4YUDA

Crystal structure of a rna binding motif protein 39 (rbm39) from homo sapiens at 1.28 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
b'GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 39
publication title Crystal structure of a RNA binding motif protein 39 (RBM39) from Homo sapiens at 1.28 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yudA01
3S6EA 3OW2R 2D9OA 3G6ES 4M5DB 1PO6A 2HGNA 5DETA 3CCQS 2CQ1A 3PIOQ 4CH1A 2CPZA 1X4AA 4WCEQ 3NMRA 1KOHA 5CXTA 2MGZA 2M88A 3U1MA 4PRFA 3I56S 1FJEB 1X5PA 5DM7Q 1Q82T 1VQ4S 1X5OA 1G2EA 2AYBA 2KVIA 1UP1A 1VC5A 1HD0A 1YI2S 2M7SA 1YWXA 1H2VZ 1DZ5A 2YH1A 2DHAA 2KYXA 3UCGA 2LXIA 5D77A 2J0SD 1U1RA 1HD1A 3BO2A 1AUDA 3J7ZT 4W92B 1FHTA 2DNOA 3TYTA 5LJ5Y 1OIAA 5DDRC 1YITS 1YTYA 2DH7A 3SDEA 1WG1A 1WG4A 1WG5A 1VQ9S 2MB0B 2M52A 2O3DA 1N8RT 2ADCA 3G8TA 3R27A 3Q2TC 4F26A 5JVHQ 2LA6A 2M4MA 1Q86T 2L08A 2U1AA 1X0FA 1M90T 5FJ4A 3N9UC 2MYFA 1A9NB 2CQPA 1QM9A 3CTRA 2QFJA 3LPYA 1A7GE 1VBYA 2CPDA 2CQGA 2EK6A 2RUGA 3B4DA 2RNEA 2YWKA 2CQHA 4C7QA 3BS9A 3I55S 2XNQA 3THPA 2DHXA 3R1HA 1WWHA 1FNXH 2DNGA 3VAKA 2DNLA 2MQNA 3D2WA 2DNQA 1XN9A 1DHMA 3CMES 2CQBA 1WI6A 1UFWA 2DGVA 3US5A 3CULA 2OTLS 1W2BR 4WFAQ 1YHQS 2KT5A 3VAGA 1CVJA 2CPXA 2MHNA 5GMKa 2VOPA 2NZ4A 1S72S 2J0QD 1M5OC 4PKDB 2CPFA 2MSSA 3ZZYA 1NO8A 1WELA 3MUVP 1H2UX 2XS2A 2DB1A 1FT8A 3CF5Q 3VALA 1OWXA 4C4WA 4UY8T 1K73T 3S01A 2WBRA 2LEAA 4CH0S 4F02A 2QA4S 3UCUP 2OIHA 1Q7YT 2U2FA 1X4DA 2CPYA 3VAJA 2DGUA 3MURP 1WI8A 2MKIA 1YJ9S 1NU4A 4YB1P 2VODA 5DM6Q 2CQIA 3G71S 5GADU 1WEXA 2L9WA 3G96A 2LECA 2I2YA 1X4BA 2AYGA 2EVZA 3SXLA 5D78A 5CYJA 1X4EA 3Q2SC 2DK2A 2DGOA 3U1LA 3S7RA 4U67Q 2M9KA 3MI7X 3UCZP 2DITA 3SMZA 3EGZA 4QU6A 1VQMS 2LMIA 3P49B 2VOOA 2DNPA 2ADBA 5IM0B 2KXFA 1VQOS 3UE2A 1X4GA 2RU3A 1B7FA 1U1NA 1NJIT 2HZCA 2MXYA 3G9CA 5CA5A 3NNCA 3CCLS 1ZZNA 2KU7A 2N3OA 1VQ7S 4EGLA 2HVZA 4FXVA 1O0PA 2M0GB 2MQOA 1FXLA 2M8DB 1L3KA 3H2UB 4TU9A 1VC6A 2LKZA 2LA4A 5IQQA 4FXWA 1OO0B 1DRZA 3B4MA 1X5TA 3VAFA 2KH9A 4Z2XA 2X1BA 1FJCA 3MDFA 3VF0B 1H2TZ 1WHVA 1SJFA 3SDEB 3CXCR 3CPWR 4CQ1A 4TU8A 2F9JA 3J7YU 2MKJA 3TO8A 2RVJA 2MZSA 4Y0FA 1SXLA 2DIUA 5GAGU 2KN4A 4YUDA 4WF9Q 2KHCA 1UAWA 2LYVA 1DBDA 1KD1T 2GO9A 5DDQC 2KXHA 4LMZA 3IRWP 2LXUA 3VAIA 2JX2A 1QVFR 2DO4A 3NNHA 3IWNC 2GHPA 4ERDA 1KQSR 2UP1A 5HO4A 2MZ1A 1QVGR 4YOEA 1U1KA 2K3KA 2A3JA 2MJUA 3MD1A 2FHOB 1KOOA 1URNA 2MZRA 2CQ4A 2J8AA 2CPIA 2DNRA 4J5OA 2MQPA 2MZTA 4C0OC 2DH8A 3P3DA 2CQDA 3TP2A 2E5IA 1JMTA 2N7CA 2MKCA 5BJRA 4WKRA 1JJ2R 2LCWA 2RRAA 3BEGB 1YJWS 2AYMA 3NNAA 2CPJA 2KI2A 2DNKA 1Q81T 3MUTP 4LIRA 4QPTA 2LEBA 2CPHA 2F9DA 2MZJA 2PE8A 2SXLA 3NS6A 2XS5A 3HHNB 5IFMA 2DGWA 3DLLQ 2MSTA 5LXYA 2ZJPQ 1SJ3P 2DH9A 2YTCA 3K0JA 4PR6A 5ITHA 2VONA 1F9FA 1VBZA 4Y00A 2HGLA 1WHYA 1VQ6S 1SJRA 2E44A 3CCES 4WFBQ 1U1OA 1RKJA 4RU2A 2FY1A 1VQKS 3CC7S 2K8GA 4CIOA 1D8ZA 5DDOC 2YH0A 4TU7A 2BOPA 3LQVA 5JVGQ 1K9MT 2XSFA 1U1LA 1VQ8S 3PIPQ 2MQQA 4OZ1A 1WTBA 2X1FA 3BO3A 2DHGA 2JWNA 2MJNA 3UD4P 2DO0A 1YJNS 2KRRA 2RQCA 3CMAS 1U1QA 1R8PA 4QQBA 3VAMA 1SJQA 1WF1A 2CQ0A 3G8SA 3ULHA 2DIVA 2RT3A 2JVRA 1KC8T 3CCUS 2HYIB 1M5PC 1OPIA 2MZQA 1X5SA 3HI9A 4IOCQ 2MGZB 2N3LA 2DGTA 1N88A 2M8HA 4ZKAA 1K8AT 5EN1A 3BO4A 2DHSA 2Q79A 4TLQA 1WHXA 2V94A 2G0CA 1ZZFA 1H6KX 1HA1A 2CQ3A 3NS5A 2QEXS 1X4CA 3R1LA 5IM0A 2CJKA 3RW6A 1VC0A 2MY7A 1M5KC 2E5GA 1VQPS 2KG0A 1M1KT 2FC8A 2OSRA 3G4SS 2MQMA 2KXNB 5LSLA 2KG1A 2DNMA 5DDPC 3MXHP 1JJHA 3S8SA 3CC2S 4LJMA 5GAHU 1R8HA 3MOJB 2XNRA 2DISA 3V4MA 2DGSA 4IO9Q 3RW7A 3P6YC 2MY8A 4P6QA 2MKKA 1FJ7A 1P1TA 2CPEA 2E5JA 4BS2A 4QU7A 1YIJS 3THTA 1U1MA 5HL7Q 3DXBA 3ZZZA 1N52B 1VQ5S 2OSQA 2X1AA 3EX7B 4WFNQ 1VQNS 2X1GA 5GVQA 1ZH5A 2CQCA 1U2FA 1U6BA 2FC9A 4ED5A 2XB2D 1S79A 3CD6S 1SJ4P 2ZJQQ 2AYEA 1VQLS 1PGZA 3L3CA 1U1PA 2AD9A 3CCRS 2ERRA 1IQTA 3CCMS 1U6FA 5H1SV 1N54B 2G4BA 2DGXA 3FEYB 5LSOA 3UWTA 2OJ3A 2N82B 5GAEU 1JJ4A 1P27B 2MKSA 2B0GA 2DNNA 1RK8A 4W90B 1HL6A 1WEYA 2RQ4A 3UD3P 2G1DA 1X4FA 4A8XA 1WF0A 2MKHA 2XS7A 2D3OR 3P5TL 4V19X 1D9AA 1WHWA 3JB9k 3CCSS 2NLWA 4F25A 2F3JA 2DGQA 2JVOA 2RS8A 2BZ2A 2LQ5A 2MPUA 1X4HA 1VBXA 2D9PA 2KRBA 3CC4S 2HGMA 3CCVS 2MMYA 2DNYA 5LXRA 4UQTA 2DNHA 2L41A 2KFYA 1WEZA 2M70A 2YKAA 2PEHA 2I38A 2MQLA 2KM8C 5LJ3Y 3CUNA 3VAHA 2CQ2A 1FO1A 3FEXB 1UW4A 3EGNA 1WF2A 2E5HA 1M5VC 3MD3A 2ZJRQ 1BY9A 3H2VE 2JRSA 2M2BA 2DNZA 2J76E 3CCJS 2RS2A 2EK1A 4OZ0A 2RRBA 2KM8B 2OTJS 4WIIA 4IOAQ 5MLCV 2FPHX 3MUMP 4IUFA
chains in the Genus database with same CATH superfamily
1IM4A 3OW2R 1RP5A 4DV5J 3MGJA 4DPWA 4C8NA 1G7CB 2YNFA 1VFJA 1NDLA 5DM7Q 1VQ4S 4NLUA 3O5TB 4OYZA 2XBPA 1HLWA 5CH7B 1S0OA 4LUBA 4C11B 3GR1A 3OXGA 1FRXA 3M8QA 3KJQB 3MPVA 3LWMA 1HNWJ 1GXTA 3BKTA 4WYWA 3Q0AA 2EBEA 2ADCA 3BGRA 2LA6A 2EC0A 4LF8F 3AD8C 3KHHA 3N9UC 3NBPB 1A9NB 1HQUA 1KEKA 1TL4A 2FLLA 1NK7A 2YNIB 1DTTA 2QSFA 2RNEA 2YWKA 4NMXA 3THPA 1KDNA 3CO9A 2OPPB 2AJ4A 3TAQA 2HMIB 2B3TB 2ALYB 2ATLA 1XR6A 5D4LA 2VPWB 2ZKTA 2W2PP 2IC3A 4PG7A 3WDOA 2J0QD 4YQWA 3LWLA 2CPFA 2GJ2A 2QN6B 5HP1A 5FLXY 1OQ3A 3MR2A 2LEPA 1X9WA 1HNIB 1VS3A 1G4CA 2ZM6J 4V19J 5IC4B 1IBLF 3R3TA 4FNHA 3IRXA 2VU5A 5H9FK 4ALZA 3SXLA 1HHTP 2VQFF 2IIHA 2RILA 4OV1A 3O1LA 1IKXA 1Z4UA 3MFIA 1KONA 2CJ9A 1PJ5A 2AMCB 4O0IA 3MEGA 4B08A 1NJIT 2D41A 1UEVA 3OTBA 2JJ4D 2Z8QA 4KJIA 4ECRA 3DFEA 4IH5A 2UVUA 4J9VA 2PFDA 1I51B 3K5NA 4B3OA 4HACB 4KPCA 3HXMA 2XYHB 2ASYA 2ZH2A 2R8IA 1TR0A 4C8OA 4I6WA 3VF0B 4ANDA 1TP7A 2DXEA 5F8MA 2ASLA 3FQLA 2VA2A 2F9JA 3OHAA 1VLYA 3Q8SB 2KN4A 4DL7A 2KXHA 2NXCA 3WX4A 3OR2B 4ERDA 5AXLA 1L3UA 5C7PA 2F8MA 4G1QB 2MJUA 1RACB 3BSNA 3ILJA 5J2PB 4HI1A 3D6FB 2VD3A 2VBXA 4OI6A 1B0VA 2P8IA 1SV5B 1R0AA 1GXLA 2V67A 1FDAA 4QR0A 2AYMA 1GX6A 1IBMJ 4C8ZA 1RAOA 2LEBA 2B51A 3WX8A 5HQLA 3JSRA 4HL9A 1SJRA 1JLEA 1RHJB 4CIOA 4CO4A 2YH0A 1VI7A 3F56A 3U02A 1M0SA 1K9MT 1HWLA 1VQ8S 2MQQA 2VPXB 2XWYA 5KFYA 4KKOB 3MEKA 4LBIA 4F3QA 3P4UB 3M2RB 4GKJJ 3UDEA 1HBOB 4B9UA 1REGX 4M5GA 5EN1A 5B09A 3TUPA 6AT1B 2OEJA 3TZYA 2KKHA 1X4CA 1Z2LA 3NWGA 3RW6A 1M1KT 1FK9A 2MQMA 5LSLA 2BQUA 3GIRA 3N5FA 3CSKA 2HQ3A 4OZ3A 4J90A 3D0HE 3LGHA 4YB6A 1KFDA 3D67A 4DBQA 4A8QA 3T9NA 2AYEA 1VQLS 4ETZA 1PGZA 4M5NA 4NASA 3OBIA 1U7LA 4KPYA 2OPPA 1NSPA 5LSOA 2GHVC 4Z7CA 3K58A 1JJ4A 4Q8FA 3WZ0A 1S0MA 4TY8B 1F2HA 2LQ8A 3M7VA 3DCAA 4LF7F 2E5LJ 2B8QA 2BYCA 3DLHA 3ETMA 4DV2J 4LSNA 2MPUA 4GVBB 3GFHA 2D9PA 3ZTPA 4HDGA 3MEDA 2M70A 1LW0A 2MQLA 1HNIA 2V9KA 1D3WA 3VAHA 4X84A 2ZJRQ 4DV4J 3B82A 3SFGA 2XO6A 3HT3A 3RG6A 1BQMB 2EFOA 5AE1A 4OFZA 2JLEA 2D9OA 4OHVA 2HGNA 4KHRA 4MKVA 1S48A 3R6LB 2CQ1A 5ETKA 1RJJA 3M4XA 2QSWA 4JI2J 4Q5VA 2F4VF 5GADI 2WVCA 1UFLA 2FVQA 1OJ4A 1AB8A 1KQKA 3NGSA 4KFBB 2XY7A 4HACA 1TMMA 1QLNA 2ACYA 4AD6A 3DU6A 4I4BA 2Y0SD 4KQZA 2NSBA 2IDLA 1QAIA 1LWEA 3Q89A 1VIOA 4RW6A 1X0FA 4AYBD 2QFJA 5DLGA 1IR1A 3OR2A 3IM8A 4KHPF 3KJNB 1BE4A 4EBDA 4O0NA 2FLNA 2ILYA 1DJ0A 1T03A 4Q43A 2DNLA 3D2WA 2DNQA 2YKOA 2E29A 2NR0A 2EI5A 2QT7A 5CZXA 3SEOA 1YJRA 1ZM9A 1FD2A 3G82B 4LF6J 4HLBA 2CXEA 3MUVP 1O8BA 5ETOA 2XZDB 1PYSB 3TUJC 4DFKA 4CM0A 2G2YA 1K1SA 2VDHA 1SUQB 4QWBA 1TL1A 2EVZA 4HT7A 4TNOA 5CYJA 4GC7A 2F40A 4NLRA 4JV2A 3IG1B 4AUKA 2DK2A 2DGOA 5GMEA 2WSCC 1S6UA 5KFCA 2LMIA 5ETNA 3R5GA 1HBOA 2AGOA 2XWXA 5KFOA 3E01B 3VHQA 4JV5J 2MXYA 3MPYA 1IXKA 3UI3A 4LSLB 1Z2ZA 2VIHA 1LK5A 4ZLJA 1U8WA 3VAFA 3RRKA 1FRMA 1KLMA 3MEEB 4BWJA 2ZC3A 2DY9A 3TNVA 2VF3A 1Q95G 3MECA 1KS2A 2O5DA 4YP3A 2R7TA 3I0SB 4DLEA 3UPFA 4C3MA 4M5KA 3VAIA 3AAWB 3IWNC 4RWWA 1ZAXA 2UP1A 4DR3F 2A6MA 2YKMB 2ZNYA 2CJAA 3M2UA 1KBRA 3PO4A 1Y0HA 1RAGB 1BQNB 1ZPWX 3C3LA 1JMTA 1O5JA 5I4MA 3AOAA 3R7NB 3TJAA 3EGWB 5HROA 1CQNA 1ZA1B 3G2XA 2R7RA 2F9DA 3N4WA 3K0JA 4OYAA 2F1FA 1WHYA 1JWWA 4KGMA 4WFBQ 1S57A 5D3GB 2YKQA 1CSJA 2RU9A 2R7OA 4Q8EA 4TU7A 4PPZA 4J9KA 2FHJA 2XSFA 2CNLB 5AXNA 4DR2F 2MJNA 4P74A 2GFFA 3W5ZA 1DQ9A 3QGPA 1Q8KA 4DV3F 4BC9A 3MM6B 5A2QY 2CQ0A 3ULHA 1C0TA 1YZ7A 2KHDA 2V9WA 5RUBA 3MMCB 3HI9A 3H5XA 3OSPA 3GJTB 2FVRA 2PMHA 3O44A 4B3SF 3ONQA 1REVA 1S6PA 1S6QB 2HZVA 4C0HA 4YMEA 1FKOA 1N5YA 2QV6A 4EI2A 1HW8A 1WTFA 4OZLA 3TEHB 2CG4A 3AOCA 2N4CA 3OL9A 3K57A 3POTB 1L3VA 3MOJB 1QUVA 4XK8C 4ZCMA 1PIEA 2R8HA 3FSXA 1DURA 1P8GA 4RUHA 4N47A 1T94A 1U0SA 3IBWA 2BEFA 5D0GA 2X1GA 4X4QA 3AJDA 5EWGA 1TL7B 2W7PA 3BQ2A 2NXJA 3PJXA 2UUBJ 2OFHX 2RQMA 3QLHA 1Y00A 2DEIA 2V2ZA 4B17A 5ETRA 3UQSA 3PW2A 2AU0A 4ZVEA 3UN3A 1IKVB 3DC2A 3G82A 1U0HB 2HBRB 1RHUB 2A18A 2FVPA 1VDHA 3ET6A 3H0PA 2B56A 3IWLA 4JUZA 5KT5A 3CCVS 4LFBJ 4O3OA 4LR8A 5EWEA 2ZH6A 1SI9A 4R0JA 1BUXA 3EGNA 4LR7A 1FWLA 2WRMA 3R5DA 3CT9A 4DI6A 4NL5A 5KOXA 3IG1A 2IDEA 3MR6A 1MW7A 3I0RB 3MUMP 2A0FB 1U24A 4K5SA 2F8EX 2DD8S 4FBTA 2D69A 4OHYA 4ED8A 2ZNZA 1RQ0A 3E01A 1MWZA 2V68A 1FJEB 4A8YA 4TYAA 2UUCF 2LXIA 3GONA 1FD8A 5HQ8A 3PNIA 2EG1A 1F9EB 2NXUA 2DNOA 1FDBA 1S1XA 3MEEA 1Z1ZA 1WKJA 3MPWA 1WG1A 3J7A1 4F0MA 1PJ7A 4OZ5A 1BD6A 2MYFA 3H4DA 2XMJA 1CULB 1WC0A 4LFCJ 3MM5B 3D4JA 4FPRA 3PRBA 4O3NA 2YKMA 2DNGA 4YDDB 2PEBA 3SV3A 4HR2A 4LF9F 2X51A 1H98A 2AV5A 4ZPDA 5GAGI 1RT2B 3J81j 2CFXA 3PR4A 3TAPA 2QL9B 3NXZA 4FKXA 1PAUB 4USVA 4PUOB 2ZDPA 1RWVB 3FSYA 1K73T 3S01A 1F3FA 5HBMB 2BANB 4PG5A 1Q8LA 1TV6B 3N01A 5D3GA 2IRXA 1NU4A 1UJ6A 1FRJA 2DTJA 3MM6A 3VGVA 2GO8A 4QIVA 4I6YA 4BCAA 1JXVA 1PBUA 5IM0B 3MMCA 3PW0A 3UE2A 3QMQA 2QA2A 1U1NA 4I2PB 3T6JA 2KU7A 2HAFA 2BKPA 4OX8A 2MQOA 1S6QA 4MFBB 1DRZA 4ZPWR 1X5TA 3OL6A 2FTRA 2HFZA 4G1IA 2QG9B 1RU1A 4ECWA 3HVWA 2F8HA 2RVJA 4Y0FA 4ZLPA 2IVFB 5CQGA 3GILA 3D0IE 2V2VA 3NAHA 1QVGR 2UUTA 2I1RA 1RAHB 3LALA 3FKBA 2V8PA 4BC7A 1NDCA 4WP9A 2J8AA 2J0XA 2DNRA 3HHEA 3VTIA 5KG6A 2FGCA 2Z30B 2R42A 1RHKB 3NNAA 2HHPA 1KKHA 3GV7B 1RWPB 1SJ3P 2BBEA 2GIQA 4I69A 3A8EA 1B99A 4DF8A 5K8MA 5KOWA 1WJ9A 4OHZA 1UWBA 2DRAA 3OTOF 1NRKA 4F8RA 1MWQA 3OXFA 2YWHA 2JWNA 2WVFA 3EICA 2GC8A 2DPJA 1SC1B 5ETSA 4X4SA 1HHQA 2RT3A 1D09B 2CNKB 2MZQA 3DLKB 2N3LA 1WC6A 2V94A 1RYSA 3LTOA 3SQGB 1DTQB 1LV5A 3T1YF 3LP0A 4AQYF 4DL2A 2V4JA 4DFMA 4UY85 1LWFA 5HVFA 3LUYA 4CLZA 3C6UB 2YY3A 1SQGA 1FX4A 3O2IA 3N28A 2OP5A 2DGSA 4NLDA 4ZPAA 1P1TA 2CPEA 2VZ9A 4ELUA 1FDDA 5CCMA 1RTDB 4RU9A 4MH8A 2QA1A 4ED2A 3EVWA 4KE5A 5FLXU 1CULA 5KFXA 2BDPA 4ECVA 3MM5A 3VVTA 5BYSA 3BR9A 4A8SA 1IJEB 3QJPA 2HIQA 3DRYA 4W90B 4RW7A 2H9ZA 1RT2A 2B43A 3P5TL 3D1OA 1H7WA 3X3UA 2OPSB 4UOCA 2YWGA 2IJRA 4TXSA 4F25A 3IBFB 4UOFA 4WE1A 4PUOA 1WKLA 5CYQA 2RQKA 1N0VC 3L4BC 3M2VB 1GMWD 4ZVGA 2B4VA 4W98A 4PPDA 1BY9A 4J9MA 3IAS9 2HFUA 3PFEA 4I1TA 3BV8A 2FZCB 2GGPA 5CHCB 2AW0A 3A3PB 1SL2A 1VK8A 1SIWB 2RSQA 2RF2A 1RBLA 3PVXA 2O1PA 1HNXJ 5A6PA 2BRLA 4NYPA 4I2PA 4DL3A 3MTJA 4MIWA 3HSZA 3T1HF 1YWXA 2YKNB 3PZPA 2GVZB 4MFBA 3ZZRA 1QD1A 4PG8A 3ZZPA 1B70B 4M95A 3TYTA 1N6QB 1TVRB 1RE1B 4JBCA 2O3DA 4OQJA 3JYTA 2RDIA 1XC9A 2L08A 1BWVA 3CTRA 3KKFA 1NXIA 4NI2B 3OPKA 4LF1A 3A1YG 3ETOA 2CQHA 4C3KA 1YRTA 4OJ1A 2UUAJ 1ZAVA 2R8JA 1RADB 1I3OB 2HPUA 1XN9A 3J7YI 4K4WA 3DLEB 4DS5A 4ELTA 5EUHA 4LF8J 3IGVA 2VQEF 4PKDB 3QIDA 4OZJA 3PHEA 5IWAF 3VALA 3M6VA 2HBYB 1URRA 2FLPA 3HSJA 5A8WA 4CH0S 4QW8A 1MU2A 2VASA 1JLQB 3SCIE 1NSQA 3UN5A 5EGYA 3CCZA 3W1YC 2FZKB 2L3MA 3N0VA 4QW9A 3HHLB 3VV2B 3TA2A 4HHHA 1SC6A 2ZWOA 4YEAA 4FYDA 3CJ3A 3DLKA 8ATCB 3PJ9A 1IBLJ 3PW7A 3LPEA 3BPDA 2UXBF 1VQ7S 4EGLA 1FFGB 4NOHA 3SQGA 1HKAA 4DR1F 2IYGA 1S9EA 4AT1B 1OY9A 2LKZA 4H54A 3AA9A 3MDFA 1EQMA 3SDEB 4RKUC 3CPWR 1RTJA 2NUUG 1EJ7L 4DPXA 2E9TA 1XTZA 2DIUA 5DDQC 3TAMB 1RTDA 4ZHRA 2PI4A 4DSIA 3QGIA 1DARA 1J27A 3FBFA 4ZMMA 3GV5B 1RAJA 2CPIA 1K44A 2XLKA 9RUBA 3JAMY 2YVSA 2XCAA 3EVOA 4I56A 2VKZG 4RW9B 1YG0A 4O3PA 3K5OA 3K59A 1RABB 5KFGA 3MHYA 5LXYA 1Y10A 1T9YA 2BJ1A 5ETPA 2CJBA 2FY1A 2H5IB 2XMVA 3M1VB 4WTOB 4NZ7A 3V4IA 3HCXA 4DPTA 3LAKA 1U1LA 2UVVA 2ZE2B 3UW1A 1TKDA 2DO0A 1DQAA 1B0PA 2KRRA 1HBUB 3MCOA 4Y65A 1U1QA 4FKYA 3TW0A 1UL3A 2FVCA 1X5SA 3J81Y 2XMUA 2GIFA 1ULRA 2V4RA 1EP4B 1HNWF 3BDEA 1HA1A 3FVYA 3IAM9 3FNNA 1TL3B 1VRUB 3W2WB 3K7RA 3KK1A 4JP8A 3DU5A 4F7VA 3HULA 2C2KB 1JJHA 1RB0A 1S0NA 1TKXB 2ZKUA 2GVZA 1YRUA 3V6HA 3FGVA 5LL6d 3QT7A 4M1KA 4OI0A 1N6QA 3HZEA 1TVRA 3PJWA 4ILLA 2ZVIA 4L3KA 3B54A 4B3TJ 2EFNA 4HI2A 3C6TA 1U2FA 1U6BA 4MK8A 4NI2A 2XB2D 5E41A 3CJ0A 3HKZD 4DZDA 3HDSA 1K1QA 4YFUA 3MOZA 4IDKA 4O44B 5LM7E 3GTYX 4NMLA 2ERRA 3VCDA 2WBMA 3OTCA 5GAEU 1CS4B 2V2QA 2ILZA 3DLEA 1OMSA 3Q8RB 2ZM6F 2CDQA 2NREA 2FHMA 2JVOA 2BZ2A 2LQ5A 3DHWC 3ZFVA 3PM9A 1VBXA 1J5OB 2W8LA 1GNKA 3W61A 1VJQA 1JLQA 3QSIA 1M5VC 4LF7J 2B9WA 2YWWA 3H2VE 4B9VA 1GMVA 2RS2A 1DAXA 4FNIA 3HHLA 5J2NA 5KFUA 2B4PA 4PAAA 4JYAJ 4NLPA 4N56A 1NK9A 3NMRA 5CYMA 4DL5A 3C66A 1TK5A 3GIIA 1YZ6A 4QCLA 1PKUA 2HS0A 1Y3KA 2NYIA 3ZNUA 4IO1A 3NCRA 4MK7A 2W24A 2JHEA 2ALZA 3GIMA 2CZ4A 2HZAA 4WXOA 3K5PA 2CG8A 3M9MB 3AOBA 4B9LA 3HVAA 3SDEA 4DPOA 1Q16B 3PCOB 1Y7PA 1AW0A 4DU7A 3OL7A 2XQCA 3I31A 1SPBP 1A7GE 3AJ1A 2Z4PA 3PXGa 4F3OA 1WUUA 5SZTA 3ZZ0A 3T19A 3G86A 2EFVA 2HNDB 4LF5J 5KT6A 3PX0A 2DXDA 1KTVA 1KLNA 2L9DA 2OTLS 4CT8A 5D0EA 4LRCA 4KH1B 1HR0F 3QJJA 3H98A 4QR1A 2PC6A 4JV1A 3K89A 1RT4A 4HKQA 2WBRA 3E8OA 2WVEA 5EDWA 4GKJF 2OIHA 1Q7YT 3M1VA 3UR0A 1FRHA 2F7VA 4GMKA 4BHQA 1TTHB 1BMQB 3G96A 3HVTB 3W9JA 3RUBL 2X7IA 1S10A 3IBCB 1HBUA 1JJCB 3MR3A 3SMZA 4UQGA 4U95A 4NCGB 4RNOA 5ETQA 3CJKB 3SFUA 1EP4A 1HWJA 3MR7A 4XTTA 3W2WA 3KK3B 3ICLA 5LSRA 2QMXA 1N5TA 5DG9A 2B6AA 3B4MA 1UFKA 1U49A 1IJFB 4Y2MA 1TKXA 2OO4A 2XY5A 3RAQA 1R6VA 3W64A 3AODA 4NCAA 2KHCA 3DOKA 3GFXA 2W2MP 5HMZA 4WFYA 2JLGA 2JEJA 2JC0A 4ZP9A 3OFEA 1YVFA 5E3AA 2M5YA 2E5LF 4FS2A 4N8OA 5I3QA 1MN9A 4J5OA 4U96A 3W8GA 4DV2F 2N7CA 4WKRA 1RDRA 3QT6A 2E7WA 1UVNA 2LU1A 1HBNA 1TAUA 4DR3J 1NSKL 2YTCA 2QX0A 4JV0A 2N4DA 1NB7A 5H9FJ 2OPRB 4L3NA 1U1OA 4RU2A 5J2QB 2K8GA 1KSPA 2IA0A 2B9YA 3LA0A 1J5OA 4KYZA 4ED4A 2HHWA 4ZCLA 2HK2A 2DRDA 2DHGA 1JLAA 2GJIA 4JI2F 1TKTA 1WF1A 4NX9A 3QFHA 3SQOP 5L1LA 1TKZA 4K5RA 3ISZA 2POKA 3MAAB 4P72A 4Q7AA 1WC4A 2ROGA 4ZN3A 4DV3J 3BQ1A 2KXNB 1KP6A 2OLWA 2DBBA 4DR6F 3OUYA 2XMTA 3GYGA 4RUAA 1U8SA 7FDRA 4LVNP 3D6MB 4F3MA 2B5JB 4TKTA 2VH7A 2P6TA 2FJAB 4K4SA 5KG5A 4X4UA 1YJTA 4ILMA 2B8PA 4GO5X 2GIRA 3LGNA 1EHWA 4NEZA 1SJ4P 3RAMA 1YBUA 1FKPB 3Q8QB 1LNQA 3BGLA 5HJXA 2PT0A 1Y4ZB 2QZ8A 2WOMB 2IMOA 4FF3A 4PQAA 1UA0A 3DMJB 4ZVOB 3A4TA 1EKRA 4QWEA 2W01A 4RX6A 2KFYA 1RBOB 4ZP7A 3K8WA 1F5BA 5E3RA 3OR1A 2IHR1 2GHWA 3HVTA 4PEOA 4FXDA 3LANA 2DNZA 3MFHA 5D4OA 2ZHBA 3Q8YA 2IMWP 4DSLA 4IUFA 2WW8A 4CH1A 5B0FA 1AYEA 4F0HA 1Q82T 3H7HB 4MTPA 1F60B 8AT1B 3KK3A 1RZMA 3QT5A 3W8PA 2J0SD 4KV8A 3GQCA 1HD1A 4ECZA 5C2GA 2ZOFA 4DUYF 1YTYA 1KQGB 1RU2A 1XJWB 2M52A 5AE2A 1NAQA 2FHJD 3QAUA 3OVAA 3E3XA 3BH7B 4MT1A 3N6NA 4NYZA 4IFVB 2RUGA 4M94A 3ISNC 2UUCJ 2HFNA 4J9SA 3RRGA 1CG2A 2ZUAA 5M2UA 1RT7A 4KAIA 3VVUA 1SKSA 1YRXA 1DHMA 2CYYA 3F41A 3RGIA 5J2MB 4FDFA 3B8HA 1S5ZA 4N76A 1H38A 2MHNA 5GMKa 2VOPA 3G6YA 4HDHA 1WELA 1RT1B 4ZVFA 4AXIA 1T9UA 4F4XA 4DPYA 2XYGB 2OPRA 4ZIVA 2BOAA 3UVJB 2V8DA 3W62A 2J6TA 2AX0A 1R3NA 4Z7YA 3RBXA 2IJFA 3VGUA 2GVDB 2L9WA 3MM9A 2H48B 1KVIA 5HI7A 2QLWA 1MROA 4WIQA 2C1EB 4U67Q 1LWCA 4QU6A 2XG8A 1XNRF 5B7WA 2VOOA 4DQIA 2ADBA 1JB0C 1B7FA 1RAAB 2CJQA 3MAAA 5CA5A 4A47A 1IKWB 4KGZB 2DKOB 2HVZA 1Q0NA 1UZHA 3DRRA 3F44A 2CADA 4ZJQA 2UVWA 5E33A 1XR7A 2PIIA 1FESA 1QY7A 1VC6A 3AXKA 3L09A 2GNKA 1H72C 3MAHA 1WHVA 1RYRA 3P96A 3VGTA 3CJRA 3TO8A 2UUBF 2QFIA 1CC7A 4YUDA 4WF9Q 3GU0A 4WK1A 2LYVA 2HS3A 1RT5B 1Y9OA 2LXFA 2H5EA 1Q8BA 4IH7A 4DMZA 2MZ1A 4X66F 1URNA 2EFGA 2D1CA 3D7SB 3IR5B 1U2RA 2IYIA 4DV0F 4WXWA 1FKPA 2JFDA 1JJ2R 1V3SA 3KFWX 4LIRA 3ILIA 4G3IA 3FBBA 5HLFA 2JH3A 4HTIA 4QOTA 1RCXB 4KIAA 4ZPCA 3U7JA 2DH9A 2W2OP 4CRJA 5A76A 1VQ6S 1U2CA 1CQMA 4MK9A 1XWLA 1F0XA 1W2IA 4O4RA 1UZDA 1RAEB 5JVGQ 2BE9B 3RJMB 4F4YA 4HH0A 4NLQA 4A48A 2RQCA 3CMAS 4GO7X 5B0DA 4QQBA 3LGMA 1AZSB 3PX4A 3H8YA 3N79A 5KT7A 3CD0A 1HI1A 3M32B 1FJGF 3HMJG 3OTOJ 3G6VA 5KTQA 2CQ3A 1T8EA 2QEXS 1WSRA 1SC4B 1CJTB 2FC8A 4NLOA 2IPOB 2XM3A 3CD7A 1FKAF 4J9PA 3OHBA 2XC9A 3QZ8A 1R8HA 2PO4A 1HPZB 5A8RA 1RWNB 5JMNA 2O67A 3NOGA 4AXJA 2YQ3A 4FVMA 3GSIA 3Q83A 1U1MA 3T1YJ 3M6XA 4WFNQ 4DQQA 4AQYJ 4FYWB 1NK0A 2DYAA 3CD6S 2ZJQQ 5DLFA 4O3RA 4P52A 4CO5A 1CPZA 4CO3A 2ZHOA 3Q23A 5DO2A 3DNCA 1O6XA 3ZO7A 4DZ6A 1KVJA 4MIAA 1KHVA 3M8PB 2GJFA 1NKCA 2PFFB 2Y9HA 5L9NA 3BQ0A 2HIYA 2F3JA 1RT1A 2XI2A 3PX6A 1Q78A 3UO0A 3KTQA 5LXRA 3LH2S 4P9SA 4ZS6A 4TN2A 4PXCA 5A8KA 2UU9J 2OHDA 1FDNA 2GVDA 3DOMB 4L76A 3DM2B 3CCJS 4ZVSB 4OZ0A 5KFZA 2KM8B 2AJQA 1RTHA 2DPIA 4NA3A 4RR5A 1UVLA 2YQ0A 2C3PA 1L3TA 3BPSP 5K14A 4WCEQ 3U1MA 4Q44A 1IKWA 2CUYA 3LP2B 1VRQC 1H2VZ 2E1RA 2RH3A 5AT1B 5ETTA 2YH1A 2Z56B 4DV6F 2YNGB 1WSVA 3HFVA 4AL6A 1EETB 3EPIA 3T6BA 2X3GA 4WPAA 3QNWB 1Q86T 4KC5A 5FJ4A 3MPUB 4NLGA 3T1HJ 3NRBA 2RAQA 2XSJB 4NZ0A 3S1TA 4EMDA 2MLYA 1LQ9A 2NPFA 3LO3A 5E0OA 4OJGA 5THWA 3SBMA 2CDRB 3JSMB 4BBYA 3FCVA 3IA0A 3CMES 1WI6A 3A3NB 3GYNA 3KLIA 4IQXA 2F5GA 4P2SA 1XNQJ 4X4NA 1CVJA 1CC8A 2NZCA 4WBFA 2HHHF 4GVLA 2DB1A 2H65B 3CF5Q 2Y1JA 3J81U 1OWXA 1UVIA 4KR0B 2QA4S 3AFGA 4OX7A 1XMQF 2LLZA 4EU0A 3HHLC 2VC0A 3MF5A 4V1Ak 1X60A 4O3QA 4ATNA 4ZDNA 3G87A 2LECA 1Q1KA 4OX9J 4ZVUB 4E8UA 3Q2SC 5IWAJ 2BJDA 1AZSA 2YNHB 3KMSA 4I7FB 3QIPB 4ZP6A 2KXFA 3NCPA 1NJXA 5DQIA 4ZIWA 4KO0B 2GQCA 2B4OA 5B0EA 4NLTA 3VWSA 3ISND 2E7VA 4J9LA 5LMNF 4FXWA 2ZH1A 2FY8A 3ITHB 2VUGA 3QAEA 3FCHA 4XDDA 2J7UA 1HPZA 1OPZA 3UD5A 5HMWA 2H4YB 3IRWP 1SVDA 2DO4A 2V50A 2HFSA 4I64A 4P2XA 1WOOA 2OPQB 2B7CB 4C8LA 3EUNA 2Z2LA 3SZ2A 2IY5B 5EHHA 2MZTA 2LP4A 4CLYA 2HHTA 2VG7A 5E7OB 1T05B 3BEGB 4ECXA 1T9VA 4PABA 1W26A 3D1QA 3QBCA 3B78A 3M8PA 2H5JB 4B9SA 4UT4A 3QSYB 1CJKB 2O66A 3KLEB 3Q8UA 2BOPA 1SH3A 1PSDA 1H7XA 1R8PA 3TA1A 3EXYA 2I6WA 3GJRB 2BABA 3DM2A 1SH0A 3H5SA 2HYIB 1JLGA 3W9HA 2UXCJ 2MGZB 1XEZA 1K8AT 3KJVA 1V5VA 1K47A 1J2VA 3C15A 3NS5A 2RKIB 3R2DJ 5A0YB 4RJVA 2CWKA 2E5GA 3G4SS 2G9OA 3FBEA 3SIPB 2DNMA 3LP2A 3SSRA 3TZXA 1RBAA 2AEJA 4QPXA 1M1HA 4Z37A 3DLGA 2EW9A 1FRLA 2DISA 3D5MA 2YNGA 2DXFA 2UUAF 3OXLA 2KZZA 5DZ7A 4F04B 4DX7A 3OV7A 1CBKA 3WC0A 2QJ3A 1GTHA 2MQ8A 3H40A 5GVQA 3KLFB 3OFGA 3T5JA 2FD2A 4DV7F 2ZZNA 3ZTOA 2DGXA 2OJ3A 3H25A 2MKSA 5AXKA 2OUGA 2R9LA 4USJC 2I5JB 4V19X 1D9AA 1OYEA 1RTIA 4DLGA 1RISA 4KSEB 3JQKA 1S1WB 4Y2KA 2EPIA 3GCWP 4YHHF 1T3OA 2Z2YB 1T02A 4ANCA 3CUNA 2ZC4A 1FO1A 2CZVC 3NY0A 2R4FA 4RW8B 1MWYA 3QRQA 2Z58B 5L1IA 2QTWA 1QUPA 1M5HA 2J76E 1C1BB 5CZVA 3BGUA 4X65F 3HHDA 2BE7D 1NMEB 2JDJA 3PG9A 5DETA 2RE1A 1YJUA 4I68A 3ILLA 2KJVA 1X4AA 5I3PA 3H5YA 4RNFA 4KO0A 1X8DA 1NPKA 2C2OB 3PR5B 2AYBA 1IBCB 2DJWA 1F1BB 1CJUB 2DHAA 1TFWA 2CNOB 5L38A 3J7ZT 3ITHA 2EWHA 2GMLA 2KFZA 2R8KA 1ZOTA 2V8VA 4X62F 1TU0B 4F26A 1SKUB 3J80Y 5F8NA 3F0NA 2HHVA 1QM9A 4LF4J 3LPYA 1WC1A 3DRXA 1SL0A 4DFJA 4QJVA 4M5LA 1I6JA 2V69A 1I94F 3HO1A 4PQUB 5F8HA 4ER8A 1D9FA 4ID8A 3G8QA 5JJBA 3SYZA 2M3DA 4X64J 2R7QA 2E9RX 4KGVB 1RTZA 4J9UE 2XS2A 3CO0P 3D3BJ 1CJKA 3KLEA 4JI3J 2C3MA 1P9YA 4QWAA 2DGUA 4JI7J 5K20B 4RW4B 5DM6Q 5K9FA 1WDTA 3KUEA 2FVSA 1N0UA 2AYGA 1HR0J 4WU2A 4LBHA 2WCXA 4RPFA 1Y11A 2H51B 5KFBA 1QSLA 4HTJA 1FVSA 1X4GA 4G65A 3G9CA 2OELA 2ZBRA 3CIMA 4K4YA 1IUJA 2LA4A 5IQQA 1VRTB 4B3TF 4UUWA 4DL4A 3O6QA 2HS4A 1S97A 3EZ5A 3QGHA 3CXCR 5B0CA 4J91A 4C11A 3TI0A 1C4CA 4N41A 1HW9A 3FK4A 4WU3A 1DBDA 3BREA 4LFAJ 1RA6A 4WJBA 5C24B 1B0TA 1YJVA 4PWWA 3PTWA 3RAXA 2JLFA 2K7KA 2VKRA 3NBPA 5FIIA 3NS7B 2W7AA 4C0OC 2YNIA 2H3EB 1HNZJ 1HWIA 3ZZUA 2HQDA 1YJWS 2CPJA 5L46A 4USIA 2BA9A 2HMIA 1X7VA 3CJSA 4JB8B 1FFSB 2QIFA 3AQPA 1LXJA 5CAAA 2IFXA 3TRGA 1Q5YA 3WIUA 1MN7A 2R2RA 5FDLB 3PRDA 4EO6A 3BJYA 2QMUB 3CCES 3HFZB 3KHGA 3CJ5A 3CC7S 1RHQB 2VJVA 1ZTTA 4CLUA 4L6V3 1R0CB 3CDUA 3GP9A 4JYAF 2OD6A 4OZ1A 1WTBA 2X1FA 5D0HA 2BM0A 1C1CB 4RW8A 4MAKA 3DYAB 3BYRA 2UXDF 1SQEA 2WTFA 4OZ2A 2JVRA 4ZLLA 1U09A 1OPIA 2EFPA 1FRKA 1N88A 3OJSA 5F0WA 2Q1LA 3RR7A 1PG5B 3R1LA 4QYZK 3NLCA 3I6PA 1VQPS 2KG0A 1O51A 2EFQA 1HNVB 1GK8A 1QAXA 4K4TA 4NRUA 2FIUA 3UR3C 1CJUA 2HQGA 4LJMA 5D0RA 5GAHU 3J7AN 3VZHA 4C0BA 3PEJA 3RTVA 1YBTA 5KG3A 2ASJA 4UW2A 4DWIA 3M8YA 3EM1A 4Q0BB 2DR8A 4LF5F 2GCFA 5F8GA 1FWPA 4K4UA 4ZVQB 5HN0A 4FN5A 1T95A 2N7YA 4DR6J 1G6BA 3TANA 1U26A 4G1QA 3JSYA 1N54B 5J2PA 1VQSA 2HK3A 1P27B 5C25B 4NXMF 2HHUA 1WD6A 1G1XA 1SV5A 2ZFHA 5KT2A 3QYYA 2IAJB 2VPYB 5DZ6A 2W2QP 1ELOA 3BZQA 5G0RB 1UPPA 3NGDA 3BGOP 3CC4S 3T3FA 2DNYA 4ES3A 2YKAA 3RU0A 1T11A 3GYXB 4OJ3A 2R7UA 2Y8YA 3R9LA 4K50A 1KWMA 1KN6A 1RWWB 4NA1A 1R8AA 4R5PB 1J5EF 1TL5A 4IYQA 4KKOA 4LIWA 1AROP 2W4DA 5M2RA 3M2RA 3W5YA 1TK8A 2QO3A 1PC5A 2OKQA 3EZOA 2DR5A 1Q79A 1AFJA 3I56S 4CM2A 1X5PA 3ZZOA 1G2EA 1S7HA 1Y3JA 2OH2A 2HVIA 2BW7A 2KYXA 5K5MA 5D77A 3UCGA 3OLAA 3MPDA 1VRTA 2RMLA 2BQ3A 3W5XA 3BO2A 5LJ5Y 2UVRA 2OMOA 1R27B 1WG4A 1QAYA 3KK2B 1R0BG 4RNMA 1M90T 1GFWB 4L75A 3KJFB 4J9RA 3BB5A 2G0IA 1JKHB 3AD7C 1DQ8A 3TZZA 2IVMA 2NCKL 3NEKA 4A8FA 2DHXA 3DRSB 3NKYA 1WWHA 4OYMA 4DUYJ 4UZCA 1D9DA 1V3ZA 2ACMA 1UFWA 3TX8A 2DGVA 1L3SA 3US5A 1UPMB 3HT0A 4K8RA 1HBMB 3DI6B 2F63A 3PHTA 2BE2B 5KFVA 3MM8B 3BR8A 2G13A 2HWHA 2MSSA 2C22A 5DS7A 4TY8A 2VV5A 1FT8A 1GH8A 2WHOA 2JL9A 3AY0A 4RL1A 1NDPA 1VJWA 2F65A 1XK8A 4URGA 4B3MJ 1RAFB 2LU2A 2HW3A 3T5LA 2V2KA 2CPYA 2MTLA 3RB3A 3MURP 3I96A 4GVBA 5KAKA 3VQTA 4YB1P 4DV1F 1RLDA 3G71S 3W60A 3MAQA 3HJVA 5HAOA 5HATA 1C1CA 4C48A 4OHWA 4ZVTB 1BQXA 3DYAA 1ZPVA 4K0KJ 3DXSX 4MIBA 3MMAB 3M9NB 4DFPA 2PA3A 2DNPA 1LW2B 4PWDB 1N56A 2GA7A 3A8KA 5KFJA 3DOLB 2QGFB 4CTAB 1BQMA 4DXLA 1U02A 1FF2A 5C42B 1EQ0A 1L3KA 4ZCKA 2J9CA 1HNVA 4ED7A 4Z2XA 1FJCA 3C14B 1SJFA 1H2TZ 1XNRJ 2MLXA 5T7LB 4KFBA 5KFMA 1F5CA 3GV8B 2XULA 3TJ9A 2GO9A 4LMZA 1VLOA 3CDBA 4Q0BA 2VB6A 2Q6BA 2GHPA 2EEYA 3O3LA 3L9ZA 3DRPB 3HD2A 2CVEA 5J1EB 3HD1A 2XHWA 2P2CB 2CQDA 2FJEB 2LVWA 3CVKA 2PMWA 2KI2A 1V3RA 2IBOA 1OY6A 5C25A 3MUTP 3V6DB 3KUGA 3UDLA 1FFWB 1VYAA 1LXNA 2MSTA 2YX4A 4X66J 4LRFA 2PGCA 2E44A 3E2EA 5G0RA 4Y28C 4F2SA 4DV0J 2FLOA 1UJ5A 4QR2A 3RBEA 5GAEI 4P2FA 1B64A 2COLA 1SUQA 1YJNS 1NM2A 2A6OA 3WQPA 3TVYA 2C2MB 1M5SA 2K1RB 3DDNA 4R5PA 3CCUS 4P2MA 2HBQB 1I1GA 2YNFB 3EYZA 2G0CA 2WAQD 2J6SA 4X4OA 3NAIA 1NZ8A 2HLTA 4E2FB 4FYXB 5KFHA 1VC0A 5CCLA 4ES2A 1RI7A 3M8QB 3TQEA 3PDNA 4CI0B 5DDPC 4L74A 2EBGA 4HHJA 3KG1A 1DFDA 4LSLA 3CDAA 2GAGC 4YN3B 1JK9B 3R5BA 3BGRB 2XNRA 3TUIC 1FJGJ 2D3ZA 1HQUB 4TYBA 3QZ7A 1DTTB 3PFOA 3ZZZA 1VQ5S 3EX7B 1VQNS 3I0SA 4UTGA 2B9EA 1JKHA 3CW2C 1S12A 3L3CA 4NLVA 3PYGA 3V2UC 3DRSA 4EYIB 3D68A 3FEYB 1BQNA 4FVCA 2ZH8A 4A8XA 1HBMA 3U1NA 2BE2A 5HP1B 2PSZA 3MM8A 2ZH9A 3OL8A 3T5KA 2XMMA 3OQ2A 1QTNB 7FD1A 4DR7J 2VL1A 3GPAA 2KRBA 2VBYA 4IKAA 1IBKF 2W8KA 2KM8C 3A3OB 1HFEL 4Q2MA 3CIZA 1U45A 1VR6A 1IKXB 1YDLA 3M6UA 1TFYA 2VA3A 4KGKA 1NPRA 1HQ2A 3T1AA 1U4BA 2YBVA 3MEGB 1HWUA 3MMAA 2EKNA 4LRDA 3S6EA 2Y0BB 3KWMA 3HSDA 2ZH4A 4USKA 2P9GA 3CCQS 2BJEA 1C4AA 5CXTA 3I5CA 5KFDA 1IN0A 2ASDA 1JNRB 3C8YA 5LT5A 2XEXA 2AHOB 1E6VB 4DX5A 1Y5NB 4W92B 2QYGA 4QIWD 4F4ZA 4EEYA 1NJWA 1S0VA 5T7LA 1N8RT 3POTA 5JVHQ 2MLZA 3GB0A 4N77A 1HI8A 1MLAA 1LEOA 4HT5A 4CP5A 3DRPA 4DV6J 3NWRA 3I55S 2YXLA 3MR5A 5J1EA 5F9NA 1TL7A 3HP6A 3KG4A 4P71A 2C3YA 3I32A 5F41A 1VISA 2GS8A 1OSCA 2E1MC 1M5OC 3MCMA 1NO8A 3V6DA 5LOQA 4ELVA 2QLBB 1IKVA 4LRBA 1S59A 1U0HA 4RLEA 5ADZA 5KFSA 2J7KA 1ITPA 4DX8H 2G2ZA 4DN0A 3RBZA 1YJ9S 5DG7A 1TUGB 2IRYA 1WOPA 5D78A 4QYRA 2HHHJ 2V63A 3U1LA 1G3OA 2BJ8A 2WW4A 4ZN1A 2DITA 2K1RA 1XMQJ 4OI3A 2KO1A 4DPUA 2HNZB 3I0RA 1FK9B 5ETVA 3NGUA 4W4MA 3KMQA 1O0PA 4DOZA 2DCLA 4JI8J 1U48A 1JLCB 5K8PA 1ICEB 2OEMA 3MMJA 5CD4H 3M05A 5KFTA 5L1JA 2GW8A 1GAOA 1SXLA 2OEKA 4X4PA 4DL6A 3UDCA 4U9RA 5LMUF 5LMNJ 2OI2A 1RT6B 1H0HB 2BJ7A 1SCJB 2BM1A 5T41A 3IP0A 2MZRA 5D4PA 1F3VA 4GKKF 3TUZC 2DH8A 3ENWA 2E5IA 2RRAA 5KFNA 1ZM2A 4QPTA 2CPHA 4LSNB 5IFMA 3NOCA 2UU9F 5I3UB 2H1YA 4WZQA 3DLLQ 4XAKA 3GZ7A 5F8LA 1RHRB 3PKMA 4PR6A 3MEDB 1LW0B 2J0WA 2HGLA 5GMDA 2J5AA 1RKJA 5D8HB 1WDDA 4WK3A 2RRNA 3AA8A 3LQVA 1FERA 5HBMA 3IO1A 2BANA 2R3VA 3Q22A 3UD4P 1TV6A 1ZAWA 5DG8A 3VAMA 3C16B 4HHUA 5E3QA 2DRBA 2RHSB 3HSGA 4FF1A 1APSA 3J80U 3BKUA 3KLGB 2Q79A 2R7WA 3LF0A 2HHSA 2G2OA 4IQMA 2HBZB 4R25A 5IM0A 4UF4A 3NP5A 3D9BA 2NS1B 3CC2S 1LWEB 2BKOA 1E6VA 4RW6B 1IQZA 4ED0A 1UEUA 5J1PA 1UTAA 1RKIA 4I6AA 2XI3A 4DUZF 2E5JA 1LWXA 4IG0B 5DQHA 4RNNA 2DR6A 1XNQF 2Q66A 1PYTA 3ENVA 4DCJB 1KNZA 3M8SA 1T03B 4OYOA 2E66A 2FC9A 3OFHA 1BC6A 3LOUA 3E51A 4PG6A 1U1PA 4H4OB 2HLUA 1VK3A 3CCMS 2G4BA 3PW5A 1HL6A 1KR4A 3D66A 3CCTA 4H4MB 5F0UA 4OX9F 2RS8A 2W2NP 1TELA 4DV7J 4UQTA 3QRRA 2FJWA 1TL1B 4F36A 5LJ3Y 1TMJA 1OQ6A 1S1UB 5AXMA 2VC1A 2JRSA 4U8YA 4F4KA 2J6UA 5SUHA 1TK0A 2W4CA 4YHHJ 4FBUA 4WP3A 1AXQA 2CPZA 4B02A 3SCKE 2HNZA 3PACA 1W25A 3ZTSA 1GMUA 4X4RA 5D6GA 1KLMB 1YSJA 2M7SA 2ZHAA 1E6YB 1PBAA 1DTQA 5HJYA 5L9XA 4X65J 1KTQA 3QPIA 4NWBA 1VHFA 4PCQA 2VG5B 5IV3A 3MECB 1JLCA 1AUDA 4WFXA 1FHTA 2PDAA 3C6UA 3RZAA 3IGNA 3OFFA 2Q43A 1KHWA 4LR9A 3HFKA 1H3DA 2QA4G 3M2UB 3FBCA 3Q8VA 3B6BA 2QE5A 1ZM3A 1RT6A 4OJHA 3ENAA 5HROB 1T9TA 1FI4A 5KG1A 4X62J 5D15A 1IKYB 2MHEA 2QRRA 3VAGA 2CPXA 4H4KC 5L1KA 3MCNA 2ZEJA 2EKYA 2F4FA 5I3UA 4C4WA 2J7WA 2OPSA 1S77D 3WIVA 1I94J 3NCQA 2DY1A 4NZ6A 2CJYB 1Q53A 2UXCF 2XZWA 1XMOF 3BBFA 1C0TB 1WORA 2V34A 2DVIA 3KHLA 3M2VA 5KFFA 1PCAA 2M9KA 2HAIA 3C16A 1MMDA 3PYEA 4NLYA 4D3GA 1NKEA 3CCWA 4ZA1A 2AQ4A 1VQMS 4K4XA 1REVB 4E98A 3PW4A 1U6ZA 1S6PB 2FJDB 4RNHA 1FNMA 1VCTA 3A13A 1FKOB 3KLGA 1Q7LB 1N5YB 2PA8D 3C19A 2AX1A 2IM3A 2GQ2A 1QDUB 3TWZA 2NXNA 4TU9A 1FA0A 4EZ6A 1HQEB 1NPPA 2XYPB 4RZRA 1ZA2B 2KH9A 2X1BA 3U27A 4M5HA 5ETMA 3I87A 2ZOMA 1UMJA 2YKNA 3FRZA 2MKJA 2AGQA 4WTYA 3TVZA 3W65A 1R6YA 3N6MA 4AFFA 3JTOA 4R8UB 2C2DA 3NNHA 2JX2A 2KJWA 3SCJE 2BX6A 4U7CA 4IG0A 2QYCA 2G0JA 1HWKA 2K3KA 2FJXA 1KOOA 3QLHB 5MAOA 5KFLA 4MMOA 5IT4A 2CQ4A 3OVBA 1X9SA 2ZH7A 1N48A 3V6JA 5D4NA 4H4OA 5BJRA 3KNAA 2DNKA 1BWEA 4P73A 3ET6B 2BUNA 2XS5A 4JI6F 3HHNB 1HMVB 2Z2ZA 3CWJA 2UUWA 2Q3PA 4H4MA 1VQKS 1D8ZA 2XO7A 3D28A 4K2XA 3CJ8A 2ROEA 4ETXA 3GJSB 2C3UA 1D8YA 2BRKA 2Y3YA 4PYDA 4C3LA 4PXDA 1S1UA 4JI4F 2YWEA 1KC8T 1M5PC 1T0TV 2ZWPA 1SKRA 2P5VA 2YX7A 3C2PA 1UA1A 3CMQA 2ZVSA 3M8RA 4M5JA 1S1XB 2UXDJ 4LF4F 1E6YA 1N33J 3EGVA 1YJ7A 1NK8A 3O8WA 2VG5A 3GG1A 1BLUA 4G1PA 3RW7A 3P6YC 1H73A 1FJ7A 4UZBA 2I9SA 4ECTA 4ID5B 3AHPA 1UETA 2OSQA 2X1AA 1ZH5A 4N8NA 3TEGA 4X64F 3JSBA 3R5CA 5AE3A 3TAMA 4LT6A 4S0MA 2NPIA 2QL5B 5IV4A 4TQSA 4JI3F 3GE9A 2N82B 3HHKA 3KHRA 1RK8A 2RQ4A 1IKYA 3EE3A 4JI7F 4F4AA 3MTKA 2DR9A 4RW9A 5A2QU 4MKBA 3HJFA 1TUVA 4ED3A 2A2DA 1V5IB 2VBZA 2K3IA 4UUXA 1OY8A 1WEZA 4LREA 2HNYB 4YDXA 4Q45A 3A8IA 4NXMJ 2LQBA 2RHQB 2DCUB 5K8NA 4ECQA 3RBDA 3EWGA 2JC1A 5HVHA 2ZE2A 4PZVA 3FMWA 3UFCX 2AP6A 4CLKA 3CE8A 2CRLA 1KOHA 1X5OA 1VBKA 3NG8A 2ZZTA 4LFAF 2BMBA 4ECSA 1J5EJ 1TL3A 1VRUA 2B7BB 3R7SB 1HQEA 4DR4F 5T14A 2C42A 1W7WA 2ZDOA 3R5AA 3HLUA 4DCPB 4OX6A 3Q2TC 3BGFA 1HNZF 4ZOSA 3JS9A 2E1AA 1RT3B 3CJ4A 4R8UA 2CPDA 2K7JA 2HEKA 3B4DA 4A8OA 4C7QA 4JI1J 2XNQA 4USWA 1FRIA 2O01C 1ROFA 5HSPA 2HKEA 4ZCIA 4O44A 1W2BR 1FE4A 1QSSA 2R2UA 4A8WA 1RWUA 1CS4A 4IRKA 3EVMA 4Y3CA 5IZHA 1UWBB 4ZPTR 1HMVA 5KFAA 1NK6A 4UY8T 4F02A 3BDPA 3QWUA 3UCUP 2Y1RI 1YLXA 4O23A 3VAJA 1OS5A 2NUHA 2ZH3A 1UJ4A 2IM1A 1X4BA 3FZ2A 3QGGA 5ETLA 4HYKA 1JX4A 3S7RA 1N5QA 3UCZP 4PXBA 4FF4A 3ZXWA 3GG0A 3AB4B 2CVIA 1VQOS 1R89A 3LP0B 4OYBA 2HZCA 1RHMB 1ZZNA 4DV1J 2V4JB 3L7UA 1R8CA 1HYSB 4FXVA 1LWFB 1OSDA 3TA0A 4XO0A 3H2UB 3FMBA 3IM9A 1WNEA 1GEHA 3M8WA 1RAIB 2W9AA 5K8OA 1I5OB 3SV4A 5A6WA 2RDDA 1N32F 4YB7A 1UAWA 2FB0A 3CGIA 1RUSA 1QVFR 4ID5A 1JIHA 3EZUA 3OTEA 2MQPA 4RW7B 4MJKA 4E0DA 1AUSL 2A1BA 5DGBA 2HNDA 2G1HA 4CCHA 3JQJA 5JUMA 4WE1B 1YK9A 5CYQB 3MM7B 3DGPB 5ITHA 2VONA 5B08A 3PEHA 4Y00A 4ZLNA 3T5HA 3V81B 3ZNJ1 4ZJLA 1EZZB 1BXNA 2HNYA 2RB7A 3GLJA 2GGPB 4EBEA 2V8HA 1X9MA 1SJQA 4CO0A 2Q6CA 2RF2B 5H9EK 4B3RJ 1FTRA 4USHA 3A12A 2MEWA 2P6SA 2AJ0A 4IOCQ 2C2ZB 2DHSA 4TLQA 1MG7A 1X0PA 4NCGA 2WONB 2CJKA 3CJKA 1M5KC 1C0UB 3V5RA 3OVSA 2DR7A 3MXHP 4FP9A 4DSKA 1SC3B 2J9DA 2AEMA 4Y6IA 1T9XA 2RJZA 3JYTB 3FZBA 4JI5F 1N5VA 3I9V9 5F8IA 4ZPBA 2RDJA 4EFAC 4P6QA 2MKKA 3CB4A 4F67A 2FDNA 2UZAA 2VFSA 4QU7A 5HL7Q 3DDKA 5KFQA 4DSEA 1RT3A 4ES1A 3NGKA 1RWKB 4DJBA 2AD9A 3CCRS 1IQTA 1FWKA 5E5NA 3D3CJ 4B3MF 1S1VB 2RD5C 5DJBA 3W9IA 1WF0A 2D3OR 4QWCA 3HK2A 5A8WB 1RSCA 1IR0A 1MU2B 4LVOP 4ZP8A 3QQCD 4K0KF 3H90A 2DNHA 4URQU 4XPCA 1V6HA 4FF2A 5BR8J 1WC3A 1GX5A 5J2QA 5C2CA 1XIQA 2E5HA 1FTCA 3RB6A 3WC2A 2OTJS 2W9CB 3JXOA 3IWXA 4IOAQ 4QYZJ 4DX6A 2BR0A 4M5DB 1IBKJ 1S9EB 5F3ZA 2B9XA 3ZZTA 4IRCA 4QBUA 1HYSA 2V8GA 1DZ5A 2Z2MA 1FX2A 1RTJB 1ZTWA 3OTDA 4OI2A 3VR1A 1NH7A 1AT1B 3TZWA 2KL8A 4F2RA 2FQQB 3LP1B 1VQ9S 4C9DA 4N7TA 4ZHRB 3FC9A 2M4MA 4CLWA 1TZ0A 2BJ9A 4YR0A 3FSIA 2JEFA 1HHSA 3R6GB 2B5JA 3M8ZA 1PILA 4O3SA 4F4WA 1NHKL 2XTJP 3BS9A 4D3HA 4KGXB 3QFWA 4AE5A 5AJ3J 2AZ1A 2MQNA 1IR2A 1GQEA 4IR9A 1XMBA 3IMQJ 4GRSA 3CULA 3Q24A 4NA2A 1MMLA 2BJ3A 1SKWA 1KFSA 2NZ4A 5U47A 3LAMA 3SSQA 5DQGA 1S7IA 4EBCA 1N34F 2WOMA 3V4IB 3MM7A 4K4ZA 3DGPA 2PI5A 2Z0GA 3R97A 4CH7A 1TQLA 4NLWA 2U2FA 3DMJA 4FYVB 3V81A 2C2RA 4YY3F 3RB4A 5GADU 2J9EA 3KLVA 1UCNA 4P7TA 4EZ9A 5JXSA 1F5AA 3FRYA 4EO8A 4MYUA 2RIJA 4BDPA 3PYDA 3V6KA 1FXRA 2LQJA 3P49B 2LQ9A 4XPEA 3BYPA 4EYHB 1VIXA 2XHCA 3CJ2A 2RU3A 4TVAB 3KK1B 2BACA 3CNQP 3FUYA 3FDSA 4QZVB 2N3OA 3TARA 2M0GB 2WONA 1FXLA 2M8DB 1C0UA 4IH6A 5IT9Y 4JI0F 4QIGA 1B7YB 4CQ1A 2D7SA 3X1LB 3ELHA 1YBAA 4C97A 3MCSA 3FJ2A 5F9LA 1WOSA 3C6TB 2JZ5A 4ECYA 1N36F 3T41A 3BSAA 3RR8A 4IDKB 4K7QA 2CA9A 4DR5F 2FHOB 2IRUA 4WYLA 2C28A 2QLFB 5GAHI 4IFVA 2W4PA 3IS9B 2HWIA 4DR7F 2IM2A 2E1CA 2ZBCA 2LCWA 4NXNF 2XMWA 1FXDA 1S1VA 1NB2A 4ILRA 1Q81T 3CEDA 2BVZA 5LMUJ 3K2YA 5J2MA 3PY8A 3BF4A 2DGWA 1ZYQA 3DHXA 2XGPA 2MDAA 4PYAA 5DRKA 2XY6A 4GKKJ 4K4VA 4AL5A 2WZ1A 3W3SA 2ATCB 3DLJA 3UVJA 2PMZD 5J2NB 4CLTA 3KG0A 3IR6B 4DUTA 3G8SA 4R0EA 2W9CA 5CYMB 3IFEA 2YWFA 3HZGA 4KTQA 2W25A 4TQRA 4M5DA 4XDCA 1NNDA 3GIKA 2VQFJ 2J9DE 2AEFA 2VBWA 2OSRA 4KHMA 3SI8A 3M30B 4OLOA 3FEZA 1NBEB 3W7BA 5KG2A 1C2PA 2ABYA 3FQKA 4NLSA 1JQGA 3JAMU 3MZIA 3LP1A 2CNNB 2MY8A 3DLBA 2XCPA 4J9NA 1ZETA 3DXBA 1N52B 1RWXB 3CJTA 3TJ8A 1NEEA 1RT5A 1S79A 1P6TA 4FYYB 5E3CA 4OL8A 2Y8WA 3ILOA 4USMA 4OMFG 3ZC4A 3R8YA 4DUZJ 2B0GA 3UD3P 1LOUA 1RT4B 4C6AA 4DL0C 2GV1A 5HMXA 3KUHA 2IJNA 2ZBIA 1NSAA 4HEA9 3CCSS 3EPGA 5CD4A 5HK4A 5HANA 4LF2A 3QO9B 3H2LA 4DV5F 2L41A 2AF6A 3KNGA 4F0KA 2CQ2A 2ROPA 4DSJA 2AKWB 1WF2A 3MD3A 2E9ZA 2WVBA 2M2BA 1JLBB 2V6AA 3IN5A 4WIIA 2BKNA 4RBTA 4KRWA 2FPHX 4YS2A 5MLCV 4JI8F 3R2CJ 4TLRA 4U7UK 1PO6A 4ZK7M 3CD5A 4OI1A 3VQSA 2I0XA 3FFIB 3AQOA 3M32A 4Y2CA 2B6AB 2CZ9A 2KVIA 1JXEA 1HD0A 5BXIA 2ZH5A 1YI2S 1SB6A 3I82A 2KVQE 2HRTA 3D6TB 4GC6A 3N5BA 1CJTA 1R7IA 4U7UD 3DOKB 2VJUA 4BLGA 4A4JA 1OIAA 2D3UA 3QATA 1EKSA 2U1AA 1S99A 4P10A 3THVA 3I4HX 1T9WA 4Q2LA 2EC2A 2L9NA 1R8BA 2KYZA 1NLKL 1FE0A 4Y2IA 2HHXA 2P9CA 5KFRA 3OJUA 3IS9A 4ZVPB 2CQBA 1XR5A 4NEYA 2AT1B 3Q8PB 1HBNB 1AFIA 4WFAQ 2KT5A 2VFVA 1S72S 4RUBA 2X3DA 1Y5IB 3ZZYA 3AJ2A 1RXOB 1H2UX 2R2SA 5I42B 3BH6B 3T9ZA 1NCLA 2VDIA 2HHQA 3DGVA 1IWGA 5F8JA 1JLAB 1X4DA 2MKIA 1RA7A 2H54B 1TKTB 4NPOA 1R43A 1WEXA 2I2YA 4OYPA 2A10A 1TKZB 4ZPVR 1VGYA 3K17A 3HKWA 1WKKA 4J9OA 5KG4A 2QL7B 3DOMA 1S76D 5KT3A 5FD1A 3HVRA 1QSYA 1S4EA 4P75A 3TOQA 3KLHB 2JEGA 5KT4A 1XMOJ 4X2BA 1HIYA 2CWXA 2RUSA 3H20A 3I4PA 5E3PA 1PAEX 2LDIA 2PD1A 1FEEA 3GJQB 3OUYB 2ZITA 1ZS6A 3JTNA 4USTA 3M30A 3AT1B 2W9BB 4TU8A 4OI4A 3GIJA 3KXDA 4NLXA 2MZSA 5B0BA 4LRAA 2F4VJ 5GAGU 4I0WA 1BGXT 4DG1B 1IBMF 2LXUA 3QJLA 2VG6B 1EETA 1S6OA 2K2PA 2WB4A 3TX0A 3BBBA 1NK4A 4YOEA 3OLBA 3D1HA 4RWXA 1KRPA 3GWCA 1ACMB 3P3DA 2XSJA 4UOGA 4ICLB 3LW5C 3W2VB 4HVZA 2YQ1A 1V9OA 3JSMA 1GXUA 4IFYB 5IT0A 4KHPJ 2YPZA 4CNYA 2MZJA 2PE8A 2SXLA 2OGUA 3NS6A 2XGQA 1F9FA 3GFZA 3KDOA 2DEJA 2VICA 3QO9A 2BW2A 2OD4A 3OR1B 3A8JA 4IG3B 2R7SA 3PIPQ 4C8YA 3BO3A 3GFYA 2GX8A 4JI6J 3IC1A 4C98A 2E7XA 3DKDA 1JLBA 4PWUA 4OIXA 2YNHA 4I7FA 2HVDA 3QIPA 1ZZFA 1H6KX 3P5BP 1S9GB 4YB5A 3FFIA 4KV8B 1N5SA 5M2PA 1MNEA 4JI4J 4QIFA 1WC5A 3V4MA 4K2JA 4BS2A 2HVHA 3NGTA 2HVEA 1X31C 1RWOB 3QRPA 2WVDA 1RT7B 5EWFA 4NE9C 3SSSA 4ED5A 1H74A 2FGOA 2GMJA 1RCOB 2IVYA 4CLSA 1VQYA 3R5JB 4PXEA 1Y5LB 3HF5A 2OPQA 1U6FA 1ZBTA 3UWTA 1WEYA 2R8GA 3MWBA 1T05A 4DV4F 1FVQA 3JB9k 4ENOA 3WBZA 1UEKA 1TAQA 5I42A 3MM9B 2FHKA 5KFIA 1SL1A 1B3TA 1MROB 3L7OA 5HQMA 1NH8A 1LWCB 3K8VA 3KOAA 3K5MA 3HPOA 2NSCA 4LQ3A 4OYXA 3H4BA 3G6ES 1LFPA 4KH0B 4DR2J 3DRRB 1Q8IA 2R7VA 5IC6B 1YGYA 4CT9A 2NYHA 2MGZA 3KLHA 4PRFA 4ED1A 1UP1A 5B0GA 3WHIA 4UOHA 1PYOB 2D3O1 2RKIA 5A0YA 1U1RA 1UVMA 3GR0A 4Y34A 4B3SJ 3W63A 2W9BA 1YITS 2DH7A 1AA1B 4FPIA 2MB0B 1UVKA 3BSCA 1P1LA 1LK7A 4LF6F 2CQPA 4B9MA 5HVGA 2CIMA 4DG1A 4AL7A 1VBYA 2VG6A 2CQGA 3PRVA 1NK5A 4TY9A 1EIYB 4OHXA 3UDVA 4EK2A 4DR4J 2KDOA 3R1HA 1UKUA 2VHGA 1FNXH 1U47A 3CJQA 3HHLD 4P7VA 3KLFA 4ICLA 3W2VA 5HLFB 1OYDA 1QAJA 4IOBA 4IFYA 2XLIA 5KG7A 2Y1IA 3I5AA 1F6TA 3OD2A 3I9ZA 1NZAA 3OT9A 1F9HA 2HWTA 2WK4A 2JEIA 2I5JA 2LEAA 2AJFE 2ZZMA 3H42A 4C8KA 3ZTQA 1S1WA 1CEZA 4DCOB 1SH2A 4JV5F 1WI8A 1DY3A 4IG3A 2NXEA 2MKYA 2CAJA 2VODA 1F2GA 4CO2A 3EDQB 4DN9A 4IRDA 2BXJA 4C8MA 3AD9C 2FYXA 3HX9A 3Q86A 3MI7X 4BWMA 1N33F 3TQ1A 1C1BA 1XQIA 1NHUA 1SJ1A 4O4GB 1NJYA 1Q4RA 4KB7A 3NNCA 4KT0C 3RYLA 4RUCA 1KQFB 2AJ2A 4WFZA 4RBUA 4B9TA 1S9GA 4DQPA 4I2QB 1S4FA 2H4WB 1OO0B 5A8RB 3BKFA 2VFRA 2XMKA 3PO5A 1SBRA 2L48A 3J7YU 2VFTA 2CKWA 1NUEA 3PKYA 3P8BB 2HURA 2R7XA 2C2NA 4CNZA 1KQSR 3G6XA 5HO4A 1U1KA 1DLOB 3MD1A 3N6LA 3AB2B 4JOUA 4KY3A 1HARA 3BN7A 2PN6A 2V4QA 1QE1B 3JQMA 2GMHA 3TP2A 1JXLA 1A6LA 2MKCA 1KVKA 1N32J 4L72B 1JLFB 3PYFA 1PC4A 4PQUA 4FZVA 6FD1A 2DT9A 2WSFC 3NGRA 2UV8A 4X4TA 2XZTB 1UWAA 5J1NA 4U6PA 3J7Z5 2HQFA 4LF9J 4M5IA 5A8KB 5DDOC 5F3TA 2ZBPA 3ADAC 2HQIA 3AH6A 2C2EA 4M63A 4H4KA 2IBKA 2W7OA 1RTHB 1S9FA 4WZMA 4RW4A 2ZOGA 2FZGB 2P9EA 2K06A 2FUG9 1CLFA 5K14B 2NQPA 2DGTA 2KT2A 1K0TA 3BO4A 1WHXA 2DHHA 3CDWA 3D6HB 2D74B 2B4UA 2A2CA 2MY7A 2ZD1B 5B0AA 4J37A 2QLXA 4J7CA 3S8SA 2JSXA 2BV3A 4JI1F 1VOMA 2CJXB 4J9QA 3BN4A 4IO9Q 3H5UA 2YKPA 4DEZA 1YIJS 5E2QA 1QTMA 1WACA 2XLJA 1R31A 2AWZA 5L8RC 5C24A 4DQSA 4B9NA 3KLIB 1LFWA 4JI5J 1T7PA 4LFBF 3GMGA 2HRYA 1P9QC 1S1TB 1QJHA 5KFEA 2G1DA 1X4FA 3GCXP 3GSDA 1XBWA 2YPYA 1Q5VA 1K0VA 1VMBA 2NLWA 2DGQA 3ZTRA 4KBIA 1M1GA 2HGMA 5FDLA 2I38A 1MSWD 4U8VA 4FS1A 2V5HG 3FEXB 5IT9U 1FNOA 4MKAA 2BQRA 2KT3A 3UNYA 4OYIA 3IXQA 2AIRB 3HM9A 1EARA 2RRBA 2Y1LB 2EXUA 1D1UA 3NMAA 1KD1T 1FCAA 2HFOA 1CJVB 3D54A 6FDRA 3PIOQ 4RO0A 1GT8A 3I5BA 3PV8A 2AGPA 1NDKA 2M88A 4O4GA 1LKZA 3P45B 1YX2A 1IWAA 1VC5A 4LFCF 2KZMA 4ITSA 4LSZB 1EB0A 4I2QA 1VHIA 4HH1A 4QWDA 3IR7B 4EWTA 4K59A 4CLFA 5DDRC 5EX3A 1WG5A 3VGSA 3D0GE 3QT8A 3G8TA 3R27A 4A8MP 3VZIA 5IQ6A 2GQQA 2EK6A 2VG7B 4CWBA 1DLOA 5EX0A 3EDRB 2C3OA 4CYUB 3VAKA 7AT1B 2QLJB 2LDYA 1QE1A 2R2TA 2E1PA 2ZUGA 3EMTA 1YHQS 4DU8A 1JLFA 4X4VA 1ZM4A 3F73A 1UW9A 4WKYA 4ZVHA 4LQ9A 2GAHC 4OYWA 2IAJA 4B3RF 2OAUA 2HQCA 2QC3A 3M6WA 4QIEA 4CZCA 1IVZA 1SIZA 3BSOA 2CQIA 1EAYC 3MMBB 3K5LA 4NCBA 1JLGB 1X4EA 1N34J 1UVJA 5IS2A 3KJVB 1EX8A 3EGZA 1YQHA 9ATCB 2KB2A 4OZNA 2KTQA 4XIUA 3C15B 5KG0A 3M9OB 2I8EA 3L95X 5IOLA 4WWSA 4YY3J 3CCLS 4DS4A 3UN2A 1T3NA 2V0NA 3DLGB 3BM7A 4MYTA 3TR5A 3L7PA 2Z57B 2ZD1A 3C46A 4ZVRB 8RUCA 1U25A 2OMLA 5CABA 4G6VB 4NYOA 2LFVA 1YKWA 1NHVA 5C5JA 1GMWA 3BBCA 1RWMB 2W1BA 1MMNA 2FJBB 5L39A 2HSEB 2YX1A 3KK2A 3DN9A 4I67A 2JFKA 2A3JA 4F50A 2AZ3A 4JI0J 1BHNA 1N4LA 4YR3A 3UNGC 2WB1D 5G4DA 4CLLA 3CDEA 2GZOA 3JTPA 5BYQA 1L5UA 4IR1A 4ECUA 1S1TA 3AXMA 5HMYA 2IC3B 3RB0A 1RTIB 1TUWA 3H59A 5BR8F 1N36J 2VFUA 3DI6A 2VPZB 2HRUA 1A0OB 2ZJPQ 4DR5J 4M5MA 3QWPA 4DDFA 1VBZA 3RRHA 2WSEC 3OSNA 4C2MA 4ZJOA 3IRXB 3ENQA 2VQEJ 4NXNJ 3EXCX 5BYRA 2OFGX 2APOA 1PJ6A 3EJMA 1D0EA 4ED6A 1FEHA 2DIVA 3KDNA 2IA6A 4YR2A 2HG4A 3TVKA 3DDIA 1NKBA 2M8HA 4ZKAA 3NL0A 1CJVA 1LW2A 4PWDA 4B3OB 4OV6A 3DOLA 2EG2A 2KFNA 4CTAA 2KG1A 5DGAA 2XMAA 5C42A 3R7BB 4WP8A 4DHVA 4PG4A 5KFKA 2UXBJ 4DF4A 3C14A 4A46A 4NRTA 4CLPA 5AJ3F 4DR1J 1IM6A 4OLPA 4ANEA 4CDIA 3THTA 1GTEA 3FCWA 2CQCA 3W66A 4N5SA 4Y2AA 1NJZA 4USUA 2FJVA 1RLCL 5IXUA 1R0AB 2QMWA 4CYUA 5H1SV 2J8SA 2ZBQA 2DNNA 5KFWA 1B4SA 4A8KA 4MKYA 2MKHA 2XS7A 2HFVA 4DQRA 3KYLA 1WHWA 5KFPA 4LBPA 1JLEB 4L73A 1X4HA 2MMYA 2JOQA 1HNXF 4CO1A 1SQFA 2PEHA 5H9EJ 4EUVA 4ZITA 2JNJA 1UW4A 3SCLE 4URSA 1XERA 3MMBA 2IM0A 4RBVA 2UV8G 2EK1A 1JNZB 1RGVA 1S49A 4M8LA 1HI0P 4DSFA 2AJ1A
chains in the Genus database with same CATH topology
5M2RA 3M2RA 1IM4A 3OW2R 2BR0A 4M5DB 1RP5A 4NLPA 4N56A 1NK9A 3MGJA 1TK8A 2QO3A 1PC5A 2OKQA 1S9EB 4C8NA 1G7CB 2DR5A 3NMRA 5CYMA 2YNFA 1VFJA 3C66A 4DL5A 1Q79A 1TK5A 5F3ZA 3GIIA 1AFJA 3I56S 1X5PA 5DM7Q 2B9XA 1VQ4S 4NLUA 4QCLA 3ZZOA 3O5TB 3ZZTA 4IRCA 2HS0A 1G2EA 4QBUA 2XBPA 1HYSA 1Y3KA 5CH7B 2NYIA 1S7HA 2V8GA 1Y3JA 2OH2A 1DZ5A 2HVIA 2Z2MA 4IO1A 1RTJB 1ZTWA 1S0OA 3NCRA 4MK7A 2W24A 3OTDA 4LUBA 4C11B 2KYXA 3GR1A 3OXGA 4OI2A 5D77A 5K5MA 2JHEA 3UCGA 3OLAA 2ALZA 3GIMA 3VR1A 2CZ4A 1NH7A 1VRTA 4WXOA 2RMLA 1FRXA 2BQ3A 3M8QA 3BO2A 4F2RA 3K5PA 3M9MB 3MPVA 3LP1B 5LJ5Y 4B9LA 3LWMA 3HVAA 2OMOA 2UVRA 3SDEA 1R27B 4DPOA 1GXTA 1WG4A 1VQ9S 4C9DA 1QAYA 3KK2B 4WYWA 1Q16B 2EBEA 3Q0AA 2ADCA 4ZHRB 1Y7PA 1AW0A 3BGRA 2LA6A 2M4MA 4RNMA 2EC0A 3OL7A 4LF8F 1TZ0A 3I31A 1M90T 3KHHA 3N9UC 3NBPB 1A9NB 4YR0A 4J9RA 3BB5A 1HQUA 1KEKA 3FSIA 1JKHB 2JEFA 1A7GE 1TL4A 2FLLA 3AJ1A 2Z4PA 3PXGa 1DQ8A 2IVMA 1HHSA 1NK7A 2B5JA 2YNIB 1DTTA 2QSFA 4F3OA 2RNEA 1PILA 4O3SA 2YWKA 4A8FA 4F4WA 5SZTA 3BS9A 3THPA 2DHXA 3CO9A 3ZZ0A 3DRSB 3NKYA 2OPPB 1WWHA 4D3HA 3T19A 2AJ4A 4AE5A 3TAQA 2HMIB 3G86A 2MQNA 2B3TB 2EFVA 2HNDB 2ATLA 1XR6A 1D9DA 1V3ZA 1GQEA 4IR9A 1UFWA 1XMBA 2DGVA 5D4LA 3TX8A 5KT6A 3PX0A 1L3SA 1KTVA 3US5A 1KLNA 3CULA 2L9DA 1HBMB 4CT8A 4NA2A 3Q24A 2VPWB 2ZKTA 3DI6B 1MMLA 2OTLS 2BE2B 2IC3A 5KFVA 1SKWA 1KFSA 2NZ4A 4PG7A 3MM8B 1HR0F 3QJJA 5U47A 3WDOA 2J0QD 3H98A 4YQWA 3LWLA 3BR8A 2G13A 2HWHA 2CPFA 2GJ2A 2MSSA 3LAMA 3SSQA 5DQGA 4EBCA 4QR1A 2C22A 1N34F 2PC6A 5DS7A 4TY8A 2WOMA 2VV5A 1FT8A 4JV1A 1GH8A 2WHOA 1RT4A 2JL9A 3V4IB 3AY0A 3MM7A 4K4ZA 3DGPA 5HP1A 2PI5A 4HKQA 2WBRA 3E8OA 1VJWA 5FLXY 2Z0GA 1XK8A 4URGA 5EDWA 1OQ3A 4GKJF 3MR2A 2LEPA 4CH7A 2OIHA 2LU2A 1TQLA 2HW3A 4NLWA 1Q7YT 1X9WA 3T5LA 2V2KA 1HNIB 3M1VA 2U2FA 3DMJA 1VS3A 3UR0A 3V81A 2CPYA 4V19J 3RB3A 2C2RA 3MURP 1FRHA 3I96A 2F7VA 4GMKA 5KAKA 1IBLF 3VQTA 4BHQA 4YB1P 3R3TA 4FNHA 4YY3F 4DV1F 3IRXA 3RB4A 3G71S 5GADU 3G96A 3HVTB 2J9EA 4ALZA 3KLVA 3SXLA 4P7TA 3MAQA 1S10A 1HHTP 2VQFF 4EZ9A 5JXSA 1C1CA 2RILA 4OHWA 1HBUA 1BQXA 1F5AA 3FRYA 3DYAA 4OV1A 4EO8A 3O1LA 1IKXA 1ZPVA 4MYUA 3DXSX 1Z4UA 4MIBA 3MFIA 2RIJA 3MMAB 3M9NB 3MR3A 4BDPA 3SMZA 3V6KA 4UQGA 1FXRA 2LQJA 4DFPA 4NCGB 3P49B 1KONA 2CJ9A 2LQ9A 4XPEA 2PA3A 4RNOA 1VIXA 2DNPA 3CJ2A 1LW2B 4EYHB 4PWDB 4O0IA 1N56A 3CJKB 3SFUA 2GA7A 3MEGA 5KFJA 2RU3A 3DOLB 4B08A 3KK1B 1NJIT 2D41A 1UEVA 4CTAB 1EP4A 1HWJA 2BACA 1BQMA 3OTBA 2JJ4D 2Z8QA 4KJIA 4ECRA 3DFEA 4IH5A 2UVUA 3FDSA 1FF2A 4QZVB 2N3OA 5C42B 3TARA 2M0GB 2WONA 1FXLA 3W2WA 3K5NA 2M8DB 4B3OA 3KK3B 3ICLA 1L3KA 1C0UA 5LSRA 2QMXA 4IH6A 3HXMA 1N5TA 4ZCKA 5IT9Y 2J9CA 4JI0F 2ASYA 5DG9A 4QIGA 1HNVA 2B6AA 3B4MA 2ZH2A 4ED7A 4Z2XA 2R8IA 1FJCA 1TR0A 1U49A 1IJFB 4C8OA 4Y2MA 4I6WA 1H2TZ 3VF0B 1SJFA 1TKXA 1TP7A 5F8MA 2ASLA 4CQ1A 2D7SA 2OO4A 3X1LB 3FQLA 1YBAA 2XY5A 2VA2A 5T7LB 2F9JA 4KFBA 5KFMA 4C97A 1F5CA 3RAQA 3OHAA 3GV8B 1VLYA 2XULA 3Q8SB 4NCAA 2KN4A 3MCSA 2KHCA 3DOKA 3FJ2A 3GFXA 4DL7A 5F9LA 5HMZA 2GO9A 3C6TB 2KXHA 4LMZA 2JZ5A 4WFYA 3CDBA 4Q0BA 3WX4A 2VB6A 2JLGA 4ECYA 2Q6BA 2GHPA 3OR2B 1N36F 4ERDA 2JEJA 3BSAA 2JC0A 3O3LA 3RR8A 4ZP9A 5AXLA 3OFEA 3DRPB 4IDKB 1L3UA 1YVFA 2F8MA 4G1QB 5E3AA 2MJUA 2CVEA 2M5YA 4DR5F 2FHOB 2IRUA 4WYLA 5J1EB 3BSNA 2C28A 2E5LF 4FS2A 5J2PB 2XHWA 4HI1A 4N8OA 5GAHI 4IFVA 5I3QA 2W4PA 3IS9B 2VD3A 4J5OA 2VBXA 4OI6A 1B0VA 2CQDA 2HWIA 4DR7F 2FJEB 4DV2F 2IM2A 2E1CA 1SV5B 2LVWA 1GXLA 1R0AA 2N7CA 2ZBCA 4WKRA 1FDAA 1RDRA 3CVKA 2E7WA 2LCWA 1UVNA 4QR0A 2AYMA 2KI2A 4NXNF 1GX6A 2XMWA 1V3RA 1FXDA 1S1VA 2LU1A 2IBOA 4C8ZA 4ILRA 5C25A 1Q81T 3CEDA 3MUTP 2BVZA 2LEBA 3V6DB 3K2YA 5J2MA 3PY8A 3UDLA 2B51A 3BF4A 1HBNA 1TAUA 2DGWA 1LXNA 1ZYQA 2MSTA 2YX4A 3DHXA 2XGPA 2YTCA 3JSRA 4HL9A 4JV0A 2N4DA 2MDAA 5DRKA 2XY6A 1NB7A 2PGCA 5H9FJ 2OPRB 1SJRA 2E44A 3E2EA 4L3NA 4Y28C 5G0RA 1U1OA 4RU2A 1JLEA 4F2SA 4K4VA 5J2QB 2K8GA 4CIOA 1KSPA 2FLOA 4CO4A 1UJ5A 2B9YA 2IA0A 1VI7A 2YH0A 3F56A 3U02A 1J5OA 4AL5A 1M0SA 2HHWA 4QR2A 4ZCLA 1K9MT 1HWLA 3RBEA 1VQ8S 3W3SA 5GAEI 2MQQA 2VPXB 2DHGA 3DLJA 1B64A 2XWYA 2PMZD 5KFYA 1JLAA 2COLA 5J2NB 2GJIA 1SUQA 1YJNS 4KKOB 3MEKA 4F3QA 4JI2F 1TKTA 1WF1A 3IR6B 3KG0A 3M2RB 4NX9A 3G8SA 3TVYA 4R0EA 5L1LA 1M5SA 2K1RB 1TKZA 3DDNA 4R5PA 3CCUS 4K5RA 2W9CA 3ISZA 1I1GA 1HBOB 5CYMB 2POKA 2YNFB 3EYZA 3IFEA 4B9UA 2YWFA 3HZGA 4KTQA 2W25A 4TQRA 5EN1A 5B09A 4M5DA 4XDCA 4Q7AA 2G0CA 2WAQD 2J6SA 4X4OA 3NAIA 1NNDA 2KKHA 3GIKA 1X4CA 1Z2LA 2HLTA 2ROGA 2J9DE 3NWGA 3RW6A 5KFHA 1VC0A 5CCLA 1M1KT 4ES2A 1FK9A 1RI7A 2OSRA 2VBWA 3M8QB 4KHMA 2MQMA 3BQ1A 3PDNA 5LSLA 2KXNB 4CI0B 3SI8A 5DDPC 3M30B 2EBGA 4HHJA 2BQUA 3KG1A 2OLWA 1DFDA 4LSLA 2DBBA 3N5FA 4OLOA 3CDAA 3FEZA 3W7BA 5KG2A 1C2PA 1JK9B 2ABYA 3FQKA 4DR6F 3R5BA 3BGRB 2XNRA 4NLSA 3CSKA 3TUIC 3OUYA 2XMTA 2HQ3A 3MZIA 2D3ZA 3LP1A 1HQUB 2MY8A 4RUAA 3DLBA 2XCPA 1U8SA 7FDRA