4YUDA

Crystal structure of a rna binding motif protein 39 (rbm39) from homo sapiens at 1.28 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
GNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 39
publication title Crystal structure of a RNA binding motif protein 39 (RBM39) from Homo sapiens at 1.28 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2015-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yudA01
2DH7A 2DO4A 4Y0FA 2MZJA 1U1MA 3SDEB 5CA5A 3CC4S 1WHYA 3G6ES 3I56S 4IOCQ 3CC7S 3EGZA 2G0CA 2LA6A 2DNPA 3RW7A 1VC5A 2K3KA 2DITA 3CPWR 2MKCA 4F25A 2J8AA 4TU7A 2XS7A 3EGNA 5JVGQ 2MSSA 5D77A 2F9JA 5IFMA 3MXHP 2LA4A 5LXYA 1SXLA 2Q79A 1URNA 1H2VZ 2MZQA 5DDOC 2NZ4A 4WFAQ 2MMYA 2YH0A 1NO8A 3THTA 1M5KC 3D2WA 1G2EA 1WHXA 1YITS 1WF2A 3CF5Q 4CQ1A 2DNYA 2MXYA 1ZZFA 2OIHA 1DHMA 3R1LA 3G8TA 1X0FA 1HA1A 5HL7Q 4LIRA 2X1BA 2LMIA 5LXRA 1WF1A 2VONA 2RRAA 1X4CA 1U1OA 4OZ1A 1YWXA 3RW6A 2CPIA 4M5DB 3CCQS 3ZZZA 2KRRA 4FXVA 2FY1A 2XNRA 3ULHA 2PEHA 3MOJB 1VQKS 2J0SD 3B4DA 2VOPA 2VOOA 1QM9A 4QU6A 1M1KT 3MDFA 4WIIA 2YH1A 1U6BA 2KM8B 4CIOA 2O3DA 1Q7YT 4W92B 2MZRA 3ZZYA 2M4MA 2M70A 1UW4A 3CC2S 4F26A 1KQSR 2MJNA 2E5JA 3B4MA 5GAEU 3IWNC 2MHNA 2GO9A 1N88A 3TYTA 1VBXA 3NMRA 2DNLA 5IQQA 2EK6A 5DM6Q 2XS5A 4U67Q 2MQPA 3CXCR 5EN1A 1JJHA 3LPYA 1K73T 5ITHA 2MGZB 1VQOS 1H2UX 2DB1A 2LXIA 2KU7A 2CQ1A 2QA4S 1U1PA 2RRBA 3NNAA 1M5OC 2RQ4A 3I55S 4QQBA 3CCUS 4WF9Q 2DNMA 5DDQC 1YJWS 2CQHA 1WWHA 4TU8A 1UAWA 1A9NB 2XSFA 1FJEB 2MKSA 3CMAS 1L3KA 4YB1P 1WTBA 3V4MA 2V94A 4Y00A 3HHNB 1R8PA 5DDPC 1N52B 3U1LA 1FNXH 2QEXS 2DHSA 1SJQA 2LQ5A 1FO1A 3MD1A 1H6KX 3CUNA 2CQ2A 1W2BR 3CTRA 2M2BA 5CYJA 1ZZNA 3CCLS 4UY8T 4RU2A 2AYBA 1VQ5S 5GADU 2KI2A 3MUMP 2DNNA 1NU4A 3VF0B 2AYGA 2EVZA 2DGQA 2MQOA 3CCVS 2DIUA 3CCMS 2ERRA 2D9OA 2KXFA 2AYEA 3NS6A 3J7ZT 4CH1A 2YKAA 1Q82T 2YWKA 2CQGA 2I2YA 2OTLS 1VQ6S 1XN9A 1WEYA 4A8XA 5IM0B 2CPYA 2MYFA 2N82B 2RVJA 2AD9A 3CCRS 3VAGA 4W90B 2JVOA 4EGLA 2RNEA 3J7YU 2X1FA 2X1GA 1DZ5A 2YTCA 2OSRA 2M52A 2MKJA 1VBYA 1P1TA 2DGXA 1VQMS 4QU7A 3MD3A 2DIVA 1M5PC 1NJIT 2KXHA 2HGNA 1M5VC 3CCES 2KT5A 1R8HA 1U2FA 2DGTA 2MJUA 2MQNA 3BO4A 3BS9A 5JVHQ 2X1AA 5LJ3Y 2D3OR 1U1NA 3UD3P 2LEAA 1D9AA 5GAGU 3EX7B 2DNOA 2UP1A 4WFNQ 2PE8A 1U1QA 2HVZA 2HZCA 2MZSA 2A3JA 2L9WA 3VAMA 3N9UC 2CQCA 1WG1A 4TLQA 1X5SA 2F9DA 1FHTA 1S79A 1K8AT 3OW2R 4IOAQ 1YI2S 2DNHA 4F02A 2J0QD 3PIPQ 2LXUA 3SMZA 3CD6S 1JMTA 2K8GA 2MQLA 3VAFA 1M90T 2OSQA 1WHVA 1WEZA 1VQ7S 1U1KA 1YTYA 1S72S 1U1LA 1YJNS 3PIOQ 3VAHA 1Q81T 2CPXA 4YUDA 2LECA 1DBDA 2M9KA 1VC6A 3G96A 1YHQS 3UWTA 1KD1T 2DNZA 4YOEA 2HYIB 2DGUA 1VQNS 5LSOA 3P6YC 1X4DA 5GAHU 1FJCA 3S8SA 3BO2A 4IO9Q 5GVQA 1VBZA 2DK2A 4ED5A 1VC0A 2DH8A 4OZ0A 1X4AA 1K9MT 4UQTA 1D8ZA 3R27A 2DNRA 1WG4A 2CPFA 2LKZA 1X4HA 2KM8C 2AYMA 2JX2A 1A7GE 2DGSA 3UD4P 2M8DB 1WI6A 5DDRC 2MGZA 1JJ2R 2RS8A 3HI9A 3FEYB 2N7CA 2RU3A 2MQQA 2BZ2A 2CQPA 1X5TA 3H2UB 2KHCA 2CQ4A 4PR6A 2KFYA 3Q2TC 1ZH5A 3P3DA 2U2FA 3UCGA 1SJ4P 2KH9A 2MY8A 2DGWA 3VAJA 2G4BA 2E5GA 2JRSA 4C4WA 3MI7X 1UP1A 1WELA 1B7FA 3CCSS 2XB2D 4C7QA 4V19X 2KYXA 2D9PA 4Z2XA 2MKHA 2CJKA 2RT3A 4FXWA 1VQLS 2CPDA 2DH9A 2MKKA 5H1SV 1FT8A 1F9FA 1JJ4A 2KVIA 2FC8A 3FEXB 3US5A 2CQ0A 1SJFA 1WHWA 1X5PA 3LQVA 1WI8A 2ZJRQ 2DGOA 2RQCA 2MQMA 2F3JA 5HO4A 2OTJS 1YJ9S 2HGMA 2LCWA 3G4SS 3SDEA 3H2VE 5BJRA 1X4GA 3SXLA 2M8HA 5CXTA 2OJ3A 2M0GB 2ADCA 5IM0A 3CMES 3G9CA 3CULA 1UFWA 2MZTA 5LSLA 2MY7A 2J76E 4QPTA 2CPHA 4LMZA 1VQ4S 5LJ5Y 1AUDA 1WF0A 1O0PA 4LJMA 4WFBQ 2MKIA 4BS2A 4PKDB 3BEGB 2E5IA 2FPHX 1YIJS 5FJ4A 5DETA 3DLLQ 1N54B 2N3OA 2VODA 2EK1A 1QVFR 2U1AA 4WKRA 3TO8A 1OO0B 2CPEA 4WCEQ 1HD1A 2QFJA 4ZKAA 2WBRA 2M88A 2E5HA 1X4FA 3S7RA 2KG1A 4PRFA 1BY9A 2JWNA 2DHXA 1OPIA 3S6EA 2XS2A 1RK8A 3MUVP 1SJ3P 1SJRA 1VQ8S 1CVJA 2DO0A 3THPA 3CCJS 1FJ7A 4TU9A 1H2TZ 3VAKA 3IRWP 1X5OA 2ZJPQ 2MPUA 2CQ3A 2CPJA 1KOOA 3UE2A 3U1MA 3MUTP 2DNKA 3TP2A 2G1DA 2LYVA 3P5TL 1X4BA 1KOHA 2BOPA 2ADBA 2DISA 1PO6A 1U6FA 2DNQA 2NLWA 3Q2SC 2CQIA 3VALA 3UCZP 2FC9A 1Q86T 3L3CA 4ERDA 1HL6A 2GHPA 4C0OC 1P27B 2MSTA 2SXLA 2MB0B 2CPZA 5D78A 5GMKa 2JVRA 2ZJQQ 1WEXA 3NNCA 3P49B 1IQTA 1WG5A 2KXNB 1VQPS 1OWXA 1KC8T 2KG0A 1HD0A 2M7SA 4P6QA 2KRBA 3G8SA 3S01A 2E44A 2XNQA 3VAIA 1RKJA 2KN4A 5DM7Q 2RS2A 3UCUP 1VQ9S 2RUGA 2N3LA 3NS5A 2CQDA 2DNGA 2L08A 1U1RA 2FHOB 3R1HA 3DXBA 2DHGA 2LEBA 2L41A 3NNHA 1OIAA 2CQBA 1QVGR 3MURP 3JB9k 3G71S 4CH0S 4IUFA 2HGLA 2MZ1A 2DHAA 5MLCV 2DGVA 2B0GA 1DRZA 1N8RT 3K0JA 1FXLA 1X4EA 3BO3A 1PGZA 2I38A 4J5OA
chains in the Genus database with same CATH superfamily
1T0TV 3CMQA 1U1MA 1EHWA 2FVPA 4I2PB 3AOBA 3F44A 1M5SA 2EXUA 2OPSB 3EGZA 4A4JA 5ETKA 4DR6F 3AB2B 3FK4A 3KNGA 1YRTA 2BKOA 5KFGA 3UR3C 5JVGQ 3KHRA 2MSSA 3C16B 2CADA 4ETXA 1KNZA 2Q79A 1X9MA 4DG1B 1YVFA 4EYHB 4L3NA 2OFHX 3KNAA 4MFBA 3I31A 1WF2A 5GMEA 4H54A 4DPUA 3OVSA 4DV7F 1RLDA 2PA8D 4EWTA 3CD7A 3CWJA 1V5VA 3MEDA 4M5DB 3RU0A 1HPZA 3V81B 2ZZNA 5SUHA 3EZ5A 4QU6A 2AMCB 1M1KT 2JNJA 4H4OB 2KFNA 3OPKA 3TJ9A 3PHEA 3KLEA 2RAQA 4USTA 3I82A 4K2JA 2E9TA 5E2QA 2IDLA 5AXNA 4GVBB 4P73A 1YJ7A 4NLVA 1WWHA 3BKFA 1A9NB 1UMJA 3J7YI 3EGVA 1VIOA 3UN3A 1RT6B 4KPCA 5KFHA 5AJ3J 1ZZNA 2M2BA 3DGPA 4NCAA 4DN9A 1NK7A 4RNHA 2QG9B 4J9LA 1U8WA 1EARA 1Q82T 2OTLS 3T1HF 4OLPA 4M94A 4EGLA 4A8WA 5KFDA 3M2UB 2V63A 3MPUB 3VTIA 1KQKA 2RKIB 2HWIA 2PA3A 3POTA 3K5MA 4PXCA 4DL4A 2KT5A 1BWEA 3CCTA 4F2SA 3SCIE 2FVQA 3RRGA 2UP1A 1AZSB 1MMLA 5T7LB 2UVUA 2AJ1A 1CS4A 1LEOA 2MZSA 2OAUA 2IJFA 3ITHA 1AT1B 3ZZUA 2C3YA 5HANA 1IBLF 4R0JA 1RA7A 2NXUA 3SCLE 4DUZJ 1NAQA 3CD6S 2CNKB 1M90T 1UPPA 1V3SA 5GADI 2QL5B 3LALA 1YBUA 1Q81T 1XC9A 5E3CA 1QAIA 1FDAA 1U02A 5JUMA 2BW2A 1KWMA 3EDRB 3UWTA 2ZFHA 2R7OA 5C24B 2XG8A 4H4KA 5E0OA 3LANA 2UXBF 4UQTA 4XDDA 3IAM9 4YY3J 2B4VA 2I6WA 3UD4P 3H5UA 1JJ2R 2ZH3A 1QUPA 4JI8F 4WYWA 3PACA 4CLPA 3HD2A 3HHLA 2W2NP 3RBXA 4C7QA 1LWCA 4YS2A 4MH8A 1VQLS 2VFTA 2DH9A 2DT9A 5IT0A 2B9XA 2MKKA 4USWA 2RDJA 4JI6F 2KVIA 3KK1B 4LSLA 2CQ0A 2QJ3A 2XZDB 4IFVA 4DV6F 1PKUA 3D6TB 3LA0A 2QLWA 3SXLA 2OJ3A 2ADCA 3MMCA 4EZ9A 2MZTA 2AEFA 5LSLA 2ASLA 3T5LA 2BJ8A 2CPHA 5KG2A 2C2OB 3PYEA 2FHJA 4CT8A 2MKIA 4PKDB 2XCAA 3IA0A 2N3OA 2VODA 2BJ7A 2H5EA 4PAAA 1RISA 1N36J 4Y2KA 3EE3A 2E5HA 4I1TA 3MCSA 3S7RA 2EG1A 4ED6A 3S6EA 3MAQA 2DJWA 2RUSA 2V34A 5U47A 3UQSA 3Q8PB 4DSIA 1BC6A 1RP5A 1RT2A 1F2HA 2GAHC 1WOPA 4A8SA 1X4BA 2BOPA 3KDOA 1KFDA 3A13A 3DKDA 2ZH2A 3ENWA 4NXMJ 2CG4A 2QGFB 2DRDA 2ZDOA 4OZ3A 1PG5B 4DF8A 1WEXA 3O44A 1I3OB 2E7VA 1FD8A 1FESA 2V5HG 3FRZA 1QE1B 2OP5A 3JQJA 4ZOSA 2B8QA 3KG0A 4PCQA 2KN4A 1HI0P 1OQ3A 2RS2A 2F1FA 3M4XA 1EP4B 2DXEA 1VRUA 4KO0B 3KYLA 3NNHA 3DRXA 2Y8WA 3HLUA 1S49A 2RU9A 1C1CA 2C2RA 4J5OA 1KVKA 2J9CA 3BN4A 4HVZA 3CJKA 3QIPB 2UUBJ 4YR0A 3MCMA 2CIMA 2ZH7A 3GQCA 1WDTA 4L73A 4L74A 5ADZA 1UW9A 4C98A 3FZ2A 3OR1A 3DNCA 2XYPB 4H4MA 1TV6A 3J80Y 4J90A 3E51A 2MZQA 3DRPB 3DLEA 3D2WA 4USJC 3CF5Q 3A12A 1E6YB 2B4PA 5LMNF 2VPZB 3R1LA 5KTQA 2Z2LA 1YBAA 4JI1F 2K1RB 3AJ1A 1TKXA 1NB7A 4LFAJ 2XMUA 5HATA 5IV3A 5HBMB 5E3QA 3HFZB 3DOKB 3LP1B 1LFPA 3HVTA 1S6QA 4NRUA 2EG2A 2L9NA 5E33A 3IBFB 1UCNA 3CDAA 2XO6A 3MDFA 2VASA 4PXBA 5K8NA 1SC4B 3NGSA 1N88A 2EK6A 2Q6CA 4QR2A 4WU2A 3CVKA 2MGZB 4MK8A 5A8KA 2CQ1A 4XDCA 4QQBA 3AAWB 1UETA 4F36A 1HW8A 3V4MA 2ILYA 3QSYB 3HHNB 2AGPA 5DDPC 2OPRA 3DRYA 4RWXA 2XI2A 1L3TA 1CJKB 5KOXA 4UTGA 1TL4A 1H3DA 3RJMB 2AIRB 1WC0A 5HMXA 4X4QA 2AD9A 4FS1A 4S0MA 2FQQB 1IBKJ 1U48A 4Q2LA 2RNEA 4DV2F 2ZD1A 4RUHA 4ECSA 1MROA 3DLGB 2VBZA 2Q3PA 3K5PA 3SV3A 2BE9B 3GCWP 2F4VF 3C3LA 5JVHQ 1SJ1A 3RAQA 2YWHA 2ROEA 2HNDA 3TUPA 4DSFA 3HSDA 3NBPB 4F67A 2CQCA 4BLGA 2H9ZA 3QGGA 2X3GA 4HR2A 1IKWB 4ED2A 4QOTA 4QCLA 3TZWA 4V1Ak 2MQLA 1C0UB 1PAUB 2GHVC 4DV1F 1EETA 3MMBA 5KFVA 3EGWB 2XWYA 4WYLA 2EKNA 4OX7A 1NNDA 4DX5A 1U2CA 1S1WA 1NZ8A 3ENQA 2PMHA 4YDDB 3P6YC 2QFIA 1R7IA 2Z8QA 2QA2A 2VICA 1TL1A 1VBZA 2W25A 1VC0A 2GMLA 4AXJA 1KLNA 4IRKA 3JQKA 2BM1A 4HHJA 2DNRA 1RT5A 2BXJA 4C8NA 1A7GE 1RU1A 5C7PA 4PPDA 3N79A 4LF7J 2VG6A 3CSKA 5G0RA 1SJ4P 3KJVA 1VISA 5KG6A 1Y00A 2XB2D 1HBNA 4Z2XA 2RT3A 4ANCA 4X64F 4WP9A 4DV3F 1X5PA 4NA3A 3BH7B 1JB0C 4MFBB 3KLGB 2OUGA 3KLIA 5BJRA 2M0GB 1MWYA 1DARA 3MEDB 3J80U 4LMZA 5ETNA 3U27A 2VC1A 2YPYA 4I64A 1JIHA 1YIJS 3U02A 5B0GA 5FIIA 3BV8A 3O8WA 4WKRA 2B5JA 3HVWA 3BBFA 5KFNA 2M88A 4GO5X 3G6XA 1Q4RA 5F8JA 2CJQA 1CVJA 3M7VA 1GX5A 1VLYA 4ZK7M 1JLAA 4TU9A 5IT9Y 1GTEA 2HRTA 3U1MA 1Y3KA 2V8VA 1F9EB 4FYVB 1RDRA 2XBPA 2NLWA 2I8EA 3MPVA 1RWWB 2MSTA 1QSLA 3SI8A 3SCJE 1P8GA 5B0FA 3CJTA 2MLYA 4G1IA 4ZLLA 2KRBA 2APOA 2UVWA 3ZTSA 4BC9A 3PY8A 3IR6B 2RUGA 4NLGA 2CQDA 4P75A 1U1RA 2FHOB 2LP4A 4IYQA 5A8WA 4FNIA 1G6BA 1PC5A 1WUUA 4DX6A 1TR0A 2B0GA 3K0JA 1FXLA 4OV6A 1SKUB 3POTB 4DLGA 2YX7A 2ROGA 4GC7A 4QZVB 1JKHB 1SH3A 1NRKA 4HHHA 4QR0A 2F5GA 3RBZA 4UUWA 4F25A 2JDJA 4A48A 2XS7A 3WX4A 1CS4B 2Y8YA 3ITHB 1RTJA 3E8OA 3VHQA 2F8HA 5KFEA 3CJ3A 1T02A 2H51B 2IA0A 3FVYA 5HL7Q 3CO9A 4ECRA 1XNQJ 4KTQA 1MSWD 2J0SD 3V6DA 1YLXA 3HZGA 2VF3A 1HNVA 3CDWA 2IVMA 2CNNB 3K7RA 2M4MA 1K47A 4F26A 1TL5A 2E5JA 2JC0A 1NKBA 3KLFA 5GAEU 5EHHA 4KH0B 4TQSA 1UA1A 5JMNA 1JJHA 3LPYA 4CTAA 3CNQP 4M5KA 5F9LA 1Y7PA 4WU3A 5I4MA 2VFRA 3W5XA 1HNWF 3HHLB 3L7PA 2V4RA 3MR7A 4YB1P 1WTBA 1UKUA 2RILA 1LWCB 3ILOA 3QO9A 2XHCA 2FVRA 4Y2CA 4EU0A 3CUNA 2VV5A 3CTRA 1TFWA 1JK9B 4LSLB 1FRMA 3WQPA 1ELOA 3AD9C 4IFVB 4OI3A 4C97A 2VD3A 5LMUJ 2RVJA 3MMCB 1R0AA 2VA3A 4ECXA 3O5TB 3MZIA 3GMGA 3R7SB 4GMKA 2CXEA 2AKWB 2H3EB 1NJIT 2CUYA 2HGNA 3CCES 3ZTOA 2HG4A 3BGOP 4IRCA 2OD4A 1U1NA 2G1HA 1CJTA 2YWWA 2HAFA 1RT2B 3DRRB 2VDHA 2IY5B 1AW0A 4LR8A 3PEHA 1FHTA 1UVMA 1T9UA 4MIBA 1H7WA 4NWBA 3I4PA 3TZZA 5IT9U 3G86A 1T9VA 1TMJA 2RSQA 5KT2A 1CC8A 4C8MA 2JLFA 1KQGB 2V2ZA 2DR5A 2M9KA 3MCOA 1F6TA 2YX4A 4GKJF 3QZ8A 2RQMA 4C48A 1R6VA 3DRSA 4RW9A 2DGUA 1VRUB 4FYDA 2DH8A 1X4AA 1C1CB 2ZWPA 2W4PA 3LO3A 4P2MA 3S1TA 5M2RA 3CJKB 3QATA 2HW3A 3GLJA 3NY0A 5HP1B 2EKYA 1QDUB 1QAYA 2VG7A 1ZH5A 3JTPA 2G4BA 2E5GA 1BLUA 3TZYA 1D09B 3OR1B 3GJRB 1RB0A 4H4MB 1TV6B 4DR4F 4WFYA 3FEXB 4ZMMA 1ULRA 4ZP7A 1R27B 4JOUA 1WHWA 4A8QA 3DLEB 1KBRA 3MHYA 4LBHA 2LCWA 2IIHA 4NLYA 3HO1A 2OMLA 1CULA 3NP5A 2HFZA 2R2SA 1MW7A 3ZNUA 3CJ8A 2C2ZB 3HVTB 1BUXA 1U0SA 2CAJA 2YVSA 2BDPA 3TUIC 2UUCJ 1TVRA 4J9PA 5ETVA 1SV5A 3PHTA 3KJFB 1LXNA 2GVDA 1FVSA 5KFMA 4NA1A 3PYFA 4ZPVR 4K4WA 1RK8A 3ADAC 1LK7A 2ZOGA 3EVOA 2B8PA 4AQYF 1REGX 2E1RA 1KOOA 4J9VA 4ZVPB 2OD6A 2ADBA 3V5RA 3QQCD 5KFJA 4UUXA 1SIZA 2OPRB 2DR7A 3D1HA 1HL6A 2SXLA 1ZAXA 2DBBA 4AXIA 3CGIA 1FE4A 1GMWA 1IBMF 1YKWA 2VB6A 5KFOA 2XZTB 4OFZA 2R7XA 4P71A 2CQBA 2VPWB 1SC1B 5D6GA 2ZD1B 2CNOB 1VJWA 1QUVA 1JXLA 2XMMA 3UDLA 1MROB 4DHVA 2NS1B 3CC4S 4LFCF 3TA0A 2RD5C 1HYSA 4DL7A 5K8OA 3CJ2A 4QW9A 4X62J 4XPEA 3HZEA 1DFDA 1VOMA 2WW8A 2QRRA 3EZOA 1GK8A 2HNDB 2CRLA 4J9MA 5CABA 1B64A 3H5XA 2FD2A 2E9RX 1N6QB 3ZZPA 5B09A 5DDOC 3IWXA 2KO1A 1D8YA 4ANEA 1R6YA 1VS3A 2X1BA 4TY9A 2QYGA 2I0XA 3WC0A 3ETMA 3MMBB 3RW6A 2ZEJA 3HP6A 3HMJG 4RNOA 4LUBA 1S1WB 2O01C 1T05A 3A3OB 4L6V3 3I32A 4W92B 2MZRA 4FNHA 2XMVA 1TL1B 4ZLNA 1FDBA 2B56A 2GZOA 1TZ0A 5D4PA 3HSGA 2XTJP 3CXCR 2FYXA 1S4EA 1MG7A 3VV2B 1WACA 5ETTA 4DL2A 2VG6B 4B3MF 1DQ8A 3A1YG 2UV8G 4XTTA 3KJVB 1VDHA 2JJ4D 2F7VA 1IN0A 4QWEA 4LF6J 2HBQB 5CCLA 1SH0A 1NK6A 2OH2A 1PYSB 4YN3B 3KG4A 3GJSB 2Z58B 3FSIA 4ICLA 4I67A 3M6XA 3OBIA 3KLIB 3J7ZT 5AXKA 1XJWB 3EVWA 1ZOTA 2BKPA 3A8IA 3D67A 2YXLA 2RF2B 2OEKA 2GJ2A 4OHYA 7FDRA 2O5DA 2YTCA 3HFVA 5ETSA 4ZVSB 2FZGB 2XY5A 3MPWA 1VQMS 3MD3A 4USKA 4KC5A 4K4UA 1H0HB 3JSRA 2B5JB 4FYXB 4LQ9A 4ZIVA 2MJUA 1V6HA 3BO4A 2X1AA 4LBPA 4NZ6A 3DHXA 5KFWA 4D3HA 1RCXB 4EEYA 2C2EA 1JLAB 2DNOA 3X3UA 1C1BA 1RT1B 4RW8A 3N9UC 4O4GA 3G8QA 4NLRA 3Q83A 1NH7A 1HWLA 2MLXA 2F9DA 1SKWA 4IOAQ 3KHHA 2JHEA 1DLOA 5BR8F 3OHAA 2PO4A 5KG5A 2VIHA 3DN9A 5LL6d 3T1YJ 3NAHA 4JI0F 4LF9J 2ILZA 4C8ZA 2QLBB 4GO7X 4KFBA 1RTDA 5A8WB 4TN2A 2WTFA 2C42A 1WG4A 4DDFA 2KM8C 2W2QP 1B0PA 3H2LA 4O3QA 3EVMA 3ZC4A 2CG8A 2PI5A 4JI4J 1R8BA 3OFFA 3PKYA 4DU8A 4E2FB 3T1AA 4ZDNA 4J9OA 1FRHA 4OX9J 3HHLD 4ZCLA 3U1NA 2D1CA 1T03A 1RAGB 4DR2F 4OJHA 5DGAA 3WDOA 1RZMA 3OV7A 5IM0A 5C5JA 1R43A 3OFGA 5L8RC 2KL8A 2ZH4A 3NL0A 1F5CA 4ZCIA 1WF0A 3V6DB 3QRQA 4MYUA 2GMJA 2W8KA 5HQLA 1HNVB 5DETA 2FHJD 3J7Z5 3QT6A 4L3KA 4KHPF 2QFJA 3KLFB 3FSYA 4MTPA 3R2CJ 2ZVIA 1Q8KA 2XS2A 1F5AA 3N6LA 2XCPA 4OHWA 1XEZA 4RBTA 2ZDPA 1X5OA 2HK2A 1T9XA 3BF4A 2HZVA 3FQKA 3QO9B 4X4NA 5F3ZA 2CQIA 2MDAA 1P27B 2MB0B 1RADB 1RBOB 2JVRA 2ZJQQ 2HQIA 4RBUA 1SIWB 1GXLA 1J5EF 1R8CA 1U09A 2XNQA 2GX8A 3ELHA 1SQFA 4QYRA 1VRTA 1R0AB 4I68A 2COLA 2AHOB 5MLCV 4WZQA 2N4CA 4IG0A 3P45B 5CZXA 4JV5F 3R5DA 1ZBTA 1WHYA 5C42B 4DR6J 1PJ7A 2NSBA 2P9EA 2DNPA 3GILA 3RW7A 5KFAA 4PG6A 3P8BB 3J81j 1CJTB 1DTQA 2AU0A 3MXHP 3O6QA 2B9EA 1H7XA 1N56A 2WW4A 1NPPA 3TAPA 3BSOA 1Q16B 4DV7J 4TNOA 2WBMA 2QTWA 2YKQA 2DCLA 4FPIA 4LIRA 5LXRA 4LRBA 3SZ2A 4OZ1A 1D9FA 4C6AA 2KHDA 1CQNA 5F0WA 3CCQS 2XHWA 1SKSA 4CI0B 3ULHA 3W9HA 2IYGA 2C2NA 3NAIA 3Q86A 2YH1A 3DRSB 4RW9B 5G4DA 1RYRA 3CC2S 1XR7A 4DUTA 2R7QA 4NEYA 4QIWD 4DPWA 5K5MA 3DI6A 1VQOS 2IVFB 2YNFA 4P2SA 1K0VA 1P9QC 1VRQC 2RRBA 2VG7B 1PCAA 4QW8A 2CQHA 3FCVA 5AE2A 5EWEA 3K89A 5FD1A 3T9NA 2V94A 4X84A 1YBTA 2QEXS 1SQGA 2MQ8A 1S12A 4HACA 4UY8T 1AFJA 2AYBA 2PDAA 3MUMP 2Z30B 3TW0A 4ZJQA 2HRYA 3T1HJ 4USIA 2IAJA 2QE5A 2CQGA 1VK8A 2LFVA 1D9DA 3VAGA 1S1VA 4I56A 1S4FA 4F0KA 1G3OA 2AGQA 3K5NA 2DVIA 2OKQA 4FXDA 4IQXA 2XI3A 3UFCX 1KVIA 2F4FA 1SV5B 2E66A 3AODA 1QAXA 2KJWA 1IWAA 2V68A 2EC0A 4Q0BA 4M5GA 3KK3A 1HKAA 1VGYA 2AZ3A 3H4BA 5IV4A 3PJ9A 3ILJA 1IBLJ 4DUYF 2XLJA 3WHIA 1RWKB 5AE3A 1R0BG 4R0EA 2XGQA 2IM1A 3OW2R 1YI2S 2LQ8A 2QMWA 3VAFA 1D3WA 4LR9A 1TUGB 4BHQA 1S72S 4MYTA 4DXLA 3AJDA 4YR2A 4DFMA 1AROP 2UVVA 3W2VB 4WBFA 2UXBJ 2RRNA 1X4DA 4LF4F 3MECA 5IOLA 2NZCA 5KFRA 3DOLA 1K9MT 4NX9A 1O6XA 2OLWA 3V6KA 5E3AA 1K0TA 3RB6A 3D1OA 3ZFVA 5HVHA 5K8MA 4U95A 2MEWA 4JI8J 3BSAA 1HYSB 4F0MA 4K5SA 3Q2TC 1FERA 1FVQA 3M8PB 1CLFA 3PX0A 3W64A 2IFXA 2Z4PA 5HROA 5A0YB 3OL9A 2NYHA 3MI7X 2HLUA 4JI6J 2D9PA 2KZMA 2R2TA 1JJ4A 1J5OA 3US5A 3ZTRA 4DV6J 1WI8A 3H20A 2ZUAA 2F3JA 1GX6A 1YJ9S 1XNRJ 5THWA 3H90A 2LQ9A 4ZN3A 2H54B 2HHHF 4UY85 1AYEA 4DR3F 2IM2A 1S9GA 1CEZA 4GRSA 5L38A 3QIDA 4X65J 2GIRA 3LP0A 1XIQA 2BVZA 4IKAA 1I1GA 1WC1A 4QIEA 2BOAA 4I6WA 3LTOA 3CJ0A 1RACB 1HWUA 3DM2B 4JI7J 3G82A 4DZDA 1JLQA 2ASJA 2DISA 3JTNA 1JLFA 4YMEA 4ZJLA 1U6FA 3L3CA 1KSPA 4OZNA 3MM6A 4HH1A 1WG5A 5BYQA 1S9EA 4K4YA 4A47A 2M3DA 3IAS9 4F4YA 3VZIA 4ICLB 4J7CA 1NK0A 1Y5LB 2PIIA 4KYZA 2LEBA 1TKZA 3M8QB 2DHAA 1DRZA 1Q7LB 4U8VA 1X4EA 4LVOP 2Y3YA 4O3RA 4R5PA 1GTHA 3HULA 3OLAA 3D66A 5K8PA 1IVZA 2JEJA 1UZHA 1FKOB 4EK2A 5J1PA 3KWMA 1C1BB 1SXLA 2WCXA 4O4GB 3NLCA 2J6TA 3V2UC 5LMNJ 2FB0A 2QMXA 4JI1J 2MXYA 1U8SA 2HBRB 1DLOB 1DHMA 1HA1A 2VONA 5D8HB 4KH1B 4RL1A 2DR8A 2R8HA 2ZWOA 2IA6A 2C2KB 2PEHA 1ROFA 1U25A 4ZCMA 2IPOB 4CLKA 4KFBB 1S6UA 4JYAF 1Q8LA 1UW4A 2MJNA 3HT3A 3DDNA 2NXEA 5A76A 6AT1B 5CCMA 2GO9A 4IDKA 5J2MA 2DNLA 3MM5B 1T9TA 2PMWA 4U67Q 4NMXA 5EN1A 3TQ1A 1RAEB 3VWSA 1DQAA 1UAWA 5DS7A 2XSFA 2C3PA 2QZ8A 5A6WA 3KFWX 1SJQA 2HKEA 3PKMA 1NKEA 4RU2A 4BCAA 1T03B 2B3TB 4Z37A 4ZN1A 1ZM9A 1SVDA 4BBYA 3BH6B 1KR4A 2ERRA 2W2PP 3UW1A 2D3UA 2YWKA 2I2YA 5IM0B 1WEYA 2CPYA 2WB1D 4DV2J 2BJ3A 4HDGA 2FVCA 4HTJA 4NL5A 1S99A 3A3PB 1M5PC 2F4VJ 1JQGA 2DXFA 3GFHA 1QTMA 4YP3A 5GAEI 1S5ZA 3IMQJ 3PVXA 2V2KA 3MMAB 1RHRB 1LW2B 3M30A 1UPMB 5KOWA 3MM8A 3D4JA 2A3JA 5JJBA 5KT4A 1RTIB 4HI2A 3M9NB 1EKSA 4IFYA 3OFEA 1W25A 1R8AA 1HNZF 2AEJA 3WX8A 2YNGB 4KT0C 2DNHA 4F02A 1Q0NA 4DV1J 4DFKA 4K0KF 1SKRA 3A8EA 4OYAA 1VQ7S 1YJNS 2BA9A 3H5YA 5D3GA 4GKKF 4KHMA 1KS2A 1XMBA 2FJBB 1DBDA 1VJQA 1IUJA 4I69A 1UVJA 4M8LA 1SI9A 3CB4A 4RUAA 4X4TA 3PRBA 4NOHA 1RHJB 2VA2A 2O66A 3L09A 2ZITA 4IG0B 1TTHB 2OGUA 3F41A 1S59A 3L7UA 1SL0A 5AJ3F 5L1KA 5FLXY 1FXRA 2AW0A 4FF1A 3DLHA 3PO5A 4X64J 4DV3J 3DYAA 2Y0SD 4FXWA 1DTQB 1WKJA 3GPAA 3IN5A 1IJFB 3NOCA 5HO4A 4K50A 3M8ZA 4QWCA 4IH6A 1TK0A 3PJWA 4TXSA 1X4GA 1TUWA 2QLFB 4HEA9 2HBYB 5DQIA 1FKAF 1VBKA 2X7IA 3OTCA 4FPRA 3M6VA 3TO8A 2W9CB 3BZQA 3G6VA 2WBRA 3BYRA 4C11A 2N7YA 1KKHA 4I6YA 1KVJA 5CYMB 3DI6B 2YNFB 1I6JA 2ZJPQ 2CPJA 5HMYA 3C6UB 5L1JA 2G1DA 2KJVA 2GW8A 3PYGA 2DYAA 4JI5F 2DNQA 4EO6A 4NASA 2CPZA 5GMKa 1R0CB 4MMOA 3M32B 2OPPA 3S01A 3OXGA 4DR1F 2FGCA 1GMWD 3BKUA 1SCJB 1S1VB 3EPIA 1QVGR 3EXCX 3G2XA 2HGLA 2H4YB 1HMVA 3N5FA 2V4JA 4AUKA 3EYZA 2FJAB 3TVYA 2DO4A 4TVAB 3PX4A 2B4OA 3PJXA 4IOCQ 3AHPA 3CC7S 2AX0A 4QWDA 1ZM4A 2FJXA 1HQEB 1RT4A 4Q0BB 3KK3B 2J8AA 3EGNA 3BSCA 3MPYA 5LXYA 2D7SA 3TUZC 3IXQA 1B70B 3FNNA 2OIHA 2A6OA 4NZ0A 4UF4A 2DY1A 4K4SA 3Q8VA 4WTOB 3RR7A 2J0WA 4ZVFA 1YDLA 5F8LA 1RYSA 2V8DA 3V6HA 3R5JB 2FTRA 4X66F 1FTCA 3ZZYA 3MECB 4RJVA 1ITPA 5B0EA 5KG1A 3DOLB 4CLLA 1PILA 3EDQB 1ZA1B 4XK8C 5DM6Q 2QO3A 1F1BB 4KGZB 2VC0A 1HQUA 4AL6A 1EZZB 2LXIA 1HNWJ 1NMEB 2KU7A 4ID5A 3HKWA 4U7UK 4QR1A 2OPQA 4OHZA 4C0HA 3K5LA 4G65A 4FDFA 2MKSA 2WSFC 4CNZA 1OYEA 3GE9A 1G7CB 4CDIA 3MR5A 1KRPA 1VK3A 3PXGa 3AA8A 3UD5A 1J5OB 4QWBA 5FLXU 1JLCA 1N4LA 4PG8A 2XM3A 2AP6A 2Q6BA 1SL2A 1H72C 1FI4A 4R8UA 3NS6A 2PI4A 3GIRA 2YKAA 1VQ6S 1FF2A 2MYFA 4URSA 1H73A 3UPFA 2CJ9A 2JEGA 5A8RA 3TANA 4QIGA 3J7YU 3ZZ0A 1S9GB 4OQJA 2LDIA 1NPRA 2CZ4A 2JL9A 1N5VA 4CO4A 3QRPA 1HI1A 2AX1A 4IG3A 2DHHA 3JSBA 4DV5F 2BR0A 3TA1A 5KFYA 5KT3A 5M2PA 1JX4A 2LEAA 3EX7B 3CJ4A 4CM0A 2EC2A 2DRBA 4KV8A 4WFNQ 3ZZOA 2AWZA 3KUHA 2L9WA 5F9NA 1XMOJ 1WKKA 1U24A 3GFZA 3G82B 1X9SA 1NM2A 2B9YA 4CNYA 2HFOA 4DR5F 2LXUA 2IM3A 4PG4A 4NI2A 3MM6B 3HVRA 1TAQA 3RZAA 3P5BP 4KPYA 2KTQA 4GKJJ 2QYCA 4WZMA 3K58A 2VU5A 4YOEA 3HXMA 2HYIB 5AT1B 4ALZA 2E1PA 2E1MC 5GVQA 3CIZA 4K5RA 1TKZB 2Y1JA 2E5LJ 3MM9A 3QMQA 4EMDA 1EIYB 4R5PB 3IBWA 5LM7E 4TYBA 3TA2A 2EI5A 3M9MB 4PUOA 2U2FA 2NXJA 3DLKB 3VAJA 3R3TA 4OYZA 2C3UA 5DZ6A 2MKHA 3F73A 4DR4J 3IG1A 4LFBF 3K2YA 3LUYA 4L72B 1S97A 2CNLB 2Q66A 2R7VA 3I9V9 3BB5A 2ROPA 2OTJS 4LF5F 4B9NA 2J9DA 3SDEA 2B7BB 1Y0HA 4C3MA 2ATLA 4ZVHA 4X4VA 5CXTA 3LP2A 2IJRA 2D74B 3PG9A 3WZ0A 4OZ2A 3B54A 4IH7A 4J37A 3DLLQ 1N54B 1NSPA 1QVFR 2QL9B 1S1TA 4NYPA 2CPEA 4ILRA 4ZKAA 2W4DA 4LRCA 4IDKB 5J2MB 1BY9A 3KXDA 2OHDA 4AQYJ 4OYXA 4ENOA 4DV0J 2DY9A 1MN9A 4DLEA 1FRIA 1FXDA 1RWMB 3R7NB 1O51A 1KOHA 2QIFA 1YZ6A 2V2QA 4EBEA 1Q86T 1I5OB 5B08A 4DS5A 5KFSA 5KG4A 2I5JA 3TNVA 1IBMJ 2KXNB 3PDNA 2ATCB 2MTLA 2HS0A 1ICEB 4G6VB 4ZPWR 4RNNA 5CAAA 5DM7Q 3F0NA 2N3LA 1WSRA 1NPKA 1UA0A 4O4RA 3HDSA 1N34F 1NK4A 3TUJC 4KY3A 2R7RA 2XO7A 2YWGA 4F8RA 3I56S 2J7KA 4G1QA 4NLPA 1HWJA 2KB2A 3FGVA 4OJ3A 4QIFA 2DITA 2ZBIA 2Y1RI 2H48B 3KK2B 3MM8B 2CZVC 2Y9HA 1H2VZ 2KFZA 2R3VA 4ID8A 4M5IA 1FK9A 1NO8A 2VUGA 4IFYB 1RWUA 3AD7C 1G2EA 1YITS 3EPGA 1HQ2A 4WWSA 3W5YA 1U1OA 4ZCKA 2EFNA 5D3GB 4FXVA 2FY1A 2G9OA 3B4DA 4MIWA 3GV5B 3GWCA 4YFUA 3D28A 4NYZA 4ZA1A 1TKTA 2M70A 3ET6A 1YJVA 1GT8A 5AXLA 4B3SF 4I4BA 4B3MJ 1TK5A 2XWXA 4ZPDA 3UN2A 1DY3A 5K20B 3FMBA 3DYAB 2FUG9 1BQMA 2YQ1A 1H6KX 1VQ5S 2ZHOA 2DGQA 2MQOA 3CCVS 2UU9F 1NK8A 5A2QY 4OI6A 5KG7A 4ZPBA 1RU2A 5EUHA 1NZAA 2QT7A 4DSJA 1VBYA 3MF5A 1LKZA 1JLBA 4MAKA 4CLFA 1KFSA 4MKVA 5M2UA 4M95A 1HLWA 2FIUA 2CVIA 5RUBA 2V9WA 2R8IA 4C11B 3SIPB 2HHVA 3V6JA 3DDKA 4V19J 1GNKA 4OZLA 2CFXA 3V4IA 4JV0A 3OSNA 4TLQA 1W2IA 5BR8J 3EMTA 1DURA 1LXJA 3GIIA 1L3SA 3MMJA 4JI0J 2BV3A 2VFUA 2NPFA 2EFVA 2CPXA 2W7AA 2LECA 4X4OA 3QJLA 5F41A 3BPDA 1KONA 2LQJA 2DNZA 3ISND 3S8SA 4B3OB 2BW7A 2QA4G 1HMVB 4F4KA 3FDSA 4PQUA 1ZPWX 3UDVA 1M5HA 4CLUA 4OYWA 4P9SA 2WZ1A 1HI8A 1LWFA 3Q8RB 3AT1B 1PJ5A 2MY8A 1U0HB 4NCGA 1RT4B 4C4WA 1WELA 1N5QA 2KYXA 3JYTA 5LMUF 4K7QA 4DQRA 3RRKA 1NSKL 4DR2J 1SJFA 3WIUA 4DBQA 5F8IA 2CVEA 4AT1B 5B0CA 3LWLA 1EKRA 1CJVA 3MM7B 4KKOA 3KJQB 4Y2IA 2MY7A 2J76E 1FTRA 3SQOP 3AD8C 2NUHA 1NHKL 1VQ4S 3W1YC 4OYOA 1AUDA 3BDPA 5KFXA 2HWHA 1C0TA 4KHPJ 4DG1A 4ED3A 1YGYA 2OELA 3MPDA 4LRFA 5GMDA 5J1EA 1IR1A 3MEGA 2LEPA 2UUAF 4DPTA 1OPIA 2J6SA 4JI2F 4JI3F 1H2TZ 4M5DA 4MK9A 2MPUA 4ID5B 2GMHA 3MGJA 2ZH9A 2OPQB 2C2MB 1YJTA 4B3RF 4C0OC 1REVA 5D78A 1J5EJ 3NNCA 5CH7B 1JLCB 1KQFB 5HVFA 3ZZTA 2KG0A 1FDDA 1VYAA 2QMUB 5KFQA 3VAIA 4R8UB 3NXZA 1XBWA 4P52A 2KDOA 3VGVA 4ECWA 5A8RB 3VGSA 3ONQA 2ALZA 3R5CA 3NS7B 5HN0A 4JV5J 3BO3A 1APSA 2Z2YB 2WSEC 3HPOA 3BR8A 4IG3B 2IM0A 3G6ES 1LQ9A 2GC8A 5A2QU 3KUEA 2ALYB 3ILLA 2G0CA 1TUVA 4ED4A 2DTJA 1KHWA 2MKCA 1RAOA 3H42A 5HK4A 2W9BB 2LA4A 4BC7A 2NZ4A 3M05A 4I0WA 2RKIA 1RWOB 2Z2ZA 4M5JA 4N56A 3IS9B 3Q89A 3BQ2A 1DTTA 2GV1A 5HMZA 5KG0A 4NI2B 1Y9OA 2RRAA 3W8GA 1OMSA 2HZAA 1NDLA 2Z56B 3QT5A 3CT9A 2ZOFA 4B02A 2HFUA 1F3FA 2L9DA 4CCHA 3RB3A 2PD1A 5EWGA 5KT7A 2VH7A 3W9IA 2MLZA 3MM9B 2MHNA 3NMRA 3AQOA 2XY7A 4K4VA 1LW0B 3I55S 2DXDA 4DSKA 2OEMA 2XMTA 3GIKA 4WF9Q 4TU8A 4A8OA 3VCDA 1XK8A 2H5JB 2XYGB 1FWPA 1TL3A 5DQHA 2HPUA 2CQ2A 1XQIA 3GYXB 2RDIA 1TAUA 3I5BA 4Z7YA 2HNZA 1Q5YA 3FJ2A 5IQ6A 1C2PA 3CEDA 2D9OA 4M1KA 3MFIA 4CH1A 3LP2B 2VQEF 3OXLA 2N82B 1KEKA 4K59A 5KFIA 1FRXA 3M8WA 3AXMA 2C1EB 1DZ5A 2MKJA 2HHWA 2RB7A 1K1QA 1NBEB 2CA9A 2V9KA 3N4WA 1DJ0A 4J9NA 1BGXT 1S1TB 2FLNA 1R8HA 4DV4F 3THVA 4OJGA 1NK9A 5CD4A 4GC6A 4L75A 4DPOA 1HPZB 2Z0GA 4DUYJ 2PE8A 1WC3A 4NA2A 4J9KA 5KFBA 3MFHA 3R6GB 5DGBA 3BGUA 4FKYA 1XMQF 1X5SA 3KLEB 1IR0A 1VQSA 2P9CA 2ZNZA 2DR9A 2VFSA 2I5JB 1YTYA 3W62A 2QL7B 4HYKA 4FYYB 4JB8B 4ECYA 1T7PA 4LF4J 2ZH8A 4ES3A 2VBYA 1SC6A 3W2WA 1VHIA 3OQ2A 3FBBA 5E3RA 3DGPB 1PBAA 1OJ4A 1VQYA 3DMJA 4HDHA 3W66A 2AYMA 3AH6A 3QJJA 4G1QB 1X5TA 3C8YA 3JAMY 2YY3A 1UWBA 3T5JA 2IVYA 4RZRA 3D1QA 2X51A 3WIVA 4KBIA 3K8VA 2HLTA 2V4QA 4ZP6A 4U9RA 2GS8A 2MQMA 2GHWA 2HQ3A 2HIQA 3QIPA 4NLDA 3H2VE 2HHHJ 4KAIA 2M8HA 4I7FA 1KTQA 4DR3J 1UFWA 5LSRA 1U4BA 5F8MA 1BQXA 3CCWA 1TP7A 3PX6A 1IQZA 4X4UA 1V3ZA 1R89A 2BABA 1ZAVA 3BDEA 1QLNA 4ANDA 3ET6B 1RT7A 1IKYA 4WCEQ 4K8RA 4B9TA 2DHXA 1HARA 4DR7J 3C6TA 3THPA 5L39A 3IRWP 5HBMA 2E7XA 4F2RA 5IZHA 2HAIA 4KB7A 1TQLA 3VALA 3CDUA 3AB4B 4LSNA 1BQMB 1T3NA 4CT9A 3T9ZA 3WBZA 1RXOB 4CLWA 2ZC3A 3GU0A 2XEXA 3JSMA 1I94F 1G4CA 1JLGA 9RUBA 5F8NA 1RKJA 1FWLA 3K57A 2NUUG 3IGVA 4J91A 3HVAA 2L41A 1OIAA 4DSLA 3GYNA 3Q8YA 2NSCA 2H4WB 2DGVA 4Y3CA 1N8RT 4M5NA 3M2RA 1JLBB 1PGZA 2PN6A 5FDLA 2MZJA 4EBCA 1CJKA 2GIQA 4WKYA 3NGUA 2ABYA 5B7WA 4IO1A 4ECUA 2RMLA 5CYQA 2B6AA 2YKOA 2P9GA 3QSIA 1NJWA 3MWBA 1RAAB 4B9UA 1RSCA 1HHTP 5ETPA 1Y3JA 1UVIA 3AXKA 3DLGA 5E5NA 4WE1A 1X0FA 5DRKA 4YQWA 3ZTQA 4J9QA 2A10A 3D0IE 1YWXA 1TMMA 1Z2LA 1R3NA 3QZ7A 4C8YA 4FN5A 1EJ7L 1RQ0A 2JZ5A 2VOOA 3HX9A 4JYAJ 3NBPA 2MHEA 1S10A 3R7BB 5EGYA 3R5GA 4LRDA 4JUZA 1KQSR 1RBLA 3H5SA 5D0GA 3TYTA 1VBXA 3VVTA 4C9DA 1UEVA 2RIJA 4Q8FA 3JXOA 3CO0P 1AB8A 1HWKA 4LF8F 4C8OA 1RABB 5DDQC 2ZC4A 4NCGB 2JLGA 1SUQA 1HBMA 5IWAF 1L3KA 3GIJA 3AOAA 1N52B 3JYTB 1FDNA 2DHSA 4XAKA 1W2BR 2GGPA 3CDBA 2XMWA 1VLOA 1NU4A 2P6TA 3JAMU 1EQMA 4NLOA 4PQAA 3RAXA 5GAGI 2AJFE 2V69A 1CJVB 4PABA 4KKOB 5KFPA 2JVOA 1HBOA 2DGXA 5E41A 1OS5A 2XZWA 5F0UA 1C0TB 4ZS6A 2KXHA 2CWXA 1CPZA 2XMJA 4LR7A 5J1EB 1TL7A 1TKXB 3KLGA 3BS9A 3MEGB 3ZNJ1 1CSJA 4N77A 1S6QB 4OI4A 3IR5B 2R7UA 2OFGX 1WJ9A 4PXEA 5EDWA 3FUYA 1U47A 1OY6A 1S48A 1ZA2B 1HNZJ 4M63A 3FFIA 4WXOA 6FD1A 4K0KJ 3DLJA 2J0QD 3TX0A 3PIPQ 1REVB 3SMZA 2UXCF 3OFHA 1UL3A 1NKCA 4GKKJ 5EX3A 5A8KB 3BQ0A 4A8FA 1O8BA 3MR3A 4CYUA 3IRXA 2QA1A 2J8SA 4DOZA 2IYIA 2Y1IA 5ETMA 5KT6A 4C3KA 3D7SB 1N32F 3PV8A 3C2PA 2LKZA 1X4HA 1HNIA 2BJEA 5AE1A 3D5MA 2N7CA 2OEJA 5EWFA 4KGKA 2CQ4A 2C2DA 3I0RA 1GAOA 3D0HE 5ETRA 3CDEA 4F4XA 3CIMA 3L7OA 2QC3A 2ACMA 1L3VA 3OLBA 4U96A 2CPDA 4DX7A 3UI3A 4HT5A 2JSXA 2G0IA 3R9LA 2YKPA 1LNQA 2DGOA 2RQCA 1Q5VA 1N33F 1JKHA 3Q0AA 2WAQD 1DTTB 4BWMA 3G9CA 3GCXP 3CCZA 1BXNA 3NG8A 2BQUA 1ACMB 1SB6A 4QPTA 4WK1A 2XULA 2QLXA 2NR0A 4LJMA 4ATNA 4Q5VA 3BSNA 4A8YA 3BEGB 2E5IA 4QYZK 1WTFA 2BRLA 2HEKA 3IM8A 2EFQA 2LXFA 2IMOA 1VHFA 2EEYA 1UJ4A 1EETB 4DFJA 1T9YA 3GSIA 3RB4A 4OI2A 4DCJB 1VQ8S 2YX1A 2HS4A 1D1UA 1FJ7A 4PG5A 3SEOA 1JXEA 3LW5C 2CQ3A 5L1LA 1FE0A 4ZVOB 4AD6A 5T41A 5D0RA 1UJ5A 4JI5J 1FRLA 2XYHB 1TL3B 1RT5B 2AJ0A 1GMVA 1IJEB 3FEZA 1ZETA 2P2CB 3IGNA 3O1LA 4Z7CA 4DR1J 1VQPS 1OWXA 2HNZB 1WORA 3UVJA 4DN0A 4G1PA 2G2YA 1H98A 5G0RB 1CBKA 1EX8A 3VGTA 2PMZD 3RBDA 3IBCB 1HBNB 3VVUA 3R1HA 2CDRB 3C15A 4YHHF 8RUCA 2RQKA 4X4RA 3KLVA 1SL1A 2J5AA 4MKYA 4DFPA 4IQMA 4Q44A 1F60B 5CA5A 3MCNA 3HJVA 3Q8QB 3O3LA 2LA6A 3W61A 3TAQA 1WC6A 4RUCA 3CPWR 1XNRF 4B3TF 1RHUB 3LH2S 5I42A 1TK8A 4ZITA 4ELUA 4WFZA 2WVDA 4X65F 4P2FA 2EFGA 1IKXA 2ZE2A 4QIVA 3OUYA 5D4LA 4MJKA 3AJ2A 3K5OA 2Z2MA 5IC4B 1KN6A 2XNRA 3VQTA 4CO3A 1F9HA 4X66J 2E1CA 1WD6A 4F4AA 1ZTTA 2O3DA 3DRRA 3T41A 3W2WB 4CLZA 2YNIA 2KKHA 4JI7F 1TKDA 3B4MA 1RTZA 3DMJB 3PFOA 2W2MP 1I51B 1X60A 2P5VA 3SYZA 2KZZA 4EYIB 4HH0A 3Q23A 2DNMA 3UDEA 2LU2A 1UWBB 1QJHA 1ZTWA 3JQMA 4O3OA 2VDIA 3EXYA 2E9ZA 1URRA 3JTOA 2LQ5A 1Q8IA 2HIYA 4Y65A 1S1XA 2F40A 4OV1A 5J2PA 2CJXB 2EBEA 3MAHA 5F8GA 2AYGA 3C66A 3QGHA 5HP1A 3OJSA 2IRYA 4FS2A 4I7FB 2JFKA 1K44A 1GQEA 4CWBA 1F0XA 3FMWA 3CJRA 3D3CJ 1RTJB 4N7TA 1P1TA 4DV5J 2V6AA 3ETOA 3N5BA 1RT7B 2BQRA 1IKYB 1FNMA 3IC1A 1PC4A 3C6TB 3BGLA 5HJXA 1DAXA 1RAFB 2GJFA 2HZCA 4UOGA 2DEIA 4ZLPA 1Q78A 2UXDF 2B9WA 3W7BA 3E2EA 4DR5J 4LSNB 3UN5A 1JMTA 2K8GA 2MKYA 3A3NB 3QLHA 1NDPA 4CTAB 1WHVA 3W60A 3NCPA 4DQSA 1J27A 3JSMB 4FZVA 1LWEA 3PIOQ 4DCOB 3GB0A 2BANA 1JLGB 5D4OA 1Q95G 2NREA 3N28A 2A1BA 1KD1T 2VQFF 1ZM3A 3FC9A 4B08A 5LSOA 3QNWB 5KFKA 5A6PA 2BX6A 3L95X 1Z4UA 2PFDA 2XLKA 3M2RB 3R27A 1YX2A 1RWVB 3BGRA 5FDLB 2M8DB 1WI6A 4ZIWA 2MQQA 4ED1A 3DCAA 1HR0F 2IRXA 3Q24A 4NE9C 3E01A 3CD0A 4WTYA 5CYQB 2B6AB 4LFBJ 4F3MA 4ZVRB 4CLSA 1B7FA 3OTOF 4V19X 1RTHA 1S76D 2P8IA 4KJIA 2VKZG 8AT1B 2FC8A 2H65B 4LF5J 2CJYB 4OJ1A 4DPXA 2N4DA 4WE1B 4OYPA 1VIXA 1S7IA 3IP0A 3VGUA 4RBVA 1YRUA 4IRDA 4HL9A 3GR1A 2D3O1 1D0EA 4WFBQ 4RW6A 3M2VA 5DG9A 2GQCA 1N6QA 2R8JA 5T14A 4DL6A 4NCBA 1JWWA 3D6HB 1NSAA 2CKWA 2JWNA 3A8JA 5I3QA 1SJ3P 3CCJS 4ED7A 5J2QA 3Q22A 3TP2A 3P5TL 1S6PA 1SUQB 1VMBA 1HBMB 3R5BA 4P2XA 4QJVA 1UTAA 4R25A 1WKLA 4HI1A 2GGPB 5LT5A 2DPIA 2VJUA 5J2NA 3QBCA 4FBUA 1N5TA 3DDIA 4NXNF 3SSRA 4ETZA 1N34J 4DL3A 2RHQB 3W9JA 4DCPB 3L4BC 1HBOB 2W4CA 1JLEA 2GVZA 2MZ1A 1IM6A 3GZ7A 4ZP9A 2HFSA 1VCTA 5L46A 4F50A 2F65A 4DEZA 2DD8S 2HS3A 3A4TA 4UW2A 5L9NA 1TL7B 1CULB 1HNXF 5DLFA 4UOHA 3DXSX 2ZOMA 4M5LA 2K3KA 1HIYA 5I3UA 2FLPA 2F63A 2J9DE 2P6SA 2RF2A 1U7LA 5D77A 3SFGA 1M1GA 4ECVA 1TVRB 2FHKA 2IBKA 4TKTA 4QWAA 2FY8A 3FFIB 1YK9A 1PBUA 3ENVA 1T8EA 2WHOA 2GVDB 1C4CA 3Q8SB 5ETLA 3AOCA 3AQPA 3P96A 1CJUA 3OHBA 3CJQA 4ZJOA 1VQKS 4CYUB 2W8LA 3IRXB 2NXNA 3PFEA 1KDNA 1RT1A 2YKMA 4J9RA 4DMZA 2YPZA 5KT5A 4P7VA 4WIIA 3TZXA 5H9EK 2LDYA 1MLAA 2ZM6F 2K2PA 5J1NA 2WVFA 5HQ8A 4B3SJ 1UFLA 1LOUA 1OY9A 2XS5A 4FVCA 1HNIB 3RG6A 3M6WA 1K73T 5ITHA 1NUEA 3FBCA 4ZHRA 2B43A 3I0RB 4DU7A 3CCUS 3BN7A 3BBBA 3HD1A 3I5CA 3CMAS 1MN7A 2E1AA 4EBDA 3GR0A 3MD1A 1EQ0A 4I6AA 2E7WA 3LF0A 2KI2A 2UU9J 4C3LA 1MU2A 3QT7A 5CD4H 1UZDA 4IR9A 4PG7A 1N5YA 2AYEA 2V67A 4RNMA 3CCRS 4W90B 1FFSB 1SC3B 2POKA 1WC4A 2X1FA 5F3TA 2OSRA 3PCOB 2DEJA 4C2MA 1S6OA 1QAJA 4CO0A 4RUBA 1M5VC 4EO8A 1SPBP 1RHMB 1AXQA 3PRDA 1U2FA 5I3PA 4NLUA 2HVIA 5E3PA 4USVA 3ZZRA 4DJBA 3R5AA 5DQGA 2B51A 3KMQA 3R97A 4A8MP 1T05B 5HLFA 3PYDA 2XQCA 1TU0B 2HHQA 2BM0A 1RT3A 2V0NA 1KHVA 3H25A 2O1PA 2NXCA 3W63A 3MAAA 3TEHB 3UVJB 3OVBA 2GCFA 1YHQS 3HHKA 1VQNS 5AXMA 1HW9A 2DCUB 5GAHU 3BO2A 3PO4A 3C15B 3FCHA 4Y28C 4F3OA 1NLKL 3VR1A 2VPYB 1D8ZA 2JX2A 4K4ZA 5DDRC 3GV8B 4ZPTR 1GMUA 2KHCA 4B9SA 3UCGA 1TFYA 1T9WA 1G1XA 1YJRA 3IO1A 2XMKA 5BYSA 1P9YA 4NPOA 3GJTB 5I42B 1IBCB 2FJDB 1N0UA 1S0NA 2LU1A 1WSVA 5C42A 2Z57B 3F56A 1IKXB 2ZE2B 3AY0A 3TVZA 3H7HB 3OUYB 3CULA 1MWQA 4Q8EA 4RW8B 2YWEA 2GAGC 4BS2A 2RE1A 2HRUA 2FPHX 5FJ4A 4N41A 4DQIA 2L3MA 3NRBA 5K9FA 1XMOF 2YNIB 1M0SA 4LQ3A 2UUAJ 4JI2J 2C3OA 4JI3J 4OIXA 1F2GA 1J2VA 1SJRA 2BJDA 4FVMA 3GIMA 1FJGF 3LGNA 1RTDB 1S0OA 2LYVA 1SQEA 1PSDA 2ZZTA 4YR3A 4B3RJ 2WRMA 4ER8A 1PO6A 2J0XA 3G87A 1OQ6A 2ZVSA 2IHR1 2YNHA 3BGFA 2ZBCA 5H9FK 1S1XB 2CYYA 5J2PB 2Y1LB 4URGA 4WPAA 2G13A 1KP6A 2BJ1A 3P49B 2E5LF 4P6QA 2XSJA 5CHCB 3T6JA 3UCUP 2DNGA 4Q7AA 3GTYX 1V9OA 4N47A 1ZYQA 1OSDA 3D6MB 2YQ0A 3K17A 5IS2A 3CD5A 2I38A 3KJNB 1L5UA 2DH7A 2JFDA 5KFLA 4X4PA 4PYDA 4PWDA 4XO0A 2HSEB 3IFEA 5CQGA 1RJJA 2CJAA 4RW7A 1VI7A 2HHXA 4LREA 4QPXA 3THTA 1WHXA 4ELTA 4CQ1A 1C4AA 3BJYA 3X1LB 3B78A 4CP5A 2ZKUA 4ZPCA 1WF1A 3QLHB 1N5SA 2AQ4A 2BMBA 2GO8A 1LWEB 1OSCA 3KKFA 3RUBL 1OYDA 1IR2A 2BANB 4NLQA 3I5AA 4ZVGA 3RYLA 3PM9A 4DV0F 1B4SA 3KG1A 4CIOA 4JV2A 4Q45A 2IDEA 3W3SA 2VPXB 4DPYA 2EPIA 4DL5A 3QAUA 1RLCL 2LLZA 3TJAA 4HT7A 2VKRA 2XLIA 1RGVA 3BGRB 4U7CA 1S57A 1SBRA 1JNZB 4ZPAA 2V2VA 1H2UX 2ZUGA 4ES2A 4DL0C 1VRTB 4M5HA 3P4UB 1RAIB 3E01B 4TQRA 3TVKA 1Z2ZA 1FJEB 1UJ6A 2WVBA 1NJYA 3I6PA 3W2VA 1RTHB 2F8MA 3M6UA 4IOBA 3GJQB 4PPZA 1NDCA 1H74A 2RDDA 2NQPA 4ECZA 1NJXA 4YB6A 2K7JA 2VQEJ 2OI2A 2DIUA 2KXFA 2E29A 2JLEA 2K3IA 1JXVA 2KVQE 2KT3A 2QN6B 3M8PA 2UZAA 5A0YA 4X4SA 5KFFA 4NYOA 4FF2A 2X1GA 1PIEA 2M52A 3HHEA 4RW6B 4QU7A 3M2VB 4OI0A 2DIVA 2DPJA 2WVEA 2C22A 3A8KA 7FD1A 4DV4J 1UEKA 4PYAA 1S0MA 4ECQA 4DZ6A 1X9WA 5LJ3Y 2D3OR 3UD3P 2FGOA 3D54A 4TY8A 1YRXA 3FBEA 3H40A 1UEUA 4Q43A 2ZNYA 1U1QA 1Y5IB 4ZVTB 3M8YA 5J2QB 5DZ7A 2OO4A 1XMQJ 1YSJA 3GFYA 2UUTA 2BJ9A 2PSZA 1S6PB 3T5KA 4OL8A 2FLLA 5HMWA 2BE2A 4WK3A 1LK5A 3LWMA 4DUZF 4WP8A 3N6NA 3D68A 6FDRA 1Q53A 3I0SA 5IC6B 3FCWA 5B0DA 4TYAA 5J2NB 2AGOA 2ZH5A 3FQLA 3LAMA 1VC6A 4DI6A 4B9LA 2HVHA 3G96A 4YB7A 3DM2A 3QGIA 1FEHA 1HBUA 4IR1A 1FJCA 4IO9Q 2DRAA 1JLEB 2GVZB 3I9ZA 4HACB 4USHA 2AEMA 2G2OA 3ISNC 5CZVA 2FZCB 2DGSA 5BXIA 4YY3F 4KIAA 2IAJB 2VFVA 2RS8A 3KTQA 2J9EA 3TAMA 2CQPA 3KHLA 2GA7A 3MR2A 3TJ8A 3EICA 4LT6A 4OYBA 1M1HA 2W1BA 5I3UB 2W7PA 5DO2A 1FX4A 2CJKA 3PNIA 4QYZJ 1PYTA 1Y5NB 3M8QA 1LFWA 3LQVA 4AL7A 4RW4A 1HWIA 1RWPB 1S1UA 2QLJB 2PEBA 4OYMA 3ENAA 2KYZA 4ECTA 4DSEA 2H1YA 3B8HA 1MNEA 2DR6A 2BKNA 4MKBA 3CMES 3SFUA 1CJUB 1XWLA 5K14A 2XC9A 3L9ZA 1FKOA 2QSFA 1AFIA 2YKMB 1A0OB 1WOOA 3KUGA 4DS4A 4O23A 1U45A 1RUSA 4YDXA 1VR6A 4Q2MA 3R2DJ 3EM1A 4U6PA 1N36F 4O3PA 3N0VA 3MUVP 2CDQA 4Y2MA 4Y6IA 2RH3A 2CWKA 3VZHA 4ZHRB 2WONA 2K7KA 2BYCA 1Q1KA 1MMDA 1UVNA 4O3NA 3UCZP 3ISZA 2GHPA 5SZTA 3PEJA 4KE5A 4NXMF 1GH8A 1F5BA 3M1VA 1NXIA 1I94J 2J7UA 4ZLJA 3MM5A 1KC8T 1HD0A 1FKPA 1MWZA 1MU2B 2E44A 3QFWA 4O0IA 2GNKA 3RGIA 1K1SA 5HROB 1N5YB 4OZJA 3NS5A 3BREA 3GSDA 5ETQA 2R2RA 4F4WA 4CH0S 2ZBRA 2VG5A 3G6YA 2VBXA 4PXDA 3BQ1A 3NWRA 4MT1A 3SQGA 4MIAA 1NJZA 2UUBF 4LBIA 2PFFB 3NGTA 3OL8A 1VC5A 2IBOA 5D15A 3GYGA 4OHXA 4TU7A 2HQFA 2IC3A 2D3ZA 2FHMA 4KSEB 3OXFA 1GXTA 2PT0A 3HSZA 4RPFA 2FZKB 4PZVA 5HLFB 3PTWA 3LP0B 2R2UA 4HKQA 4EI2A 4KGVB 2W9AA 2HHSA 1RT3B 1RCOB 3OVAA 1CC7A 2DNYA 1T94A 1ZZFA 5DG8A 2VHGA 2C3MA 3D9BA 3MAAB 3R8YA 3M8SA 3BR9A 2PC6A 3HSJA 1P6TA 3MMAA 2CPIA 1LW2A 3RTVA 4LFAF 2FJVA 3MOJB 4JP8A 2VOPA 1JLQB 1QM9A 1RAJA 1JLFB 3MR6A 1RTIA 1ZS6A 2KM8B 3OL7A 1FEEA 3D3BJ 3Q8UA 3MEEA 2YNGA 2V8HA 2GJIA 3BM7A 4P10A 1S9EB 1E6VA 3TWZA 2BQ3A 4LF8J 2QA4S 1U1PA 3NNAA 2YQ3A 1M5OC 2RQ4A 5IWAJ 5C2CA 1YJWS 1W26A 2AJQA 4G3IA 1WC5A 1R8PA 4ES1A 1FNXH 1FO1A 4RX6A 4O3SA 1NHVA 5GADU 2DNNA 3GONA 3VF0B 4YB5A 2EVZA 1XR5A 1EB0A 3TARA 2B7CB 3CCMS 1XERA 4LSZB 3TX8A 1FFGB 4A8XA 1KLMA 3CE8A 3UO0A 4UOCA 2R7WA 1IBKF 3O2IA 2BUNA 2HVEA 2B4UA 2HVDA 1YQHA 2MQNA 1T11A 4FF3A 5B0BA 5MAOA 1NB2A 3HT0A 3ICLA 2K06A 3NWGA 2EW9A 2WVCA 2HQCA 1WG1A 4DX8H 4JBCA 1RWNB 2UXCJ 2J7WA 2HNYA 4HHUA 1K8AT 2YNHB 3PW2A 4CRJA 5BYRA 3PZPA 2W9CA 4CO2A 3TI0A 1QD1A 2OSQA 2ZHBA 3HCXA 1WEZA 5CYMA 2XSJB 1Y10A 2AF6A 4YUDA 4M5MA 3HJFA 3DOMA 5C2GA 1X31C 2XY6A 3MOZA 2ZHAA 2ASYA 1XR6A 3C6UA 3MTJA 1N32J 2AT1B 2V50A 4TLRA 4A46A 1B7YB 3NGDA 4YEAA 3K8WA 4LF1A 4PWDB 3M32A 3DU6A 2RU3A 2HWTA 4PR6A 1QY7A 4LF7F 2DGWA 4RW7B 1UP1A 4CM2A 4O44A 2D41A 3FZBA 4ZVUB 5H1SV 4LFCJ 1FT8A 1SH2A 1AA1B 4OZ5A 3DFEA 1N33J 3QFHA 2DKOB 1Y11A 2BEFA 3D0GE 2I1RA 1NSQA 3ZXWA 2Q43A 3D6FB 3M30B 4URQU 2HURA 4LIWA 1RAHB 3KHGA 1RWXB 4W98A 2YKNA 1S0VA 1W7WA 1HQEA 3C14A 3KLHA 1BHNA 3GFXA 1O0PA 3UR0A 3HKZD 2EK1A 1CQMA 4WFXA 1NDKA 1FRJA 1HD1A 2KG1A 4BWJA 4QBUA 1PAEX 3B6BA 4E98A 4OX6A 3E3XA 1NH8A 2RJZA 4KRWA 4CLYA 4RKUC 3Q2SC 1Z1ZA 3QJPA 3RRHA 1N48A 3NCQA 1IQTA 1UVKA 1BQNA 3HFKA 2M7SA 2XMAA 2GQ2A 4LF2A 4F04B 2GIFA 1VQ9S 3T6BA 2L08A 4YHHJ 3NCRA 4N76A 4F3QA 2HFNA 4LVNP 4NRTA 3I4HX 5HAOA 3H4DA 2X3DA 2R7SA 2VJVA 4P7TA 3U7JA 5D0EA 2ASDA 1S7HA 2R42A 3SBMA 4CO1A 3N6MA 4FP9A 3DU5A 1V5IB 4B3TJ 1IKVA 5HQMA 3IM9A 3QYYA 4TY8B 2Y0BB 1RBAA 2F9JA 5HSPA 5IFMA 3LPEA 1ZPVA 4JV1A 2HHPA 3T5HA 4B17A 5DLGA 5H9EJ 1AUSL 4EUVA 3H0PA 4WFAQ 2HMIA 2YH0A 1OY8A 4J9UE 4U7UD 2BE2B 3RR8A 1ZM2A 1FFWB 3G8TA 5C25A 2LMIA 2FJEB 4ED8A 3I0SB 2JEFA 3NGKA 5HJYA 1WOSA 3ZZZA 2FJWA 2KRRA 4DWIA 2UVRA 3PW7A 2YBVA 4I2QA 3B82A 1XNQF 4DR7F 3DHWC 4CZCA 1HBUB 3OL6A 3UDCA 3PR5B 3OR2A 3IWNC 1R31A 3WC2A 2V8PA 2OPPB 2MQPA 4AFFA 1FD2A 4KGXB 4N8OA 2BBEA 3TAMB 4PWUA 3HK2A 1HHQA 4Y00A 2V4JB 3U1LA 4FKXA 3GV7B 3H59A 2HQGA 2D69A 2WK4A 5CYJA 1IM4A 3CCLS 3LGMA 4RW4B 1S1UB 4W4MA 4BDPA 4F7VA 3PW5A 1U26A 2BRKA 4F4ZA 2WOMA 4J9SA 1IXKA 3EZUA 1O5JA 5D0HA 5E7OB 3DLKA 1RHQB 3HF5A 5K14B 3QPIA 3W65A 2JEIA 1F3VA 4IH5A 3SCKE 2A2DA 3M9OB 4I2PA 3PR4A 4RNFA 2OPSA 3RAMA 2L48A 3EWGA 2DGTA 4UZBA 4P72A 2ZKTA 1EAYC 1D9AA 2QSWA 3TQEA 5ETOA 4K4XA 3C16A 2HVZA 4DF4A 2JC1A 2UXDJ 2R4FA 2WONB 3VAMA 3TOQA 2M5YA 3CJSA 2AJ4A 1BE4A 1S79A 3HHDA 4OX8A 3M1VB 1HQUB 1U1LA 1FKPB 2EWHA 3J81Y 3IWLA 4ZVQB 3NKYA 1YJUA 3V81A 2VQFJ 1X8DA 4D3GA 3H8YA 4H4OA 4MK7A 2W2OP 2DK2A 4ED5A 2EFPA 2VG5B 3BKTA 4KHRA 1MMNA 2A6MA 3VQSA 5IT4A 3SQGB 3CW2C 2R9LA 1CG2A 1HR0J 3H2UB 2KFYA 2FVSA 1Y4ZB 4GVBA 4OLOA 3P3DA 3QWPA 3OTOJ 2HHUA 2A2CA 4U8YA 3TR5A 4ZP8A 2IC3B 4Y2AA 4DQQA 1RT6A 2XGPA 4ILMA 2UUWA 3NMAA 4OYIA 3IR7B 3TEGA 3UNYA 4XIUA 3QAEA 2A18A 2HGMA 4UZCA 1BWVA 2F8EX 1NEEA 9ATCB 1YZ7A 4EFAC 3BPSP 3R6LB 4KV8B 5LJ5Y 2O67A 4AYBD 3M2UA 3KK2A 2HK3A 3EJMA 3SSQA 4AE5A 2U1AA 5GAHI 2HBZB 5H9FJ 2UUCF 4LRAA 1OPZA 4RU9A 3MEEB 1B99A 1ZAWA 3OTBA 4PRFA 4ED0A 1E6VB 1QSSA 4P74A 2DO0A 4OMFG 1AZSA 3VAKA 5T7LA 5L1IA 3UE2A 5DG7A 3J7A1 2DNKA 1T95A 2HQDA 3FRYA 4ITSA 3T3FA 1GEHA 1S77D 2V8GA 4GVLA 3GG1A 2UV8A 1QSYA 2ZBPA 4FBTA 4ERDA 3OSPA 1VFJA 3NEKA 1U2RA 1X0PA 4WIQA 2LQBA 5B0AA 4NZ7A 4CLTA 4NXNJ 2A0FB 4CH7A 3G8SA 5KFCA 1RA6A 2JOQA 4PUOB 2LVWA 1RHKB 4RO0A 5C24A 1KLMB 3DXBA 2DHGA 3IG1B 3JB9k 4WXWA 3EUNA 2VBWA 4K2XA 4NLXA 4ZVEA 1UFKA 2NPIA 4N8NA 1UVLA 4Y0FA 1HNXJ 4RLEA 3SDEB 4E8UA 5L9XA 2IMWP 3SV4A 2EBGA 3ILIA 5JXSA 7AT1B 4X62F 1JJCB 4K4TA 3N01A 3M8RA 4XPCA 1PYOB 2GQQA 3C19A 1URNA 3KK1A 3QWUA 1U6ZA 4AL5A 2MMYA 3ZO7A 1M5KC 2HNYB 3QT8A 1B0VA 4USMA 2CZ9A 4RR5A 2ZH6A 1X4CA 2PGCA 1JNRB 2JH3A 4F0HA 1IWGA 1FCAA 3DOMB 2ZM6J 5D4NA 2ACYA 3K59A 1U6BA 1Q7YT 2R8KA 2ZH1A 3I96A 2H5IB 5HVGA 3OJUA 3BBCA 2KT2A 2AZ1A 1Q79A 2BACA 1RE1B 1T3OA 3J81U 4C0BA 4UQGA 1RI7A 5IQQA 1A6LA 3OT9A 1NK5A 3W8PA 2DB1A 1B3TA 4MKAA 3QGPA 4E0DA 4X2BA 2VZ9A 3HM9A 1FX2A 4O44B 4LF6F 4UOFA 4B3OA 2FDNA 3SSSA 1U49A 4H4KC 2R8GA 2HHTA 2OMOA 4NMLA 1QE1A 5KFUA 1V3RA 2W01A 3OTDA 1EP4A 1XN9A 3C46A 3KMSA 4KO0A 4WP3A 2YKNB 1U0HA 2AV5A 1S9FA 2W7OA 1HFEL 3C14B 3KLHB 3JS9A 3GG0A 4B9MA 5LOQA 3HHLC 2BE7D 4N5SA 1FK9B 4CO5A 2HFVA 4NEZA 1FNOA 4A8KA 1FWKA 4HTIA 2IJNA 2YWFA 1GXUA 3UNGC 5GAGU 3PW0A 3W5ZA 4RWWA 3MM7A 4B9VA 2WSCC 3LGHA 3MEKA 3MTKA 5KAKA 4C8LA 3DRPA 1WNEA 1TKTB 2RHSB 1UWAA 3LOUA 4L76A 3JSYA 1E6YA 2EFOA 3OTEA 4HLBA 2NYIA 1N0VC 2K1RA 2IRUA 3TRGA 1FRKA 1HHSA 3NOGA 1BQNB 5EX0A 1U1KA 2I9SA 5KG3A 3DOKA 3LP1A 3FKBA 3VAHA 4OHVA 2Q1LA 3T1YF 2ZZMA 3J7AN 4PEOA 4LF9F 4C8KA 3FBFA 4FF4A 3AA9A 3GP9A 4O0NA 4UT4A 3PRVA 3T19A 4OZ0A 2C28A 3NGRA 2CPFA 8ATCB 1Q8BA 2MGZA 3HI9A 1KTVA 3FEYB 2BZ2A 4OI1A 2KH9A 2W24A 4JI4F 1DQ9A 1IKVB 2JRSA 4KR0B 3CCSS 5DJBA 2G2ZA 2G0JA 2CJBA 3I87A 4OX9F 1YG0A 1F9FA 2ZJRQ 2HMIB 1GFWB 3KOAA 3QRRA 3OD2A 4NLTA 2QX0A 3G4SS 5C25B 5IXUA 2NCKL 1FA0A 1X7VA 1QTNB 4ELVA 4WJBA 3V4IB 3RB0A 4I2QB 1RKIA 2GFFA 2W9BA 2ZBQA 2J6UA 2AJ2A 3H98A 3KDNA 4DQPA 1OO0B 3OR2B 1NHUA 3DGVA 3IS9A 1X4FA 2QV6A 4FYWB 1L3UA 1B0TA 1FJGJ 2FLOA 5KFTA 3LAKA 1LWXA 3RBEA 1PJ6A 3BYPA 3DLBA 3MUTP 2VL1A 1TELA 1NCLA 1IKWA 2FC9A 4PQUB 5KFZA 2R7TA 1C0UA 3FSXA 3DC2A 1WDDA 1LWFB 4ILLA 2WOMB 3AFGA 5F8HA 1BD6A 3CJ5A 1H38A 5HI7A 4KQZA 4USUA 3PW4A 4EZ6A 1LW0A 1XTZA 1LV5A 4PWWA 1BMQB 3ZTPA 3MURP 1P1LA 3G71S 4IUFA 4KGMA 4NLSA 4Y34A 4NLWA 2WB4A
chains in the Genus database with same CATH topology
2DH7A 2JFDA 5KFLA 3HPOA 3BR8A 3R5DA 4IG3B 2IM0A 4X4PA 1U1MA 1ZBTA 1WHYA 4PWDA 2FVPA 3G6ES 4I2PB 5C42B 4XO0A 1LQ9A 2GC8A 3F44A 1M5SA 3IFEA 2OPSB 2NSBA 2P9EA 5CQGA 3EGZA 4A4JA 1RJJA 2G0CA 4DR6F 2DNPA 1TUVA 2CJAA 3AB2B 3GILA 3RW7A 3KNGA 5KFAA 4RW7A 1YRTA 2DTJA 1KHWA 2MKCA 4PG6A 5KFGA 3UR3C 1DTQA 5JVGQ 2AU0A 3KHRA 2MSSA 2W9BB 3MXHP 4ETXA 3O6QA 2LA4A 1KNZA 1VI7A 2Q79A 2HHXA 1H7XA 1X9MA 1N56A 4DG1B 1YVFA 4BC7A 4EYHB 4L3NA 2NZ4A 4QPXA 3THTA 3TAPA 3M05A 3BSOA 2OFHX 4I0WA 1Q16B 2RKIA 3KNAA 4MFBA 1WHXA 3I31A 1WF2A 4TNOA 4ELTA 4CQ1A 1C4AA 4N56A 3BJYA 3IS9B 3X1LB 3B78A 2WBMA 2YKQA 4H54A 2ZKUA 3OVSA 4DV7F 3BQ2A 1DTTA 2DCLA 2GV1A 4LIRA 5HMZA 5KG0A 4ZPCA 2PA8D 4EWTA 5LXRA 1WF1A 1Y9OA 3QLHB 1N5SA 2RRAA 2AQ4A 3SZ2A 3CD7A 4OZ1A 1D9FA 2GO8A 3CWJA 3MEDA 2KHDA 1CQNA 5F0WA 4M5DB 3RU0A 3CCQS 1LWEB 1OSCA 2XHWA 3KKFA 1SKSA 4CI0B 2BANB 3ULHA 1HPZA 4NLQA 3CT9A 2ZOFA 4B02A 2IYGA 3I5AA 4ZVGA 3RYLA 3V81B 3PM9A 2ZZNA 5SUHA 2L9DA 3NAIA 3EZ5A 4QU6A 4DV0F 1M1KT 2YH1A 3DRSB 3KG1A 4RW9B 5G4DA 4CIOA 4H4OB 4CCHA 4Q45A 4JV2A 3RB3A 2KFNA 2PD1A 3OPKA 5EWGA 1RYRA 5KT7A 3W3SA 2VH7A 2VPXB 3CC2S 3PHEA 1XR7A 2EPIA 3MM9B 3KLEA 4DL5A 2R7QA 3QAUA 2MHNA 2LLZA 4HT7A 2VKRA 3I82A 2XLIA 3NMRA 3AQOA 4QIWD 2E9TA 5E2QA 1RGVA 2XY7A 5K5MA 3BGRB 4U7CA 1SBRA 3DI6A 1JNZB 4ZPAA 1VQOS 1H2UX 2ZUGA 2IVFB 5AXNA 2YNFA 4P2SA 4K4VA 4ES2A 1LW0B 1K0VA 1P9QC 4DL0C 2RRBA 2VG7B 3I55S 4DSKA 1VRTB 4QW8A 3GIKA 2XMTA 4WF9Q 3E01B 4TQRA 4NLVA 2CQHA 3TVKA 5AE2A 1WWHA 1Z2ZA 4TU8A 1A9NB 1UMJA 1FJEB 4A8OA 3VCDA 5FD1A 3T9NA 5EWEA 3J7YI 1UJ6A 2V94A 1XK8A 4X84A 3I6PA 1NJYA 1VIOA 1TL3A 3W2VA 1RTHB 2F8MA 2QEXS 3M6UA 5DQHA 1RT6B 4IOBA 5KFHA 2HPUA 2CQ2A 4PPZA 1ZZNA 2M2BA 3DGPA 4NCAA 4UY8T 1AFJA 2AYBA 3GYXB 2PDAA 4DN9A 2RDIA 1NK7A 1TAUA 3MUMP 3I5BA 4RNHA 2NQPA 4ECZA 1NJXA 2HNZA 3FJ2A 4J9LA 5IQ6A 3TW0A 4YB6A 2HRYA 2K7JA 4USIA 2DIUA 1C2PA 2IAJA 2D9OA 3CEDA 2KXFA 4M1KA 3MFIA 2E29A 2JLEA 2K3IA 2QE5A 4CH1A 1Q82T 2OTLS 2CQGA 3T1HF 3LP2B 2VQEF 3OXLA 2N82B 2KT3A 1VK8A 3M8PA 1KEKA 1D9DA 4K59A 4OLPA 5KFIA 1S1VA 3VAGA 1FRXA 4I56A 2UZAA 4M94A 5A0YA 4X4SA 1S4FA 4EGLA 5KFFA 4NYOA 4A8WA 4FF2A 2X1GA 1DZ5A 1G3OA 5KFDA 2AGQA 2M52A 2MKJA 3M2UB 3K5NA 2HHWA 2RB7A 3HHEA 2DVIA 3VTIA 4RW6B 1KQKA 3M2VB 1K1QA 2RKIB 4OI0A 2HWIA 2PA3A 4QU7A 2DIVA 2OKQA 3POTA 3K5MA 2DPJA 4FXDA 4IQXA 4PXCA 2V9KA 2XI3A 1DJ0A 3N4WA 3UFCX 4J9NA 2C22A 1BGXT 7FD1A 1KVIA 1S1TB 4DL4A 2KT5A 1BWEA 1S0MA 4ECQA 2FLNA 1SV5B 2E66A 3CCTA 1R8HA 4DV4F 4F2SA 3THVA 4OJGA 1QAXA 2KJWA 1X9WA 1NK9A 5LJ3Y 2D3OR 4GC6A 3UD3P 3SCIE 2FGOA 2FVQA 2EC0A 3RRGA 4Q0BA 3D54A 4TY8A 1YRXA 4DPOA 3KK3A 1VGYA 1HPZB 1UEUA 3H40A 3H4BA 2Z0GA 2UP1A 1MMLA 2PE8A 5T7LB 2ZNYA 4Q43A 4J9KA 1Y5IB 4NA2A 2AJ1A 1U1QA 2UVUA 2MZSA 2OAUA 2IJFA 3ITHA 5KFBA 5J2QB 3MFHA 2OO4A 2XLJA 4DUYF 1YSJA 5AE3A 3GFYA 5DGBA 2UUTA 3BGUA 4R0EA 2PSZA 2C3YA 3ZZUA 1S6PB 1IBLF 2XGQA 3T5KA 4OL8A 4R0JA 1RA7A 2IM1A 1XMQF 2NXUA 3SCLE 1X5SA 2FLLA 5HMWA 3KLEB 2BE2A 4WK3A 3OW2R 1YI2S 2QMWA 1IR0A 1VQSA 2P9CA 1NAQA 3CD6S 1LK5A 2ZNZA 3LWMA 2DR9A 3VAFA 4DUZF 1D3WA 1M90T 3N6NA 1V3SA 6FDRA 2VFSA 1Q53A 5GADI 3I0SA 2I5JB 3LALA 4BHQA 5B0DA 1YTYA 1S72S 4TYAA 5J2NB 4HYKA 2AGOA 4MYTA 1Q81T 2ZH5A 3FQLA 4YR2A 1XC9A 3LAMA 5E3CA 1VC6A 4ECYA 1QAIA 1FDAA 5JUMA 4B9LA 2HVHA 4DFMA 3G96A 2BW2A 4YB7A 1T7PA 2ZH8A 3DM2A 3QGIA 4ES3A 3UWTA 2ZFHA 2VBYA 2R7OA 5C24B 1AROP 1SC6A 2UVVA 1FEHA 3W2VB 1NJWA 2RRNA 1X4DA 4LF4F 2XG8A 4H4KA 1HBUA 3W2WA 4IR1A 3MECA 4IO9Q 1FJCA 5E0OA 3LANA 3OQ2A 2DRAA 1JLEB 3I9ZA 5E3RA 5KFRA 4USHA 3DOLA 4UQTA 4XDDA 1K9MT 2UXBF 3IAM9 3ISNC 4NX9A 5CZVA 2OLWA 1VQYA 2B4VA 3DMJA 3V6KA 4HDHA 5E3AA 1K0TA 3RB6A 2AYMA 3AH6A 2DGSA 3UD4P 3D1OA 3H5UA 3ZFVA 4YY3F 4KIAA 2IAJB 2VFVA 5K8MA 1JJ2R 2RS8A 3BSAA 3KTQA 2ZH3A 1HYSB 3QJJA 2J9EA 4G1QB 2CQPA 3TAMA 1X5TA 4K5SA 3KHLA 2GA7A 1QUPA 3MR2A 3Q2TC 4JI8F 3C8YA 4WYWA 3JAMY 1FERA 1FVQA 3M8PB 3PACA 1CLFA 3PX0A 2IFXA 4LT6A 2Z4PA 5HROA 3HHLA 5A0YB 3OL9A 2YY3A 1UWBA 3T5JA 5I3UB 3MI7X 2IVYA 2W7PA 5DO2A 2HLUA 4RZRA 4C7QA 1LWCA 3D1QA 2X51A 2D9PA 2CJKA 2KZMA 4KBIA 4MH8A 3K8VA 1VQLS 3PNIA 2VFTA 2DH9A 2DT9A 5IT0A 2B9XA 2HLTA 2MKKA 4QYZJ 2V4QA 1Y5NB 3M8QA 2R2TA 2RDJA 4JI6F 1J5OA 1JJ4A 2KVIA 3KK1B 4LSLA 3US5A 2CQ0A 1LFWA 4ZP6A 3LQVA 4U9RA 4AL7A 1WI8A 4RW4A 1HWIA 1S1UA 3H20A 2MQMA 2F3JA 1GX6A 4IFVA 4DV6F 2GHWA 1YJ9S 2HQ3A 2KYZA 2HIQA 4ECTA 4DSEA 3QIPA 4NLDA 3H2VE 3B8HA 1MNEA 5THWA 4KAIA 2QLWA 4MKBA 3SXLA 2LQ9A 2M8HA 2OJ3A 3CMES 2ADCA 4I7FA 1KTQA 3SFUA 1UFWA 3MMCA 5LSRA 1U4BA 2HHHF 5F8MA 4EZ9A 2MZTA 1BQXA 5LSLA 4UY85 2ASLA 1XWLA 3T5LA 2CPHA 3CCWA 5K14A 4DR3F 1TP7A 2IM2A 3PX6A 2XC9A 1IQZA 5KG2A 1FKOA 1S9GA 2QSFA 4X4UA 1V3ZA 4CT8A 2FHJA 1CEZA 1AFIA 2MKIA 4PKDB 2YKMB 2XCAA 3IA0A 1R89A 2BABA 5L38A 1ZAVA 3QIDA 4DS4A 2GIRA 3BDEA 3LP0A 2N3OA 1QLNA 2VODA 4O23A 2H5EA 1U45A 1RISA 2BVZA