4YUVA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with decarboxylated s-adenosylmethionine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
285
Chain Sequence
ISGGWFREENPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
molecule keywords Spermidine synthase, putative
total genus 97
structure length 285
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuvA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuvA02
1D2HA 2P41A 3FTCA 4HRAA 5EMKA 4BP1A 1WZNA 2NXEA 3LDUA 3BT7A 2JG3A 4B17A 1EJ6A 1EQAA 3HCFA 5HZMA 5H02A 4MHTA 2I7CA 5E8JA 1R00A 2FK7A 3SM3A 1YZHA 4AX8A 3S68A 3KPWA 3DLCA 5E9JA 2G72A 4EQZA 3LHDA 3LSTA 4NECA 3T7RA 1FP1D 3DMHA 1QYRA 1U2ZA 5EIFA 5FA8A 3ELUA 4GF5A 2ZBQA 3B89A 2DPMA 5DXAA 1VL5A 4YV0A 4C07A 2JH9A 4E30A 3SSMA 4EKGA 2C7RA 3CCFA 2ZZNA 3AJDA 1B42A 3GO4A 4RWZA 2OPBA 3QOXA 2UYOA 3ER8A 2IP2A 3ID6C 5FCDA 3B5IA 4C04A 2JJQA 2PXAA 3KQQA 5DX1A 4CTKA 4YV2A 3HVHA 2ZIFA 3OE4A 5DM2A 3KR9A 3TRKA 4RTOA 3HCAA 3PT9A 1HMYA 3G5TA 3GRUA 5EVJA 4CKEA 4E2WA 3PTAA 1YF3A 2FYTA 2GH1A 1X1AA 2QY6A 3AWIA 4X60A 4QTUB 5EC8A 4GBED 1D2GA 5GIPE 1KPGA 2ZBPA 3GIWA 2C7OA 3R3HA 3G2QA 3EVDA 1R74A 2PY6A 3P8ZA 2B25A 2PXXA 1G60A 3HCEA 1FPQA 3EEOA 1N7JA 4KIFA 5FULA 3FUWA 1KPHA 2PT6A 3MAGA 4OQEA 2PSSA 2GB4A 1KR5A 2ZTHA 3CC8A 3DH0A 5EQJB 5FWDA 3TOSA 1ZKDA 2PX2A 3PS9A 2QE6A 3BZBA 4H0NA 5BXYA 2FHPA 5CD1A 2EJUA 2CL5A 2WK1A 5LQKA 1R8XA 3GRZA 3PVCA 1VIDA 4LECA 2K4MA 3OU7A 5E8RA 4CKBA 5E1MA 4PIPA 3KPJA 5LQJA 5CCBA 3PLAE 1AQJA 4FSXA 1Q0SA 2OZVA 3M6WA 4XUEA 1SG9A 3T7SA 4GUAA 4PCAA 5K03A 3LDGA 2H11A 4OBXA 3UJAA 1RJDA 2IH4A 2V74B 3ELWA 3FPHA 3LCCA 4V0RA 3G7UA 2CMHA 3GJYA 2UZ4A 1KYWA 3BGIA 3BUSA 3OZTA 4PGGA 3M33A 2R3SA 3CJRA 1JTFA 4PONA 2ONYA 3TPZA 2LD4A 3A25A 3HTXA 4DZRA 3A4TA 3TM5A 4RTMA 2BM8A 2ZULA 3UZUA 2QM3A 4IWNA 1DCTA 5U4XA 3O7WA 3EVBA 5DWQA 2VZ9A 3UWPA 2OY0A 5K0CA 1ORHA 3JWHA 4YUXA 1QAMA 1RJGA 3PFGA 3G89A 2ZFUA 4FT2A 1G38A 1XJ5A 5JR3A 4C4AA 2NXNA 4CWAA 3JWIA 1KHHA 1RI2A 1IXKA 5K0GA 5KS2A 5C9ZA 4GEKA 2H1RA 4RTRA 1KP9A 1SUSA 2UYQA 3V97A 1M6YA 2IPXA 4YUWA 2OB2A 2KW5A 1L3CA 4PYLA 3CBGA 3FTDA 1MJFA 1AV6A 3MCZA 4KRGA 4DCGA 3KR1A 1BOOA 1PJZA 5K05A 4XCXA 1R8YA 5EKXA 5EKUA 3P9CA 3NDIA 1P91A 2QYOA 3UA3A 4AZWA 1RI3A 4EKIA 2I62A 3KQSA 4EMSA 2AR0A 3NTVA 4RVHA 5DRTA 2Q41A 5EMLA 3RODA 4KIGA 5C0OE 3THRA 5T6BA 5E1DA 1RJFA 2FK8A 2NXJA 4RTPA 1H1DA 1NE2A 3M6XA 3TMAA 4ER0A 3BKWA 2CKDA 3G2OA 3BWBA 3KQTA 1RI5A 3TM4A 1EAMA 3FPFA 3LBYA 2AN5A 2P7HA 2VDWA 3R9XB 3HCCA 3OU2A 5EZSA 1JSZA 3ORHA 5ICEA 2YXDA 3A26A 4GQBA 3QOWA 1YB2A 4HGZA 3EEYA 5HIMA 1I4WA 4QTTB 2ZZMA 1BHJA 3MCTA 5E1BA 4GOOD 1F3LA 3JWJA 3T7TA 4MIKA 2HR1A 1JG2A 1I1NA 2IBSA 1NKVA 2E5WA 5DT2A 4YUZA 3LGAA 5HIJA 4RTSA 3OFJA 3M6VA 4GOMD 2H00A 1UIRA 4QDKA 5ICFA 3B3GA 2OYRA 1JQDA 4BLVA 3EVZA 4OBWA 3GU3A 5LQCA 1WXXA 3H2BA 5GINE 1L1EA 2EFJA 3EVGA 3OPNA 2OB1A 2R6ZA 3OU6A 4P7FA 1ZQ9A 5DXJA 5GM1A 5GOZA 3SVZA 3OE5A 4KVZA 4E2ZA 4YMHA 3M70A 3GDHA 4PYNA 2OKCA 4PIMA 3CGGA 2IH2A 5FADA 1O9HA 1SQGA 1TW2A 2V7EA 3EVAA 3FUUA 5M5BA 1JQ3A 4R6WA 3X0DA 3FTFA 5LQUA 2BR4A 1QZZA 3CJQA 5P8WA 1M0EA 2YXLA 4RV9A 1XVAA 5K0NA 4RVDA 5HOQA 3ERCA 3FYCA 1AF7A 4YUYA 3FPEA 2UYHA 1WY7A 1ZGJA 2O06A 2P3LA 1HNNA 4XUDA 2UYCA 5LQRA 2ERCA 4GC5A 4DQ0A 5K8VA 5E2AA 1QAOA 1XCJA 3HEMA 2XYQA 5C1IA 3UA4A 5ICGA 3GXOA 3UFBA 5JUWA 5K0BA 3NJRA 3NW9A 1WS6A 5FUBA 2ZLBA 3DP7A 5F2KA 3V8VA 1L9KA 4DKJA 3BKXA 5DTMA 2ZW9A 4GC9A 3C3PA 3B7PA 2OO3A 1ZG3A 3FPJA 2BR5A 4OA8A 2NP7A 3SSOA 1WXWA 5DSTA 2GS9A 1JR4A 4EK9A 1VBFA 2BZGA 5BP7A 2BH2A 2PVCA 1YZ3A 2ESRA 3CVOA 3QV2A 3DXZA 2XVMA 4HGYA 1O54A 2PBFA 3E05A 3GRRA 4P7KA 2OBFA 5EPEA 1R18A 2ZSUA 4Z2YA 4BY9E 1JTEA 3HVKA 1KPIA 3Q7EA 2VDUE 4X41A 5D1HA 1F38A 3AY0A 5GM2A 5HFJA 4QPPA 2PX5A 1ORIA 3EGIA 1MHTA 2IDJA 2P40A 4RX1A 5CVDA 5CCXA 4PYKA 3C6KA 1SUIA 3E23A 2GA9A 3F4KA 3R6TA 1O9GA 5CVJA 4OX9Y 3KR2A 4P7JA 3DOUA 4KW7A 2IH5A 4DCMA 1AQIA 3PX2A 5K09A 1NW7A 4RYLA 2O07A 3KQYA 2ZBRA 4E2XA 2O57A 2NP6A 1XCLA 4EVIA 4E70A 1T43A 5K0FA 2FRXA 3MB5A 3MTIA 2ONZA 3AXTA 5DSXA 5EHGA 1P1CA 2PLWA 3FUXA 4L7VA 2ZWAA 3E7PA 4OA5A 4E2YA 4MWZA 1NBIA 1BKYA 5LQAA 2NYUA 3OZRA 3VSEA 1JSXA 1PRYA 1G8SA 1Y8CA 3FRHA 3G5LA 4PYQA 4AUKA 1KYZA 2Y1WA 3CKKA 3LKZA 4FZVA 4FSDA 4M7RA 1G55A 2EX4A 3WSTA 3SX0A 3I53A 1RI4A 3HCDA 4R05A 5LSAA 1YFLA 2XYVA 1JG4A 4F85A 3KPVA 3E8SA 1Z3CA 2AOTB 3BXOA 5DPMA 2FPOA 2ZVJA 4AZSA 2IDKA 1JG3A 3A7EA 1YFJA 3P9NA 1X1DA 3EVEA 2HTEA 4KWCA 2JHAA 2ORED 5CVEA 5EMJA 4ER5A 1VQ1A 2JH8A 4X1OA 2AOUA 2CWWA 3KQPA 4YV1A 5FHRA 3SSNA 1UWVA 1KXZA 4CTJA 4YMGA 5E9WA 1XDUA 2ZIEA 4POOA 3I58A 3HM2A 4RSRA 3BWCA 1NW8A 2CMGA 1IM8A 1N2XA 4UOEA 5LR6A 3VC1A 2YXEA 4HG2A 2NNWB 5DM4A 5FTWA 3EPPA 3L8DA 3NWEA 1KIAA 4RTQA 2XBMA 2AZTA 5FQNA 4E33A 5KYGA 1N7IA 5GIOE 2PGXA 3KKZA 3IYLW 5HILA 5EGSA 4MTLA 4IV8A 1L3BA 4AZVA 4FP9A 3THSA 2I9KA 2WA1A 2IBTA 3I5UA 1I9GA 1YUBA 3P71T 2AN3A 3DUWA 3PB3A 2HNKA 2PX8A 4GOLD 5EEGA 3RW9A 4C05A 5K0JA 2B9EA 2PKWA 4WVLA 1V39A 3UBTA 5E1OA 3EVFA 3KPUA 4R8SA 4DM3A 3JWGA 4AZTA 3UJCA 5HEKA 1NW6A 3G2PA 2GPYA 4FT4A 4KDRA 1VPTA 3SR4A 3KQOA 4K6MA 1NW3A 3FPGA 2A14A 2VP3A 2G8NA 1UFKA 3NDJA 1OR8A 3KU1A 4HTFA 2B78A 3FRIA 5EHIA 1X1CA 2ZWVA 3LCVB 3I64A 3UJBA 3HA3A 3M6UA 4V0QA 3HCBA 4BP3A 1X1BA 3TFWA 3UJ9A 1P39A 1TW3A 4HSGA 5HIKA 5IH3A 1SKMA 1EJ0A 1JQEA 3HA7A 2P7IA 4C08A 4PNEA 3EGEA 3ELDA 4LG1A 3IEIA 2DULA 2PX4A 3LDFA 3P9IA 5FA5A 2Z6QA 1EIZA 2WA2A 3P9KA 5DTQA 3TQSA 4PYMA 3HVIA 3GGDA 5EOVA 1NW5A 1VP3A 3TLJA 1VE3A 1INLA 3C6MA 4Y2HA 1XXLA 4GOND 3ER9A 4A6EA 2Z6AA 5CM2Z 1G8AA 3GNLA 2O0LA 1NV8A 4X61A 5E9QA 1VLMA 3NMUF 3TKAA 3P2EA 3LBFA 5DTRA 2YVLA 3R0QA 4PWYA 1SQFA 4ZTBA 3EGVA 3DLIA 4ER7A 2YUIA 4P58A 2AOVA 2JHPA 5ICCA 1WG8A 4ATNA 3MQ2A 4QPNA 4E32A 4YUVA 3FZGA 4IV0A 3FUVA 2FCAA 2PV0A 2PXCA 3D2LA 2O05A 4M37A 3TKYA 3LL7A 3P2IA 4HC4A 2G1PA 5EG5A 5CUQA 3KQWA 3LECA 1IY9A 1FP2A 3G8BA 3I9FA 3DULA 3GRYA 1RI1A 2IIPA 1QANA 3AXSA 4JXJA 2JHCA 5D1NA 1R6AA 4BLWA 9MHTA 1NT2A 4DMGA 3MGGA 2I6GA 3IHTA 2HV9A 4QQNA 3OFKA 5CVVA 4DF3A 3BGVA 3Q87B 4WXHA 4DA4A 1D2CA 1NV9A 2YQZA 2ADMA 5E2BA 5ERGB 5EEHA 4Y30A 2ZIGA 5T67A 3VC2A 3MTEA 3P2KA 3HP7A 3LX6A 3HA5A 4IKPA 1NBHA 2AOTA 2IFTA 1ZGAA 3ELYA 3R24A 2XYRA 5FHQA 1P1BA 5CVUA 3PX3A 8MHTA 1JG1A 4O29A 2QRVB 2YR0A 3PFHA 4RTKA 1SVUA 2AOUB 4KDCA 5EIWA 2EG5A 1FBNA 3A7DA 4ER3A 1Q0TA 2PWYA 3SGLA 4FS8A 3KHKA 3DXXA 3P97A 5HIIA 4LWOA 5CIYA 5MHTA 5DX0A 3ME5A 5KVAA 4U7TB 1ZHFA 2PJDA 2BM9A 5K0EA 2HMYB 1VP9A 1BC5A 3K6RA 5FQOA 2GAFA 3U81A 3GCZA 1M6EX 3MHTA 4X63A 3SMQA 4G56A 3UJDA 2G70A 3DMFA 1TPYA 3KQMA 1XTPA 4P7GA 1XDSA 4M36A 4PYOA 2C7QA 1RJEA 5DM1A 4PINA 5DX8A 2F8LA 5IKMA 3HNRA 2VDVE 3DTNA 3BGDA 4A6DA 3EMDA 4C06A 1DUSA 4E31A 3T0IA 3B3FA 4QQKA 4BLUA 2P3OA 5BW5A 3EMBA 5G02A 4RVGA 2B3TA 2ZZKA 3G88A 3UJ7A 2ZCJA 5GP1A 3REOA 3UJ6A 5KQRA 2N47A 3G2MA 2C7PA 4PYJA 5LQNA 3LKDA 3OZSA 2OXTA 3A27A 3KR0A 4HTFB 3ANXA 2QRVA 2NXCA 4FR0A 1XDZA 3MERA 5F2NA 3K0BA 4U7PB 4C03A 3O4FA 2P35A 1G6Q1 3FYDA 2P3QA 4PCLA 4LWPA 4RVFA 4XUCA 2AOWA 2YX1A 4QDJA 3LPMA 2HWKA 3B3JA 5B1SA 3DMGA 3EVCA 2EJTA 3BWYA 1FJXA 4M38A 2BR3A 2Y1XA 2IGTA 4RTJA 2AVDA 3M4XA 3TR6A 4RTLA 2G71A 5FWAA 10MHA 5DLYA 3CJTA 4R6XA 4R8RA 5DRYA 3VYWA 2P1DA 3NWBA 3IV6A 1L3IA 4F86A 2P8JA 3C0KA 4ER6A 4RTNA 5GWXA 5K0LA 3GWZA 5F2OA 2AN4A 3KPYA 3FUTA 3RIEA 4QVKA 4QVGA 4OQDA 4ISCA 3UJ8A 4CKCA 3KQVA 5DM0A 2AVNA 3C3YA 5EZQA 3FTEA 2Z6UA 2XVAA 2YTZA 2AOXA 3GRVA 3DXYA 1EG2A 3OCJA 4MQ4A 5T64A 3BWMA 3DR5A 3HVJA 4CXMA 2B2CA 4HH4A 2AS0A 3LCUA 4PGHA 2GLUA 4PYIA 5K01A 5KQSA 3SXJA 1X19A 2VS1A 3G8AA 3NVKI 3NVMB 7MHTA 5EMMA 1DL5A 3O31A 5BW4A 1QAQA 2PWPA 2PT9A 4F84A 4FGZA
chains in the Genus database with same CATH superfamily
4RV5A 2QVGA 2ACVA 1BU5A 2WJ6A 1B74A 3BOSA 3JQBA 5HR5A 5KDDA 1CJUC 2PZLA 3O75A 4L22A 4CEIB 2A58A 4PLWA 4UU1A 3VAZA 2BEJA 4WOKA 3NC0C 1EB8A 3UV6A 3VOSA 4OO3A 4Q7LA 4BO1A 4XD2A 3E3AA 3ECAA 3BMCB 4PRKA 1USUA 4R8KA 5H82A 5CCEA 1CEEA 3CKYA 3INYA 3LSTA 2NW6A 1G5PA 4E3ZA 5J4HA 1WKVA 5JNSA 3NTOA 1SRQA 1BJKA 1J8VA 2YDXA 3GELA 3QEMA 1VDMA 2HUPA 2FE1A 1QG6A 2IHKA 5A5EA 3EPHA 4LYGA 4C01A 2G08A 1BE6A 2VZ8A 1XKLA 2M6RA 3HVHA 2JF0A 1ICIA 1BWPA 1R9GA 2RK4A 2N3ZA 1JDTA 3TRKA 4F6LA 5C4MA 1NVUQ 3IE0A 4QU5A 1S7CA 1VECA 2NVOA 3DAPA 3ZDRA 3ASUA 4CCYB 2PIDA 2HF8A 4M0PA 1P0PA 4X54A 4DLXA 3BRSA 2M1XA 1L6IA 4G6ZA 1EPUA 2JZNA 5B2EA 4G86A 3GIWA 1Z4KA 1J0XO 3ZYZA 1KYVA 2BKVA 4ZO9A 1E92A 3BH7A 1VMIA 4D3XA 1KVQA 1MEJA 1RBYA 5A1JA 2WF5A 4H7PA 1E3WA 4A27A 5DHQA 4F4CA 4RXUA 1XBTA 4U5QA 1SVMA 4ZI7A 1Y5MA 3UMFA 3BCSA 3HB0A 4YRAA 4KPUA 2Y9MB 4DGQA 3M4JA 5IZCA 2JW5A 2DQ4A 1MAUA 2EJUA 2ZYAA 3H2KA 1BGWA 1XVUA 4KYUA 3ZXSA 4QTZA 5CURA 4A73A 3CLUD 3L8YA 4PO3X 2XYPA 2O59A 3HYSA 3R9KA 1TUIA 3KYJB 4S1PA 2FP4B 1IYZA 1Z73A 2C2ZA 5DI9A 4KN8A 5DDIP 5HJ2A 4RV4A 5HVNA 4XH9B 3DE0X 1WOYA 5JPIA 1FDUA 5HQ3A 4NI5A 3JQAD 4PCVA 1I8TA 2JJ8A 4XR9A 2Y1CA 1U5BA 2FPIA 4XJXA 3HFSA 1L7MA 3HTXA 1I01A 2Y6VA 4K05A 3L8GA 2GBFA 4JI7B 1QG0A 4LI0A 4RCZA 1K92A 3QMWA 1Z75A 2D1SA 3CX8A 3UIEA 4JAVC 2QMHA 4D4IA 4OSEA 1KQOA 2VF7A 4RLQA 3CLTD 2QG6A 1KFKB 1QFXA 2GZSA 2C3YA 4CKEB 3LJKA 3U1VA 3L8HA 4FNMA 4JS0A 1XCMA 1J33A 4ACBA 4KO4S 1G7SA 1FFWA 1V25A 4C4RA 4YRGA 4GEKA 2XQVA 1XTIA 4NSNA 1NXWA 4RK7A 4C7OA 2ECKA 1WULS 2PR2A 2IPXA 2B3DA 1FNCA 1MXHA 2C96A 5FPSA 3S0JA 3SYLA 3A11A 4O4IB 4MVJH 3AJ8A 1BDJA 3GT3A 1AV6A 2DYKA 1N2IA 1WPGA 4ZQEA 2HF2A 3OJLA 2FG5A 2ZI3A 3NBMA 1JI0A 1R8YA 1V8OA 1IN6A 1NY6A 1W73A 2LR0A 1Q1QA 2QRJA 3EQ9A 3L7DA 4WOJA 1RI3A 5KVQA 3RRZA 4BX0A 2QLJA 4LXHA 4XJSA 5K8VA 4Q47A 1PTJA 2YNMD 1JZQA 3BB1A 3E5HA 2IEDA 3V55A 3S40A 4U7FA 2UZ1A 4RDXA 5LYJF 2J9RA 3GPLA 1DZIA 1UPFA 1KMNA 5FPQA 4HVCA 2XWQA 2CZCA 3JVDA 2IHBA 3QKRA 4QDTA 5ALOA 4QDUA 1Y82A 3MOSA 1EK5A 2YIJA 2XIJA 1UWLA 3BQMB 1GRCA 1R12A 2GYVA 4DIBA 1XK7A 4KACA 2WIDA 3RTEA 4TUYF 4W1QA 1DWOA 2WBLC 1XXHE 3MCTA 3ZE7A 3KWMA 4RVNA 1TADA 2X2OA 3IAHA 3T9BA 3OOYA 1MIHA 1UL1X 3FCAA 2O8DB 1XRPA 4HN2A 1KXJA 1L5ZA 1S3GA 1U9YA 1R5JA 5A5FA 5BXQC 1RZRD 1Z08A 1UIRA 1WDKA 3PJDA 3V1MA 1NQVA 5DGDA 3ZZMA 1SA0B 1BVUA 1O94A 2Q1WA 2VRCA 3GJ4A 3M3PA 4P22A 4RKFA 1WB5A 3EK2A 3NO4A 3LFHA 1Y8AA 5FI1B 2PBLA 3RU7A 3IH5A 3LKVA 3IBTA 3ZZUA 2P0YA 4PYNA 3L1KA 1MZVA 3GFFA 1QTRA 1DIOB 2RONA 3JVIA 4HV4A 3KETA 1YDHA 1FDOA 2O48X 4ND8A 4B0OA 4R40A 4GPBA 1QBGA 3BULA 3GVIA 2HSWA 4FD2A 1Z7GA 2R1VA 4RVDA 5J40A 5KB3A 1YRYE 2FDCA 2VJYA 3FPEA 1Z7WA 4R2KA 1F8FA 1P81A 3ZC3A 2Q3DA 2R7KA 2V7UA 4HDSA 3U17A 1ZH0A 3A9RA 3DL2A 5BR4A 1N34B 2EQBA 2H7VA 2A9KA 5JY6A 3GLGB 1BS2A 1YE3A 2E2WA 2C04A 2HYDA 5JECA 1AUQA 2YIMA 2GN1A 1DARA 1PR6A 1J1IA 2JGNA 4N9WA 1GZ6A 5I47A 3JALA 4MUJA 1GEEA 4I2NA 1DSSG 2CVHA 1SXGA 3DYIA 1VPLA 2VOJA 1H65A 1TYZA 1VLHA 3GUCA 2TECE 2C8VA 4AJKA 3E15A 3L7AA 4CV3A 4X6UA 1ENZA 2VZEA 1VPEA 3IVGA 3QNMA 3U0BA 3TBFA 1IIRA 1PV2A 2YCLA 4BY9E 3F7MA 2JI9A 4UBLA 3KV1A 1VHDA 1Y3IA 2OL4A 2O9JA 4I6EA 2BMJA 4JYMA 1WJGA 5FFFA 1RRCA 4RX1A 4B79A 1P9OA 2YY6A 2A3RA 1C0IA 3OTHA 1T6NA 3DPUA 2PL9A 3TG8A 4R7ZA 4XR4A 3UT6A 1UODA 4BGEA 1SIWA 4UDYX 1QONA 2J6CA 3DOUA 5THQA 1CRZA 1U8AA 1XFAA 3PNBA 1DO2A 4W8OA 3W8NA 3PUVA 3DMNA 4WVFA 5CLHA 3SLRA 2D2XA 3H17A 2IXDA 5KOYA 4FEGA 3C6ZA 1MV8A 1T43A 1KYIA 1JILA 3FPLA 4YCJA 1AHPA 2OXFA 4E4TA 4D9JA 3LIPA 4B82A 3HQ4O 1LDNA 5KYUB 3AVXA 1DAEA 1PSWA 2PLWA 3U4AA 1KYXA 2ZJ6A 3EISA 4PX5A 5ILQA 4MWZA 3RYFA 4WESB 5LQAA 2O5CA 1C4KA 1G41A 1VMDA 3H5AA 3NWPA 2WNHA 4DNQA 2AFRA 3L8ZA 3WFJA 1D4OA 3CSDA 4OREX 4NJOA 1V9CA 4PO9A 2W6PA 4HAOA 1VBNA 4A0HA 2PQ2A 1ZAKA 4QOEA 2QTNA 2N1BA 1YRWA 4U9HS 1JFVA 2G7MC 4AZSA 2IDKA 2ZJBA 3EW7A 2A8YA 4JLWA 1ZXLA 2PGDA 3L6RA 1FJHA 2XNJA 3EZYA 4PBTA 1EM6A 3VHXB 5AVTA 1Z4NA 1NQAO 1ZXBA 1S96A 4YRQA 4P4UA 4DMFA 3AF6A 1IMJA 3QEBZ 4BVGA 3FOFC 4M1OA 2QAIA 3ZH9B 4QL3A 1F51E 2CMGA 2OECA 5LR6A 2ODTX 1MC5A 1Z68A 1S8OA 3PXGA 1HFKA 1EFVB 5FTWA 3NWEA 1AMUA 4CM6A 1I14A 1T35A 3FVVA 5U4QA 5C8XA 1VIVA 2DKOA 2G25A 3CLSD 1J90A 3TOCA 4PXAA 3VV2A 3ZCSA 3W6UA 3A1NA 3H4IA 1NFFA 1XVLA 3HR4A 3AB7A 4V0ME 3TNLA 1E2QA 2C4HA 1S2NA 2W2TA 4GGOA 5D00A 3SY8A 2WOOA 3W7BA 3HXOA 1X80A 2VRCD 3CZ5A 3WL3A 1KEUA 2PBZA 1UOEA 5CDFE 4DABA 1IY2A 5DIFA 3Q9SA 3QBVA 3SNHA 5E4JA 1ZMXA 3UBTA 3I9NA 5E1OA 3TLYA 3N39C 3TNYA 4JUAA 5AM0A 4B6QA 4N9QA 5ALIA 1UOQA 2BUBA 4GMFA 1A9XA 1A8HA 4AZTA 4A16A 3J7AC 1VE1A 2D2IA 1UDWA 2HB6A 2PXHA 4MSUA 4RIIA 4MPPA 3Q40A 1GNPA 2B5OA 1TRKA 1J8MF 2VP3A 1DRJA 1FLVA 1XMXA 4L8LA 5TY0A 3ZHZA 3TTTA 4EA9A 4EW1A 3BFPA 2Y1FA 3T1QA 3WLSA 4C6HA 1E1YA 2VZ0A 1KDYA 5AW2A 3W06A 1XZCA 3D54D 3JU3A 3SR0A 5JT1A 5LDHA 3ZJUA 2FLVA 2ZDGA 1OGJA 1U2SA 4LF9B 3M9LA 1EJ0A 1JQEA 2C2KA 4L4SA 3KQNA 2B5VA 1PDVA 2P2SA 3KBBA 3TLCA 4J0IA 2XMDA 1EDZA 2VNSA 2ZITA 5TF4A 3T6KA 4B43A 1ZUIA 4HX5A 4F46A 3EH2A 5IUNC 1QFZA 1VJRA 3G5UA 2EP5A 4ZOLF 3AETA 3ESQA 1J8YF 2B4RO 1F4PA 2JLBA 2MINB 1CR4A 3DSRA 3U1TA 2X0FA 3C6MA 1Y4DE 4WZAE 1DDOA 1FIUA 1O97D 3O91A 2GILA 1DBRA 1CQJB 3OP1A 1G8AA 3BMQA 4MIEA 4BGVA 3A1TA 4EWLA 4QM6A 5FNVA 5EPUA 2CVQA 4EHFA 1QVRA 2LE0A 2HJWA 4PWYA 3R3SA 4KGDA 3BWDD 4N03A 4NJMA 4Q6BA 5LD2C 1QHEA 5DHUA 1FFBA 3DLIA 1JHVA 2WYVA 3FR7A 3CEHA 4H4EA 4IJKA 1MNQA 4R9UC 4X3OA 1WG8A 5DZSA 4QPNA 4B7CA 2Z1MA 4I1UA 2BUAA 1XMQB 4A03A 2L0XA 1E5LA 1IM5A 4UD6A 1RRVA 1XXHA 4HC4A 4K9MA 3GDWA 2Q3LA 4JL5A 1JDUA 1TQ6A 2DWUA 3ZZTA 2PK3A 3AFIA 5AJZA 1D4FA 1YQXA 2ROQA 3BZWA 1M7GA 4ODIA 3LVBA 2IW1A 1JIUA 1W88A 3BE4A 3MPOA 4J1SA 2SKCA 2ZB3A 2FTKE 3R0VA 4TN1A 1NUPA 3SHQA 1O2DA 4ZVUA 2YV3A 4BC0A 4DA4A 5J1TB 1A5BB 5HJ5A 2RDMA 5F2EA 1RHRA 2I1LA 3FYTA 4YGYA 1AKTA 1Y37A 1XOIA 3G9XA 5IMBA 4IKPA 4YUAA 1PT7A 5FBHA 4Q19A 2ON6A 2GK7A 2D3WA 1K5HA 3T5DA 3JQGB 4TWRA 3CWQA 5ALUA 3RADC 2IYSA 1FW8A 1N5JA 2ZUWA 3O9MA 4W5TA 1I2ZA 2GYYA 4F5EA 2RIPA 3DDHA 3DEHA 4OKSA 2ZBGA 3RUPA 2W2MA 3MA0A 4D79A 1RIIA 5BWLA 1SBIA 4PQEA 1NUQA 3KHKA 5GY7A 4LWOA 2QD2A 1XD2A 2B69A 2ORVA 1FFEA 3NHUA 2PA3A 3R20A 3ME5A 4LKRA 3IAUA 4IIBA 2GHQA 1RLJA 3BF8A 4KOAA 4ZCMA 2C4TA 5DYGA 1EUDA 3DYVA 3KSBC 1IJFA 4OFZA 3GD7A 5D84A 4OQZA 1ANKA 4HGNA 4LSGA 3WKDA 1TT5B 1T4MA 2OOSA 4GPEA 4P35A 4Q7JB 1JAYA 4RZQA 1XTPA 3VH3A 1JGTA 1PJ8A 4Z4CA 5JDCA 5LD2B 4N41A 4PINA 3DHYA 4B5LA 2NTJA 2W4IA 3ND9A 3NHBA 4RIFA 3U5ZB 2OBYA 4ZVNA 3WNQA 3ISJA 4AJOA 4DM7A 1T5LA 2GD6A 3EMDA 4A6DA 5HWSA 4NLLA 1DXOA 2EF0A 3K0EA 2DHDA 1R9MA 2F9LA 4W5NA 4P38A 4HQRA 1D5CA 4O1HA 5ER6A 2EHDA 3A9WA 2PVSA 3TZHA 1NIJA 3AT1A 3QXJA 4AG5A 1PNOA 2J5XA 2WQ6A 1JKJA 4PFSA 3EH1A 4PLFA 2ZRGA 1TZMA 3H4TA 5G0WA 1E2HA 3C8HA 2OXTA 3N2KB 1Y6GA 4OHFA 3O4JA 4V1CA 3D7KA 2QK4A 4R8LA 1GUFA 3KJNA 4II7A 4N7MA 4ZDWA 5BMVB 2UUPA 3RSGA 5T3UA 1VKHA 4L9WA 2RFLA 4NABA 4GZ3A 2QSJA 4S1NA 1VA4A 3W1EA 4BNYA 2JGDB 1ZAYA 1C7IA 1HDRA 1QH1B 4KYVA 3GLHE 3QITA 3UQZA 2EJTA 4OYRA 3HBNA 1Q84A 2Q5OA 3M4XA 3RC1A 5F7OA 1NR7A 2OUIA 5DLYA 2V0GA 1VE7A 4OCZA 1NBAA 3PE6A 1R9NA 4IRUB 4EP1A 4DB2A 1QDLB 4MQLA 5KJCA 4HXEB 4EUNA 2X3YA 4EEZA 3WL5A 3P4XA 3U7JA 1GZUA 5BVGA 1XZEA 1VYHA 2VXOA 4ISCA 3VPFA 2WG2A 3KT0A 6YASA 2VFAA 2WZCA 4K26A 3JR7A 4I99A 4OFBA 3Q3GE 4AYTA 4EAQA 3FPCA 2KSQA 3SYMA 3P9ZA 5JMWA 5AVKA 3E3MA 1BS1A 3D6VA 2GHIA 1B3RA 2FPSA 2FOXA 2IHTA 4KDEA 5GJCA 4PGHA 4RD0A 5D3MA 3SOZA 3ZE6A 1E98A 5FNZA 2DLNA 3DZ8A 3NVMB 5DYTA 5AVSA 2FSVA 3O31A 1LBIA 3QYJA 3SMVA 3L4KA 2JKZA 4S0ZA 5EMKA 3RK1A 1E6KA 2A94A 1ZINA 3E5RA 3IIIA 1XJQA 4PAQA 4WJKB 3FYSA 3W3AD 4DM4A 4D80A 3A32A 3FWPA 2CXUA 4Q37A 2AN9A 1Z6ZA 2ZTLA 1E8DA 4XWWA 3MFQA 3DD5A 1DIAA 3HWWA 3PNOA 4WHMA 1JWAB 4TUYA 1GZ3A 3DFMA 4N8SA 3AOGA 5JCPA 4GKKB 4OBBA 5EIFA 4CIYA 2GSDA 1DV1A 3HKBA 3AM4A 1L5QA 1U3CA 3ED5A 1NVWQ 5GV7A 1BHQ1 1NBME 2XSZA 2BW0A 3C41J 1R37A 2FPLA 2GHTA 3L0SA 3P94A 2C2WA 4ZRNA 1ZKMA 4WZBB 3MXOA 3GP8A 1PVDA 2OPBA 4HUQB 4LJ7A 2J5QA 1KZ4A 2UYYA 2ZR8A 2VL7A 1BFDA 2HQ1A 4ISBA 3HO6A 1U0RA 3HL4A 3FPKA 5KJEA 1OAKA 4GVLA 4CKEA 1HK7A 1DFHA 5BRAA 4AKHA 4F3YA 4UVIA 4M1KA 1JEQB 4X60A 2ZUFA 3AUUA 3FGOA 4PICA 2OCLA 4KE6A 3CZMA 2BFEB 2BM0A 4QBHA 5JJCA 4QLAA 3GCXA 1F60A 1KL7A 2IUSA 2HDWA 1UWCA 2MSWA 4G8DA 3LWBA 3IPYA 1G60A 3RVOA 1FS6A 3BD8A 5BR8B 1UJMA 1HF3A 1N7JA 4M83A 1V43A 2M2IA 4HYQA 2V9PA 4Z9FA 3DEAA 3HCNA 3ZNQA 2PT6A 3RS2A 4JBLA 1E5DA 2MJLA 2Q4RA 5HCUA 4DJTA 1N1GA 3EEQA 1UPTA 1OTHA 4F9TA 3CO5A 2GLXA 1O6FA 4E4RA 1U8XX 3QMVA 3JYHA 3QHAA 4YAIA 4YJ3B 4FYJA 2OFWA 4UE6A 4OHYA 3EFEA 3KPJA 1CR1A 4GYJA 4TOIA 3PLAE 3C85A 4ED9A 4HDCA 3T35A 3RRMA 4GZLA 5BPFA 2ZUSA 4PAGA 1C81A 3LVQE 2VRNA 1A4XA 4MWEA 1USIA 1SJ9A 3PUJA 4FMBB 4WFQA 2LCFA 5EUBA 3AOEC 3VBCA 3WR5A 4C78A 2CMDA 4ZQIA 2GJSA 1ZD2P 3OZTA 1SOUA 2OA0A 1HDGO 2K6GA 4M46A 2ZJFA 3NNSA 1ABBA 2ZULA 4FTWA 1P61B 2GZAA 1KJNA 2J5RA 3IPAA 2PYZA 2ZQZA 2OY0A 1P72A 1UDXA 1M9NA 3KUXA 3L0PA 3HJNA 4RACA 3CRMA 4OH1A 5EWJB 4V0MA 2FMFA 3VNUA 2AZ4A 3WIDA 3MMXA 4BTLA 3FDZB 4BHTA 2ES4A 2XT6A 2R2GA 3HJAA 2H1WA 1TTHA 1Z8HA 1VJ0A 2P79A 1V7QA 2ZROA 3AZQA 5A1TA 1E1CB 1DBIA 1TGVA 2KE5A 5LPNA 5J23A 1AKUA 1DC6A 2QNBA 1K06A 2CBGA 4ZDJA 1PZXA 5D86A 4UPEA 2NV6A 3K72B 2HM7A 2CJPA 2BGNA 3L8FA 5LM3A 1PJ4A 3KCQA 4L9RA 2B4QA 1TAHA 3G7NA 3N53A 4V24A 1Q0PA 2AE2A 1MAHA 3D6UA 3FFTA 5CFLA 2PFGA 3PQCA 2QMUA 1KSFX 4MW4A 4DLPA 5KNDH 1G98A 3EA5A 5AKIA 5E1DA 4JJIA 3RROA 1BYIA 4IEEA 3DFIA 4C7BA 2VK8A 5ECGC 1C41A 3DBOB 4HLUC 3NTQA 3BWBA 4UUOA 1RI5A 2XUPA 1C3LA 3ZBUA 1N0IA 3KU4A 2JLXA 4EHBA 3R1IA 4J4TA 3ORHA 2Q7XA 4P31A 1MVOA 2GAIA 3O2NA 4DGSA 4DQKA 3A14A 3HI6A 1KY5A 4M54A 1GPH1 1P45A 2APJA 3EEYA 1I4WA 1TLTA 4TLDA 4Y1EA 4CFYA 2YWBA 1L8AA 4I4CA 2ZZMA 4Z1OA 3FHLA 3FE2A 1GTJ1 3SEFA 4DA0A 3COSA 3E8MA 4IILA 2C5BA 1P4JA 3N8NA 4BKOA 2JFUA 2X5OA 3JWJA 3N07A 3R5XA 5AKHA 4QULA 1XLTC 3WY9A 4C89A 1HE4A 2G83A 3E9ZA 4ZI2A 4OQMA 1NKVA 1PHPA 2OXCA 3BE8A 4URZR 5HHTA 5CEJA 2NQTA 2XADA 3I9OA 4YTEA 2OYRA 1NNI1 1YZGA 1PR5A 1QIMA 1Z5VA 2J7PD 2YZ7A 5KKNB 2ZS8A 3KT6A 4OJTA 1L1EA 4P7FA 3OPNA 1XYVA 4AYXA 5TB5A 4YMHA 1NOIA 3PBKA 1T6ZA 2GCOB 3DMRA 2RGEA 4NONA 3ROEA 2G77B 3CGGA 4JFAA 5IARA 4AU1A 1OWOA 2BD0A 5AJYA 1NNEA 2X2PA 3HB1A 2PSHA 3E0QA 2YVKA 4MQUA 4WX2B 3VNBA 4AXBA 3H1FA 4DY6A 4H2DA 3TE7A 3B6JA 1UPBA 4QUAA 4ZZ3A 3AZOA 4JUBA 5LA6B 2IT1A 1OA1A 3W2HA 3PXBA 2GN6A 3B1WA 1S9HA 4BRUA 2RBKA 1W76A 3IJEB 4Y7CA 5JEDA 2GEUA 4KXVA 1RQXA 1CNMA 2ZJZA 3T3PB 1KEZA 3L9WA 5FPKA 4OG2A 4D8XA 1S2IA 5TJHA 5TPWB 5F2KA 1D04A 4KRYA 1L9KA 2QJTA 1VG0B 2DZDA 3UHFA 3WJ7A 4LRTB 2IYVA 4NHEA 2CHQA 4ZEXA 2BJHA 5HS6A 4GC9A 4BO5A 2IP1A 2F1RA 1A69A 2IYPA 2Q6LA 3F6CA 1SKYB 4J3JA 4LXIA 4GP9A 1G21B 4FW9A 5EJ9A 3A1WA 1JA0A 1PJTA 3FFXA 2PCJA 2V03A 3GX1A 4TKUB 1UQTA 4EVRA 1VGQA 3ANMA 3H2YA 1T2CA 1UPAA 1OFUX 2WKRA 4IRMA 2HLNA 4JR2A 4P7KA 1Y9AA 5E6UA 3W34A 4KRXA 2Z8YA 4Y2YA 3EXHA 3MG9A 1RHMA 3LPNA 1KPIA 4LRSB 3K0CC 3EQ2A 4X41A 3UJNA 4B2LA 5ADWA 3HY4A 2AG5A 1OFUA 2W2LA 3OJFA 1G2PA 3K6KA 3VH1A 4B1FA 4B4WA 3AF5A 4O1MA 1KIMA 3VQTA 5JY1A 2YWGA 4LYDA 1VKJA 2YVUA 5IASA 2WD7B 5REQB 4M1TA 5GVRA 1VTKA 1KJ9A 3VR6H 4CMGA 3UOGA 1WEKA 1LLFA 4KW7A 5DK6A 3C98A 4DCMA 3D5TA 3CPHA 1IWBB 4IXTA 1D1QA 3P20A 4D5GA 2I80A 2DFKB 4DSUA 3FJYA 2R5NA 3VR0A 4B7XA 1K1EA 4X90A 3ZHYA 2PMFA 2QW1A 3HR7A 1ODJA 3HU3A 5EHGA 2Y1DA 2X8JB 4Q24A 3N0TA 3VZCA 1R3UA 4NULA 5CYOA 4H7FA 2K5UA 2YC2C 4B45A 3SPXA 3GLGA 1K89A 2QBYA 2R47A 1WZCA 2XB4A 3JW8A 4YO7A 4TMVA 3A10A 1A72A 3LVFO 5CDGA 4NMHA 4JEIA 1WVMA 1OXXK 1MA0A 1OF1A 3R0JA 4LCJA 1VLZA 2HLDA 2MSNA 4JASB 4OXRA 2EBUA 3ILYA 3IKLA 3R5JA 5DNWA 3UMJA 1I5RA 2CK3D 2J3QA 4NPHA 5BYJA 5TVGA 2PKRA 3WWDA 3RAEC 1J1UA 4RETA 4E11A 1EHIA 1BTOA 2NU6B 1YFJA 3P9NA 1Z2EA 4PSKA 1NMYA 5HFNA 1G3MA 3PQ5A 4UAGA 5CK5A 3HPRA 5IVHA 4I50A 4Y2QA 1T2NA 5CM9C 1JQLB 1M6VA 3WMGA 1GPYA 1V47A 2DB3A 4QE3A 1KI2A 3OD5A 4P53A 3NAGA 4KWHA 4QAJA 5I7WA 4LF4B 4WLUA 1O08A 2C57A 4L2IA 4GT1A 2GPBA 4LCEA 5KKCA 1J9GA 4UZFA 4LVCA 2DH5A 4UZEA 4D8WA 5DM4A 3FKQA 3H04A 3SLGA 4X1YB 3N86A 5HUQA 4AY3A 1FU4A 2QMQA 3V6LA 1YIDA 4MW0A 2BZSA 3ECSA 1U02A 3A1VA 3LO8A 5KOHA 1JYEA 2IHZA 2WA1A 2PLNA 2YWRA 1MABB 1U6JA 2QN3A 3KV3O 3GWGA 3IOBA 3M9XA 5ILOA 1XP8A 5DSZA 3FMFA 4B3BA 4GOLD 1QMGA 4J75A 5EE0A 4BIIA 2OCAA 4BNTA 4DDTA 3ES9A 4RFSA 4WMLA 5CEEA 5TEWA 1TCUA 3QU2A 2BLNA 3KJZA 2P4HX 3AILA 2JS7A 5HBGA 4M7OA 1DG9A 3WGNA 4QNNA 2J1LA 1D6NA 3CINA 4V0KA 3OAAA 5I9TA 4BMCA 3QOFA 3HXPA 1GPNA 1E7WA 2GPYA 3EA0A 3AR4A 5DWDA 4C2BA 4AUEA 2PGOA 4MPDA 4PN7A 1M8KA 2VTBA 2G8NA 4MW7A 4D42A 5BR1A 3AWDA 1UFKA 2XUDA 3B7WA 1XA0A 3GA7A 4XZ3A 2FQXA 3STHA 4DMMA 2QLFA 5GWXA 1ZGHA 1QK5A 3M6UA 1W36D 1FUUA 1XF9A 5CB4B 4YNBA 2SECE 4HSGA 4MUFA 1QIEA 1BROA 3NFYA 1DI0A 2NUPB 3RYHB 3H3JA 4C08A 1LQ2A 2FEOA 4GSKA 1T36B 2PX4A 4RPIA 5K3DA 1FVHA 2PSEA 4LF6B 2HPVA 3W8EA 3HCOA 2M6LA 1A9YA 3Q2IA 5KAMA 3V4OA 1UC8A 1C8KA 2IEBA 4P0PB 3V34A 5EOVA 5EXXA 3JR3A 5GMOA 4UHDA 4FKMA 4OXQA 3DZGA 4X97A 1G2QA 4C0SA 1AS3A 4YR7A 5B12A 2WJGA 1W34A 1YDFA 2HZ7A 2XTZA 2XXAA 3GNLA 4K0RA 4NDNE 4NNPA 1ORRA 2WKPA 3HXKA 4TROA 4GXTA 2YOHA 1SXJE 3JD4A 4BFUA 2VYQA 4YAGA 2OCKA 1MNAA 2PO5A 3GPCA 4NDAA 4GGMX 1NXPA 1FOEB 5CT6A 3T3OA 3EUWA 4ATNA 2AMLA 1UT6A 4UHJA 5F4BA 2ODAA 4IV0A 4AW9A 4CQNA 3WFIA 4WLNA 4TXNA 2WAAA 3GPBA 3TKYA 1EVYA 3MQFA 1IMOA 3NT5A 4ZQFA 3P2IA 3SC2B 3MILA 5K3FB 5GADl 1MENA 3T38A 4EKYA 1N2BA 1POXA 2NQ2C 1E3EA 3LWNA 3EDOA 5CHEA 2ZJ8A 3IHTA 1F2UA 1YS6A 4FEYA 1RXYA 1E6WA 3EOZA 4I3FA 4LGVA 4QQNA 5G53C 3SQDA 4TPKA 3W1WA 4AF6A 2KYRA 3ZDFA 5IHPA 1EUYA 1DJLA 2PKQP 1T5OA 1YULA 2VT2A 4IJQA 4GLJA 4G84A 1B26A 1TZCA 3ILHA 4O4LF 1S3FA 5AKZA 2IFTA 4JB0A 5AUQA 5IWAB 3R24A 1N5IA 2UAGA 3K0SA 3NIBA 3L9XA 3T7EA 4EG1A 4NJEB 4Q9KA 1X7WB 4C2TA 1DWQA 2V7QD 2YR0A 3QE4A 2QXYA 1LQTA 3AERB 3O73A 2IU3A 3KWLA 3N59A 1CDOA 2X22A 1Q0TA 4M0LA 4NDZA 4BKQA 4G0XA 2FFBA 1GLGA 3PCXA 1CV2A 1Z4OA 2J59A 4YI3A 4JEUA 5MHTA 2PGIA 3PIRA 4O08A 4FDUA 1Q7GA 4HX9A 3U61B 1U0NA 1NSFA 3KKMA 3ASZA 1BRMA 4IIVA 1TM3E 2H2AA 2I65A 2OXRA 3D6HA 4Q3CA 3IAM1 2E89A 4JT4A 5CT4A 1Y3FE 4BFZA 2B1IA 3D1JA 1Y1KE 4HBGA 1LVHA 2WFZA 1H9CA 1F5SA 2NTNA 2CLHB 4TWAA 3ZHXA 3ZWCA 5K3FA 1HA3A 5A9SB 1Z39A 2C9OA 5C1BA 3T5BA 3DFKA 1NJ6A 1G9XA 4Z4QA 3ZIAA 3C8MA 3G8DA 5JXHA 3AUXA 3R7SA 4BAGA 3H13A 6ADHA 2JCGA 3BGDA 1G20A 2YS7A 1HFJA 4MJXA 4PTLA 3ZU5A 3K0CA 4KG7A 4B3JA 4DBLC 2GEJA 5M04A 3V8EA 1QCCA 2FW7A 3DPSA 4ZV9A 4YREA 4AMYA 3Q9UA 2ZCJA 1MB0A 2CXQA 3ICQB 4U2EA 1M2VB 4YPFA 1MB2A 1NXOA 1SN7A 2P4EA 5TIIA 2W0MA 1JVBA 3LOUA 4EI8A 5KUTA 3FG9A 1H9BA 3VM6A 2DCMA 2NXCA 3U2QA 5KWVA 1ZPDA 1TCVA 3VH4A 1A8PA 2CJWB 3O4FA 4YHBA 3D8NA 4BFTA 1C7JA 3QP9A 1J49A 2NAPA 5HYVA 3B2QA 1T5IA 3P5BA 2AOWA 4DJEC 4YCLA 5IKEA 3ZDXB 5IXYA 3FZQA 3OMLA 4M38A 4CF3A 1KZ1A 2IGTA 2IOQA 1DBPA 3IMFA 1USGA 2IF0A 2JFQA 5E7JA 4DG9A 1K6EA 3ND6A 3IESA 4RZ3A 4C0WA 3PL1A 3GP5A 2QYSA 3GJ0A 3O8QA 4HMQA 3SFTA 4C88A 1GPKA 4LXYA 5BURA 4HEA1 2IZ6A 5CFMA 4RTNA 3HXQA 3QE9Y 2QHXA 1E62A 1MC4A 5ED0A 2REXB 5KTPA 5CR9A 1NI5A 4WXYB 5TQ0B 2O8NA 4N8DA 1ESCA 3DT9A 4FYXA 3A9TA 1ATIA 1UKBA 3IAAA 3TZQA 3THYB 2RHHA 4NCNA 4TKVA 2P6MA 3FYUC 1QF9A 1GKLA 5EERA 5A6SB 5HPYB 1ZJWA 1J2RA 4KV7A 1QC5B 1BYUA 4B6RA 2RHJA 3NHMA 1X42A 2Q9BA 4B47A 1A1VA 4Q9NA 4EYEA 1JHYA 3IL2A 4Q3NA 2AS0A 4C22A 3B1KA 3IPXA 4DJ5X 1U2EA 1TIKA 2JLAA 1GNSA 4N6GA 1M7HA 3S5JA 4DWVA 5LMUB 1KEWA 5K5EA 1ENOA 3WLNA 1KNQA 5IZCC 2XIQA 1MR3F 3GZ4A 1T5HX 3LUKA 2WWFA 1V11A 3F9CA 4M99A 1TNDA 4XIIA 5DO9A 4CLOA 4LJKA 3TB6A 3O6VA 1YAHA 4D2IA 4YV7A 1BVRA 1MG5A 1UKVY 3R40A 5KVCA 2QUZA 4LOKA 2F00A 1W0KD 4GDMA 1AHHA 2C2XA 3UT5B 3QK7A 3NHPA 1RJWA 3GGGA 4NATA 4BMDA 5AK4A 2QENA 3GAMA 3K2IA 3KKPA 1MOQA 3C8ZA 3OUZA 4HMOA 3OP4A 4RUKA 4XIFA 3RVBA 3VTKA 3C43A 1U80A 2WVHA 1AB6A 4Q1VA 1K7YA 4HRYA 5JVDB 1PFYA 4EBFA 4H15A 1U5BB 2FPIB 2EAUA 2PQ6A 4NCBA 2WVAA 1S6YA 3CX3A 4ZU6X 4AECA 2UUCB 3R7DA 1WDTA 3QOXA 3HGTA 4FIZA 4MUYA 5BNIA 2YWFA 1GYPA 1HI9A 3VNQA 2VKQA 4ZODA 4CKCB 3HPQA 4UE3S 4Y1FA 3IEUA 5CA0B 4WCFA 1EH5A 1VB5A 1HMYA 1VYVA 3N05A 3HE3A 2NIPA 4YAWA 3G0IA 1N9ZA 1NPDA 3BWXA 3NHFA 3NKVA 5I8ZA 5L7TA 3ROPA 5K0FA 1CRPA 3IALA 2BN4A 4D5EA 1L4FA 2PUWA 2BTEA 4AUNA 1B6RA 1Z2CA 3EFHA 4KIFA 5EYPA 2N42A 1FCJA 3NYIA 1TMGE 2FUNB 5JAHA 4MS3A 3OY2A 1LW6E 3UJAA 1JXMA 1UAGA 4BOYA 5KNBD 4LMPA 3MMZA 3UMMA 4LF8B 2FQYA 3DDWA 4FUQA 3DLPX 1H23A 3PGLA 4RY2A 3OLCX 3VZDA 5A4JA 2K87A 1A2KC 4ZC1A 3VYUB 1YR2A 4X8OA 4QJ3A 3M1YA 1JDJA 1FTSA 1H8HD 4EF5A 1KQGA 3KDSE 3RRBA 2XGSA 2BKLA 2ZIUB 4FSXA 4E5DA 1AQJA 1QLWA 1TEXA 2FVXA 1THTA 3T3IA 1J4AA 1YBMA 1YJBA 3CW8X 1PNTA 1IHOA 1G3QA 2OR3A 1ORVA 5HKAA 4BFSA 1LLQA 1C7EA 2BFDA 3AK4A 3MUNA 4G1FA 3GHHA 3LCCA 4PGMA 4JNCA 3STYA 5ABPA 1KQFA 4DPKA 2IVZA 3Q6NA 4FBLA 4JJ8A 2UZ4A 4BLPA 2G36A 3RHSA 4ZHSA 2QT9A 3UAYA 4DV6B 1RAAA 4ZA2A 1P1KA 3HCPA 5IVPA 3UMYA 3WA6A 2XNHA 3SJCA 5THKA 1EFHA 3BDAA 1I1QB 1HC7A 4KQFA 2BZ1A 3DCJA 1PJRA 4QVIA 3EAFA 2IEZA 3AI7A 4HAXA 2QR2A 3MOIA 5ED4A 5K7SA 3QEJA 2JCVA 4LHXA 4UC0A 4MP6A 3COPA 5K8IA 3LD9A 1AIPA 1M8GA 2HIAA 2OBLA 1FDTA 3GJ5A 1O7JA 1V3TA 4WESA 3HDGA 5EPOA 1C30A 1TVFA 2Q6KA 2WF9A 4FX2A 4UPVA 3THYA 1M2EA 1U3FA 3M2TA 2V97A 3H1GA 5JQGF 3G2NA 1AKYA 3TLXA 4ENQA 4XOUA 1NLUA 3VO1A 5I5EA 4K6GA 4KNVA 4PBRA 4AZ3B 4OB6A 4FPXA 4BNWA 3HDHA 5K6RA 1KJQA 1Y98A 3S99A 2QMEA 1P2DA 3DMTC 1FF9A 3GLRA 1QO0D 1SBTA 3K9WA 2ZSHA 4WGGA 2I66A 1M33A 1IC6A 2GCNA 3Q8WA 1X7ZA 2CHUA 4HXFB 3K8YA 2O5RA 2L42A 2AI2A 2YUTA 4M0FA 5IULC 4KMOA 4LY0A 4M89A 4GL2A 3QVKA 4BAZA 1XAGA 2L18A 3DE7X 3JX9A 1PD1A 4GKBA 4KXLA 4EDFA 5CDTA 1JE1A 3EG9B 3TB4A 1LY1A 4CMCA 1PQ4A 2J31A 3A2MA 2JFOA 4IHKA 4H3HB 2H65A 4GI5A 2QJWA 2H1HA 2JPDA 1T9BA 2WD8A 2GASA 1WU7A 1FXSA 4LOJA 2HYIC 4E5SA 3LGAA 2XMZA 3LQ2A 3U7EB 4M55A 1Z0SA 2RGGA 2VF5X 3THXB 4FEEA 4NYIQ 4WLFA 4J0EA 3PSAA 2W5UA 5KSYA 4O5OA 2BYTA 1Y7IA 3WDMA 3DVSX 4M4SA 1GSHA 1RWMA 1Y1SA 2E5FA 1PW7A 5HTKA 1T9KA 2QU7A 4YQZA 4M9ZA 1UKZA 4G0YA 2WJJA 3DOEA 4LHYA 5DT9A 3ZGNA 1C8LA 1E7SA 3WISA 5C32A 1LPSA 3HI4A 4G9GA 3RSCA 5FDFA 1UDBA 5BT9A 3UMGA 1GADO 4JDPA 1Q0ZA 5CNIA 1SHUX 1Q20A 3CX4A 1NM5C 4W9NA 3S7ZA 3WO0A 2C97A 5C53B 3HM9A 4XUDA 3ILSA 3KX2A 4DADA 1QIGA 1SY7A 2UYCA 8ABPA 1DO8A 3H5LA 3IVAA 1NMQA 3W3ZB 1QAOA 3OX2A 2HW8A 2P2NA 5CDUA 4OJMX 1NSYA 1T91A 1U4SA 1NFQA 2QG9A 3A3NA 3IURA 1I2DA 2FUG1 5E95A 5DM70 1MJ5A 2AWNA 3L7LA 1Z8FA 4KSCA 5TJ9A 2R5WA 3RYTC 2I55A 5K20A 1U0OC 1EFRA 1FYWA 4OATA 2HIMA 4BP9A 3VOBA 4FFBB 5G41A 1THZA 2OO3A 3LHKA 2CXNA 3V00A 5C1PA 1WXHA 1ZWLA 3MWKA 4FUTA 1VFNA 4XRGA 4G0VA 5DSTA 4MEJA 3NALA 2HXYA 2ORWA 2O1XA 1V9SA 3CLKA 4IHJF 4PX9A 4UVEA 4EK9A 5JXGA 1F1JA 4BNDB 1IM2A 1VKZA 2BJVA 4FFOA 3G68A 1XYGA 3QFFA 4ZDKA 1DAHA 4NWIA 4CMAA 2HA2A 2ACWA 1TO1E 3DKVA 2QYHA 5C3MA 1JFFA 4L72A 1UF9A 2QPOA 2KPOA 3AEXA 2P5UA 3AY0A 2RH9B 1O89A 2GXSA 2JLCA 2P2YA 2W6JD 2X9GA 3AC0A 3KUDA 3M1LA 1RAGA 2P8SA 3N2GB 1I7LA 1RKQA 1WMFA 2IDJA 2JCXA 3P0EA 2HGSA 4BRZA 1MHTA 5BWCA 1J0EA 2MYUA 2QD1A 4QUGA 3D2CA 1SUIA 1TU0A 5CVJA 3KWJA 2VJOA 1SCDA 3TGPA 3KR2A 1JHAA 4L3OA 5LMCA 2B1GA 4IICA 4PG6A 1H8EA 1SZPA 4KIUA 5AKJA 4RNCA 4WBNA 1JE0A 1C0LA 5JFGA 4AN0A 4E2XA 4IQFA 3O38A 1XCLA 4CEJB 3HYCA 2OCIA 2XWSA 3A06A 4PLZA 4IPTA 3NH6A 3FWZA 2F9FA 2VTKA 4MR9B 1N9GA 3KB8A 3MHPA 1OYOA 3PF9A 2RD2A 3SEZA 2G9RA 5DHFA 5L3VA 1WMEA 4EPYA 4YJ2A 2AQKA 3GRCA 3CZAA 5KPJA 4AXXA 4IF6A 3C5EA 2W6NA 3GP3A 3DBRB 3CUSA 3EXIB 4OUKX 3U16A 4TLCA 4EO4A 4OXIA 3HCDA 4R05A 4G5SA 5JO0A 4ILEA 1TKAA 3KPVA 4PHTA 2C3MA 5BV7A 1CDZA 2YFHA 4BN0A 1VL1A 2IKQA 2X7XA 2BKUA 4L1KA 1PR4A 3HUUA 5B1HA 2V3VA 1PWYE 3EVEA 1CR2A 5H3CA 4DWOA 5AKEA 1X7ZB 1MP0A 2IUTA 2JH8A 3C3KA 2JFNA 2R68A 5J5CA 121PA 2V65A 1HLGA 4JVMA 4YMUA 1Y7LA 4Z3OA 2QJFA 4NF2A 4MKGA 5DNDA 2EL9A 4Q1DA 2P5TB 3VU8A 1V8ZA 1YR3A 2YXPX 3N3AC 2Y1GA 1KIAA 2PNFA 3NIFB 4CQMA 1MBZA 3UMCA 4F45A 4YXFA 1W5SA 2C9ZA 5J9FA 1QTQA 3OC0A 5KJ6A 4I4LA 4MRMB 3MTAA 1L3BA 3I73A 4ZP1A 4QFMA 1YQGA 4JVNA 2E4WA 3IDOA 4PLPA 4NMMA 1Z0ZA 3ACDA 4K6CA 4YECA 4REQA 3HR8A 1YUBA 3ZLJA 3DUWA 2Y0CA 1H69A 5EEGA 3W05A 1ZCBA 3AQIA 4QODA 1UPXA 1RQRA 3EZGA 3T1HB 4YCCA 4IRXA 5L7WA 4BO3A 4IMIB 4MUHA 4JR1A 1JHQA 1RT9A 2AG8A 4KO2S 4NC9A 4QYXA 2D0OB 1DU4A 3SSAA 3JWPA 3D2AA 2Q4OA 1OFGA 5KNDA 4N01A 3T54A 2VZLA 4ND8B 4QUJA 3X2EA 4UXIA 1RKVA 4D0SA 3LL4A 3KXLA 2QUJA 4NZMA 4XQ9A 4C7VA 1AQYA 1XV5A 4LI3X 4NH4A 3CUKA 5AWFC 3SC2A 3B8HA 4V2IA 3HXMA 1BO6A 4ALLA 2TYSB 1D2AA 2FRVA 5K45A 3P0FA 2YZNA 1WXQA 3HU1A 4TKMA 3TZKA 4CR7A 5I5GA 4RNDB 2CXHA 2IUFA 2KBEA 2R97A 2BFAA 1YHYA 5HIKA 1P8AA 1W0CA 4XX1A 4LWQA 3EGEA 3MWLA 3GR6A 3DAOA 1WCXA 2W43A 3N8IA 4NNOA 1QE5A 2UVPA 3O4IA 4MR7A 4BFXA 5K8UA 2Q5QA 3N76A 3B5JA 1OHHD 1HEIA 5EXDA 3U7QA 2H16A 2QNRA 3OBBA 3HVIA 1A88A 3OEYA 4R41A 3W6OA 1NZDA 2GXUA 3G1UA 6Q21A 3GDGA 1SKBA 1ZOIA 1NP6A 3RKRA 3SZ3A 1Z34A 3MVEA 2BPOA 4JWTA 1L6RA 1JIKA 2C1EA 2O3QA 3CZRA 2I3ZA 3L4SO 4YDQA 4WH0A 2W2PA 2GFHA 3KQUA 2O5EA 4X61A 3DMDA 4N5IX 4FEAA 1GT91 1K7XB 2V3WA 5IDYA 5JYDA 2TMYA 1JJAA 2V6MA 1QHHB 1SQFA 1YS7A 4ESHA 1U6IA 1E9BA 3EGVA 1R6TA 3GEEA 5CM8B 4PBSA 2C83A 3ZFPA 2BGWA 1QQ6A 3FZNA 2IS4A 3MCWA 1MTZA 4GLFA 4A8PA 3NYWA 3CY6A 1Y3HA 4J49A 5LB2A 2CCKA 2R6CA 4QT0A 3AR7A 2XF8A 4TVSA 1KWGA 2G3YA 3H2IA 1YR8A 2EW2A 2VDJA 1B1AA 2XMQA 4DBVO 1XAIA 3RUDA 1TVMA 1RI1A 1XPOA 4D8UA 1BG6A 3K70B 5CXSA 4M1EA 3LV8A 3MGGA 4ARIA 1T8PA 1Z7YA 4WXHA 4LV8B 1BSVA 2DG2A 5KOJA 3ILXA 3RYHA 3BD9A 1NATA 2ZIGA 4R69A 2VATA 1DJPA 3V3TA 3M6LA 5JAMA 4D25A 3MK31 3NATA 3PI6A 1S3IA 1W5AA 3BFVA 3C4VA 2W6OA 3OZ7A 3R23A 4O59O 4NU0A 4P81A 1YQUA 2XYRA 3DV2A 4I8IA 2VEOA 5FBKA 1Z15A 4EGAA 1IB0A 5AVRA 2XNCA 1IZ7A 1E3IA 2E55A 3AUJB 1PLLA 2QRVB 2J85A 3FDXA 4URFA 1G4HA 2GF9A 3BS4A 3VPSA 3ZVRA 2WYWA 3OZEA 5KYKA 2Y1OA 4PAWA 2CYAA 3PXAA 1CUYA 2B36A 3BSFA 5F33A 4UKDA 2JB9A 2Y99A 2YWJA 4L2IB 5LKRA 4L4UA 3P97A 4XGIA 1J9EA 4ACAA 1ZNYA 1J21A 1ADJA 2C8KA 2FJ0A 2PJDA 3O1HB 3Q0IA 4OHOA 4QC2A 4YRSA 3MZ0A 1XZNA 4AG3A 4DWJA 5FQOA 4I1VA 4RU1A 3IR6A 2FJPA 1EINA 1ULZA 2E4AA 3DEYX 3UFBA 2CUKA 3ZI7A 4GLBA 4G56A 2IDZA 3N2LA 1W75A 2HCBA 2EFGA 4Y9RA 3OIYA 4CHGA 4FE3A 4CM9D 4DDUA 5A4AA 3GLGE 2W6MA 2WSIA 1BXRB 5IFKA 2VPXA 4JJGA 2W00A 4MS3B 4H7EA 2AFIA 4CT5A 3HNRA 4D4MA 5JNVA 4TMYA 3DLHA 3TZ6A 3LX4A 4V3BA 4HVLA 5KNLA 2XBLA 3I9KA 4AVYA 1WNFA 1OB5A 3KWFA 2KX7A 1E2LA 5SY4A 3ZK9A 3TTWA 1X7GA 2TMGA 1O57A 2WUWE 4PC2A 2JI6A 5GP1A 2ZS9A 1HOXA 4PC7A 1W49A 2YXNA 3P4YA 1E6MA 5EE3A 2B1QA 2CJXA 3IHKA 2CNWA 2OFOA 3IQDB 4QO7A 4KSYA 2GXQA 4B80A 3T5GA 2VHCA 4KZPA 1WQ1R 2VK2A 1M6NA 2X1HA 5KU1A 4KLRA 2C8JA 2ZWPA 3OOSA 1E3MA 1QP0A 1GRVA 4GUDA 1YBHA 3V4SA 1GCAA 3MWJA 4UATA 2RI1A 2SKEA 2WSSA 5FF9A 3NHZA 3C5VA 1WY5A 1CUWA 4EW2A 1GHTA 1GUAA 3WGYA 1MKYA 5TQVA 4RO0A 3BTSA 4TQAA 3D9QX 1ZOSA 2AVDA 3IPRA 2R4TA 3TPCA 4U0JA 3P5SA 2PBRA 4XFDA 1SVSA 4HVTA 2P1DA 1S7GA 3WL4A 3U3DA 3KRTA 2OGZA 3N5CA 4DAOA 5ALYA 4F86A 5JBNA 1SPXA 2QTHA 2A9QA 1Z9BA 2V96A 4CEHA 4B3GA 3FUTA 4BQEA 3NHAA 5IYZB 2J45A 2WU0A 3EWAA 5FX2A 1D2NA 1E63A 2EU8A 1NLFA 1WW2A 3B36A 1XA3A 3GOQA 5EZQA 5BV0A 3KZOA 4N5NA 5IJ0A 3GRVA 2GD1O 3H84A 1TK9A 5L95A 2AKAB 3OIFA 4RHYA 4YBZA 4DYHA 4E0BA 4GGPA 3VTAA 4DV3B 3AEZA 5L4NA 1KO1A 5FXMA 2XRMA 1W35A 4B8YA 2LKCA 2IE0A 3I4CA 3PQ8A 3KEGA 3RSZA 4BLQA 4Z4EA 3L8MA 3OLZA 2XHZA 5I51A 4UNRA 2PAFA 1G20E 4ZZ0A 1LZLA 1ZHHA 1U8TA 2PKQO 3RF7A 3K92A 3IJ5A 3KYCB 2P1RA 2IHJA 1DQNA 1ISSA 2XD4A 4BO7A 4RABA 3HCFA 3GJ7A 3AEQA 4TV8A 2Y93A 2JFBA 2ZJ3A 2PUTA 3IULA 4WIAA 4CIDA 3SM3A 1YZHA 3KSRA 2JGDA 3DV9A 2C03A 4FMDB 2BWJA 3DLCA 3U7RA 1YQEA 4IVPA 5CVTA 2ZJAA 1ISRA 2GN2A 3L0ZA 4LWZA 1SUWA 1H3NA 4E5VA 2VO1A 2LDXA 2VP0A 5HE8A 1ST3A 2BKXA 2NZ2A 2Z2YA 4YQYA 4UTZA 3UENA 2FW6A 2J6HA 2VSNA 4BWFB 1XHFA 3WK7A 3GO4A 1W19A 2UYOA 3LP8A 4FJ2A 1YDEA 2JVIA 2Y2VA 3TZEA 1PEYA 1DKLA 1L7NA 5KNBH 3SQWA 4L5IA 3OM0A 3SQOA 4E5NA 3C5WP 4K1XA 2NYAA 4C9BA 3PTAA 2ZJYA 2GH1A 2C9BA 2JK1A 4KN9S 2RK3A 4QTUB 1MAWA 5EC8A 2X6RA 1V8FA 4R1UA 5IUKC 1C3EA 1LFAA 1MQ9A 1EM8A 3NBQA 3T9CA 3EX7C 3VH2A 5FORA 1GRQA 2N46A 3E35A 2Y9PB 1G8PA 4TXHA 5A5GA 4B3RB 1Q0HA 1L5VA 1RQLA 2X3FA 1F9AA 2EKLA 1P4RA 3NIGB 1H2AS 5FULA 5BRJA 4QJIA 3NXKA 3G5AA 3EF1A 5KJ1A 3K09A 4INJA 3E70C 1TECE 3TXAA 1OBFO 4A2PA 1ZCAA 2V3CC 1TVKB 1SVNA 2WU8A 4AWAA 5HRAA 1HY3A 1B6SA 3CF2A 2AMFA 1S4MA 4G0WA 4PHCA 1YB5A 2R00A 4QGGA 2JLSA 4BYGA 1L9XA 1TM7E 1VG8A 3TRJA 4ZVRA 1GCOA 1PWEA 2PCLA 3RVJA 5CDSA 4LPSA 5AXCA 1SVOA 4G1UC 3T7SA 1WRBA 3JZMA 3R8CA 3VU0A 3T4UA 3KSZO 3GVPA 1NUAA 2BVNA 4URXR 1FTGA 4KGZA 4MUAA 3GIDA 1YI8A 3QE2A 1KYWA 2G9VA 3ZCRA 3Q7RA 3NVAA 1DWPA 1QYDA 2O3UA 1PR3A 1ZU5A 2H4WA 2XZPA 2BF7A 4DZRA 1K68A 4F04A 1P4AA 2ZKIA 1E99A 2QM3A 1O6ZA 3E81A 2W71A 1G4AE 4MJ7A 5B64A 1ORHA 2GM5A 4LNAA 4Q00A 2WP0A 4GWKA 1W30A 4C4AA 2AH5A 5D3QA 3DWFA 1ARZA 1ZLYA 5JWRA 4RTRA 3JRXA 2BSQA 2WTBA 3L79A 4GR5A 1P5RA 3SZLA 4F9GA 1U7WA 2J3DA 2WIGA 1BQEA 1C1YA 1FMLA 1K98A 4DIOA 1E9CA 2QU8A 4DE5A 3FHCB 4RF3A 5LLTA 1T9GR 3GJSA 1ZUHA 1M7BA 4X94A 3Q9LA 2XRYA 4BB6A 4QLOA 3ZVLA 1SNYA 4BVHA 1Z6AA 1GL6A 2ID7A 4X20A 3T7KA 1OI3A 5KQMA 5IYZF 3MOGA 4FI3C 3E2IA 3H8SA 2CDRA 4B6SA 2VF4X 4ESOA 1HX7A 1YS2X 1DKQA 3PTLA 4OFXA 2H8GA 5L3SA 1LC0A 5G0UA 1A50B 1IY8A 4LTMA 2XWBF 5DYIA 4EITA 4FZRA 1XQXA 3HYRA 4GQBA 4MROA 3CF4G 1XK6A 3TGWA 3INRA 3QXGA 3TIFA 2O19A 1VCHA 1M1XB 4WL0A 4YEDA 2A1UB 1TFUA 2JATA 3V6MA 1DAMA 2CL6X 4L8GA 2IUYA 1D0SA 2M6KA 2DTDA 4UMVA 3FFBA 2VSQA 1WZUA 4C7MA 1E66A 3F0TA 3JQQA 3S27A 4LNUB 1Y9DA 1V37A 3F5QA 1JG2A 3CLTC 1I6MA 5DTIA 1O95A 4YUZA 5DNVA 3WRWA 1UAYA 2PRSA 1ULUA 3O0DA 4RTSA 2O7SA 1NUSA 2B61A 2OVFA 3M6VA 1FNBA 4PG5A 4ZCSA 3AFMA 3MGCA 6NULA 5F52A 4XRRA 1ZYUA 1UK7A 1F06A 1US8A 4PZZA 3ACCA 3I9V1 1ISMA 4PC6A 5GOZA 3LSYA 3LY7A 3O03A 3VYSB 3OE5A 4TYQA 4LDPA 4F6CA 4DR1B 1D03A 1QYWA 2HWYA 4FWTA 1JHRA 3MRVA 4MA4A 1QCZA 2EATA 3TX6A 3JQFA 5M5BA 2NV2B 2G9QA 2OM2A 2YJ6A 4GNKA 4I6GA 4MI9A 3UWDA 4DA8A 4EY4A 4JGBA 1Y1TA 3UAOA 1ZHOA 1QIKA 1PSDA 4RV9A 3QOYA 3TEMA 5JZMA 1VZ2A 3MUFA 3IX7A 1FTYA 2I4TA 3ZDQA 3ZIAD 2AEFA 4GI7A 3F49S 1Q7RA 1TJ3A 3RRXA 1WNTA 4TTAA 4EH1A 4YASA 4XTCS 3ZE8A 1S0UA 1OLSA 2QX9A 4Q3DA 4RIHA 1K5DA 3L0CA 2GPJA 1TYDE 3EXIA 4KPFC 2EVWX 5AUNB 1EZ4A 1NM5A 2FG7C 2H6EA 2JBAA 2VSOA 4AMVA 4DXHA 1UM9A 3I4FA 3ZOZA 3HUDA 3A1SA 5A3RA 1K75A 4NZYA 4RPKA 5K4AA 2CHVA 3IVXA 4NXNB 2WTAA 3PQ2A 3FDJA 3DXZA 4K1LA 3AJ9A 4X6XA 3IQGX 1UEJA 2G9ZA 2JIPA 3DDSA 4MCAA 4HYYA 3WBFA 1TYCA 3QENA 2CXXA 3R8FA 1X15A 4PQYA 3D6FA 1CQIA 3NUGA 3OTIA 2PX5A 3KZMA 1SU6A 4N0DA 2PNJA 4CLDA 4DANA 3DKIA 2YN2A 3KL2A 3BG5A 3VR4A 3NT2A 5A04A 4GBMA 1V1MA 1KE2A 2IH5A 4J0GA 1YL6A 3AU8A 2H52A 3EN0A 4Y0VA 3KOXA 4EYOA 3C7KA 1JHOA 3H3XA 4GXNA 4YBRA 5DTJA 2BCJQ 5C4IA 1U0BB 3PYXA 2ZRQA 1PYGA 1JKXA 4UW9A 3GJ8A 3AXTA 3C7CB 4Y6OA 2NZWA 1C1DB 1UZMA 2OD9A 4RADA 1E9RA 2F1JA 2OAQ1 1X3LA 4OA5A 1I6KA 4NENA 1TVEA 5AI9A 3RSHA 3RSQA 2NYUA 3TWOA 3VSEA 4ESEA 5JANA 1BOFA 4D9EA 1R4AA 1Z0AA 1XDDA 2ZSFA 1ZGBA 3E8XA 3QSGA 2HBRA 2Y1WA 3CKKA 4C4PA 2RIRA 3G23A 5LZ9A 2W83A 3HNOA 1NAIA 2VNKA 3ZQ6A 4FCVA 2H3EA 1G8MA 2QTMA 3LUJA 4JH0A 5LSAA 2ZR9A 1AM4D 1B1CA 4YAUA 3JD3A 1DX4A 3I12A 3R5FA 3ZZ0A 1CQWA 1N2CE 1ZH6A 4EARA 5BV2P 3R0XA 1AUPA 4KBYA 4JYBA 1Z4LA 2HHAA 1DRWA 3JZFA 1PU2A 2R7MA 4HNQA 1CUIA 1L4EA 4R81A 1UT5A 2P2ZA 1W47A 3PEUA 3UAXA 5E9WA 4JLSA 3ROZA 2O2SA 2OSBA 4GWLA 1VM6A 3ZWMA 1PJSA 5ADVA 3ADCA 3UMRA 2UXCB 3ORFA 3P52A 1P31A 3BHJA 3KCNA 3LBIA 1T8WA 5HMLA 2VEDA 5A05A 1CEYA 1NUHA 4R7TA 3MTJA 3UBMA 5JE8A 3KKZA 1AVTA 5EGSA 1JEAA 2ZUEA 2R87A 1FVXA 3EZLA 4UM8B 1B15A 3I5UA 1MO4A 2V6JA 4AS1A 3THXA 4NY1A 2I4MA 4RJKA 1T1EA 2HCJB 4YAEA 5ESWA 2WG1A 2I8LA 1OUMA 4NBVA 2C61A 3W9UA 5JNLA 2C3OA 4XJTA 3IEMA 1EUCB 3NZEA 2LIVA 1WPQA 2OGTA 2ZBEA 3FPSA 2HBQA 7MDHA 3V8QA 2P67A 1HYBA 4MI6A 2W90A 1NXVA 5DASA 1TO2E 2YY5A 4D8YA 2LKDA 5BV1A 2ZRMA 3M7IA 2PZKA 1ISPA 3KVRA 3GG9A 4TZKA 1N5RA 2N75A 4H6PA 4M9UA 4YFVA 1LEHA 3SZMA 4EMTA 4Q7EA 2FG6C 2G5GX 4KBFA 4XARA 5KEIA 2BT4A 5B2FA 3GEHA 2FSGA 1OASA 4FFVA 1Y8QB 1W59A 1NZFA 3LXRA 4CFSA 1ZC3A 1M34B 1I6WA 2D1TA 3NDJA 1FS4A 2IUUA 4EHHA 2PLAA 1NJ1A 1KQ3A 2ZWVA 3OX4A 4QUKA 4I14A 5F7JA 3VHXA 3HA3A 2NTEA 3GZJA 4WERA 3W8RA 3TFQA 3DHVA 1H8HA 2Q6VA 4CL0A 2YJNA 1Z37A 2XUHA 3ZQ4A 1CNFA 4X7BA 5TGDA 2C1XA 2AJTA 1K8QA 2W9XA 4OLFA 3TJMA 4O2AF 1CNEA 2R5FA 1XZIA 4N7RA 3KVYA 1OXMA 2H2DA 1NF2A 2IHUA 1N6IA 1XRSB 2YWEA 2FSHA 2IYAA 3N8DA 3EW9A 3E9QA 1Y6FA 4M9XA 3PGKA 2QDXA 3IV7A 4PZPA 3D3KA 3TIIA 2WWWA 2ZDHA 3V33A 3WK8A 3K70D 2QLTA 2PUGA 4QYIB 3ZW9A 1NV8A 1XMOB 2PKEA 3TKAA 2IIQA 3NOQA 3S5UA 4J0QA 1ORWA 1IOZA 1QCDA 4QUBA 3WNCA 1M2OB 4D26A 1XC7A 1Q3KA 1U9IC 2GCEA 4JROA 3WZLA 2I78A 4HZUA 1SEVA 4COOA 3BHMA 1R5NA 5DGIA 4OJNA 2EJCA 4MA0A 2BKEA 2WJ3A 1Q5PA 3LQ1A 4ITVA 5FTJA 3D2LA 2Q45A 4F4HA 5LP6B 5IKXA 4H3SA 1JSCA 4YRFA 3VSBA 4D9FA 4GSYA 4PRLA 3SJ7A 4EVSA 1I3NA 1IG0A 2Z98A 1XU7A 1K4YA 4JXJA 1QIJA 1BWRA 3W4IA 2OO5A 5C34B 3U26A 4CLHA 1KP3A 3C6YA 4UNSA 4MS1A 4G9BA 3DM5A 2ZSKA 5TMEA 4KUEA 3SCZA 1QZ3A 2I1WA 5F51A 4CMBA 5LP6F 2G8LA 1YXMA 1HBJA 1FPMA 1I5EA 2HA3A 4KH0A 5EEHA 3U62A 3QMPA 3TX2A 4EATA 1W5BA 3P2KA 4FKZA 4RA9B 2CXOA 1H2EA 1MX1A 2I33A 3MLBA 1WUKS 1CVRA 3FSRA 3DZDA 4QHSA 5C7LO 1MEOA 2P9TA 1GFWA 1HE1C 2ZIVB 4RD1A 3WL6A 4B3IA 3KEFA 1FQOA 2C84A 4B6PA 2J0UB 4B76A 3IGFA 4DR2B 4NCAA 4TS4A 2CSXA 1MHPA 3SJAA 4HUQA 2YV5A 1FLNA 3S1LA 2ZAGA 3EIWA 3NORA 1BVYF 3BMQB 2CLKB 4WDRA 4ALMA 1JPJA 3KXPA 5IVIA 3SI7A 1XNJA 1A1SA 2XUZA 2Y1KA 3LXUX 4BV3A 2QVBA 5DX0A 1T2VA 3F6PA 3JQ7B 3O8BA 5L8VA 1FMFA 2G4LA 4EB6B 3VOAA 5JNUA 3LRTA 1BC5A 3DBLA 3CH7A 1YCHA 4HUJA 3PEFA 3PNVA 3ZWKA 2AJLI 4TGLA 3SMQA 3AFGA 1CY6A 3GLUA 4IH9A 1JA9A 1XG5A 2IV7A 4MR8B 4IGIA 1XXHB 1W4RA 4ZT3A 2IHYA 3ENNA 4NMXB 4CV0A 5IANA 1Q57A 2DPHA 2Z9DA 1FSSA 1QO7A 4PGFA 5F3RA 1AXRA 1SGWA 1WHTB 3EA4A 1X1QA 3FLBA 4RFSB 4RGYA 3C45A 3X3HA 5ITVA 1IN1A 3LDHA 4MAMA 2F7SA 4C1BA 4OM8A 5AT1A 3VYTB 3ZY3A 1DKUA 4MQFA 1U8FO 2A7QA 3B1JA 4G3XA 1SHJA 1NQXA 4IUDS 5JCOA 2YBEA 4C0JA 5BW5A 3H5WA 1UMCB 3UJ7A 1Z5PA 3D43A 2ODNA 5D3MB 4MULA 5KQRA 4BXOB 2JGMA 2CBZA 4ZOEA 4ENWA 2E6KA 2WHPA 3HDQA 1F4VA 4KUGA 3GT4A 4U2KA 1J2JA 1W5EA 4W1PA 1JG7A 4QXQA 2J3MA 2ZJOA 2Z4SA 4AMZA 1T9ZA 2R6JA 2XVZA 2QS9A 1EA5A 3QELB 2QN1A 1COWD 1XCGB 2C59A 1YOVB 2IZ7A 2PMBA 1NOJA 2PZMA 2FDXA 3DT6A 4J43A 1U3DA 5GONF 2YX1A 3LPMA 1F2TA 1YT5A 2H07A 4NPCA 4GPZA 1TJNA 3T9FA 3PUHA 3U3JA 1UJCA 3HKBB 1J0CA 3E84A 3H2GA 4C3VA 1AZTA 3WLJA 1FK8A 2FEWB 4KV9A 3TBHA 3LC7O 1BD3A 1L3IA 1WABA 2BI7A 5LN1A 1FLDA 1R0XA 3C0KA 3MJEA 4LZNA 1P3Y1 4WZBA 5K0LA 2IPAB 5JMOA 2FX5A 2EARA 3QH4A 1JAIA 1A82A 4G5FA 4KQ2A 4XM2A 1E1LA 3IIEA 2RKBA 3WBJA 4CKCA 2RGNA 4PG8A 4AP9A 2AVNA 3IO3A 2BHLA 4NU5A 1ZLXA 4PAMA 2YTZA 4JQCA 2FFRA 1FDVA 4TZ6A 4DV2B 2I29A 2I76A 1GA1A 4ZKDA 5C8DA 1OAAA 1QFJA 2F3PA 3DTVD 2OYCA 5IX8A 1DTWA 5T64A 1EHYA 1PQWA 1PT5A 1XMSA 3SAJA 1NJ2A 3AF0A 4OYLA 4YJ3F 1YQTA 4RPJA 4Y1GA 1DHRA 1Z4PX 2C5AA 4AIIA 1K8RA 1C8VB 3BIWA 2B8NA 4Q4CA 1VE6A 3X2SA 1V7CA 3QJ5A 4EG8A 3R9XA 2WZDA 5IXJA 4FGZA 3AKZA 2J9ZB 2ODEA 3QX3A 5AM1A 1WZNA 4H59A 2PS3A 3OTQA 1WXDA 1XEXB 2O7QA 2X0JA 3PPWA 3NH9A 1M6HA 3HFRA 1RADA 3T5CA 4Y6QA 1OTXA 4DQLA 2I7CA 5FLKA 3QEKA 3VDMA 3ZU4A 1R00A 4AX8A 4BLRA 3LUDA 5DW0A 1MH9A 2I7TA 1SWWA 1X7XA 3PEEA 3R7NA 3TZCA 4NCJA 2QM8A 3UGJA 5A06A 1E9SA 5EP1A 4TTVA 4JKOA 4GPTA 4RZSA 5AK5A 2VPQA 1ONNA 1AA6A 3OMXA 3KBOA 4MB0A 4E30A 1PFQA 1YB1A 3DE4X 5UKDA 4EKGA 3RVPA 3V7FA 2PD6A 3A0UA 4IKEA 3SC4A 3RG8A 1OH6A 2P4SA 5ENVA 5JXWA 2JEOA 3M6FA 3PDWA 4R0MA 4YV2A 3LQRA 3ML1A 1SZJG 3A31A 2XECA 1IK6A 1YASA 2C77A 2FUG6 2Z2JA 3BEDA 3GFQA 3GJRA 3H4VA 4GOKA 1GILA 5HMMA 4R1PA 4E2WA 4MO2A 3MJSA 4RSHA 4EB6A 3D4NA 3WP1B 4WKCA 1X2EA 3OE1A 2EOAA 2CNWD 4GBED 3OECA 5ALMA 3KTFA 3QXXA 1O0CA 3MYYA 3A36A 4HNAA 4KI0A 1LTQA 3TSWA 3EVDA 1DT5A 3ESYA 4FMCF 3MSXA 5BV8A 4H7HA 4DDVA 5JC1A 5J4VA 2F67A 2XEDA 3IIJA 1LF0A 1Z5WA 3G1WA 1VCIA 1EBFA 1IY0A 3REQA 3WBBA 2WWTA 1PL0A 4JSYA 1KR5A 3HUMA 1XL1A 1HDEA 4MKIA 3TOSA 4DTIA 4K6OA 1X39A 1JB1A 2HCFA 3DM9B 4FGKA 5LQKA 2JD2A 3PVCA 3ZHBA 1A77A 2IPLA 2X5XA 3KYDA 2RGYA 1N78A 3B5EA 3W5HA 1I7DA 3IQFA 1Q0UA 3FMPB 1FB5A 1SCAA 1CUGA 4JR0A 1M73E 1ZOLA 2WF7A 2TMDA 1ULSA 3S2YA 2XQGA 3ZXIA 2WRZA 4HDRB 1U2DA 2Y92A 4MMXB 5B55A 3FSGD 4DRYA 3RAGA 3CRNA 4UULA 3TSOA 4QYMA 1IOLA 3GJYA 3LTEA 4MYRA 1V5EA 2I6TA 4Q12A 5J5AA 2GVZC 1JTFA 3V8MA 1AO0A 1XJCA 3TLEA 4XVUA 4EYQA 3DTYA 2DE0X 1HDZA 1P3DA 3D0KA 4LK3A 5H7XA 4AULA 2G09A 3CUEF 3CUUA 3QW2A 1LD3A 1I32A 3G13A 1RJGA 4FJ0A 4MUKA 5K0CA 3NTUA 3ONEA 3G8CA 3DHWC 4CYMA 3EPKA 3K20A 1R2QA 2JFZA 2OMEA 3EB9A 3HXLA 3JWIA 4RKEA 5HF5A 4ZZIA 4K6KA 4TYNA 1OB2A 1L4UA 4MWGA 1S3SA 3JRWA 3P9YA 1QYCA 3QX7A 4GM1A 2AB0A 2EP7A 2HA7A 3BFJA 3F47A 4HQ6A 4HSEA 5D5QA 2WYIA 1I0IA 4V1CB 4UQPA 4JL6A 1PJZA 4DCGA 3RUCA 4OQLA 4AQ7A 3I9LA 3DBRA 3P9CA 4WN3A 4ZJYA 2W70A 4BMZA 2XZLA 3FBWA 2Q41A 1LU9A 3KYDB 2DPGA 2RGCA 2FK8A 3SBDA 3M6XA 3KYBA 1L7EA 2DUUA 3A0RB 4O2AB 3RU2A 4BX9A 5EUMA 4G09A 1OI7A 2JGFA 5LL6P 1BFUA 1KJZA 2GPAA 5HQTA 4I9FA 1P8JA 3NANA 3BMOA 4OHXA 4Z0PA 3KQLA 4JOQA 4RM2A 1I7PA 4U1RA 2O8FB 1N2EA 1TJYA 1ML3A 1NLZA 4IJMA 4QGFA 4JN6B 3CRZA 3RIXA 4QPZA 2IVFA 3VI3B 2VQDA 2BEVB 4JFRA 1A5ZA 2BRUC 2BEWA 2GVDC 4KKXB 4Z1MD 3TBKA 1P0CA 2GK3A 1I33A 4FKBA 4UVDA 3TIXB 1SR8A 5HX7A 2HK8A 2DR3A 1SVKA 3VR5A 4NYIR 1J5XA 2O7NA 3ZE0B 1U1CA 4G0MA 4IG4A 4UD2A 5TX7A 1XROA 2QPTA 2R6ZA 3CNNA