4YUVA

Crystal structure of trypanosoma cruzi spermidine synthase in complex with decarboxylated s-adenosylmethionine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
288
structure length
285
Chain Sequence
b'ISGGWFREENPGQAMSLRVEKVLYDAPTKFQHLTIFESDPKGPWGTVMALDGCIQVTDYDEFVYHEVLGHTSLCSHPKPERVLIIGGGDGGVLREVLRHGTVEHCDLVDIDGEVMEQSKQHFPQISRSLADPRATVRVGDGLAFVRQTPDNTYDVVIIDTTDPAGPASKLFGEAFYKDVLRILKPDGICCNQGESIWLDLELIEKMSRFIRETGFASVQYALMHVPTYPCGSIGTLVCSKKAGVDVTKPLRPVEDMPFAKDLKYYDSEMHKASFALPRFARHINN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine synthase, putative
publication title Structural insights into the novel inhibition mechanism of Trypanosoma cruzi spermidine synthase
doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
molecule tags Transferase
total genus 97
structure length 285
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 4yuvA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4yuvA02
2PWPA 2I7CA 2GPYA 4PGGA 1ORHA 3KPJA 2PX8A 4FSDA 3RIEA 3E8SA 4RTSA 4PIMA 4CWAA 2YX1A 5DRTA 2C7RA 2OY0A 1I9GA 3FUWA 2EJUA 3KPYA 5LQNA 3M70A 4YUVA 2JJQA 1QYRA 2DPMA 4XUCA 3M4XA 3EEOA 3GRZA 4GQBA 4F85A 1M0EA 1RI4A 1QAQA 3M6UA 2BM8A 3DXYA 3P2KA 2O0LA 3DXXA 4KWCA 3SMQA 3HVIA 3TFWA 4YMHA 2ZZMA 5E1DA 4B17A 3HCDA 5BXYA 1P91A 4PYIA 3NVMB 4POOA 2IP2A 1JSZA 3DR5A 3KR9A 3P97A 2EFJA 1M6EX 2ZBQA 3P71T 4PIPA 4RVFA 3VC1A 3NDIA 2HNKA 3CKKA 2AZTA 2O06A 2ZBRA 1WY7A 4C04A 3BWMA 3BT7A 5EQJB 4RTKA 3KPWA 1X1CA 4X61A 2YXEA 2I9KA 2P8JA 3ERCA 3I64A 4FZVA 1P39A 4R8RA 5CIYA 1HMYA 4FS8A 4ER0A 1VP9A 2R6ZA 2OYRA 3G2QA 5DWQA 3VSEA 3BUSA 3PFHA 4XCXA 1JQ3A 3TLJA 4O29A 3O4FA 4RV9A 5T6BA 2ZZKA 3VYWA 5FWDA 2H1RA 4LWOA 2F8LA 3CGGA 3G89A 5DXAA 4E2XA 1BHJA 2CWWA 5HFJA 1XDUA 1ZQ9A 3EVCA 4QDKA 5EMMA 3T7TA 2WA2A 5KVAA 1VPTA 3NTVA 3GO4A 2PWYA 3HA3A 4DA4A 3MTIA 4LWPA 3I58A 2GB4A 5FCDA 5DRYA 5EGSA 1VL5A 1XCJA 3TR6A 1NKVA 4PYMA 3IYLW 4HG2A 2PXXA 2NYUA 1RI5A 3L8DA 3ER8A 4PYQA 3CC8A 3MERA 4FP9A 5DSTA 3SGLA 1RJFA 1D2CA 5E8RA 5GM2A 4BP3A 4OBWA 3EGVA 1N7JA 2EJTA 3FPGA 4NECA 4QPNA 4DKJA 3BXOA 2NNWB 4ZTBA 1WZNA 3NDJA 1L1EA 1O54A 2G71A 2AN5A 3VC2A 1IM8A 2HTEA 5HZMA 3A27A 2O57A 4G56A 3P2EA 3JWIA 2BR4A 4KDRA 1L3CA 4OX9Y 5CVDA 1JG4A 5K0GA 4LECA 2NP6A 4DCMA 4FSXA 3OE4A 2P7HA 4Y2HA 1KIAA 5FQOA 5CM2Z 1KXZA 4ATNA 3UBTA 2QRVB 1JG3A 3FTCA 2UYOA 4CTJA 1DUSA 1Z3CA 2AOXA 5K09A 3ME5A 4BLUA 2OPBA 2PKWA 3HCBA 4IV8A 4KW7A 5CUQA 4RX1A 4M37A 1JTFA 2PBFA 4YV1A 1RI3A 2XVAA 4M38A 3KQSA 1O9HA 4P58A 3X0DA 1G8AA 4CKCA 2QYOA 5K0JA 4AUKA 4X60A 3OFKA 3MGGA 4KVZA 3LCCA 3LECA 5DM4A 4ER3A 1FBNA 1P1CA 8MHTA 4OBXA 1RJEA 2FYTA 2OB1A 1NW6A 2ZW9A 2NXEA 2PT9A 3A7EA 3EVGA 4RSRA 2ADMA 1YFLA 3GGDA 5LQUA 2JH8A 1UWVA 1KPGA 3HTXA 5E9JA 3PFGA 1X1BA 3G8AA 2UYCA 4YUWA 5CVVA 3FPFA 3DH0A 1DCTA 5FHRA 1JG1A 4MIKA 4YUXA 2P3LA 4OA8A 1N7IA 1RI1A 1TW3A 5B1SA 2E5WA 5ERGB 3I9FA 2FK7A 2B2CA 2FK8A 1XJ5A 3KQYA 4AZTA 3V97A 1FJXA 1SUIA 3PX2A 1QANA 3JWJA 4RTQA 2IDKA 1AF7A 3OU2A 1G8SA 4QTTB 3BWYA 2JG3A 2IBTA 1XXLA 2ZIEA 3GRRA 3R6TA 3PX3A 3LCVB 4X1OA 2IIPA 1WXXA 2WK1A 1JTEA 3B3FA 5JR3A 3FTDA 4E2WA 3K0BA 1QAOA 3K6RA 2BH2A 4MHTA 3R9XB 3CBGA 4KRGA 3PLAE 3OPNA 1ZGAA 3WSTA 5DPMA 3QV2A 1KPHA 2UYQA 4BLVA 4E33A 1NW8A 3R3HA 3SM3A 5EHIA 4QQNA 4LG1A 3BZBA 3AJDA 2BR3A 1SUSA 3DMHA 3KR1A 4DMGA 5EOVA 3MB5A 3OZSA 5E1MA 4RTLA 3T0IA 1KPIA 1EQAA 1NW5A 3A25A 2PGXA 3G5TA 2FHPA 3LBYA 4M7RA 4QPPA 5DTQA 3OE5A 2AR0A 5CVUA 2CMHA 3UJBA 1U2ZA 3NVKI 2HMYB 4ER6A 3M33A 2HWKA 5LR6A 5LQJA 3KQQA 4A6EA 3CJRA 5LQKA 1YFJA 3KR0A 4E31A 2EX4A 5HIIA 1P1BA 4PYKA 3ER9A 4OQEA 3EVEA 5M5BA 3AXTA 5FA5A 2OB2A 2O05A 3HEMA 3MCTA 4C03A 1ORIA 3MAGA 3OU7A 2ZZNA 3P9NA 2OZVA 4CKBA 2JHPA 2GH1A 3A4TA 1SQGA 2G8NA 3HNRA 3LBFA 3DTNA 5FULA 4GOND 4BLWA 1XTPA 5GIOE 2Q41A 2ONZA 4V0QA 4WVLA 1JG2A 3DMGA 2Y1XA 1EG2A 1FP2A 5EMKA 4YUZA 2YXDA 3H2BA 3EGEA 3LL7A 4PONA 1XVAA 2BZGA 3HCFA 1RJGA 4UOEA 5GP1A 1NE2A 2AN3A 1EIZA 2B25A 5IKMA 4RTRA 1JQDA 5EIFA 4E70A 3B7PA 3MQ2A 1EJ0A 2IPXA 2PV0A 2ZTHA 4IV0A 4QTUB 5EKUA 5CD1A 2YTZA 4E2YA 2XYRA 2QM3A 3LSTA 5EZSA 3RODA 2G72A 4C05A 2ZCJA 2ZWVA 1TW2A 3M6VA 4GF5A 4FT4A 2AOUA 3TRKA 3D2LA 2IH4A 4RTNA 5ICGA 1IXKA 3GCZA 3TQSA 5E2AA 3BWBA 4M36A 2AOVA 2ESRA 1ZGJA 2DULA 3FPJA 4XUDA 4AX8A 3LDGA 1KR5A 2R3SA 3EVAA 4DM3A 3GJYA 3LPMA 3LDUA 5HIMA 1TPYA 2NXJA 1HNNA 2NXNA 1WS6A 4GOMD 3OFJA 3DLCA 2P41A 2CKDA 2PXAA 4K6MA 5DX1A 5F2NA 5K0BA 5E9QA 2BR5A 4EKIA 4PCAA 4EKGA 4GC9A 1JQEA 3KQTA 3THRA 3FRHA 3LKDA 1R00A 1MHTA 4WXHA 3DOUA 3SXJA 2OO3A 2IDJA 5LSAA 1VLMA 1BOOA 3GNLA 2AOTA 2K4MA 4PYOA 3UA4A 1MJFA 5BW5A 3ELYA 3OZTA 4F84A 4IKPA 1EAMA 5ICCA 3FYDA 5LQRA 3AY0A 3O31A 2PX2A 3S68A 3GRVA 2H11A 3JWHA 10MHA 5D1NA 1N2XA 5ICEA 2AVDA 3AWIA 5CCBA 5KS2A 5DTMA 4YV2A 5JUWA 1NV8A 1SKMA 1M6YA 2B9EA 3CJQA 5D1HA 5FQNA 3OCJA 1UIRA 3OU6A 1L3BA 1H1DA 2C7QA 4QVGA 2Y1WA 5K0FA 1I4WA 4YMGA 4EK9A 3KU1A 3LCUA 5FHQA 4PYNA 5U4XA 5FUBA 1Q0SA 4C4AA 3HVHA 1L3IA 3HCEA 2N47A 1ZG3A 3KKZA 4HTFA 4KDCA 1AQIA 3NWEA 1XDSA 1R74A 2CL5A 2PY6A 5G02A 5E2BA 3LX6A 3FPEA 3UJ7A 2XYQA 3EMBA 4P7JA 1R6AA 3HM2A 3ANXA 5EEGA 3NMUF 1XDZA 3LGAA 2OKCA 5MHTA 2VP3A 2ERCA 5DM1A 4QQKA 5E1BA 3TOSA 3DXZA 3DP7A 4EQZA 3PTAA 4PCLA 3UA3A 3C3PA 2PXCA 3IV6A 1VIDA 4PGHA 1KHHA 3OZRA 2C7PA 4QVKA 3G7UA 4FR0A 4P7FA 4E32A 5T67A 3A26A 4RWZA 4Z2YA 2C7OA 2CMGA 2PVCA 5GOZA 2VDUE 1X19A 2PLWA 4U7PB 4E2ZA 5H02A 2AOUB 2V74B 1R8YA 3ELUA 3HP7A 3KQWA 5P8WA 2AOWA 2G70A 4PYLA 4C08A 2YXLA 4R6WA 5EEHA 2QE6A 3QOWA 3GDHA 3ELDA 5DXJA 3PVCA 5HIJA 3UJAA 2PX5A 3B3GA 3DLIA 5DM0A 5GWXA 3THSA 1FP1D 3GWZA 4IWNA 5HILA 3UJCA 1OR8A 4F86A 5CVJA 1WG8A 3RW9A 1NBHA 3HVKA 4HC4A 1I1NA 3M6XA 3V8VA 3KPVA 2AVNA 5F2OA 5DT2A 2HR1A 4BP1A 2P3QA 2P3OA 3FZGA 1X1AA 1YB2A 2NXCA 3ID6C 4U7TB 4C07A 4ER7A 2P7IA 3BWCA 5KQSA 1G60A 2IH5A 1D2HA 2Z6AA 2WA1A 5K0NA 1DL5A 3FRIA 4HSGA 4KIFA 2YUIA 4XUEA 3SSOA 2AN4A 1L9KA 1VBFA 1Q0TA 2ZFUA 5EG5A 3FUXA 3UJ9A 2G1PA 4H0NA 5DSXA 1WXWA 3KQVA 5IH3A 2B3TA 1PRYA 2GAFA 2P35A 4DZRA 5BP7A 2AOTB 2IFTA 4C06A 2I62A 4AZWA 5C9ZA 3HVJA 5GM1A 1ZKDA 2GS9A 2ZLBA 3PB3A 4CTKA 4GBED 2YVLA 1JSXA 1O9GA 3TMAA 3FUTA 3ORHA 2ZIFA 4YV0A 4PINA 1AV6A 2P40A 4MQ4A 2VZ9A 4PYJA 1YZ3A 5K05A 5FADA 2ZBPA 1AQJA 3KR2A 2ONYA 4HH4A 2NP7A 2UYHA 5HIKA 3G2MA 2V7EA 5DX8A 5EVJA 3SR4A 2XVMA 3BGIA 1EJ6A 1XCLA 4AZSA 4OA5A 3AXSA 2BM9A 1BC5A 5HEKA 5K0EA 4AZVA 1VE3A 3M6WA 3DMFA 3FPHA 2ZIGA 2FPOA 5F2KA 4E30A 2EG5A 1INLA 4FGZA 4HTFB 3FYCA 1VP3A 2UZ4A 1PJZA 3EVDA 4RYLA 3B5IA 5EC8A 2ZWAA 3G88A 5ICFA 2OBFA 4GUAA 3GIWA 5K8VA 3KHKA 4GOLD 3FUUA 4EMSA 2GA9A 3GXOA 2VDWA 3R0QA 2OXTA 4DF3A 3E23A 3BKXA 3CJTA 3NWBA 1G38A 4RVDA 2XYVA 4GEKA 1NV9A 3A7DA 3G8BA 1IY9A 3GRYA 5EPEA 1NW7A 5LQCA 2FCAA 3O7WA 5C0OE 3F4KA 3T7RA 1YUBA 5CVEA 3PS9A 4GC5A 3IHTA 5K0CA 5EMLA 2HV9A 5BW4A 3P9KA 3UJ8A 4RTMA 1BKYA 2ZVJA 3DUWA 3EVZA 4P7GA 5EZQA 3BGDA 3G2OA 1JR4A 5C1IA 1QZZA 2JHAA 3HCAA 2PSSA 3QOXA 1RI2A 3NW9A 5E1OA 3G2PA 3EEYA 5GINE 2KW5A 5K03A 1YF3A 3REOA 1D2GA 2LD4A 1G6Q1 5LQAA 4RTPA 3EVFA 4PNEA 1QAMA 3CCFA 3SX0A 4RTJA 5EIWA 4RTOA 4X63A 3Q7EA 1NBIA 4A6DA 3BKWA 3HA5A 3G5LA 5GIPE 2IBSA 1ZHFA 2VDVE 2GLUA 4FT2A 4KIGA 1YZHA 4HGYA 2ORED 2PJDA 4QDJA 2FRXA 5DLYA 5DTRA 3IEIA 4L7VA 4EVIA 3MTEA 3TKAA 3PT9A 3TM4A 3LHDA 3B3JA 3NJRA 5FTWA 3UJ6A 2Z6QA 4R6XA 3TPZA 2ZULA 3MCZA 2ZSUA 1R8XA 3T7SA 4PWYA 1SG9A 1SQFA 3FTFA 3UZUA 3SVZA 3P8ZA 1FPQA 2JH9A 3CVOA 2H00A 2YQZA 2PT6A 7MHTA 1VQ1A 3LDFA 3I53A 5EMJA 5HOQA 1B42A 2VS1A 3DULA 3HCCA 2QY6A 3C6KA 4R8SA 3UFBA 3KQMA 1F3LA 3R24A 5E8JA 4RVGA 3C3YA 9MHTA 1G55A 3HA7A 3Q87B 1KP9A 5KYGA 2YR0A 3E05A 4HRAA 3BGVA 3E7PA 3P2IA 4RVHA 1UFKA 4X41A 3TM5A 5FA8A 1NT2A 4MWZA 4R05A 5T64A 3SSMA 5CCXA 5E9WA 3TKYA 4CKEA 3LKZA 4HGZA 4MTLA 2JHCA 3GU3A 4OQDA 4ER5A 1X1DA 3JWGA 2IH2A 2PX4A 5K0LA 5DM2A 3EGIA 2P1DA 1NW3A 3GRUA 3I5UA 1T43A 2O07A 1Y8CA 3UJDA 2IGTA 2XBMA 4BY9E 1F38A 2A14A 4YUYA 5DX0A 4CXMA 1RJDA 2B78A 2I6GA 3KQOA 3KPUA 3U81A 3EVBA 4DCGA 2QRVA 3KQPA 4ISCA 3P9IA 4DQ0A 3C6MA 3C0KA 4V0RA 3EPPA 3FTEA 4JXJA 3B89A 4P7KA 3FUVA 5K01A 3MHTA 2Z6UA 3ELWA 1V39A 5EHGA 4GOOD 1R18A 5FWAA 5KQRA 1KYZA 3EMDA 3P9CA 1KYWA 4Y30A 5EKXA 3SSNA 2AS0A 1SVUA 3UWPA
chains in the Genus database with same CATH superfamily
2PWPA 2AN1A 2PH3A 3NHYA 4C22A 4OYLA 2EHDA 3ODGA 3PHCA 5IAOA 1Q17A 4HV4A 2Q4RA 3OM9A 3WLPA 4FKZA 1HGXA 2P30A 2WHYA 2X0FA 2A92A 4GAEA 3BHNA 4DR4B 2J07A 2H06A 3EQ9A 4Z5XA 3FUWA 3HB0A 1KEUA 3HUEA 1IBLB 4Q00A 4YO8A 2OBLA 4PG6A 5K6AA 4AW9A 2ODBA 2DWPA 2PS1A 1M0EA 1GTRA 4UDNA 3JQFC 5MGNA 5J4HA 4WX2B 3S3TA 2JFBA 4QRDA 3DAOA 1JRLA 1L8QA 1C9DB 2APJA 3SN6A 2O7QA 1ZI8A 4ZK6A 3NU1A 3WB0A 5IT5A 2H2HA 1UEIA 3ZGLA 3SDBA 4QM7A 2JF0A 3ITKA 2A5DA 4G4JA 4F2WA 1TZJA 2RGXA 2C3OA 4J16C 2EFJA 4S1VA 2ZBQA 5HKAA 4GDMA 1B1AA 5MF6A 3NDIA 3O9MA 3F90A 1NX6A 3SR0A 4BRUA 3PI6A 2FZVA 3MPOA 4QJIA 3RM3A 4RHCA 3BFVA 1M73E 3W2GA 4H4EA 1XJWA 4EHJA 1F06A 1QH8B 1HDZA 2FPKA 1Z0UA 4B48A 3A1EA 1NSYA 1L0BA 3BX1A 2IYQA 2R6DA 3L1HA 4H6WA 1EUDA 3OPMA 2AKEA 1XFDA 4X00A 4BFLA 3LRXA 2DFVA 5LU8A 1N34B 2IZ7A 2X5XA 4GSKA 4KQ6A 3RYFA 5CITA 3BQ9A 3TLYA 3FKSA 3HA3A 4H4DA 1BXGA 3SIXA 1U9IA 3VKGA 3RC3A 1CB7A 3HCOA 1FFHA 1A2QA 3ETJA 3QI7A 4JOBA 4YROA 1I3NA 2ZPAA 4G1BA 3MS4A 2C94A 4O3MA 1FYFA 2V0NA 1C7RA 3I4FA 3PFCA 2PZAA 4OKIA 1HOTA 2VF2A 2BFAA 5CIQA 4CKWA 3L84A 4JUCA 1BNCA 2E1RA 4IHQA 5CFZA 3MSXA 5ES3A 1SUDA 3TZBA 5K45A 5HZGA 4B6QA 3CZAA 1F51E 4Z9XA 4C1BA 2V7BA 3L4KA 4MQLA 3K1JA 1N4DA 3RUIA 1QIHA 1FXUA 1X38A 2R79A 2MSDB 3KSUA 3MNFA 4P0PB 1NXSA 4QRIA 3NHZA 4XRGA 5TPZD 1QMGA 2QIOA 2P7HA 4D82A 5EJ9A 5CGQB 4K0RA 1B6SA 3FNHA 2O2YA 5IASA 5K8IA 1F0PA 4ZZ2A 4P4UA 4ZEOA 2OSBA 1XN1A 2YHIA 4IEIA 4NICA 1ZAYA 2W6ZA 3T61A 1RI3A 3DCJA 3EXFB 2BJWA 2BD0A 3PUZA 1O9HA 4Z0PA 2RAUA 2V8OA 1D0VA 4YCAA 1IPHA 2HBQA 3K3PA 3MGGA 3N5KA 4GXTA 1M34A 4EB6A 4DJFC 5AW6A 4Y1FA 1PW7A 1XRQA 4RF2A 1XK6A 3R7AA 4B4WA 1UMKA 1ADCA 2FVYA 1YI8A 1T9BA 2H2WA 2JH8A 4Q12A 1KPGA 1NLUA 4XAQA 1GZ6A 2QN9A 1YVEI 4ZFNA 2OD2A 4CQJA 2JGFA 4YUWA 5KX5B 3GDOA 3IL2A 2GN0A 3PUIA 3RAJA 1DCTA 4O2RA 1AKRA 2IYRA 5F23A 2XQIA 3ZE7A 4U4AA 2JFGA 2FK7A 1LPMA 4HQOA 2D5IA 5CM9C 1Q1ZA 1QANA 3DR3A 2JLBA 4DA8A 4YJKA 4K9QA 1YONA 2IYOA 4HB3A 4YMVA 1LPNA 3GRRA 4V1CB 4DSTA 4JT4A 2J48A 1KI4A 4WHMA 3W05A 1FRVA 3WY9A 3N2YA 1HYQA 1LA2A 1B43A 1TD1A 1Z39A 2AX4A 2I2AA 3E81A 3PIIA 4FFRA 2GEFA 4MB6A 4ETMA 3LF1A 1K3FA 3AK4A 3NDBB 2W11A 1FTNA 1K3TA 3GUVA 4RC9A 1JDSA 3HYSA 4KLRA 4QPZA 3A2MA 4QQNA 1TRHA 2FFAA 5ECWA 5JQGF 2K2WA 3DLBA 3NKLA 5E1MA 3TTUA 4Q9NA 3A25A 2PGXA 4CDRA 4M7RA 1OYVA 1XF1A 4LDAA 1SQSA 1U90A 3SX2A 1IG3A 3FVVA 4FOPA 2I54A 2PKCA 5LZ5A 1DU4A 3VSCA 1G5TA 2HXYA 1WTAA 2QN6A 3BC1A 4B45A 2D0DA 4J43A 1U2GC 2G1AA 7MDHA 5F3DA 4BNIA 3V3KA 3CJRA 2Y6UA 2ZT5A 5DDIP 2OBBA 4BKQA 1UZAA 2IITA 3N0TA 4BMXA 4DILA 3EAGA 3NKVA 1Z8HA 3I6ZA 4RZIA 7REQB 4W6QA 1E2IA 1Y4ZA 5KOYA 3GOQA 2DHCA 4HAWA 1EZ1A 3QTBA 2HIMA 2HV8A 3HVUA 4GX1A 4RHFA 1I2CA 5M7EA 4ZTZB 2YOFA 2M6LA 2QQFA 1OB2A 3LL7A 4ZDKA 3OQBA 3KSBC 1FFBA 3RUEA 5AMXA 4AJ2A 4BNVA 2V45A 3VV3A 5IFKA 1PR3A 1JKFA 1E1NA 1NE2A 4LMRA 4CKCB 4AULA 2RG1A 4N7BA 5DHUA 1PO7A 2ZI9A 3A1VA 4FW9A 5L95A 3MQ2A 3PK0A 2GBPA 4EKYA 4FMBB 1XPJA 3ABOB 3PUKA 2NV2B 3ANMA 3AHGA 3AVYA 4CF3A 3QU7A 3H9BA 3EF3A 4YV7A 4C7OA 4FI3F 2W7TA 1Z0AA 4FT4A 4KXFB 4UHBA 4XW2A 3ROXA 2HT6A 1FUIA 4FMPA 3QPVA 4QHTA 4I4IA 1J0XO 4M36A 3H9JA 2XMZA 1JYSA 2GMWA 1TK9A 2FUG6 2UKDA 4IRXA 4KO1S 1RM0A 2ZIVB 1M6HA 3AT1A 3FMFA 3RS9A 4C0SA 3TTTA 3ZIAA 4FNGA 1IJKA 5B1YA 1CHNA 1CQWA 4NC9A 4RGYA 4Y2SA 2P8SA 4JKOA 2GXUA 3HDJA 4WVFA 1THZA 4K6MA 5JD4A 5E9QA 2PSDA 3ESDA 4PCAA 1I14A 2B4YA 3H8VA 4PAWA 5DI9A 4AN0A 5JTTA 1R00A 2HK6A 1IIRA 4YXWD 3TNYA 4BVJA 3Q0TA 1TCAA 4QBTA 1OA0A 3FY4A 3WLNA 5JBQA 4Q4LA 1T9ZA 3ELYA 2ZJ7A 3NHMA 3GLGE 1A4RA 1Y8RB 1A7KA 2AH5A 2N0SA 4J7XA 4URXR 4DJ5X 2QF7A 4B2IA 3WIBA 5D1NA 4KH0A 5F2NA 3MLBA 3KQHA 4BFWA 3WMGA 3OJEA 5CT8A 5DTMA 5JUWA 4HXYA 1PZNA 4R3WA 2YZ2A 2BKEA 2PUJA 3NNSA 1XSEA 1G8JA 2WJPA 1OYOA 3VVLA 3UUFA 1NFFA 5IUKC 5B2EA 4DVJA 2AXQA 2WMOB 4PO8A 3F2VA 1J2JA 2OZEA 3WR5A 4OLFA 3W4IA 4OXQA 1HQCA 2H7XA 4KDCA 1F4PA 3OX2A 4KMRA 1XDSA 1NI4A 3U62A 2NG1A 2PE5A 4TKZA 2AEFA 1ACMA 5SY9A 2F43B 5EZYF 5JLAA 3UMCA 1YXMA 3L8ZA 3HM2A 5I7AA 1RRGA 5DULA 4BZQA 4PFSA 3BE6A 4Y2UA 4HAOA 4TLEA 2YMQA 4I6JA 1O6ZA 3LI2A 4BVGA 1TRKA 1U7OA 1J07A 2QJOA 3F49S 4FFMA 3UK7A 4TMYA 1GL9B 3A2NA 4UNQA 3S1AB 5EJ6A 4FR0A 1KI2A 4YREA 5BMVA 3BDIA 2QUAA 4P3XA 1MIHA 4HLNA 3KX2A 1WCIB 3M3PA 1OY1A 4LJSA 3CXRA 3ED5A 4PZCA 3GLFE 4EGJA 4F96A 3BRQA 1CQJB 5EIHA 1RDFA 5AKGA 1F8GA 2PZEA 3KE8A 4LNAA 4OPMA 4DCNA 1WPGA 1RWWA 3I6BA 2EEPA 1W581 4FWTA 1ECCA 2G67A 3P26A 2WUWE 2Y1FA 2FR8C 1WHTB 4P33A 3ZNOA 2GO7A 4E14A 4X3OA 3SC3A 3UC5A 1QYIA 3MZ0A 5IF9A 1LQUA 2OORC 5JDCA 1H0HA 2NZWA 2PLNA 3K8ZA 3BB3A 2HRQA 2Q5CA 3THSA 3DLIA 3D6AA 2AFIA 5CLHA 1SBCA 2C00A 5C1BA 2CNWA 4LHEA 5HCUA 2D1TA 4NZMA 3V8VA 4S1NA 3COVA 4TRNA 2WUDA 2P3QA 3KKMA 3RG8A 4V1CI 4X6UA 2AFVA 2BLNA 2C4HA 3TN7A 1ZEJA 4AF8A 4G5YA 2HF9A 1A0OA 2Z6AA 2B8NA 2VJPA 4ND6A 5K0NA 3TTWA 4J0QA 1VBFA 3LCRA 4HP8A 3LBAA 3LUGA 4WXYB 1XELA 5JU6A 4FFVA 4HEJA 2GAFA 4BGUA 1D03A 3BIJA 1NUQA 1KDRA 2OV1A 1DKRA 3H1GA 2GS9A 3DV0B 2YNMA 1LDGA 3P2JA 3Q40A 5IM4A 1KNXA 3L9WA 4F1WA 1ZY2A 3TMAA 1Z26A 1GM5A 4E94A 1E9CA 2NU9B 1E2BA 4GYKA 3A1CA 1OFHA 2REQA 4B8WA 1J24A 1KVQA 3FRJA 3RQIA 5JNWA 5DU2A 1TM5E 3X1MA 3GMDA 2OLEA 5CXUA 1ZMRA 2QNBA 1PR1A 1WRBA 3FVQA 5K8JB 2PUHA 1KS9A 2V7EA 1EVLA 1GRCA 1LJ8A 4KR0A 4N9WA 3VX4A 3WYCA 2CJWA 4J03A 5J2UF 2D54A 2Q9UA 3DE3X 1ADFA 4M2LA 4V0KA 4YI3A 5HEKA 3EX7C 1P17A 1HLPA 2GCOB 2HYDA 3DMFA 4IR7A 2A30A 2VJLA 5KYNA 4IIEA 1R3UA 2JZNA 4KFRA 4TTJA 3LXUX 2QYHA 1PNTA 1CQIA 4RYLA 2BSQA 1E1QA 5BOSB 4Y8VA 3VHQA 1D2EA 4UDYX 2C92A 2C9BA 4B44A 4AKGA 1KJ8A 3DWGA 2RHDA 3NS7A 4CKXA 1IHXA 2HEIA 4DSAA 2PPVA 4FHZA 1YOVA 1VBKA 4DAEA 1QX4A 4JR0A 4LI3X 5CB0A 4H7HA 1A2OA 2JI8A 2R6FA 4PS0A 3C3KA 3LIIA 3PS9A 1EXWA 2A0WA 2H5LA 4NV0A 4A8JB 3HFSA 4EABA 4LZPA 1E7SA 4J0CA 1YQTA 1T0HB 2I4NA 2WHQA 3DUWA 3FOZA 2A5LA 3ETEA 1UJMA 3IVAA 2QHXA 3MFYA 2XGMA 4JR1A 5DISB 4BWGA 3Q11A 3M4ZA 5JSYA 4ONEA 5E9AA 2P79A 5JE8A 1GG8A 4LRSB 2TMGA 2HDWA 1K8XB 3E0XA 3R0ZA 3NM5A 1TTHA 4BLPA 4Z4CA 5CLLA 4WOKA 3R76A 1U7DA 1C3OB 1SNYA 1C14A 1UBUS 5IP5A 4FHFA 4RTJA 5IC4A 1XVIA 1NBIA 4CN9A 1OGIA 1DHTA 3IXMA 2DQ4A 5DVZA 1R50A 3U09A 5GIPE 1JAYA 1N0UA 4KUHA 2GLUA 2O2DA 5KJ6A 1ABEA 1FJHA 1FVFA 4J2OA 4BFSA 3BH0A 4EYQA 2FE4A 2VBGA 3A6ZA 4GMGA 3A11A 5L45A 3MTEA 4MIEA 2D5CA 4AO8A 1XRRA 3HZHA 4KXMA 3NBKA 4GQIA 4U3JA 1DUIA 1Q6YA 2WNIA 1OT5A 4B6PA 4OAPA 1HZZC 4UAGA 3GLIE 3EPLA 4UKDA 2DPLA 3ZWYA 3SU8A 1O2DA 4K86A 2IHKA 2JCYA 2RH9B 3A04A 2BGUA 3O75A 4TMKA 1V3QE 3EDCA 1NW4A 1ESMA 3E9CA 4UCWA 2R62A 4LXTA 3MCUA 3H75A 1MQ9A 2NU8B 1UK9A 3INGA 4PQGA 4WESA 2G7ZA 2XVYA 3RT9A 4EBBA 1J20A 4MV5A 2JIZD 2O5RA 2Q3EA 3F9CA 3IS3A 4FPXA 1J25A 2EDAA 3FOBA 3JRXA 3QKIA 5T8KA 5BNZA 1FSFA 5JSUA 5IJXA 5JJLA 5CLFA 5ED4A 3B5JA 5EXEA 3U3XA 1H1LA 5JW6A 1U8XX 1U8EA 1SVKA 5E7JA 2VH2A 4EFNA 5JQGB 3H2HA 1WQ1R 5B1DA 5H4GA 2C07A 2VJCA 3C5HA 3E05A 4CM1A 3D4IA 4L5JA 2ZRBA 2AZ4A 4M0FA 5AFSA 1L7VC 2PWZA 3O91A 2BGNA 1HEIA 1UM9A 5AK0A 3QF7A 3VPDA 2X42A 4LJRA 1P3Y1 4O4HA 2Q5IA 2H2GA 1TF7A 2QW8A 3ET4A 3EODA 4D3XA 2DXIA 4PAOA 2J6HA 2J9XB 4OP2A 1YDGA 6AT1A 3HP4A 1FC0A 1BKSB 2A14A 5B7PA 1OWOA 3PWKA 1NR7A 1BX3A 2VDWB 2ZTMA 4Y7DA 1RJDA 4CCSA 5SY4A 5G0UA 4F12A 3N8HA 2E4WA 2QRHA 3MOGA 1XTKA 4LQDA 1UJ5A 4AJPA 2JCGA 4NK5A 3PT5A 4JUIA 3H97A 3LP8A 5IWCA 2G17A 1FTWA 2ZP1A 2D1RA 3ELWA 3VDRA 2PMFA 1T6BY 2E1PA 3M3HA 1ZM4A 3EMDA 3RVBA 3BMCB 1M67A 3COPA 3Q3GE 2RGNC 5BN3B 4KRYA 3PDJA 3KPJA 1E6EA 4KK4A 5I48A 4D5GA 3FTNA 4J1TC 3RVPA 2XJ4A 1GA1A 1M1NB 1T3SA 4EELA 4MWBA 4P84A 1HA3A 3KPYA 1WE2A 1UFQA 3TH5A 2X8JB 4YUVA 2GR9A 2L18A 3UPTA 3VPXA 2H1VA 1ODJA 6ABPA 4DNPA 2VDOB 1NGSA 2G40A 1UXKA 1JUDA 3NWPA 4YT8A 1KU6A 4BVFA 1HDOA 3D6MA 1P91A 4PYIA 5BQ5A 3UKOA 4POOA 1USIA 3VMFA 1Q3TA 3BCRA 3ONNA 4U7DA 3A3OA 4ZAGA 1A97A 2C2MA 4F5ZA 2C8KA 4EOGA 1A88A 2HFKA 2QTZA 3CKKA 3EIQA 3OWOA 4J75A 1UBMS 2OMEA 4P5EA 3RH0A 5M5BA 4XDHA 1G18A 3I6YA 5A1JA 3JQ9C 5K3FA 2ZDQA 1B4DA 4IZIA 4R1MA 1LQ2A 2IGBA 1VP9A 1OYWA 3M2PA 1H4QA 3U3JA 2QUZA 3MOSA 4QNNA 3M81A 2R4UA 1JQ3A 1YR7A 4RMGA 1YU6A 5H8WA 2ZZKA 1JMVA 1EVYA 2I9PA 4GMHA 4D0RA 4N3GA 2ID8A 1XDGA 1CQXA 1U3GA 2D8MA 3GJ3A 3WK6A 3QW4B 1E3WB 1RYFA 5EJ2A 1TUBB 3NTVA 2A9VA 3MTIA 2IEBA 3FWPA 3TR6A 1SXHA 3WBBA 3U3DA 3L01A 1EH5A 1DQRA 5G4KB 3D64A 3B1VA 3ZX5A 1QYCA 3MERA 2YRWA 1CP2A 3PENA 5REQA 4CKEB 1FNBA 1E5XA 1E32A 2WWTA 3EGDA 3K9GA 4NBUA 4NR0A 3AM5A 1BOFA 4D99A 4DNOA 4QJ4A 4A7PA 3JQEA 2G71A 2QAIA 3V42A 4RGVA 2R1TA 2VT7A 3RVMA 5IT0A 4AICA 1MOPA 3ETHA 4AC9A 1MMFB 3H5VA 2FKAA 5JEEA 2SKDA 2QW0X 4KDRA 1RZVA 5B3JA 2PR2A 3AFNA 4AJLA 2HHCA 2Y67A 4J0DA 3TQIA 1CY0A 2BH9A 1XVUA 4UDOA 4UTXA 5A04A 3FNFA 1GRQA 4TKUA 3STYA 4NYMQ 3UBTA 1JG3A 3EEFA 5EZYB 2GSDA 5DHQA 2IYSA 3T7AA 2BGMA 2H4YA 3R3XA 5DBIA 1M2OA 1VI5A 4YV1A 4IZ6A 2CMFA 4II2A 4P58A 2FZEA 1GOTA 1Y1TA 2GVZC 2QX6A 3BF8A 4I0WB 3PUWA 4MR7A 5AP9A 1KDYA 3ZU4A 4TKVA 1L2TA 5I9TA 4H2DA 3LBIA 5M3BA 4AUKA 1XR3A 3NUGA 1H69A 1NVMB 1TLTA 3LECA 1QLJA 4EVSA 3U60B 5CAEB 2LV8A 3ZOKA 8MHTA 1M2VA 1ETHA 1TXGA 4NPHA 1LNSA 1O7JA 1HDCA 1PAUA 2GUGA 2I7VA 2WIFA 3O2NA 1T5IA 3PKJA 5DGXA 2I6FA 4O2AB 3DA8A 1BRTA 5FJIA 3WK8A 4HUQA 3A8TA 1EFHA 1J5EB 1XG5A 1SPBS 4I6EA 3ZWPA 3QFCA 4AMYA 1KO5A 2P3LA 2NTYC 1N7IA 3K94A 2VNIA 4BQOA 5CCEA 1J2UA 2IX3A 3SQXA 1K66A 1L5ZA 1CR4A 1J2EA 3PR1A 4PQRA 3T54A 1F8UA 1XTRA 3PU6A 4O4JF 3V97A 1O4VA 1JHOA 1FF9A 1AF7A 3G13A 4H15A 5F1PA 5FT9A 4RIIA 4OI0A 3WZLA 4A16A 1QHEA 1R6TA 3IEUA 3ZKWB 5IVKA 2FFBA 4IRMA 3EFOB 2CSUA 1J70A 4G26A 1CUJA 1GZUA 2FX3A 7ABPA 3PDWA 3OMXA 3GLFB 1RYMA 1OI4A 3RFVA 1T1SA 1MV8A 4RBNA 3RBVA 4S12A 4HADA 1MA3A 1LPSA 2JFPA 2PTGA 4R41A 5CFLA 1JR6A 1NX9A 3G9XA 4HLQB 2JFYA 3HNPA 3E6AA 4YRRA 2FLKA 4DNFA 5K3CA 1C3XA 3OFNA 5PNTA 2DBYA 4KUGA 5LP6A 3OO1A 3I2IA 1ZCJA 4EQ6A 1OKKD 1SJ9A 3U7GA 2XXBA 1ZFNA 5EOVA 5HK9A 3IMGA 2Z3WA 3BG5A 5B55A 5KNBD 1KAMA 4XUGB 2FWJA 3KCNA 4YVFA 1E64A 3TLKA 3JASA 4ZVRA 1YC5A 3X2SA 4CQMB 5A7FA 1SXPA 3A28A 2Q3BA 4G0QA 1GZHB 4QOEA 3Q5GA 2HF2A 2CDCA 4RS4A 4WN9A 1ESNA 2SCUB 2G82A 3DBHB 1JHDA 1GPH1 1P74A 2O8NA 3JW8A 3IILA 1BCRB 1PIWA 3RJ5A 4BQSA 4CM5A 3KQQA 2DB3A 4YDQA 2ZJ4A 3E3LA 3TNLA 3GGSA 2RGUA 2P2SA 4GU5A 3ER9A 1BWSA 1Y8AA 2BFDA 4OU4A 4NG5A 5FA5A 5J2UB 4DUYB 1AVTA 4M1EA 3NP9A 5L3VA 1A8HA 3INNA 1II8B 5AJWA 3A4TA 3L79A 4LVNA 4WJKB 2JI6A 3LBFA 1ZIXA 1HSZA 3DTNA 1BYIA 3S5UA 5FAXA 2V7QD 4IQ8A 5TQVA 5GY7A 2ODWA 4WVLA 4V0QA 3DMGA 1LZLA 4ZU1X 1U2SA 1UAYA 1US8A 3GJ4A 5TQ0A 4E7PA 4ZU3A 1GCGA 1HKUA 2PK3A 3N8GA 2GKSA 4GOXA 4DBLC 3GJZA 5TGZA 4G5SA 2RDMA 5DLDA 5KVSA 5KYTA 1Z2DA 2HPVA 2R6AA 4ND8B 1L5OA 2B25A 1LI7A 5F78A 2JA1A 4IO0A 3S2GA 3WNZA 3R0IA 3F6PA 3IXQA 2ZTHA 5JS2A 2W2VA 721PA 4YCMA 1UC5B 4YT5A 1R5NA 4KGXA 4R40A 1QGDA 4I9UA 1IDOA 3T5GA 5A5DA 1J23A 3HXPA 3RHTA 2QBYB 1E2UA 4XPZA 2D7DA 1VCOA 3WWYA 1T0BA 1IL0A 1WSBA 4EY8A 2DULA 2MMCA 3B3QA 3G2NA 3I9V1 4MUIA 4YMIA 1TJYA 2IKQA 4BGDA 3THWB 2QXYA 3OPVA 1WOYA 5B7NA 3PIDA 521PA 4ZCQA 3CW2A 3KHSA 3PV0A 2VR1A 1BD4A 3OAAD 4P31A 1URPA 2TYSB 5A0FA 3SKVA 4H7FA 4WY5A 1B0UA 4C0KA 5K2OA 4NBVA 1ZJ4A 3ZWWA 1QH1A 1QX3A 2VBCA 3FYUA 2R5WA 4GC9A 1GPUA 3QVWA 4GX0A 5BOVA 4AMUA 2JVKA 4ZMRA 4DV2B 3FD8A 2VA9A 4AP9A 4G9GA 3CNNA 3DEIA 1RT9A 3VDNB 1FLDA 5EI5A 2A59A 3EDOA 3FYHA 2ZJ1A 3QJYA 1JR3D 3LSYA 1BOOA 1KORA 4TS9A 1BFDA 1P5JA 4H6VA 4R0VA 3KYIB 3V1LA 3H6HA 3HM9A 1B0ZA 1JGTA 1CR6A 1EAMA 2QVGA 4OTZA 1L5LA 4LV5B 2ZSHA 1CUWA 5EKDA 3S68A 1KZ7B 3OE7A 5DNEA 1YZVA 3QKSA 2CVQA 4RMJA 1TEZA 2QV7A 5FPPA 2V7UA 2EQAA 5E6RB 2B1JA 1DAEA 2VDMB 1CB0A 3UAYA 2B9EA 3V5NA 3NWJA 2VHEA 4EX6A 3JVVA 1ZHHA 3LT2A 3BE4A 3RSSA 5ICMA 5ALUA 1HY3A 4XCVA 1RYZA 4ZQFA 3R7FA 1T5OA 2OGSA 3AL3A 1B8OA 4XYMA 1FP6A 3ESAA 4A15A 3LCUA 3GRAA 4EJSA 1FE8A 1ZH0A 4MYSA 1G3QA 3DE2X 1K06A 4NZYA 3KKZA 5JH7A 1GAWA 4HTFA 1YJBA 4C30A 5MFPA 3ZVLA 1GZ3A 1N5MA 4MPRA 4MGEA 1T0JB 4PLHA 4AO6A 4I1UA 3ZX4A 2PJZA 2YVAA 4OOFA 1T2EA 5BN5B 1UPAA 4A03A 2Q3LA 2ROQA 2HPZA 2YJZA 3JALB 1ZITA 4FYPA 4YYEA 1OH8A 4S1OA 2VLIA 2ADFA 4L28A 4B3FX 4UCFA 3I9MA 4PR3A 5JPCA 4BNZA 1WPXA 1Y3IA 4QQKA 3RF7A 4US0R 1G291 1A8QA 3UA3A 4CUZA 2ZJAA 3BVPA 1GCIA 3WHKA 3TVYA 4Y9RA 3VTAA 1NTRA 2JCXA 1V9LA 5IF3A 1SEVA 4QVKA 5E0KB 3UGQA 5IHPA 1YCGA 2JD0A 1PQ4A 1ZMXA 3QE3A 1HG1A 1Y9ZA 3HU1A 1OFTA 1W0KA 4IJ6A 2AXPA 3CX4A 1GARA 1N2HA 1VXOA 2TMDA 2C2XA 1B8PA 1ECGA 2GJ8A 2X15A 5JCOC 5FI0B 3ET5A 5BN4A 4WGGA 1LH0A 3I01A 1QTIA 4Y0NA 2RGCA 1QQTA 4OXNA 2D5LA 2R8OA 1G2IA 1P19A 5DP1A 3VR3D 3WQHA 3PVCA 1EP3B 1OA1A 2PX5A 2MSCB 3S29A 1HO3A 4B6FA 5B37A 3P0FA 5TMBA 3UJCA 4F86A 4RSGA 3RS7A 3NNNA 5CPBA 3IAUA 2DH6A 4JC8A 3TTSA 1U3WA 2X3UA 3EASA 5THKA 3WK5A 1CFZA 5FRDA 2PYIA 4Q3CA 2FU5C 3ID6C 4AB1A 4AL4A 1QFZA 3BE8A 4H1HA 1DEKA 3RKRA 3TX2A 3WSVA 2QWXA 3GPDG 2PKQP 3F6SA 4JKYA 1Q91A 4NH4A 2C7OA 1YRAA 2BW0A 4LTMA 2F3PA 4Q82A 4R54A 2ZFUA 3JD1A 5EAIA 3RJ9A 1Y34E 3FDFA 3IUQA 1I36A 1SBZA 3K9WA 2BPOA 1V5FA 4B7ZA 4DRXB 3OZAA 1XALA 3Q1LA 5HZKA 5CMLA 3TRHA 4EY3A 1C7IA 1NXOA 3QJ5A 3M0EA 3E4CA 5BSTA 1PLKA 4CTKA 2FMHA 1L7MA 2H2DA 1GZ7A 3HLYA 4GBED 3OKPA 3OQHA 4OLJA 5HE8A 4FYYA 1FUKA 2IU4A 2X4LA 4M8SA 2ZSBA 1QRAA 1AC5A 1PZFA 3MG9A 2RE8A 1JMKC 1YC2A 3NBMA 1N6HA 1K7EB 1W47A 2OUKA 3V4VB 2ZBPA 1Y4SA 4TLCA 2GD0A 1GYQA 5CFRA 1RZRD 1QGUB 4RZXA 4OA5A 1E4EA 3H2IA 4HNGA 1J56A 2PZ8A 3NTLA 2VYQA 3KUCA 2PL9A 4HDKB 4MGYR 3G49A 2HWUA 3HPRA 3BFXA 3G1TA 5E3IA 1GAXA 1C9JA 2ZRDA 4REQB 5CXXA 4ED9A 1UF9A 2UVPB 4KE7A 4Y3UA 4YYZA 2JATA 5ALXA 2PZLA 2OO5A 1UBKS 2Y0PA 1H8HD 3RCBA 5FTNA 1XBTA 2ATEA 1PFKA 4L15A 1NBMD 1Z0ZA 3K5PA 4MIOA 5AI8A 1YRQA 3GXOA 2C54A 1AQYA 4GLJA 4JNCA 2ZREA 5DYWA 4D4HA 3UHAA 2Q1YA 3TCXB 2NZ8A 1WNFA 5JSZB 4I1YA 5F1YA 1T6ZA 1YQWA 1A9XB 2FCAA 1OWNA 3MINB 2XB4A 4W5JA 1ZS9A 1USGA 3HDVA 4U2DA 4GC5A 2PZMA 3MQ4A 4RM3A 1ECLA 3GLRA 2VCHA 3I23A 3IDFA 5AW7A 3PXDA 4BCDA 1Z6YA 3E03A 3LQ4A 2WVJA 3JQAA 3RT1A 1QZZA 3KELA 2CD7A 2XCOA 2GEDA 1ENPA 3U0VA 3ZZ1A 1D6NA 1GKIA 1RI2A 2P91A 5E1OA 1JXOA 4OJMX 4UBKA 2X9GA 2CFCA 2LD4A 3H8WA 3O1LA 1O95D 4UAUA 4F2GA 3SNKA 5AUOB 2NUBA 3I9KA 3OM8A 1RABA 1W29A 2XECA 4RVUA 4RE5A 4DMHA 4HZIA 1SCKA 4YH1A 4CI9A 3GEHA 3KQNA 1W1WA 2W8BB 3SF8B 2VDVE 4JK3A 1J0BA 1CTQA 4HGYA 4R9NA 4GPEA 3LUJA 1U2PA 1Z62A 5C8YF 4JJAA 4MI1A 3VR4H 1DCMA 5FIUA 1DG1G 2JVJA 1ZLYA 1A04A 3N7TA 3HDQA 3V2HA 2KQUA 1P5HA 3MLAA 4IJMA 5FTWA 3VU8A 2IV3A 3K31A 4O4JB 5TB5A 1CIPA 1UDCA 2QN7A 4IL5A 5AXDA 2XF8A 2XUAA 4MB0A 1DJMA 3D8BA 1EX9A 3EWIA 2BKVA 1DAGA 2OC4A 5D5HA 3GMSA 4OIMA 5FA6A 2OSVA 2WVGA 2WPDA 3OIDA 4OV6B 2W83A 1QH8A 1Y6QA 3CEHA 3NEYA 5AVZA 3WV4A 3MMXA 3GFTA 1LX6A 1WW8A 4H9KA 2Z2XA 3WZMA 1J8QA 2C2YA 4YFYA 1B7GO 2JJYA 2WV7A 1V4BA 5HOQA 1IG0A 4G41A 3DEKA 5HK8A 5DYNA 3PICA 3P9RA 3UFBA 4Z7NB 1V5WA 2ACKA 2O1EA 1GYRA 4AM8A 1E5VA 4LJ9A 4Y2VA 1FSPA 3C3YA 3DEJA 3HACA 1M66A 3EMVA 2OBNA 2HWYA 1C0IA 1FNMA 4E6EA 3KB8A 4ESOA 3FX2A 4PM4A 1HL3A 5EXTA 5EZ6B 1WXHA 2OP0A 4HRAA 3S7ZA 4ALKA 5L4SA 4BRWA 4H35A 2DFKB 2R68A 1PG0A 2C5BA 4JA0A 5EN4A 2WW8A 1PJ8A 4QXPA 4UHCA 2GCGA 5G53C 3UWDA 2Q2OA 2JVIA 5DLPA 1AN9A 1E2PA 1QZ3A 2P1DA 3DPSA 3FFTA 1MVOA 1PFQA 3VOBA 2Q5JA 5HVNA 2X40A 5E4TA 2XBMA 4UQPA 2AGVA 1U9JA 1PD1A 5AVTA 1EFAA 3CVYA 2CXPA 4CXMA 1PR2A 1P4HA 4I5DA 5J40A 3PBKA 4OU5A 4Q16A 5J5AA 4HH3C 3OZGA 3PE4A 4PZEA 1VCHA 3HLKA 3MRVA 4Z4IA 2DUWA 3C6MA 1ACJA 3C0KA 3GJ6A 1EFPB 4KVGA 4YACA 1XZFA 3WADA 3EK2A 4ZV7A 3AUTA 3IX7A 2IV7A 3ZFUA 3EXFA 3MT7A 1PQPA 1TB4A 4HDQB 3A3KA 1KYWA 4RCZA 4RPCA 4Y30A 1YAJA 4EG5A 3AVXA 1SVUA 3D4NA 3I0ZA 1EVZA 4PGGA 1RMQA 5KTRA 3PDUA 4QASA 3ZJYA 3D7LA 4HAXA 3FN4A 1OWMA 1Z88A 2EFDB 3ZDRA 5DEOA 2X2OA 2M6SA 4EKDA 4MW6A 4TN5A 3KUXA 1HTWA 3DONA 3OPYI 4RGBA 5KX5A 1HURA 4AJIA 4NY1A 1K2VN 1ISGA 2VT2A 4PO1A 1OZ0A 2AFHE 3JYHA 4XOIA 4KWCA 5D6NA 3SMQA 4R71A 2Q3HA 2ZG6A 2HT1A 1Y3CE 4B17A 1FVOA 2C97A 3I92A 3P4XA 1S8OA 1HL7A 4IS3A 3OQNA 3FCAA 2PFGA 1X15A 3E3OA 2ILVA 2X6QA 3HN2A 3PRHA 3ZXSA 4V1CA 3LQRA 2XOEA 2QAGC 3KPWA 4JCCA 4IAOA 3VV2A 2F1KA 1P0QA 2OZKA 4Q3AA 3RUPA 2AJDA 3PC4A 4KXUA 5IKPA 5EKTA 5ADHA 4QYMA 2IT1A 3P94A 1G1AA 4FS8A 3DVRX 1M2JA 4IJVA 1Q0ZA 3DAHA 5DBOA 5DWQA 5E38A 5I9IA 1KI3A 1M74A 3H1PA 4EI8A 1CYEA 2O2IA 5LUBA 4EG7A 3SSAA 2B4AA 1DC6A 4CZ2A 3GQBB 3IAAA 2BGKA 3PQCA 1X80B 2HLPA 5LWHA 2WTUA 1JE0A 1JDBB 1FNCA 2PBZA 3I58A 2UYYA 4KAJA 3KETA 2JKZA 4WZAE 1NKVA 2JL1A 2WLTA 3EXEB 3BGOS 3GCDA 2PXXA 3H4VA 3K9LA 4DIDA 3H0CA 5DSTA 3ESYA 2MYPA 2BFOA 1BVUA 1NL3A 1Z0FA 3EGVA 3PZRA 1B16A 1V0JA 3GBPA 4FGJA 4HQRA 3ZUGA 1MEEA 3BXOA 3K15A 4FNOA 3DFZA 1P9NA 5ALRA 3SQOA 2OGTA 3L46A 2AN5A 1T4GA 5BUSA 1GEEA 3PXEA 4L95C 2AT1A 2PGNA 3GFFA 3IAS1 2YS6A 1DJLA 1R0YA 3OOSA 3P2EA 4HPJB 4DJDC 3LW8A 2EFCB 2HF7A 3MCWA 3L18A 4NMLA 4I1SA 4ZYWA 7REQA 1MAHA 5L9AA 5IKXA 3U1TA 4D2IA 5G40A 4LVUA 2F3RA 1IM2A 1IU9A 2PFKA 2X7HA 2QXTA 1KIAA 4FTWA 4ZDWA 1G21E 4BGVA 1VJ0A 2Q2QA 1E62A 3FWKA 4U7JA 1FRQA 1SBHA 1YKSA 1NXTA 2E85A 2DHDA 2JKYA 2C2WA 2QN1A 1HDGO 2VFAA 1XQ9A 4X20B 2PBFA 1Q0PA 3AQIA 3WRVA 2ZRFA 1Z74A 3G82C 1RADA 3F6YA 1OPXA 2AI1A 2DFNA 2WUGA 2AD1A 3N0RA 5LC1A 4CKCA 3W90A 2B0CA 2IOYA 2ZUUA 5IN5A 4UTPA 3LCCA 3Q2KA 1MRSA 4ER3A 3E0QA 1XWFA 4QGHA 4RSRA 4K05A 3LPNA 4DSNA 1UODA 3WXBA 3TQOA 1KI9A 3HTXA 1FVHA 5DIFA 3A70A 4P93A 1SEPA 2IE0A 1QVWA 3DBLB 2GBFA 4L74A 4XFKA 3A3PA 5ALPA 2TS1A 4G2TA 5G0TA 4EB3A 5LKAA 1AQUA 3DH0A 1XYVA 5DK4A 2I8CA 1LBQA 3E18A 4Q9LA 4DUPA 1JB1A 4J9VA 4EPRA 5C5DA 4YQZA 4FR2A 3J7TA 3ZDXB 2I33A 3UKDA 1FJXA 4BYGA 5SZKB 4NENB 1YVUA 4HAIA 1TC2A 2SBTA 2VYCA 3FJOA 3OU2A 5DLEA 2HBZA 4INPA 2WR8A 2CSXA 4RNCA 1NJ5A 1ZMTA 3H65A 1U2DA 3PX3A 3R6TA 4R1TA 3GD5A 4PRKA 4WCDA 1SBNE 1QV6A 1R0CA 4WQMA 3OSZA 1QAOA 3R9XB 4OF4A 1QONA 1YU9A 2C2GA 3R8CA 1H6BA 2QA5A 4ZCMA 2F1IA 3D8UA 1D1SA 4YMUA 2HW8A 3OM0A 1SURA 3KEGA 3VNSA 1FFGA 1NRIA 1CY7A 3E9MA 4CMHA 1XRNA 4L0MA 3WJAA 3H19A 1Y8RA 3ZU6A 4HRYA 3KR1A 5FLKA 1WVIA 3CISA 4YQYA 1OH7A 3TTVA 2VOEA 2XW6A 4FX2A 1C8BA 4KOEC 5KAPA 1NIJA 3I04A 2HLDA 4OMFG 3ROMA 4C7VA 5JXIA 1OBFO 3V7NA 1WZCA 3B6JA 4EG0A 5C1OA 5A4AA 1NKSA 1YFJA 4G37A 4FZRA 3TFQA 2EX4A 1IEWA 1P1BA 4OQEA 5ECYA 2H29A 3K0CC 4CIAA 3HEMA 3V6MA 4MKGA 2OZVA 4U2CA 4R5MA 4DDTA 2QJWA 2FPRA 4XX0B 8AT1A 2CDBA 4NP6A 1QLWA 1E92A 1UOEA 2ERXA 2F43A 3LY9A 4MCAA 4Y2PA 4IXNA 2WF5A 3PNYA 1UQTA 2R1UA 4QUHA 4TSFD 4X94A 1EGQA 2D3TA 4BX3A 4DQKA 1CQZA 2DR2A 2HXSA 2WAXA 4ZTUB 1KJQA 1C8KA 1OOEA 3S1AA 4LBYA 3K16A 4G0NA 2ENWA 2JB9A 3RS8A 3IAEA 4JLNA 4AUMA 4FHEA 4WDQA 1WCIA 2VDNB 1P2BA 2IPXA 1UT5A 3O84A 4QTUB 3DEFA 4XARA 3S2FA 3U4AA 1CQJA 4QGBA 1TFUA 2B94A 5FYDA 2IIQA 3AR3A 2X2PA 4GZ6A 4QG3A 4AJJA 2Y1EA 5MN6A 1P45A 4NV3A 5F5LA 5AW0A 2BHTA 4Z53A 4E0BA 4K87A 1U2RA 2HLNA 1WHTA 2ZWOA 3R44A 5LFAA 4DV4B 1A9SA 1ODSA 1E77A 1Q1GA 3DAGA 2QZZA 3PCRB 4H17A 3ICCA 4DWOA 1I7SB 2ZRKA 1DAOA 4NOKA 4DM3A 1EP2B 1JI0A 1GVNB 3CF4G 3J80A 4M98A 4BDTA 2AI3A 4CMAA 1QVAA 2KJQA 2B2XA 2VP5A 3DZIA 3HBMA 3K8OE 5K0BA 1OH5A 1E2NA 5BPFA 3BMXA 4Q5IA 3X1ZA 3BTOA 2VKQA 3KQLA 4U7HA 2EJBA 1FDRA 4PVCA 2KPOA 5MN5A 3WA6A 4L02A 1ZK1A 4JQYA 4YRKA 4JI8B 3FLAA 2JLZA 3CZPA 4I3HA 3EPJA 1WLYA 4HDOB 4YGXB 4PG4A 2WJYA 3FCEA 3AR7A 4WCFB 3UQZA 1P75A 3ONDA 5GONF 4HXGA 2PUGA 1JU9A 2P9QA 1E3TA 2VXCA 3PF8A 1EHIA 3DV0A 4HWGA 5SZHB 3W2FA 5ALNA 6PFKA 1WXFA 2EYQA 3ZHUA 4CMKA 2B1IA 4ZZIA 2GTPA 4PZPA 2NU9A 4E12A 5CEEA 4HHEA 1D9XA 2QAJA 2W6PA 3NC4A 1ZD3A 4K9PA 1EE2A 1IAQA 3ACCA 1G41A 2WSIA 3DDZX 1GNSA 2PYZA 3FWNA 3L1UA 3U7QB 2PAFA 3UXMA 1U9YA 1X1TA 3VH2A 4XYLA 1IAVA 1KEVA 3ZV3A 1YJXA 4FXOA 4QNMA 1VJDA 1IATA 4EYKA 4YX9A 2FSHA 3LRPA 4FS3A 2GCOA 2OXIA 2XMCA 4ARBA 5L8VA 4AKIA 2HY7A 2CYBA 1L3IA 2AF3C 3AEXA 1G3RA 1D3AA 2DGDA 4Q6BA 2YBDA 1SC6A 3R3UA 3AVOA 4JJIA 4ZCTA 2VHUA 4HQNA 4FDAA 3TW0A 4A8HA 3RWMB 1C1HA 3ADKA 3N2GB 2BFEB 2D5BA 4BMDA 5BOSA 1WSWA 3I37X 4RSMA 4G85A 3IQGX 5A62A 4F7WA 4LUCA 3C8HA 1XDZA 4XJVA 1GGMA 1T35A 2OKCA 4F04A 1ZZEA 1J7KA 1RAGA 3F9IA 4F6RB 4MKIA 2JK1A 2ZQYA 4NONA 3S8EA 2FP3A 4AY6A 2ZJZA 4L1KA 4DG9A 3EQ8A 2PUFA 4A8JA 2BFCB 5EGNA 1WNTA 3WO1A 3LKBA 4F3YA 4HB2A 3O4IA 4EG1A 4RAOA 1Z4OA 2YFQA 4KRXA 1DQPA 3HB7A 5BR1A 2FSPA 4ASUA 2AYXA 2R48A 3PYXA 5ARBA 3WQQA 4AY5A 2WYOA 5LP1A 5DMHA 1XZMA 1GPBA 2NZYA 4JLOA 5H02A 4PLYA 1F4LA 1YRWA 4W4TA 4PYLA 1UUFA 2FLWA 3HKBB 1C3OA 2WWRA 3Q6MA 3ROPA 3GDHA 1OTYA 2FEOA 5TXGA 1XMOB 4WOCA 4NX2A 2FFQA 4U6QA 1FP1D 3ASYA 3BD8A 1GSIA 4QGSA 4PXAA 2NZVG 1X0XA 3GFOA 3A2KA 1D4ZA 2X9LA 1HNWB 1CDZA 3X3HA 2PSJA 4CV0A 1OXTA 2AVNA 3KOOA 4MROA 1DUVG 3TX6A 5I9NA 2HCRA 5BW6B 1X1AA 2NXCA 4EUKA 4C7BA 1ADBA 4ER7A 2P7IA 4X24A 3I12A 1LPAB 5M34A 2FJUA 1P3JA 4X7RA 1K98A 4L4ZA 3T3EA 1J0CA 4NDAA 1Q0TA 1L4HA 2WILA 4BBJA 4CM3A 1XU9A 2ZJ5A 1S02A 2Z9DA 1QCCA 4JJ6A 4U8GA 1IEQA 1KVRA 5BP7A 1AKNA 1YV9A 1ZI6A 2PNFA 4G1UC 4RM2A 4Y9SA 2NU8A 4L4UA 5IULC 3ZDBA 4QUDA 4L78A 3VXKA 4ZOLF 3FUTA 4NCJA 3TCKA 3ZZTA 1N5OX 1AV6A 1PG5A 1KYVA 4RPLA 4CDNA 3ZHSA 1CF4A 1YR3A 1E6UA 1LRJA 4HH4A 4KGZA 5JQGA 1ZCZA 3BHMA 5EVJA 2C61A 4Z4FA 1JALA 5AJHA 1NJ8A 1BC5A 4FN4A 4EG4A 4JLPA 5BNFA 2ZRNA 4C7MA 1P2UA 1ND5A 3GOHA 1E2EA 2X19A 3LBNA 4D02A 4QATA 2H2FA 5L7TA 4QM6A 5IM5A 1QR6A 4ZOCA 4AP5A 2FN4A 2OV3A 3OQJA 4D43A 2W6NA 5H3CA 4YMLA 1OREA 5EC8A 1GNVA 2D00A 4V3CA 2RHBA 2ZVPX 4XGIA 1VSVA 5DGDA 2GLXA 1ZNYA 2VDWA 4TSKA 1I3KA 4LF4B 1GQYA 1E69A 2QI9F 1DTWB 2I3AA 2Z8XA 4NEHB 1VPEA 4D57A 5L4NA 3FNBA 1T5LA 2D0IA 2RH8A 2E0IA 3AIOA 5LBUA 3FSJX 3TFOA 3WMEA 4IDEA 4KO8A 3T7RA 2F1OA 3R5HA 3SIPA 1JILA 2OHFA 2P2YA 1XC7A 3VR4A 3MWLA 3BMCA 2DLCX 2AF4C 1NOIA 1ZR4A 2XGOA 4XIGS 1NJFA 5BN3A 3I61A 4GICA 4GQAA 2NV6A 2J5XA 1RW4A 1JLMA 2R8PA 1Z5GA 5DGHA 2GD1O 1SU4A 1M1NA 3LHIA 4H1TA 2HWWA 4C78A 4PNEA 2HRRA 2E18A 1COZA 1XHLA 2X8JA 3L8YA 3NANA 4UNNA 4YQEA 2PYDA 4B7XA 4BBAA 5DM60 3Q7RA 4LBVA 2M6KA 2WQ7A 4KQXA 4KQIA 4WXMA 2A1TS 2JAQA 2G77B 1Z45A 1ZINA 1U8YA 3H2JA 3RF6A 2H9YA 1R16A 4HWTA 4D8TA 5A9SB 3STXA 1QRTA 3MFDA 2GERA 3SR3A 3UJ6A 4GM4A 1EQ2A 4P53A 3P0IA 1XTZA 2HSDA 5FWXB 4HN4B 4E4YA 4ZZ3A 2P6RA 4II7A 4RIGA 1M6VB 3EQZA 3O5AA 5AKLA 3C14C 1IQUA 1R8XA 5FOTA 4LXGA 5KUTA 1TT5B 2H7YA 1H0RA 3KLBA 2FEKA 1FSSA 4JU8A 3L8CA 5AW1A 4HUTA 2O8FB 4AJKA 5EJAA 1MABB 1P81A 2Q50A 4PX3A 4TTRA 1XDDA 3CVOA 4OATA 3ZY5A 4KWIA 3LVBA 4Q3DA 1G66A 1PDOA 1SCQA 2ZJ2A 3QXJA 4OYHA 4TX1A 4DBLE 2PAAA 3PWTA 4KVFA 4WA8A 4ETWA 4S04A 3N5CA 2W6ID 4V3BA 2I4OA 1MC4A 1Z2NX 1E3WA 2NSJA 4RESA 1TUBA 3K5HA 3R5XA 3T1QA 3R7NA 4V03A 9MHTA 4ZJUA 3GLVA 3C15C 2IJGX 2O6LA 4IGKA 3QPBA 1M75A 4X41A 5G4KA 4RJTA 5FA8A 1G7RA 2FCRA 4XIFA 1M2HA 3KZOA 4J3NA 3SC2B 3OEED 4CKEA 1CQPA 4RIHA 3KLOA 3CF4A 3TKYA 3WL5A 2PQ2A 4G86A 4DW8A 4YPOA 1U7TA 4HYYA 5TX7A 1JFRA 4H3HB 1NDQA 3CT4A 2IH2A 4EHFA 2PSHA 5AHRA 3W1VA 1WX1A 4HKTA 4O25A 4L7QA 1OUMA 3SDZA 2JA2A 2P69A 4GR5A 5AKXA 2GBCA 1S2NA 4F2DA 4EYSA 3TAUA 4FFDA 1NT4A 1O95C 1GL7A 3OETA 3GNSA 4MB2A 4HGNA 1QR2A 3CU5A 4OHZA 2G5PA 4ZT4A 3EBOA 4YUYA 3KJFA 2AMFA 1S7CA 1U0GA 1DTSA 2ECPA 2JLQA 3E3MA 2JGNA 4UOQA 4DCGA 1FQJA 1W19A 1V1JA 5GQSA 4TTSA 3ZXIA 5EZYA 5F77A 1EWKA 2BC9A 3EEBA 3NHRA 1DQNA 3QMWA 3LUPA 4JXJA 5FBQB 5MGBA 4D0LB 1RYBA 3TIVA 1NQXA 1AS0A 1R18A 2RHRA 4OB6A 4UUQA 4UAJA 1TF5A 1UKZA 2FDXA 2FPIB 3HXTA 1DXQA 1MFPA 5IVDA 5CA0A 4YAUA 1CNFA 4JT2A 5IS2A 1QP7A 5CAEA 1X9GA 2QD3A 1YMQA 4CWAA 3UMRA 3QUSA 4PX9A 4TOIA 4AO7A 3AR8A 3LIPA 3MJEA 3NT2A 3D6NB 3EEIA 3D4OA 4O2AA 3GN1A 1KY3A 3QVLA 1IC6A 3GRZA 2H18A 3RFCA 4DDHA 3AI2A 1MX5A 4KHPB 3T0FA 3PIRA 3UH0A 2D2XA 2A33A 3E58A 3DCIA 1PTKA 3AKCA 3I72A 2P6OA 4KIJA 4B3XA 1ID8A 1ZD8A 1PWEA 5GVSA 3NVMB 4M9CA 3TZ6A 5HQ3B 2I1WA 3P97A 1UJBA 3N58A 4NARA 5ENVA 2EWVA 1E1LA 3EFOA 1NMSA 4JBWA 2ZBEA 1DP4A 1X6VA 2F3QA 1PD0A 4GR9A 1QE0A 2H0QA 2NUPB 3EZ7A 3ETGA 3ND9A 3NNDA 4WK2B 3GLFA 5FTLA 4LRUA 2P8JA 2I9KA 3ADDA 4BUCA 4XLTA 1P39A 2HGSA 2JFZA 3UAVA 4BE4A 5CB6A 3AKEA 1CF2O 5F4ZA 4MVJD 2R6ZA 3LNTA 3ZDAA 1KO4A 2QLJA 3IE2A 4YWHA 3GN2A 3ZBQA 1Z12A 3RVKA 1L5SA 3BTVA 1LBEA 3F78A 2RHMA 4R2KA 2W2XA 3G89A 1DAKA 3DO6A 5GONB 2GEKA 3R6WA 1VPTA 4X6YA 3BWVA 3ZE8A 2R60A 4PSCA 5J43A 4Q3LA 4NU8X 4Z2AA 4CQMA 1XCJA 4JS0A 4ZEXA 1Y3FE 2L42A 4QU9A 3WMXA 1AMNA 1J8MF 1W30A 2EKLA 3QIAA 4IIYA 4MCHA 2SCUA 2EG9A 3DBHA 5JXHA 4JV5B 1TCVA 1A5BB 1UOPA 3MD9A 1BCRA 4QSHA 3TSAA 3ZY6A 4BFUA 5EJ4A 4ZYXA 4Q4AB 3H9CA 3IBYA 3URMA 2RHCA 1B73A 3KT0A 3NDJA 2VUHB 3ADOA 3UWMA 2B21A 3GRPA 3NHJA 5J2UA 1UBHS 5BWNA 3E7DA 2E4ZA 3RTGA 1G5QA 2UUOA 2W2OA 4EJMA 5BR4A 1II8A 1T9DA 3T7KA 5AUPB 3NH6A 2C2BA 2Y2UA 4DARA 1H4VB 2I65A 1SO8A 4D3FA 1ST2A 4ETIA 1HH4A 5DE3A 4YMTA 3WIDA 1VG0B 4JEHA 3HYCA 2RGWA 1K4KA 4AYTA 4O1MA 1RM4A 4E5NA 3AB7A 3IMFA 4EW2A 3SVLA 4IV8A 1KI1A 3WOVA 4RX1A 2XWSA 2BCGY 3W2HA 3VYVA 3M89A 4P3OA 4DEVA 2DWCA 2XVAA 1VJ5A 5AI0A 3TIXB 2VQEB 2DLNA 4ND8A 3DL7A 3SYTA 3V33A 1G98A 1N2EA 4LJ8A 1VB3A 2DQKA 3SQDA 2ODAA 4IUDS 2J4FA 3U4GA 2P2LA 4PR0A 4EEXA 1R1DA 3NHPA 3QVOA 3DDWA 3OZCA 3RU2A 3T1TA 1BRMA 1CWUA 2CHQA 2E4XA 2QBYA 2VK4A 1QH0A 4MDHA 1BHSA 2NYRA 2O14A 5AJZA 3DKKA 4XFDA 3FVTA 2QZ4A 1NVWQ 3K20A 5GZ3A 3CZQA 4E4RA 1CJUC 1TYZA 6YASA 8OHMA 1J21A 3D3NA 3THWA 1EA7A 2CXOA 4NFHA 4MIKA 3CNQS 4Q4CA 4BLOA 1J09A 5B1SA 2DPGA 1AGNA 4B7CA 4F11A 4R0MA 4W7HA 4DG5A 2V59A 4LGCA 4AZTA 5FXMA 4E13A 4EKNB 4UM9B 3HJGA 3ZK7A 3RSGA 3T1VA 5C8XA 3I4CA 3C16C 4MVWA 2Z9CA 4DPKA 3M6LA 4TTPA 3MT0A 1E7YA 3GF4A 4YI5A 4HD8A 3OMWA 3NT4A 3GJ7A 4ZOQI 2V7XA 1GTMA 2P77A 1N1MA 3BSYA 3ZHZA 1EDEA 5G0VA 5BSGA 3K6RA 1I6MA 2Q3JA 1EEXB 4CCAA 2Q07A 5CNKA 1N8KA 3BQMB 5KQLA 2C42A 3KXDA 3CH7A 1T24A 5DH9A 3WSTA 1M2EA 1S6YA 3HXLA 4ESEA 4V0OA 2FRVA 1N9ZA 1XQWA 1WUTA 3BZBA 3TZQA 4JZKA 3WJ7A 4FIZA 3H16A 2GILA 1O08A 4MEAA 2FHPA 1YGYA 4ZOLB 3TUIC 2LDXA 2WYHA 3RASA 5E6RA 2J9YB 2KLBA 4WXPA 1T5BA 4JI6B 5CM8B 3X44A 2NNLD 3QLEA 4B80A 1H6AA 3M33A 2XA1A 3ZY4A 5LQJA 1KBQA 1GNRA 2KSQA 2VHYA 1FFAA 2GFHA 4JBLA 1ZL2A 4R1NA 3TZHA 3IHKA 3U40A 2GYYA 3RQSA 2WP0A 1RM3A 3K96A 3UMFA 3DO5A 3ZS9A 3OEHD 2PKEA 4LSZA 4MS4B 4X90A 4YRJA 2JJ2A 1UC8A 2GN4A 3WLSA 4EHAA 1SQGA 1V7PC 1IBKB 2H0RA 1CPYA 1H8EA 2EERA 3GK3A 5BN5A 1XTPA 3JALA 2C4VA 1Z34A 1KOJA 2XSZA 1II9A 5DHTA 3HCWA 4YAJA 3CLTD 1OROA 1RIIA 1SUWA 5AKEA 4EO9A 2IXFA 4DTIA 2GZ3A 1N6NA 4J2TA 2QEQA 2ZGVA 3ZYCA 2P2GA 1RJGA 1RACA 4J94A 4LZOA 3W77A 3ZQ4A 5M29A 5EJGA 1TAUA 2ZQZA 1K0UA 2R96A 1G7TA 3E61A 4WEOA 3B7PA 1DV2A 2IYPA 2ORWA 1F8FA 4XWKA 1H1TA 2X0NA 1TVMA 2QM3A 3SLRA 3OQMA 4Z3OA 2YH2A 4K6CA 1BD3A 1E7RA 1AQLA 1BN6A 1G6HA 1JXAA 1N0HA 1QO9A 1Z13A 1UPBA 3D4BA 3DTVB 4P36A 1KC1A 4OFZA 1GL3A 4RHXA 1R9MA 3PGMA 4KXWA 2CN1A 1OZGA 2OV8A 2QDKA 1PLJA 1WXEA 2QG9A 2R3SA 2VZEA 4I1IA 3UF0A 1AMUA 2JFOA 5CX1B 2VEOA 3ACDA 4LZNA 1NA5A 4Q1AA 3CRW1 1R8JA 2CLHB 1SQ5A 4WKBA 1BA3A 4DIMA 4RK7A 1WVMA 1XZHA 2UUCB 2IIVA 4M0MA 1F5NA 4QDTA 4B8ZA 4B3IA 1TJ5A 4DSOA 3KSZO 3HJAA 3TG2A 4I1PA 5KNLA 4DDWA 2PL1A 2C8LA 2REOA 3QLVA 4GGPA 4JP1A 1YULA 5DIZA 2P9BA 2IXAA 5FBHA 2O2JA 1KKUA 3ADBA 4D4IA 3JRWA 1I10A 1DOAA 3LPCA 3TLGB 4DRXA 1HM5A 4E5DA 1J0EA 1P6UA 4H0CA 4LC9A 4KLNA 2NO5A 2AUMA 4KYTA 5GV8A 1ORVA 1D6MA 4Z4HA 1N2CB 3KB2A 1PT7A 2QGNA 3K0KA 3O38A 1XKTA 4IDHA 3PGLA 3AY0A 3UANA 3ZWBA 3SXUB 3PDIB 5KU1A 5LQRA 4HLUC 1DBIA 1MKYA 2VAXA 3K1ZA 2JIBA 2AA3A 2V1XA 3PF9A 4HEHA 5GGYA 4ZCIA 1M33A 4M9RA 4MQMA 4DZTA 1P0CA 1SOWA 1YWGO 1SOMA 2D74A 2XGSA 4MVJP 1Q1NA 4P3NA 4WKOA 1AUOA 3TL2A 4HUJA 3L1IA 1QGUA 3KLMX 4U8HA 5LLDA 1SH7A 3ZK9A 3W2IA 3WTCA 1WDKA 2J4CA 3MTBA 2RC5A 3PC2A 4OBEA 2P2DA 4QVGA 4ZVKA 3X1DA 1E79A 2FSSA 4HDKA 4YMGA 1BWQA 3KIPA 3KU1A 3IODA 1M72A 2G7MC 1M1UA 5G0WA 4BQPA 5IAAA 5D2CA 4REQA 1CUHA 1B76A 1T6XA 1R6DA 1CEXA 1V71A 2N47A 2UVPA 3HCEA 3MWFA 4Z3DA 2WSSA 3K0EA 1MJ5A 2OCLA 421PA 4DSZA 1YIOA 2A3RA 2CL5A 3OBBA 2B8EA 1PS0A 3O95A 4LYAA 1TEXA 3CW8X 4OI4A 4UW9A 1U0OC 1Y81A 1LGYA 3BHIA 4EMTA 5EEGA 4G6ZA 2MTBA 4XDZA 2VNJA 3ACBA 1DOHA 3H5RA 2GAJA 1QLHA 3HYTA 5DM1A 4B76A 4BECA 5BV7A 3KUUA 5JSZA 3C3PA 3CWCA 1KE2A 2Y1GA 1A9XA 3MINA 2RIPA 1OLXB 2XZDA 4BLTA 1SBYA 4XQ0A 4WZBB 2BGWA 4OI2A 1QP4A 2PG3A 4IG9A 3VZDA 4UM5A 4UXHA 2V0GA 1YK0A 3A26A 4FE4A 4NQRA 1E0DA 3G17A 1GGJA 2NT4A 2GRAA 3I1JA 4PICA 4Q6WA 2ZRHA 5JD6A 1E2DA 3KWJA 5GOZA 1S2LA 4JQCA 4CM8B 1VGVA 1QYWA 3CCCA 1SY7A 3OZVA 1V7ZA 1VKJA 3L02A 2YHSA 5IZCA 3Q9LA 4RCYA 4BZPA 1JW9B 5EEHA 2N75A 4NBRA 5L40A 3HS3A 3RFTA 1MJGM 2ZJ3A 5FI3A 4AQDA 2W8BA 3SF8A 2WWHA 3HXQA 1JIVA 4TXHA 2YWBA 4PRZA 4US1R 3G5UA 3FFAA 1PE0A 3DKRA 1M0TA 5G0SA 1G9XA 1JJAA 1N0IA 4O4JA 1IBCA 3I6MA 4LZAA 5CXSA 3VNQA 4I36A 4IUBS 1DDOA 2EXXA 2H4HA 4UE6A 1L4GA 4MQUA 1OLUB 4OMCA 2OAQ1 1LX7A 3E9QA 3L8FA 2QVLA 4ABTA 4KQFA 1RAAA 1VJCA 2V6JA 3ND8A 2PQ6A 3G59A 1BCSB 2P35A 4Q01A 4R98A 4U1RA 5DBGA 1G8MA 4AIIA 2I62A 2RHWA 2VI5A 1JBQA 2Z5LA 1GPDG 3GA5A 3LHKA 1XIVA 4OJQA 1ZISA 1M83A 1QKKA 1N3LA 1ZA1A 4ALLA 5AVRA 1XUOA 2C77A 3MAAC 4LZLA 4LSGA 3KFLA 4ZOEA 2P40A 3AESB 1X2EA 4C3ZA 3QUQA 2DBZA 5KNCH 3QPAA 4JBNA 1S1CA 4FKMA 3C6ZA 3QSYA 2JHGA 4MR9B 5B2FA 3VR6A 5HIKA 4X65B 4D45A 1YHZA 1M8GA 1G5IA 3BGIA 3BXEA 3GLHB 2A5FA 4PSKA 4WECA 1I4TD 3SR4A 2WTEA 2W2MA 3JR3A 4TV9F 3DMDA 1JHZA 1NBOA 1KC3A 4WXEA 1UWKA 1RXSA 4GUDA 3NZEA 4N18A 2EG5A 1G1MA 2EIXA 3FYCA 1Z7YA 2HO5A 1FCJA 3QLUA 2HTFA 5HTKA 4EIWA 4P4NA 2ZWAA 3G88A 2P2CA 1IOVA 3X1KA 5A4JA 1JWAB 4KO3S 1SC3A 1WMDA 1E8MA 4JP5A 5EXPA 1KFBB 4IIBA 2J7PA 2PPLA 3VHRA 1Z75A 2XYVA 2PQ0A 1XJCA 1NW7A 2I2WA 3GNQA 4IMIB 2C4UA 4J49A 4RQUA 1OJ7A 1R10A 2H4WA 3OF3A 5DNYB 1EFPA 4IDDA 1NULA 2YINC 4MCJA 5ARDA 4KB5A 4F2PA 2ORIA 1JFSA 4UNSA 3R7BA 3QPWA 1U0RA 2VUUA 4I6GA 3KWLA 4BCCA 1QH9A 5JALA 5LLSA 4CLRB 5IVPA 4BIIA 3C43A 1PKEA 3VJRA 5YASA 1N78A 4GBGA 4K9NA 3LT5A 1BTOA 4DM7A 1LSSA 1NQAO 1DEAA 3G2PA 4BUJA 2EGUA 3W5DA 3KVVA 3C6YA 4F4HA 1I2BA 4GRDA 5BT8A 1TVCA 2OCGA 3RRMA 5KOJB 2RB4A 1S3SA 4K6GA 5LQMA 5IT9A 2EF1A 3G2LA 3KL4A 4D97A 1P77A 1HEYA 1K7YA 4JLDA 4FUTA 1V4VA 4JB0A 4MJXA 1ZEMA 4XQEA 4L5AA 3TKAA 2J0QA 1QRSA 3OUZA 1TZKA 1DIAA 1BX0A 3GROA 1PL8A 3TPZA 2DOKA 4F93B 3NO4A 1UXJA 4H7IA 1G42A 4GPBA 3KO8A 3MJFA 4HEA1 2GK7A 2P9JA 3MCZA 4GECA 1USVA 4BMNA 4WLNA 2XNDA 2PV7A 3OPQA 1P9LA 4IQ0A 4M60A 3P2OA 3ST7A 3FTFA 2MU1A 4NYIQ 4M4SA 4P3KA 4HF7A 3OF5A 2ZRCA 4LRYA 3WYNA 2Z83A 4XSGA 2WF8A 4FFSA 2YYSA 1ECJA 4RPHA 3SJZA 3OESA 4FHDA 4P7BA 4LZJA 2I3ZA 1Q6ZA 1SBTA 2JI9A 2VHJA 3GQBA 4LE1A 1KOLA 3VO9A 1X80A 4KR9A 4D6YA 2R8RA 3EAQA 1HNZB 4WGFA 4C76A 2W4MA 4MI3A 3ZDDA 4L4XA 3ZWAA 4BXOB 4AN1A 1HK7A 4BEVA 3IFSA 4EZBA 4LTNA 5JBIA 2F55A 5JS8A 1VLHA 3EXEA 3Q7QA 4DR5B 4JQOA 4A0QA 2WTXA 1QWOA 2VKTA 3DOHA 5LOVF 2G6BA 3NIFB 3R1IA 4RENA 3RLFA 1IHUA 2ZTLA 1SQ6A 2ZIUB 1O0BA 5B2ZA 3JWGA 2QMQA 2P9CA 3B5EA 3T9CA 5K0LA 2L17A 3D5QA 2Z5VA 1E8DA 2ZKLA 3ORFA 2Q0SA 4R84A 2WJZB 4HL6A 4Z0NA 3WGZA 2O07A 4B4VA 2YBEA 2P4SA 1BDIA 3T12A 1J1UA 3QE2A 1V5GA 2G80A 3EW9A 1W4CA 4MWDA 3VOSA 3VC1A 3FTPA 4GXNA 3TOVA 2FN3A 5U4QA 2Z5GA 3NBQA 3ZV6A 1UBFA 2Y0EA 5JHHB 4ZPXA 3FHOA 4X20A 2CHEA 3I0MA 1W2WB 4BQNA 5AJTA 1OBOA 4L85A 4BLQA 4WEQA 3CEPB 1XU7A 3DDHA 4PAMA 2J5BA 4Y6LA 3D8NA 3IQEA 2LNDA 4HQ6A 4K9MA 2F1HA 4QO7A 4TKMA 3CLHA 2NPFA 3S70A 1ZR2A 2WTAA 4KXLA 3EG9B 2QP4A 3MBOA 4KNVA 3IUSA 1VYHA 4LS3A 1Z36A 1LCIA 1Z6AA 3SKXA 1ONSA 1OXMA 3WB9A 5KYXB 3HI4A 3M6AA 3DBLA 1IE3A 4C6SA 4LOAA 1U63A 1WXIA 3EEOA 1M5RA 3TRIA 1PJBA 4KO4S 1NONA 2O0LA 3DXXA 2O50A 4JL5A 4W9RA 1SFRA 1LPPA 4J16A 5I7UA 1YMUA 4IDQA 5DF1A 5CA0F 2YMPA 4ON9A 1DQYA 4S35A 3TFWA 3WDMA 2ZZMA 1W7AA 4NENA 2WABA 1NYTA 4Q9HA 1WV0A 4DR6B 4E1AA 4GKVA 4BNXA 1M6EX 3Q3CA 3CX6A 3LK6A 2VZ8A 1FYDA 2HNKA 2W70A 1ZA2A 2HK9A 2Q1TA 4R8KA 4DYHA 5BQ3A 3BD9A 4E3ZA 1DAHA 3WGKA 4EI9A 2E9SA 1MPTA 4G0PA 5DBHX 4CTMA 4I46A 4X61A 4W99A 5C7LO 1QK3A 2I76A 2VCEA 2YWFA 3AVTA 3IUBA 3LRTA 3KV1A 3R9XA 1YIAA 4Q1FA 3SZUA 1H0SA 2VWGA 4GKKB 1NVUQ 2A0XA 3QEAZ 4RV9A 3QVXA 4K2HA 1ZRSA 3V7WA 3K7EA 2WMDA 3EN0A 1JG7A 3DVAB 4UVEA 3V8NA 1A9OA 3N75A 5EMMA 4WAUA 1SXJD 2QJTA 5L7YA 1V11B 1W59A 1QG4A 3AJEA 4LOLA 5KDLA 3G6KA 2CK3D 1VL5A 2HPHA 5JNTA 2XE4A 5CK4A 2XNSA 3A10A 2GJSA 2ZYRA 2ZDGA 4M0EA 2XUGA 1RJFA 3IB6A 3D4LA 4JHXA 1WF3A 2PHZA 1BEUB 4ZHSA 2ZAGA 1NI3A 4R1PA 4D96A 5ADUS 1JR3E 2BOVA 3HWX1 4BYMA 1TZCA 1JIKA 1MEOA 1SAYA 2C0QA 2GUWA 2O57A 1MH1A 2PUVA 4Y6SA 3JWIA 2UZ1B 6LDHA 2WQZA 4FOOA 2R47A 2Y8EA 3D8RA 3ESXA 2OHIA 3OD1A 6NULA 4XX0A 3LUKA 2D13A 5KWJA 2JIQA 3D43A 4MVJI 2J46A 2XB9A 3RVQA 3ZBPA 2XF2A 2LKCA 2R1ZA 1E59A 2Z57A 1XT6A 4IX1A 2C31A 4BQFA 2IEDA 1GTSA 3NUZA 2I1LA 2GF9A 2YN0A 3NONA 3OOEA 4KW7A 1J8VA 4JLBA 5B64A 5C3MA 2GNOA 3R5SA 5C46F 4R5HA 1P33A 2HDOA 2G08A 3MPUA 1I3LA 1Q83A 4RH0A 4QBIA 4ZU6X 2VT6A 1L7PA 3AUFA 3G2KA 3A6GA 4JSTA 2C4KA 2RKBA 4MA5A 3T3OA 3T34A 4KVZA 2DSTA 5EWLB 2R4TA 2QTAA 3FPBA 4M1YA 5I9BA 3IDOA 3UN1A 1AXRA 2DMRA 1JEDA 2ZW9A 3R20A 3EHEA 1HE4A 3U9LA 1F2DA 5ALKA 3LF2A 4K7JA 1EVJA 5T4HA 4RL4A 4I50F 4YRMA 1JP7A 2FHSA 2M2IA 2AXNA 3LLVA 1CJMA 3PQDA 4LHWA 3ZQ6A 5BQPA 3AOEC 3OT4A 4F98A 4OHRA 1IY1A 1M76A 3G79A 4GW3A 3IEXA 2QK4A 4B43A 1UDRA 1TYDE 1SKYE 1VLZA 3AJ8A 3C6XA 3N28A 1UBEA 5TEWA 1GWNA 3BMOB 3W8FA 2BRUC 4C4SA 3JQ6A 3HJCA 4HGOA 4LK3A 1U5AA 1K6XA 3GFRA 3IEKA 3CM0A 3WTBA 1W1IA 1HE8B 4ND3A 2GM3A 1CDDA 2B1GA 3LCVB 4H9GA 5M2QA 1WXXA 3EFHA 5A3QA 4ZVMA 1U3FA 2BONA 4X54A 4J7CA 1E9EA 1Q19A 2Y92A 4KE8A 2EARA 4E2WA 1Z6XA 1RWPA 4LVOA 4UHEA 4RZ2A 2HOQA 1ZJWA 4PHGA 4WCFA 1EVEA 3P4UA 3DT9A 3BHJA 1KPHA 2J08A 4ARSA 3J81k 1R15A 1QF7A 2QL7A 3W5JA 3WNBA 3FKSD 1U2QA 3GJ0A 3CRMA 3LMKA 2QL9A 4RY2A 1BVRA 1CRZA 1VPLA 3T0IA 3WL4A 5A1TA 2CV1A 3PRJA 1SOVA 3C3WA 5ERXA 3OFVA 1AO3A 4IQ4A