 2WCSA 3B8DA 3N9RA 4IG2A 3OZPA 2X41A 4J5NA 3V0UA 4DJFA 2Q6ZA 5A94A 5C70A 2J47A 1MFUA 1ZCOA 2B81A 3E1F1 4IMEA 3QW4B 5H8PA 1G69A 4L1XA 3OGVA 4O14A 1XLBA 1OGSA 3QMRA 4Z2JA 1VHNA 1LROA 3STPA 3Q37A 3PN8A 2YOCA 2V6AA 3TTSA 4U2YA 5LNVA 1VIWA 3IGHX 2NSOA 4LUSB 3AXXA 1XP3A 4QG8A 5FI8A 4GY7A 1QR7A 3OW1A 1NARA 3IIVA 5D2XA 4JQAA 3VIJA 5CQ1A 2V5CA 3W9ZA 2VM8A 1E6SM 5D38A 1SO5A 4XD3A 3W2JA 3AHXA 1TMQA 3F7JA 1M04A 3RILA 3UJRA 4LQ1A 3H4GA 1Q6CA 5I3KA 4UOQA 4Z0SA 3N73A 1C7SA 2J7GA 3OQEA 5D9MA 4YS1A 3RITA 5BXRA 1H1NA 1H51A 1JYVA 3ZVHA 4AD4A 4QJ5B 3W7KA 3TYCA 5DMLA 1EIXA 1ZAJA 1BQCA 3BOLA 4IMCA 3N9KA 4MB4A 2GQ3A 2X2GA 3LS9A 5LNUA 3L4WA 4BZYA 3R0KA 1IWBA 2W0UA 1EP2A 2WVTA 1PX4A 1F4HA 3AMDA 4FF7A 1JF6A 2DZWA 2INEA 3NL5A 5FD0A 4RDWA 4KWSA 2WWCA 3RR4A 3CUFA 1RA5A 3L23A 1V3HA 1H0IA 4PCNA 4LVAA 2OLHA 3WCZA 1JDDA 4G1NA 3RPTA 3CB3A 4Y9AA 2DQWA 1L6FA 4MNMA 2WM1A 4GXMA 3OLIA 1KM1A 1W9XA 5AFDA 4LUSA 3WNPA 3LD5A 1EIBA 1M7XA 2VX4A 3KTSA 5IFTA 2WBGA 3CQKA 3S0CA 1W1IE 1PL9A 3QGKC 2OWWA 3HBLA 1XCXA 5BMXA 3MV01 1A50A 2XN1A 3W1AA 3EWWA 3VMNA 1CX9A 2UWFA 4AXNA 2REQB 5GJPA 1JVNA 5DN1A 4QSHA 4EPKA 2I14A 3S6TA 1Y5XA 4LY4A 3W72A 1N8FA 3QPZA 2O7SA 2ISWA 2FHCA 1T6MA 2HBVA 5HQMA 1HJSA 1K4GA 4AY7A 4XBJA 4PTXA 4S3JA 1FXQA 5FCZA 3SBFA 2VQUA 3OBKA 1A5LC 4L6OA 1QTWA 4DNMA 3LTYA 3RM4A 4ASTA 4H41A 1CPUA 7REQA 4PCPA 1H1YA 2BHUA 2JKPA 4NZ1A 3UR2A 4EK7A 4PB4A 1EC8A 3GNXA 3MKKA 4FNRA 1SZFA 3P84A 2OEMA 3NZQA 1PTAA 1UPMB 1EDTA 2Z27A 3AYRA 1SMAA 3I6TA 2PE4A 3GE7A 4LEFA 5A69A 3WUEA 1D8WA 2IMRA 2ACSA 1D7FA 1QOQA 2VRQA 2V2CA 1TPC1 4AZIA 1CGXA 2QZRA 4EPBC 2R1PA 1V93A 2E4TA 4O1EA 4D8LA 1M7JA 4JTEA 1P1XA 3LSCA 1V6UA 3UWVA 3W76A 4DBEA 3ZT7A 4CNNA 1M41A 2I5QA 3EDJA 1DJYA 2ZC8A 1TJ0A 2E77A 3C6CA 4XKYB 3FDKA 4EPEC 1REQA 2OYKA 1C91A 4JEQA 1YPIA 2CHOA 3GWQA 4C6FA 1KRBC 1XXXA 3QZ6A 3SCQA 4UR8A 1CECA 1J2WA 3QHMA 4CCZA 4F2TA 3CU2A 4HU0A 4XAGA 1VFMA 5I7GA 2NX1A 3MW7A 4PMJA 3B9DA 5JQ9A 3KOXA 2W63A 4HNOA 2E9LA 4F2UA 3KHJA 3QMTA 3W28A 3CQJA 3URQA 4IPNB 1O1ZA 1GHSA 3KWXA 3ZJ6A 3NGJA 1VZWA 3C2FA 4XO7A 4LCSA 1HJUA 2WO5A 1J5SA 1DJWA 3PBVA 3DBPA 5AZ1A 2XGBA 3O6AA 2FZDA 1I2OA 3E0LA 4YN5A 3C86A 3CZEA 3GXIA 3NQDA 4JS3A 1BTCA 4GQRA 3E0IA 1B3ZA 4FEZA 1ZJBA 3AXHA 2ZX7A 3W1MA 4AWEA 3AYVA 3VYLA 2ZXDA 1EJUC 3DFHA 4LANA 4B16A 1ISYA 2QCFA 3ABOA 3VNJA 3G77A 3SEPA 1R9YA 2NQJA 2R8WA 4BQ3A 4LBSA 4RCXA 3E6EA 3EMCA 3NDOA 4O1CA 1QPOA 3SADA 4RPPA 5G1MA 1L6SA 4I8YA 1H7OA 3CUJA 4TX6A 5I03A 2G3NA 3NEVA 4YHGA 1P6WA 2J27A 1TIMA 2ZYFA 1JNEA 3BLDA 3W1UA 4FXJA 5HULA 4JFVA 3PPGA 3S5OA 3MUAA 3WQ8A 1OZMA 3NIYA 2GYIA 3ARZA 1TJ1A 1H63A 1AMKA 1MW2A 1EJWC 2VCCA 2G37A 1S2CA 1GVRA 1Q6EA 2Z25A 3V5OA 4PCSA 2GQ8A 4M0XA 3OZOA 4LVDA 1DJQA 1QATA 1U30A 4CU7A 3GG8A 3SN4A 1OY0A 2QJIA 3ATYA 4RZ4A 1RUSA 4B5SA 1WXYA 3OZMA 5F2MA 3OVGA 3V18A 3AO0A 1S3HA 3IS4A 3NL6A 3UXKA 4B5VA 3CMGA 4OHQA 2AQVA 1DXIA 4DUWA 5JU6A 2Y7GA 3HG4A 4QE1A 1J18A 3FYYA 3P81A 3GZAA 3HB9A 3PPHA 1RK6A 3CZGA 1EBGA 2W62A 2QPXA 3NPUA 4AVOA 2ZRUA 1QHZA 4UQBA 4R7JA 4B3KA 5TQLA 3B0XA 3TYAA 3LPOA 4PMQA 2IXUA 3BCJA 1OZQA 3PG9A 4HK6A 1E9ZB 1Q4NX 1EHNA 2WVVA 2D2OA 1UR1A 1VC4A 5AHNA 3FJ4A 4HSNA 4M1RA 2XFFA 1WO2A 4MY9A 2ISFA 4A3QA 5I24A 4GABA 4NY2A 4N4PA 4QNEA 4I90A 3I10A 4ORMA 4K1GA 4LH8A 2DZUA 3LDVA 1VS1A 1ME7A 3H2FA 2ZZ3A 4Z42C 1TQXA 1H4PA 4EAMA 4I3GA 3SSJA 1PE1A 4GNJA 3TCEA 1PYMA 4HHPA 3I65A 3NA8A 4US6A 4ROPA 2CKSA 1OX6A 4B4HA 2ZRWA 1XIIA 1XBYA 3CIVA 2DSZA 2GSHA 1F7BA 3P7YA 2PZ0A 3OVRA 2C18A 3QSTA 3R1ZA 3CT7A 1MRAA 3CASA 2TAAA 5AC7A 3NQBA 2F6XA 1AZ1A 2W5FA 1LRTA 2C7FA 4GHRA 1J4EA 5GNYA 5HDRA 2NQ5A 4O17A 3N34A 3UEQA 3V3WA 1AH4A 4B5NA 3OIHA 3MZNA 4NP7A 4XKYA 3UBPC 5HQEA 3ISIX 4NSBA 4XUGA 4BKNA 5LNSA 2DT3A 3CHEA 2PEVA 5AVNA 1QJWA 1X97A 5DMNA 3FGCA 2GGEA 3BJSA 4I6VA 1ECQA 2WYSA 3UERA 5LSMA 4O16A 3EA1A 3DESA 3HPSA 4U5IA 4ADTA 1FQ0A 4IQJA 2PI6A 3QLDA 1JZ5A 1BWKA 4I5XA 4KWVA 2DW7A 3FY1A 4BEQA 2R9RA 4LY8A 3B8IA 2ZE3A 1MI3A 3LI1A 5JIWA 2GGIA 1JFHA 3UVIA 2CZDA 3B8UA 5ABFA 3TP4A 3TKFA 1RD5A 1UD3A 3AIQA 3AXMA 1OEPA 5K9CA 4HVXA 3HG2A 3MZ2A 1XDMA 5KZMA 1SQ7A 1GYLA 1QI2A 1X7FA 2Q09A 4LUYA 2FZ9A 3G8EA 3SCUA 3V4BA 2ZDRA 1KR1A 1FWBC 1ZALA 4GKLA 5HINA 3HF3A 4IIDA 3KRBA 3IUDA 3DUGA 1VRDA 4BI5A 4HP5A 3XIMA 3LRKA 4M6UA 3NDZA 2WSKA 3S2JA 3UWEA 1H60A 3TTQA 1DXEA 3SN1A 4W5ZA 3CIXA 3ATZA 4QX4A 3R2GA 5DCEA 2X1IA 3MUIA 3A4XA 2X7WA 5BRPA 4O12A 3SUVA 2E28A 2J7HA 1BSIA 4GVIA 1MUMA 2I57A 3GTHA 1FWHC 3G18A 1O5KA 3VD7A 4CN6A 2VKZG 2YL6A 3LM7A 1IR2A 3NYDA 4F0HA 2I9EA 1XG3A 1JZ6A 4JKMA 2B7PA 1EPVA 4QS5A 3KVLA 2DJXA 2PA6A 3MJMA 2AOSA 1TE6A 3QRHA 1JPKA 2XZ9A 3LBMA 3BLOA 4MKSA 2C0AA 4JXCA 4DLMA 3WDHA 1MO0A 4FX7A 3VZXA 1XLKA 1BFNA 1QPNA 3STGA 1UIOA 5KZ6A 1OD8A 3HURA 4UTKA 1R5YA 3QLLA 4QFUA 3Q45A 3G1SA 3GR8A 1HIZA 4HD5A 5FJRA 3VC5A 1QCWA 2YW4A 3M0JA 4HTBA 4ADSA 5DY3A 2FVMA 3GHTA 3E0WA 1P0NA 1NOWA 1FWAC 1SSGA 5CSYA 3MC5A 4V28A 3W1XA 1U5JA 3RLHA 4XB3A 3V7PA 4HSHA 4YYCA 5CC5A 3I4EA 1V6TA 4RNHA 3RXZA 3TTYA 4WXZA 4Y8FA 2QJJA 4WY0F 2ZUVA 3LXAA 1PWLA 5EFFA 1GOOA 1UWSA 2YLLA 1JQXA 1BYCA 2FB2A 2WB5A 3CTTA 3T07A 3CH9A 8XIMA 1R3YA 3RU8X 4OBSA 4Y2WA 3PK7A 3WH9A 1DQWA 3N6HA 3IARA 2PDNA 4ZO9A 3VIIA 4S2CA 4QG9A 3GXFA 3QGVA 1UWIA 8RUCA 2XSAA 4L6HA 1G9HA 4AC7C 4MGGA 7ODCA 1MZRA 3SECA 2P88A 1PVNA 3B9AA 3T7VA 5EA9A 1HF6A 3IWPA 4G7EB 2PWGA 4TMCA 4AEFA 1AJ0A 1A5OC 3GVGA 1M3UA 2DZVA 1FP8A 1E0WA 6TAAA 4FZIA 2D2GA 2YGYA 1UR8A 4RNIA 1CGWA 2CCRA 1KTCA 4OU1A 1TMLA 3CTLA 5F1UA 1W1ZA 3S2NA 5DMYA 1QI4A 3DG3A 4E4FA 1ADDA 3A22A 3QQ1A 4JNMA 3EDKA 3FVDA 4HPHA 3H21A 4YNGA 3O15A 1KKRA 2OZ8A 4AG0A 3TN4A 4HA4A 1EUNA 1B3VA 2ADAA 1TV8A 1O5RA 4JCMA 3F2DA 3B0UX 3PPFA 4BWLA 4XZLX 2J62A 1UD5A 5CBJA 5KITA 4CVUA 5FJPA 2QUUA 2V67A 3RLUA 1UR4A 1DIOA 1REQB 2ZCGA 5C9WA 4ZXLA 5H2ZA 3OOQA 3W7LA 2A3EA 2PUZA 4C6KA 1ZHAA 3VFLA 4ZOCA 4AMCA 5I0DA 2DT0A 2BY0A 2R14A 3KXQA 2KX9A 4LUJA 1LL4A 1JPDX 3S2CA 3AYSA 2FH8A 3GHRA 3BGGA 4HA0A 3BAYA 3LHVA 4UMBA 4EAYA 4UFKA 1ZGDA 1P0BA 1EO5A 3CLMA 3R43A 1R30A 5CPQA 3U7VA 5AY7A 3EX1A 3JZEA 1IWPA 5CKSA 4FNSA 4NYYA 4B15A 1BYBA 3R8HA 1EB3A 1NFPA 4IT1A 2PODA 3EB4A 2F6UA 3AXKA 3CUZA 4Z2LA 4W93A 1W37A 3APTA 3QGAC 3AIRA 1KGUA 3USZA 1O66A 2O4MA 4AWTA 4TTUA 2J7CA 1YRRA 3STCA 3W1QA 1OFBA 1ICSA 1ZQ5A 4LOCA 3GTIA 1TPWA 1OX4B 3BK0A 4B90A 4FPSA 1VPYA 4N02A 2A0NA 3WEOA 2EPMX 1ZL1A 1WDDA 3G1DA 1GZJA 5F2GA 4O54A 3MY9A 1GOMA 3T6CA 1MWOA 1TUFA 1Y5VA 2Y7FA 2ON3A 5CAKA 4D1JA 2GDVA 4DWDA 1EA9C 4HMCA 5J8LA 3MCNA 1UWUA 1BF6A 4O15A 1M01A 4IIBA 1LRNA 1XD0A 2WCGA 4BWLC 7ENLA 2VFFA 1W5OA 4KGLA 2HE5A 2H6RA 3GR4A 4S3BA 2C1HA 1OFDA 9RUBA 5I3FA 4HYVA 1KM5A 3E12A 1F5ZA 1NF0A 3D46A 2UBPC 4HNLA 4PL1A 1OIMA 1RPXA 1X6NA 3APGA 3QKEA 2OYMA 1KWGA 3TW7A 3B04A 1XRFA 3W7NA 2H8XA 5L9FA 2BHYA 3WQWA 1S2WA 2XZ7A 4DJEC 2GDQA 1GYNA 1J6PA 1M03A 3W22A 3NPXA 1K70A 3VIKA 1RZMA 1F73A 1KRCC 3VZZA 2NV1A 3M47A 1EGZA 3VNLA 1E15A 3PZIA 3UG8A 1EA0A 1LOQA 2QKFA 1UA3A 2QJGA 5C5YA 1A5NC 2XVGA 2PP1A 2VR5A 4XG1A 1DJNA 5JVLA 4DHGA 3EWXA 4CQ9A 4DJFC 4K8HA 4XWUA 3HM7A 1KGXA 4HOWA 4J3SA 5K7JA 3LNMA 3HJEA 3GFXA 3EX2A 4W8BA 1TV3A 2W9MA 3WDPP 1DBTA 4G7FA 2D69A 3GZ3A 3U5YA 3GC5A 2V30A 3N19B 2BWGA 3A12A 1RY0A 1EYEA 3VO0A 2XVPA 1F3XA 1Y8BA 5TD4A 3NQ8A 1H61A 2ZZ7A 1UZHA 4Z0JA 2VD9A 3OLEA 4DJDA 3PTDA 1NQ6A 2ANUA 4GQQA 3PSWA 2CLHA 2R1MA 1ZAIA 4DUOA 1HKIA 2Z1VA 2OPJA 4MG4A 4H6KA 4H19A 5ABGA 4Z2IA 4DYEA 2V69A 5XIAA 4I9JA 3C3NA 1U22A 4Q4OA 2Z1XA 1KQZA 1E56A 3POCA 4CU8A 3F2CA 2UY5A 3MBFA 3AZSA 4LRSA 3DI0A 4AZ5A 3ZM8A 2P8CA 1KFCA 1ESWA 3T2PA 4MM1A 5A8GA 4J7RA 4FLQA 1L2UA 4W84A 3EX3A 3IK2A 3WLHA 1JYXA 3ECQA 4J35A 3T2QA 4XAFA 3PWGA 4XAZA 4E4UA 4G1KA 4GC4A 3UWQA 3I6EA 3PULA 1GPFA 2GSJA 4GY0A 3BAXA 4H2HA 4OE7A 1ZP4A 4P7RA 1TCMA 3UR7A 4JIEA 2PP0A 1RY8A 2W79A 3EKZA 4L80A 3VE9A 3V5FA 1XIMA 2OQHA 3H6OA 3LN3A 1OFAA 3LLDA 3STFA 2RH9A 1S2VA 4GZJA 5K9XA 5E09A 3PM6A 4JX5A 3C52A 4ZR8A 3KL0A 1WXJA 2PC4A 5ECUA 1ME8A 2IQ0A 3FCPA 4JQ4A 1BKSA 1PIFA 3DH7A 4R7OA 4ZXOA 1E6QM 1QDSA 1W31A 2QNEA 3DGBA 4HA3A 1N55A 5ENLA 5BMWA 4GJJA 3AUJA 1WUEA 3PB0A 4MFDA 4KRTA 5CGMA 1WBJA 2W91A 2ZWZA 4TV5A 1JPHA 1KO0A 1MXSA 3H2AA 5CC7A 1XYFA 4AHOA 3M0HA 1XIBA 3BANA 5HWMA 1J0ZA 3IV8A 2O55A 1MDRA 1UBSA 1P0KA 5EMUA 1N2VA 1V0MA 4FO4A 3IAPA 1FP9A 2PF8A 3M9YA 3SRKA 1Q8AA 4HZ7A 1M1BA 2R24A 1LM1A 2XG9A 3L4TA 4M7SA 2WZEA 5GPRA 4XBKA 3G5EA 3MV11 4JTSA 3GDKA 5CZTA 2Z2AA 1G6CA 2NUYA 3GVWA 3OPSA 5D4YA 3UWUA 3BSGA 3WO8A 3VZYA 2CZ5A 5BU9A 1JUEA 3K5XA 4IJBA 2EBNA 2AKMA 1LRQA 4QBXA 3GU2A 1NDVA 1K6WA 3L4ZA 1H7XA 2YR1A 3HN3A 3MHUA 5I78A 4PA8A 3HFYA 2Y8VA 1F74A 5EMJA 4L9XA 4NJKA 2FH6A 2PDWA 1XLLA 2QHAA 3WZ0E 5FAGA 4W88A 3VNKA 1RCXB 6REQB 3IACA 2CWNA 2TYSA 4N4QA 1V3IA 2ZA1A 3GIQA 3NQ7A 2BV9A 3G1YA 4MOZA 2KZHA 3SFWA 4UZUA 3W7MA 1DHPA 1GZ1A 3KDNA 5DELA 4LVBA 1W6TA 1LDCA 3W2UA 3KOWA 1B9BA 4ZB0A 3W7JA 1JXJA 1NP2A 2A1YA 1V0LA 1VBRA 2QCEA 3ZVHB 1WV2A 4MY1A 4LUIA 4UIOA 1J9YA 3W1NA 2IQTA 1EX5A 4BF9A 1RQEA 2CERA 1PO9A 3P0WA 2BODX 3PWIA 1M7OA 1JRBA 4BEUA 4Q6JA 4S23A 4CNSA 3CV1A 2XIQA 1GEHA 4UTMA 3M44A 4P7NA 1I6NA 3RJYA 4G9PA 1JDEA 3T0DA 1RSCA 4L64A 2CYGA 3UFYA 4HIBA 1E0XA 1BWVA 1KW1A 2X16A 4B5WA 2XH2A 5BOFA 2JEQA 1C8YA 3SRHA 1FRBA 2AL1A 1K7XA 4GIYA 1KM6A 1P5BA 3TU9A 3TEVA 1OC5A 4NRSA 3LLFA 5EMYA 3QPEA 4DAIA 1FWRA 1ZLPA 4BF5A 1EJTC 4H9UA 1Q45A 3G24A 1IXOA 1D8CA 4MB5A 2VZUA 1NU5A 5TIMA 4EE9A 2OOGA 5CJNA 2WLYA 3SY8A 3UYCA 1K7FA 4POCA 5AOUA 3M0MA 5HXMA 1XDLA 1NWRA 1P43A 4D6DA 4JTIA 3F5LA 3LA4A 1I2PA 4MYAA 1OQFA 1FVPA 2OELA 3EWDA 1I1WA 3IVTA 3NQGA 3H53A 2YZRA 4IOTA 2FPTA 4A2RA 7TIMA 4AD3A 1FTXA 4H8UA 2OR2A 5GNZA 4A3HA 3BPWA 4GH3A 4C1NA 1TTIA 5KZDA 3OO2A 5RUBA 1KKOA 3EZ4A 3N2CA 1AA1B 1R47A 1A80A 3UPBA 2HXTA 3CV7A 4PMDA 4Y9NA 3NQEA 1JULA 1KFEA 2VX6A 3VIPA 1H0GA 3DHFA 2C3ZA 2HCVA 1JCXA 2XYLA 3TNOA 3TQPA 4A2SA 4U5KA 1J0JA 3WNLA 3A23A 2VZVA 3QV9A 3VTRA 2EPHA 3NM3A 1DTUA 3RM9A 5E9XA 4MNLA 2NQ9A 1TR1A 3LUTA 5C9UA 1RD6A 4QCFA 3PZQA 1OF8A 1Z44A 4M7TA 1JZ8A 2PCQA 1TVPA 2E5DA 2CPUA 3FAXA 3SIZA 1E5JA 3POHA 3WMSA 3RYSA 1EHAA 2Y88A 2GVJA 3FKRA 2W3ZA 1Z6KA 3U8GA 3CEUA 3VDGA 1H7NA 3FXGA 4L4MA 3FX4A 4ZA0A 1V08A 1XGEA 4IFKA 3RK8A 5C9ZA 3FK4A 4DF1A 5BRBA 5JXQA 3LBCA 3AIUA 3TYEA 4JY9A 2RUSA 1S5WA 3AIVA 3V0SA 2VXNA 1XLJA 4ERAA 2HZGA 5AHLA 2E67A 1SJCA 2XVKA 3WNNA 3ES7A 2PSNA 1GOKA 4FLOA 3N3MA 5KSWA 1P0EA 3QTPA 4GI9A 4YHEA 4UTTC 3CQHA 4NF7A 1B3XA 4RW5A 1QNSA 1RQHA 2EG7A 1M65A 1S2TA 3KVKA 1VEOA 3R13A 2GJNA 3N13A 1MMFA 1EGMA 4MYXA 4UB9A 4GQBA 3VMPA 3NQAA 4U3AA 1LTDA 4NNAA 1YYAA 2JQXA 4MB3A 2Z1BA 1U1HA 4ZOAA 4DO7A 4ZTYA 2BXVA 3T0TA 1BWLA 4S3GA 4NJJA 2X7VA 4AVNA 4CCCA 1JI1A 2J78A 3B9OA 3V36A 3WFLA 5CZSA 3UNDA 4DZAA 4KIEA 3G6LA 3S47A 6CGTA 2XM1A 3NEHA 4BI7A 3GNOA 4J28A 1WKFA 5BOOA 1X1NA 2PDCA 1K8ZA 3K1DA 3ZXWA 2Z0IA 4P61A 5AYIA 2A6NA 2QPSA 5LIYX 3N2XA 1ML1A 3PZGA 3URAA 1IXPA 2PDBA 1NWSA 2VUYA 3LEPA 3PZMA 1U33A 3HU7A 4EF8A 1RLCL 1FH7A 3H4XA 3WLRA 4KFOA 3U4FA 4AEEA 1LBMA 4PTNA 5EL1A 1V02A 4MJ4A 5I5RA 1WZAA 3EOUA 2DZBA 2GWNA 1BG4A 1VRXA 3MU7A 4C91A 4GD0A 5AYZA 2Y4SA 1FDJA 3PZ9A 4KRZA 5FACA 1R3WA 1JD9A 4XTIA 4HNCA 4X0NA 5C54A 2RDXA 1TO3A 2JIWA 3MO7A 2VGGA 2ZXBA 2ZX6A 1M53A 3GG1A 4GI6A 4W9TA 5D02A 3W7EA 3INPA 2CLLA 3GG0A 1H7WA 3EKGA 4DWSC 2NLIA 1JG9A 3PSVA 1ISWA 3NWRA 4P8XA 5LYRA 3ZLHA 3F1QA 3P14A 5ABTA 9XIMA 3T78A 3T08A 4H8NA 1TPVA 4QLJA 1ADOA 5FJOA 2J79A 1J8VA 3QZEA 3BXWA 1UC5A 3ARQA 5FIPA 1TX2A 1XYZA 2CHNA 5A95A 2OSXA 2PDXA 3DHPA 5CG0A 3TOYA 1G0CA 1G01A 3CUXA 2BGQA 2D2HA 4K38A 1X96A 2Y1HA 4PE8A 5IBXA 1US0A 2W4XA 3ZSSA 5M2FX 2ZUMA 1RBLA 1VFLA 1JL8A 2LLEA 3O2LA 3NSNA 2HNHA 4P2VA 2YPIA 1YDYA 3EXSA 3H12A 1RK5A 2PDLA 5G4WA 4OBRA 2R91A 4MY8A 3VOHA 1GJUA 1NAL1 2YDRA 4Q8VA 3W38A 2OJPA 3RPDA 2XSBA 1YDNA 3RNDA 2VO5A 1OFOA 3BGJA 3DKJA 1LP6A 2WJEA 3QQ0A 3SQSA 4ACYA 3CAQA 3FA4A 1SYTA 3S2LA 2WQPA 4WGHA 4US5A 1EKOA 4A4AA 3DDMA 3IV3A 3IJDA 5K4XA 4RK8A 1KTBA 5AC5A 4OQVA 1L6WA 1P6CA 1V3KA 4AIEA 4ACZB 3MCOA 3MTWA 2NXIA 3DGRA 3AMKA 1W56A 1M6JA 5I3DA 2C14A 1PCKA 4IGMA 1OVDA 5CSUA 3HIJA 1CB2A 3E9AA 1PIIA 4W5UA 1BPLB 2CBUA 4G8TA 2WNQA 3P0XA 2CBVA 3P93A 1Q6LA 3EB3A 3BH4A 3R12A 3THDA 2HE8A 1XYMA 4RJEA 4RR4A 2HTMA 1UD6A 2QJNA 4GZ7A 4ADUA 3TOPA 4UFJA 5C0QA 2I5IA 2NV9A 1J0HA 4D9PA 4ZE5A 4RZ6A 2NQLA 4NNBA 3ITVA 2VURA 4PTVA 1JCYA 1G7UA 1UW9A 1TA3A 2P50A 2CZVA 1FDYA 3WSUA 2DH2A 1R2RA 1ZTVA 3NXFA 3SCRA 3OA3A 4RE2A 5FF0A 2Y89A 3MVIA 4YXGA 1EC7A 3S5YA 4HCLA 4QHRA 1I2NA 4NZFA 2QJHA 1ITQA 3QY7A 1VFOA 2Z1KA 3LGEA 2QULA 1MEIA 4QDMA 1B0IA 4E8GA 3W23A 1KRMA 2WZIA 2WCAA 1A3XA 4CEUC 4PUKA 1KXVA 3HG5A 2VC7A 3OA5A 1V03A 1SR0A 4BS0A 4R85A 1V7AA 4JHOA 1NFBA 3K4WA 2Q71A 1KCLA 3ITTA 4W4QA 3TC3A 4FF5A 4K2SA 1X39A 1KXTA 3PNZA 4NAEA 4V1YA 4AZBA 4GYPC 3GM8A 4MNJA 4U3CA 3W7QA 4HNNA 4NAFB 4MZ1A 3M0KA 4Y7EA 3W26A 3U3HA 3W07A 3EXTA 3EPOA 4R53A 3AAMA 1OFRA 2ZRYA 4W87A 5AYXA 2OB3A 3PR2A 1FDZA 2ZUWA 4O53A 3I6RA 3DFPA 2PCEA 4KCTA 2DIKA 1NOUA 2FGZA 2RDWA 4O8RA 2PDFA 4ZFCA 3VCCA 1V77A 4JQ1A 1GKPA 1QK2A 5C6MA 3UJFA 1VQTA 1TVLA 3G0XA 3A47A 1BXCA 2PLCA 2Y61A 2HSAA 1GVQA 1AW2A 1T0OA 1UC4A 3LB0A 4LVFA 5DRCA 1OADA 1OCNA 2AKZA 2VX7A 2O9PA 1G67A 4LC6A 4S3EA 3Q58A 4RE4A 2OLAA 3S6DA 3CAKA 3T42A 2DSKA 1W2VA 3SY5A 3MKVA 2VRJA 1S2AA 1SO3A 1GVYA 1MYRA 5FSEC 5AHEA 4A29A 1EWDA 1PHWA 1OC7A 3WMBA 4QLKA 5D09A 1UASA 4DIAA 1FY6A 1Q6GA 3GDBA 4UNLA 2Q3RA 4H3DA 2FZMA 3N25A 4RNFA 1EC9A 4U10A 3L2IA 2E9BA 5DT7A 3G1HA 3ZIZA 1VENA 4Q3MA 3KWSA 4H00A 3WBXA 3CPGA 1QMLA 2VT0A 3FEQA 2BMBA 5DX7A 1EJ7L 3W00A 3R89A 4RNJA 2FHBA 2O0TA 3OBEA 4HZ6A 1Q85A 1UPPA 1Q13A 5KTLA 3W27A 2O4QA 4Y9MA 4TVCA 7XIMA 3N2MA 2E8ZA 3THCA 4JFSA 4QGCA 2FZNA 4ILSA 1EZ2A 3W29A 5A6MA 1TTPA 4A21A 4K7VA 2E9MA 3BZGA 2FIQA 4ZODA 1TX0A 3NG3A 3LQLA 5LIXX 1H1ZA 1W5PA 4LB4A 2ZADA 5CLWA 1ENUA 4DZ5A 3VD4A 3VGDA 1JAEA 1VFTA 4NKCA 3WENA 4JIHA 1WZMA 4MHBA 4A8IA 2PGFA 1W8SA 1EQPA 4GQ0A 2XINA 2PGWA 2Y5JA 4F3HA 2YKKA 1XCFA 2JEPA 5LIKX 3KBNA 4L56A 3ZOAA 1A5KC 3PZNA 3KDOA 2VGFA 2BZNA 3LPGA 5HNUA 4PEKA 3OYZA 4JDBA 1WOBA 1ONXA 4LXFA 3CV2A 2FDSA 4LAOA 4PUMA 1XUZA 5DLCA 5ABFB 2YXXA 4DX3A 1VFHA 1WDRA 1VCVA 3LRLA 2ZTJA 2Y5EA 2ZRVA 1R6WA 1RVGA 4E8DA 5D8ZA 1CCWB 3I3EA 1TCDA 3KBVA 3WLTA 1RPKA 3W37A 5A2AA 4O0ZA 3VILA 3KBSA 3QXBA 3D6NA 3UJ2A 3TA9A 5BROA 1C3FA 3KX6A 3L0GA 2XTKA 2P8BA 2QAPA 2CW6A 4QS6A 1WNOA 1AW1A 3W88A 4E4PA 4M6PA 1DOSA 4LFYA 4QE4A 2YL8A 4JPGA 3PP7A 5B7YA 4KWUA 4S1FA 1JPIA 3UA3A 2IKGA 3SUUA 3VDHA 3O3RA 4YIWA 3HGJA 4PCFA 3VIOA 4JDYA 4LUTB 4K39A 3NZ1A 3EMQA 1XBZA 2BY3A 3GIPA 4FMVA 3HO8A 2J7BA 2A85A 4BQ5A 2G3IA 1Q2SA 3BLFA 1V3JA 3WF2A 1VJSA 4AH7A 1HKVA 1YNPA 5REQA 4NJHA 3BMXA 3PBWA 2HQAA 1L8NA 1PB0A 2P76A 1UR3M 4J2PA 4JN6A 1L6GA 3LX9A 3IIZA 2A4AA 3B05A 5D8WA 1GYMA 5IFPA 3GHUA 2QQ6A 1AQMA 3RLGA 4PTMA 3UWWA 4IUOA 4TX8A 1VBHA 4C5ZA 2IKJA 2P0IA 4RE0A 3LV5A 1YPXA 3CYVA 4KCUA 5T9BG 3VX0A 5H8MA 4ZSTA 1MRQA 1US3A 2UY2A 4O10A 2V0TA 1J0KA 4A3YA 2E1WA 3W7OA 3LQGA 1ICQA 3N2OA 4GIAA 1ZFJA 3VFCA 2YBUA 2DVXA 5CPTA 3SCSA 4HU4A 2YCKX 4GGBA 2V2DA 3KS6A 4EWND 4YWIA 1BVNP 3SM0A 1KTNA 1GT8A 3GB6A 3NQMA 3D0CA 1F2JA 1MFVA 4IFRA 3AU6A 1P7TB 5JMUA 3W86A 2J8GA 2NWRA 3G1AA 1H2JA 2G3JA 1SUXA 4F40A 5CSRA 1V6VA 4DM1A 5CC3A 4OGZA 5IOBA 1LT7A 3H2NA 1Z89A 7A3HA 4B2DD 3C5QA 3SUSA 1GOQA 1R2TA 1WZKA 2XGIA 4DYJA 4O18A 4KRUA 1DYSA 1V4YA 1YDVA 4IXXA 5IM51 3SCNA 4UTWC 1H11A 3BAKA 3ARXA 2VJXA 1O68A 3AJXA 2DH3A 3WEMA 3LM3A 3N04A 3FV9A 4GYJA 3G3MA 1KM2A 2X0YA 2GQ9A 2UY4A 3S6OA 4CNOA 1PIGA 4M56A 4NG3A 4MDOA 3A21A 1GK8A 3MUZ1 3LHTA 3LBOA 2V9DA 4PL2A 1E9LA 1LWJA 1NDWA 2WMKA 4H8VA 1WPCA 2GUBA 4NT0A 1LOSA 3UXIA 5CPNA 1VFSA 4O1AA 4WHBA 3E5BA 4HU3A 3W24A 1W3LA 1O1HA 3EWBX 1Z9AA 2XSXA 4E5TA 1NH6A 1CXIA 3II1A 3TXVA 2ZA3A 3WLPA 4JX6A 4NNCA 4J3TA 5U7SA 2VEMA 3FGCB 2O92A 3UCCA 1KCKA 2WPBA 4KT2A 4EACA 4XV0A 2H8ZA 4NJIA 1VP5A 5A2CA 4G7EA 3L0NA 4YWSA 2VELA 3TSDA 3HMJG 4AU0A 2R1NA 3DFSA 1OIFA 1ZY9A 3ZWTA 1ZS2A 4CU6A 1VPQA 3REQA 2CC0A 3DU0A 1KFJA 3N3TA 1PKYA 2CZEA 3QYQA 3VCRA 2W67A 4PN2A 3WY1A 3T05A 5BXSA 2JALA 3TNBA 4WRHA 3U2CA 2DSVA 2DEPA 3T44A 1TPFA 4MNKA 5C71A 1E51A 1XLGA 2D22A 5EBUA 1P0DA 2VC5A 1RHCA 4QNWA 1I2RA 1QWGA 1OG6A 1YTDA 1S5VA 4Z1BA 3VUPA 2NW0A 1TWIA 2ZZ4A 4JR5A 1BRLA 4O4WA 1FCUA 2F8QA 3GYCA 1QPQA 1UKPA 5B80A 3OVPA 3DX5A 1O94A 1Q6OA 4W8LA 1O7AA 2C0HA 9CGTA 3BVJA 3VC6A 4HCHA 3R94A 3CHCA 1XSKA 1FWJC 4JNYA 3N1AA 3KEHA 1ZSXA 3IGSA 2PDMA 3ES8A 3MYPA 4MJ2A 4ZO7A 1NELA 2ZICA 3ERPA 3BMVA 4ZO8A 3N29A 5MF5A 1ZJAA 2XPKA 3PFRA 2D1ZA 4HZMA 4NU7A 3W25A 3T4WA 1K8XA 4AIBA 5A8NA 3AUOA 4GZEA 5MHBA 4GBDA 3WJXA 2VNCA 4KERA 3VOGA 1F3WA 4FLSA 3CZKA 1PEZA 1R86A 3THAA 2ZXAA 5F1VA 4JL1A 3O6YX 2QCHA 2NZLA 3M0IA 4ZFMA 3A9IA 4JY8A 4BQ4A 1Z41A 2F84A 1PDYA 3NGFA 5F4XA 5AHMA 1TZZA 1VFUA 1TPDA 3KAOA 4FA3A 3CC1A 3NJ3A 3FJ6A 3TWAA 3SJ3A 4MUPA 6PTDA 3T0BA 3ZWSA 1DKWA 3VPLA 4GZIA 3VIFA 1LQ0A 3E2QA 1K1DA 3OHIA 2VHLA 1YDOA 4AZGA 1AL8A 2OZTA 1K8CA 3WQDA 1WZLA 3MSDA 3K4AA 3QVQA 1NY1A 4JEJA 4RV3A 2VC9A 5LA2A 3SCVA 4AZCA 3S9IA 3QY8A 1E6ZA 3WH8A 4KEZA 3EAUA 2IXVA 3GKFA 3PS7A 5LNRA 1HN1A 4MB1A 4ZL1A 3GHSA 4HYRA 2ZUUA 3RUBL 2W27A 1YXDA 3W7GA 1B4KA 4H04A 3JUGA 4CLMA 1XLDA 2CXGA 1GOXA 3MP3A 4NZ3A 2CLMA 4A22A 1OABA 3BTNA 4JTUA 5CH9A 2BVDA 3GY1A 2QEZA 3CHFA 2RGLA 2AAMA 4YVPA 1OFQA 3ZR5A 3OJGA 3P8IA 3DHUA 3BAJA 4LBRA 2JFEX 1F05A 4ZOBA 5FJTA 1IF2A 3UGRA 5HR7A 3IVUA 2NXGA 3OIXA 4Q8QA 4KEVA 3BC9A 1MNZA 5C8BB 1TV2A 5C9RA 4UFMA 1LWHA 2PMQA 3CQ0A 4ALDA 1AMYA 2XFYA 2ISDA 1WCGA 1UA7A 3DERA 1QRQA 4JIIX 1YXYA 3UF9A 3VM7A 3H7VA 4MPKA 2VOMA 5HATA 9XIAA 3OODA 2FB3A 4IHCA 4Q7NA 2ZX5A 3DG7A 3KL5A 4EANA 1OF6A 3M07A 2YCJA 4R34A 2CWXA 4WR3A 2AMXA 3HQOA 5HMSA 5IHRA 4WSHA 3DI1A 3M5ZA 3PWAA 3GVVA 3BWWA 1K9EA 3UPMA 2CBIA 2GJRA 3W87A 1ZPTA 1XW8A 5CZJA 1QVBA 3NL3A 3UG3A 5I3IA 5J5DA 2QCNA 1JAKA 3V1PA 1ODUA 2XFRA 2HVOA 4A3RA 3VNZA 1AZ2A 4PSPA 1IGWA 2XUCA 2FGLA 4PB5A 3LCIA 1FCBA 1SM9A 3G2GA 2J8FA 2WZTA 1QNRA 3BE7A 1PDZA 2VQTA 4BR1A 1JPMA 1KBLA 4N6EA 3GXTA 6ENLA 3BQ6A 5FL0A 3L4VA 5F7UA 1OSEA 1VD6A 5FEPA 1ZZMA 4M6VA 1X38A 3QJAA 2E6AA 2YDAA 1U5VA 4HB7A 1TTQA 1TV5A 4DWSB 2DT2A 1BHGA 3WNKA 2IUZA 1TV7A 3GNDA 4B92A 2EGZA 2QCLA 4UZSA 1TYGA 2V3DA 1WAWA 4O13A 4WDXA 2A79A 4LJ3A 5ABHA 1FUYA 2FFIA 5AZ0A 3M43A 1VBGA 4FP1A 2XWDA 1FHUA 5A3HA 1MW1A 1E70M 3U0HA 3I7RA 2G3FA 2WQDA 3CH0A 1HUVA 4OV9A 4PEEA 4DPQA 1QI0A 1UOZA 2PWHA 4GVFA 4AB4A 2VFDA 3IUIA 4H9XA 2ACUA 3N15A 3PZTA 3BAIA 2FMNA 1YE6A 4MWAC 1XLEA 1S39A 4PMYA 1LL7A 3ZQ9A 1OK6A 1IYXA 4L4OA 3BG5A 1EOMA 3BAWA 4JTRA 3JR2A 1KBKA 1F3TA 3WK2A 3AHYA 1M9HA 3JW7A 3H22A 5B7ZA 3VK5A 1RQBA 2A3LA 3LGGA 4IFOA 4WJ8A 4MZ8A 1ZNNA 5CPMA 2OX1A 5ABEA 4XD5A 1R38A 2PURA 3G3DA 1XRSA 3SCOA 2PP3A 3GVRA 1POKA 1F4AA 1KLZA 1PPIA 3CK5A 3EA3A 3UPWA 3SJNA 3O06A 2DIEA 3DYMA 3J7HA 3PZOA 3C56A 3M64A 4OWGA 4PMOA 2YB4A 4X9SA 2GJXB 5I3HA 3WNMA 3DEQA 4H83A 4QLLA 4N0RA 3VD5A 3S9ZA 4LRTA 2GGJA 2QT3A 4JTGA 1VCGA 1OBAA 5BU6A 1CXFA 3UG5A 1A5SA 1BYDA 2QS8A 4GXPA 3THUA 2PWDA 4TMBA 4HK7A 2XN2A 3DFTA 5HPOA 1F6PA 3HQ1A 3VD3A 4D72A 1XG4A 4DJDC 3SZ8A 3GAYA 1C9WA 3LNPA 2D2JA 1UD2A 2NVAA 2HS6A 1OFPA 1GJPA 4AZ6A 4HMEA 1KBBA 5BOEA 1TJ2A 4DM2A 5FOOA 4V1XA 3M0YA 3OG2A 4PULA 1E1FA 4PMZA 3A13A 5I06A 1HGWA 1F8IA 2F6KA 1DHKA 3PUOA 4LPCA 2WWDA 4KCVA 3A5VA 3T1GA 3WJWA 3VKJA 1RA0A 4R5EA 3FOKA 1TVNA 2QVHA 4MPQA 1E4IA 4IZGA 1CGTA 2AQOA 3O63A 1ISXA 1V6WA 4K37A 5D30A 3NL2A 3DN5A 2WSPA 3VE7A 5LGZA 1SZRA 3P2VA 2H3DA 3GW0A 3UESA 4NZJA 3APYA 4Y9PA 4D6JA 1UCWA 2EAWA 3R5EA 3ARVA 2XHYA 2VI0A 2DP3A 4Y90A 4LW7A 2PLJA 1TJRA 5JUVA 3WD0A 3KRZA 4QAIA 5A6SA 5E1QA 4XK2A 4AWSA 1QASA 4GI4A 3QV8A 1F07A 2ACQA 4JFTA 1SJDA 1VB9A 1QBBA 5AECA 3TCSA 4UNKA 1V6YA 3SAZA 1QNQA 4H1ZA 4REQA 2ZC1A 1A4LA 3TLQA 4DZIA 2Y2WA 1ODZA 1FHVA 4LYQA 4Q22A 2YIHA 4C7DA 2PWVA 1MQRA 1QU4A 3GSMA 3QZAA 2DY3A 1V02E 1FX6A 1UR2A 2X09A 4PUDA 2JKAA 3GTXA 1ZJIA 3W2KA 3B8WA 2FVKA 3I3BA 3SUTA 4MZYA 3LCHA 1FA2A 1S5NA 1GQNA 2BVYA 3WF0A 3H70A 4F9DA 2A3CA 4YTRA 4DRSA 3PBYA 4A8LA 2BOGX 2YXOA 2F2HA 4GX8A 4C6EA 1E5NA 4XVDA 3IEBA 1UWQA 3EOOA 4RE3A 2Y8UA 2ABAA 4U31A 1TRIA 1KM4A 2Y6ZA 3MMWA 1UZ1A 1OGGA 2ESCA 4FX6M 5PTDA 4N9EA 4JKKA 3GX9A 3MYOA 1MW0A 4J40A 5C2XA 3GO2A 4HK5A 4C6MA 2V3EA 3SSZA 1J93A 1EBHA 1EO7A 1E1CB 4H7VA 3WQVA 2Q8XA 2PC8A 2D24A 1W5NA 2V5KA 4DXKA 2NVDA 4Q8UA 5A8PA 1UR0A 4KH2A 4DY1A 2TSYA 2ZUTA 3S1VA 5A8OA 4JL2A 5HMFA 2W66A 5HNRA 1BXNA 2PDJA 3ONBA 3T81A 5HBFA 2BTMA 2ALDA 4XZMX 2WPGA 4IP4A 4EOUA 2OFJA 4MADA 3BO9A 3MI2A 1NQKA 4L6DA 4EXAA 3G22A 4DN1A 5IHSA 3BICA 1R3RA 5EB8A 1RV8A 3TDFA 3RDKA 4GX9A 4AZ7A 4D6IA 4JBRA 2OODA 3PC0A 4JAWA 1C8VA 3AFBA 3ME3A 1GQIA 2NX3A 2AGTA 3ZYZA 4DB7A 5D9NA 4X61A 3WQ5A 1L9WA 3NDYA 4Q4MA 2OX4A 2ZVIA 2SFPA 3LI0A 4JFWA 4XZWA 4MLJA 1HFBA 8A3HA 2AAAA 4AD1A 2V3GA 2A6LA 3VOIA 4TVUA 3S1WA 1CW2A 2HNEA 3IIOA 4PMRA 5CEWA 1E4LA 4FIRA 4C5YA 1J11A 3HA1A 2ZXQA 3MUY1 3UR5A 4M3PA 3ONCA 1ONWA 5ECVA 1K9DA 3KCLA 3KP0A 3ZLFA 4AX7A 1RR2A 4IIHA 2VFHA 2ZRZA 4OUIA 1MUCA 2XH4A 2Z6JA 3JZUA 3T40A 2CHRA 3N9SA 4O1BA 4XSMA 2HK0A 1K02A 4RW3A 4PYSA 3XISA 1J2BA 1E1CA 4DO5A 2GUYA 4C6QA 2WVVB 2GUUA 3F4CA 3RO8A 4GNVA 4YU1A 3TFCA 3TAKA 3KOFA 3SO7A 2J7FA 1TWWA 3AIBA 3H2OA 2YL5A 4H6QA 2J7EA 5HMDA 2CIPA 3AS2A 3P61A 4N9DA 2ZZ6A 4AAJA 2IPWA 4L9ZA 4MSSA 4CEXC 3URNA 4Q8OA 1PBGA 1MZHA 3QH2A 4KWWA 1W1VA 1ITCA 2A21A 2Z6IA 5D2TA 1GQJA 1X6UA 3UETA 4ZQRA 2G4JA 4F79A 4CD4A 1KRAC 1XUUA 1DQXA 4R33A 3B0YA 4GACA 1U1UA 2EPKX 3TSBA 2VTFA 1O5XA 3TLLA 4NI3A 1B9ZA 5BNKA 1NOFA 4LSBA 4AYGA 4XIAA 2QYGA 2DVUA 2C79A 2EQDA 2OSYA 4M51A 4DO6A 2PWEA 3TAOA 1FCVA 3H24A 2XJ7A 4GUJA 3AMGA 4ZQCA 1I4NA 4PZVA 3LTPA 1CZ1A 5GJMA 3KZSA 4IH3A 3MDUA 3C4UA 3BG3A 3V16A 1XISA 3BLIA 3AHZA 3MUCA 3IRDA 1W5MA 8CGTA 4RV8A 3RJXA 4UQ9A 4IF2A 2GGHA 4PBFA 3QF0A 3K8MA 3FSTA 4M82A 1IT7A 3RPMA 2VDIA 2D73A 3MVTA 4X2RA 1AH3A 1JNDA 3P60A 2J24A 4IJCA 2O7QA 2AL2B 3LERA 1UIPA 4IISA 2RGMA 3A24A 5GJNA 4MAVA 7TAAA 3H4WA 4HT3A 4JX4A 3NNTA 4UQEA 3SI9A 3QC3A 1IR1A 1XBVA 3C2YA 3SB0A 3L2MA 3AS0A 3UR8A 4YJ5A 4HPXA 3FAWA 2WZHA 4TQTA 1QOPA 3K8KA 4F48A 5AB3A 3PAJA 2CZFA 4AQLA 1DXFA 1FWSA 1RAKA 2BSLA 2DZSA 2QDEA 1EWEA 4M24A 3VINA 2OEKA 3GG7A 5CCZA 1Q5MA 3T2OA 3TV8A 4B5UA 1X1ZA 1MW3A 3IJIA 4MTVA 4H9ZA 5K9DA 4ENLA 1XQKA 3W3OA 4UTUA 3QW3A 1UH3A 4RZBA 3QV6A 1MQPA 1JDFA 2EO7A 1ALDA 2J25A 3AHTA 3C2RA 1H7RA 1SW0A 2PDPA 3EWZA 4JKLA 1DVJA 1PX8A 1NWTA 3GNNA 4DNHA 4R7WA 3G1RA 3MHGA 4DBUA 1E71M 4H2CA 1FWTA 3WQ4A 4W86A 3KM8A 1XKJA 4I9MA 5HOSA 2HRWA 5FF2A 5CJMA 1SR9A 1MXDA 3CPRA 3DFOA 5FF7A 1MQQA 2IKHA 3Q2DA 4HYWA 1KBJA 4Z1YA 1QNVA 3GVQA 5I2UA 1UHVA 1HVXA 3AICA 3VKBA 3U7BA 1DV7A 4RDYA 3W1PA 2HJPA 3R0UA 2Z28A 1CXHA 3CL6A 2RFGA 5AC6A 4A3UA 2Z2BA 1JQVA 1QW9A 4FNUA 5FJJA 1Z8AA 5DANA 2WSQA 2POZA 2FQIA 3YPIA 8XIAA 2YA0A 4GVGA 5E0CA 4ATLA 1CXLA 4WDTA 1V51A 1S5MA 2CEQA 2GVEA 1K77A 1ZBWA 3MKCA 3QSRA 2C8NA 4H9MA 4AC1X 3LV6A 5A6AA 3VDBA 4X0VA 4XO6A 5HWJA 1WBHA 2J9YA 1UH2A 4LTSA 4JHZA 4US5D 2VYOA 3VGFA 5BWFA 1VKFA 4S2BA 4L7ZA 4MF4A 5LKYA 4E3VA 4GJ1A 5TAOA 4LAKA 1O12A 1I2QA 3IVSA 4F0RA 3W73A 4X60A 3W83A 3W1TA 2HPMA 4M1BA 1B54A 4WD0A 3W7PA 3W6MA 1J0IA 3VIGA 3EXRA 4A05A 4F4RA 5AC8A 4R27A 1QXLA 1RBOB 4Z1AA 3TQ0A 1OCJA 2F61A 4P8VA 4MKVA 4O50A 2IPGA 5DCDA 2GL5A 4LCRA 3EWYA 3FFSA 1UKSA 3KE0A 2GK1A 4DWSD 1IXNA 4IIFA 4LBUA 4M19A 2BS9A 4BCEA 3KBWA 4QEHA 1ZBVA 1R8LA 4AD5A 3D3AA 1NSJA 3S2MA 4XZ9A 5LA0A 4DBSA 1W1YA 3BDKA 4K68A 4GLEA 5JBFA 2RHGA 1UR9A 3GIYA 4JFUA 3HQPA 3GH4A 2QVNA 2WM0A 3FYOA 4X63A 2VRKA 1JUKA 4NL1A 2HWGA 2PF0A 3WFAA 4GCAA 4P7QA 2ZUSA 4KEMA 2GQAA 2VR2A 4LAMA 1DWAM 3LXCA 4JTTA 3B0VC 1FWCC 4WSJA 3RX3A 1SFLA 3KZPA 3H7UA 4NZCA 3RLVA 3B40A 1A5BA 1CGVA 1WKYA 2Y63A 2WANA 2WKGA 2ZKMX 3DC8A 4IQEA 4REQB 1SFSA 3D3FA 4CUCA 3WYZA 1GVEA 2XH7A 5A8MA 4R9XA 5HANA 1TWZA 2BXZA 1EJXC 2V8ZA 2NT1A 4F2BA 3OZYA 3E74A 2HEJA 3WIJA 4GRSA 3N4FA 1GW1A 4Q4RA 3NQFA 2JKEA 2QV5A 1SJBA 4MLRA 1G4TA 2V81A 2L5HA 3W02A 1E0TA 4UTFA 4YTTA 1LWIA 3GNRA 4LEQA 3CXOA 1LUCB 2BOEX 4L61A 3K2GA 1M5WA 4UXDA 3IJ7A 3SUWA 1CXEA 1TUXA 4LF1A 2PPGA 5D37A 2A2IA 2C16A 3PBUA 2QUVA 4MWAB 1HJVA 3VUSA 1R9ZA 2INFA 1CTNA 5FF3A 4ORIA 1JXKA 1XRVA 5F2LA 1W3HA 3HPAA 3TXZA 1XSIA 2G4FA 3HMCA 4Q4PA 3TE9A 1HW6A 3CO4A 2V2HA 3BOXA 2WC4A 2NUWA 5J5RA 2OG9A 5JH1A 4LC8A 3TA6A 1DJXA 4J3UA 2XWEA 1WOAA 3L9CA 2NLYA 4H4IA 2VL4A 4QROA 3B9EA 1RBAA 1XFBA 3VABA 4Z2HA 4GO9A 4M6QA 1CT5A 2HK1A 2PWUA 1OX4A 2EJAA 2HDJA 1PTDA 1TB3A 2IPJA 1Y7VA 4FS9A 3WD1A 2FMOA 2VVNA 2UV8G 4HHLA 3VNIA 1DPMA 4IMDA 3CUGA 3GXPA 2GJXA 1VYRA 1E1EA 1S3TC 1DTNA 4I6KA 2RJGA 3M16A 3IRSA 5A2BA 4FIQA 4WVXA 5HK4A 2FLIA 2BHZA 3GXDA 3S42A 2PRMA 5AHIA 5A6JA 2VDHA 3FNDA 5LIUX 3WDIA 3S3GA 1GQKA 2GZXA 3T09A 3XINA 1XLFA 4H9VA 1CWYA 3MQTA 2YLAA 3HFTA 1XINA 2OGYA 3WQCA 4K8GA 5M5DA 3QC0A 2D0FA 2QUMA 1KB3A 3FJLA 1IT0A 4EWJA 4AY1A 4DELA 3AOFA 1O4UA 2Z00A 3FIGA 5KINA 3UT0A 3BW2A 1PUDA 2OGJA 3D47A 4WF7A 1EXPA 3TN6A 1EF3A 2CITA 3PHAA 4HPNA 1X7IA 3PFMA 1KFLA 2RAGA 5IXEA 3L4UA 3UA4A 2Q8ZA 1JCMP 1I9CB 4YYFA 2JIEA 3OYXA 4QRNA 1K9TA 1THFD 3N17A 4J1OA 3BLPX 2MANA 4HSOA 4QE5A 1TE1A 3P5YA 3LRMA 1LORA 3M46A 4HPGA 4K3ZA 1O95A 1N8WA 3FEMA 1H5YA 1GW9A 2YCEA 4KEUA 5KETA 1B30A 1XLIA 4L1WA 3NOEA 3TFXA 5HNTA 3G0UA 5E70A 1PZ2A 4CQ8A 4RPQA 2ZZ1A 1HO1A 1XHGA 1UQZA 2OMAA 4HU8A 3TMLA 2G3MA 4EXBA 1AVAA 2CKRA 2AQWA 4XX6A 3WBYA 4H9YA 2GJPA 3PPCA 5I07A 1LCOA 1EPXA 3CZLA 4B91A 4PUWA 4IPPA 4GYFA 4CQAA 3MT1A 1XLCA 3IJ6A 1W3IA 4OKDA 3O1NA 4GMEA 5LNWA 2EHHA 1UG6A 4LS0A 4Q8NA 4NAFA 1MSSA 2C6QA 1AFSA 2XN0A 3MSRA 3ARRA 4AZHA 2TRSA 5JBEA 1RJRA 3ICJA 3CHDA 4EX4A 3VGBA 3WNOA 1JCJA 2R94A 4S3DA 1ITUA 1GCYA 1NWUA 5CPSA 1JI2A 4IX2A 4FR6A 1V8EA 1XIFA 2J6VA 4YTUA 4LF2A 1NIUA 2A5HA 4IPIA 3ZZ1A 2NWSA 1W9BM 1A0DA 4UMCA 4PH6A 4TR9A 1C7TA 4RKAA 2X42A 3WL1A 4TUFA 4I7VA 5HAOA 3EX6A 2DZTA 4GE8A 3CQIA 3UXLA 4I5UA 1FOBA 3B8TA 3GDRA 4PGLA 4ZTXA 2CESA 3VNDA 2XGZA 4JTFA 3OG3A 4MWAE 1KFWA 2ATMA 1DJIA 3RCNA 1IE7C 3VGGA 1OX5A 5CZKA 1QW8A 3PVFA 2E5CA 4X9YA 3WDJA 4LS2A 4I5RA 2PWFA 2GJLA 2XFWA 1TRDA 4YVXA 2PDKA 2MNRA 3A6OA 4RXGA 1DEDA 6ALDA 2PLMA 3CHVA 1B4EA 5TNVA 5KMYA 1B31A 3MWCA 4NJGA 4AHPA 2IKIA 4WDUA 2CBJA 4AIOA 1Q6RA 3WG6A 2J4GA 3W70A 3AS3A 5D9OA 1IZKA 3FVMA 3TJIA 1Y5WA 2WHKA 3EOSA 1Q2RA 4LNCA 4TTGA 5I3GA 2PD5A 1HXJA 1O6IA 1LG2A 3WELA 1VLWA 3JU2A 5HUOA 1O60A 4QCEA 3R25A 4E2DA 4E8CA 1BVWA 4PUNA 3PNUA 3NXLA 5E6YA 4XD6A 4UFHA 1D3CA 1GUVA 2ZX9A 4C6BA 2DORA 4HCDA 3C8NA 3NURA 5JH2A 4WKFA 1Q65A 1XH2A 3ZJ7A 2DZAA 3DENA 2GDUA 1AD4A 1KLYA 1NM9A 1G4EA 3S9YA 2Z26A 1JCLA 4C6NA 2Z7GA 3N18A 3QMSA 3W53A 2QGHA 2WW5A 3N12A 2GPTA 4AFYA 4C90A 3SGZA 2J88A 4KW2A 2WNNA 4ATDA 3KS5A 1LLWA 3T0CA 2VCAA 4E2VA 2X0SA 1IXQA 1IEWA 1LQAA 3NZRA 3E2RA 4URIA 1XWYA 5DBUA 2E8YA 1R87A 4YMZA 1MNSA 2WMHA 4JNZA 3SCTA 5DY2A 2QDGA 3NO5A 4Q8MA 2VCBA 2D23A 1AG1O 1I45A 2NX9A 1QO2A 1VGAA 2BLEA 1NF7A 4CVWA 1BTMA 4WQ6A 1OYCA 2OQLA 3WUBA 2BNJA 4U2ZA 4XIMA 1FWEC 3PTMA 3QV7A 4P5UA 4PBEA 3WDQA 3EEGA 1C93A 3TJLA 1G4SA 3NSXA 4GYPA 4QEEA 4QITA 3CT2A 1A5AA 4QR6A 5CPOA 3ABXA 3IJ8A 4EF9A 1W54A 3F2BA 4J2MA 3AXIA 1OFEA 1JGIA 2NSXA 3VOFA 2DUAA 2WHLA 3TVAA 2V63A 3WKZA 4O4VA 2BOFX 1TPH1 3EA2A 1FFQA 3KRUA 6REQA 1FH8A 3UQNA 1XYCA 4LCQA 4EKJA 3CL8A 1IV8A 3EPMA 4NXSA 3R79A 3ANYA 1W3NA 2JF7A 1JRCA 1FHDA 1XGDA 4E38A 1XF0A 3AMCA 4M5PA 1T8QA 3CJPA 5AYYA 4WIWA 1A3HA 1M7PA 4MDPA 1BVZA 3SRDA 2G8ZA 2E3ZA 1KCZA 5FJIA 4ICNA 2OOFA 2PTZA 5TF0A 3PUGA 3K8LA 3QHOA 3COTA 4OV4A 4IIGA 3UW6A 3IJQA 2DU2A 5C9XA 2ZTKA 1OG0A 4FXRA 1ZBCA 4HHMA 4PRTA 5E6ZA 3ARUA 3LZ3A 4DJEA 3WLOA 1K3UA 3MCMA 1HJQA 4C60A 1DWJM 3GNPA 3QFEA 3T8LA 4RDVA 1EQCA 2EJ1A 3DAQA 2GFTA 3L21A 1R85A 2QAFA 3CUHA 3N2TA 4MAZA 5FEXA 2WKJA 3CMJA 4JTJA 5CBBA 4WKHA 4KQNA 2W92A 3HZ3A 4LYKA 1DJHA 3T4CA 3ANVA 1HJXA 1UUQA 4RX0A 3WBEA 5CG7A 3RAOA 4L4LA 4MIMA 3LXBA 4LYPA 5DO8A 3DIPA 4UR7A 2ZRXA 4JTKA 1DL3A 3GS6A 3NQVA 3W01A 4O1DA 3M0LA 2OSWA 4HOXA 2A7NA 1HL2A 3SGGA 2HS8A 4IUGA 1US2A 4ECLA 2VZTA 2XIBA 4JZ5A 1VFFA 1K9FA 3GDTA 1UOKA 3C2EA 3WLJA 3S4TA 2XDFA 2YCIX 3FKKA 4C6DA 2PTWA 5HJXA 4CNUA 3AHVA 3KP1A 3BLLA 5C2CA 1XIGA 3M5YA 2HISA 1TV4A 4A8RA 4RZ5A 4ZCWA 2ICSA 5FL1A 1EOKA 3IAQA 3N6QA 1RLDA 1UP3A 4W85A 3SIMA 4Y6GA 3K30A 4O0QA 4ZQOA 1R46A 4OFCA 4C65A 4ZE4A 1WDQA 3R4IA 3NAVA 1TREA 1V3LA 3TK7A 4PRRA 3O6CA 4QJ1A 3K1GA 1N7KA 1GGOA 4WKAA 3NPWA 4UBPC