4YV7A

Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmei_3018, target efi-511327) with bound glycerol
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
GALKIGFSQATQQSPFYVALTDAAKAEAQAQGDELFYADANGDITKQNNDVQDLITRGINVLVINPVDPKGVTPSLAAAEAAGIKVVTVDRPVESGAASFVGRDNKAMGELVGKAAVDTLGPDGGKIIEIQGDAGGAVARDRRDGFQAAVSGRPNITIVEGPYCDYIRSKAVTAMQDLLQAHPDLKGVYAQNDDMALGAMQVLAENNRTDVKVFGVDGLMEAVRAIADGDQYVATALNDPDAEGRLAIQTAAKVARGESVPEFVDAGTGLVDKSNASALVGQSTFAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF AN ABC TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM MYCOBACTERIUM SMEGMATIS (MSMEI_3018, TARGET EFI-511327) WITH BOUND GLYCEROL
rcsb
source organism Mycobacterium smegmatis
molecule tags Solute-binding protein
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
total genus 107
structure length 288
sequence length 288
ec nomenclature ec 3.6.3.17: Monosaccharide-transporting ATPase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yv7A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yv7A02
3LMKA 5IUKC 4RK5A 4MS3B 1Z2DA 5TQ0A 3QK7A 2NZVG 1RXEA 4XFKA 3QEMB 3NNNA 5F64A 4RXTA 2PUAA 3LUGA 5ABPA 3LOPA 4QYMA 2V0NA 3BRSA 4F11A 4L4UA 3UK0A 2FVYA 1LBIA 1Z2EA 3HM9A 2A9RA 4OLBA 4W5NA 3T6KA 2QR3A 5DKFA 3SY8A 1D2AA 4ETIA 5KC9A 3C3WA 5TE9A 1D1PA 2JVIA 5EWMB 3Q9SA 4Q6BA 3HO1A 3HK2A 5IUNC 1RZRD 4EYKA 3JVDA 1JLKA 1RXIA 2IYNA 1DCMA 5TPZD 3LUFA 5TQJA 4W5TA 4G97A 3QELB 2MSLA 2WWVD 5JNWA 3KLOA 5GOTA 3HSYA 5CHYA 4RK4A 3C3MA 2X7XA 3KYIB 1JWLA 2WJAA 3EODA 2QW1A 4EYOA 4ETNA 3HJFA 3OQOA 2HQRA 1Z25A 3VNAA 5C5EA 2J48A 3RVKA 1I3CA 4MS3A 1YS7A 2MSKA 4MRMA 4N47A 2YHAA 4PE5B 4M88A 1NXPA 4MQEB 3IP6A 1RZRA 1EWVA 2FN8A 3QLTA 1P6QA 2IKSA 4HNQA 1KMIY 3MQ4A 2FSPA 3CFYA 2DRIA 3GRCA 4LE0A 2MYPA 3E61A 5BQ3A 1A04A 5KWSA 1E2BA 4MYRA 1OXKB 1W25A 4EUKA 3JPWA 1F51E 2FQYA 4HNRA 2GKGA 1D5WA 1GCGA 2QVCA 1NXVA 5EWMA 1H9CA 1M2FA 3IP9A 3BREA 3NHZA 3QELA 1KRWA 4IRXA 4IF4A 3JTEA 4OTZA 3P9YA 5E3JA 1PEAA 4QPJC 2CHEA 3ROFA 3ROTA 1CYEA 1SRRA 2RJNA 4KZKA 4MLCA 3Q7TA 4DN6A 1DBPA 1USKA 3GT7A 3O75A 4MGEA 4OATA 3F7NA 2JK1A 1Z15A 4MRMB 3RVJA 3N0XA 4WXEA 2Q5CA 1SXHA 2FXIA 9ABPA 2IOYA 4XXHA 4MQEA 3T38A 1P8AA 3GV0A 2FMFA 1JBEA 4LE1A 1ZHHA 4Z4CA 2P9HA 3IPAA 1Z16A 2E4XA 5HQJA 1DP4A 4ZMSA 3OLXA 1AB5A 5JNUA 1WETA 3QEKA 1AB6A 3HEBA 4PEVA 2HSGA 4MS4A 3UUGA 5KQPA 4KFCA 1JDNA 2PL1A 1B00A 2JRLA 3OLYA 1ZITA 4KV7A 1QQBA 1CHNA 3A3KA 3LKBA 1VKRA 4IMIB 3CTPA 3Q7SA 1FSPA 4W5QA 1TLFA 3O1IC 1FFSA 2CD7A 2FTKE 1VLZA 4HNSA 2JB9A 5TPWA 5KQGA 2PUCA 3VNBA 1JFTA 1NXSA 1CEYA 1NY5A 2FEKA 2HQBA 4PICA 1BVHA 1JYFA 2FQWA 2QVGA 5CNMA 3FFWA 3Q15C 2IDMA 2YHBA 4RV5A 4W5RA 5FBHA 4Z4IA 3H5LA 1QP7A 4N76A 1QQAA 1Z13A 4UHJA 2JVKA 3JY6A 1OXBB 1YMUA 4GPAA 4KQCA 1ABEA 4Y9TA 2LBPA 4MS4B 4JB0A 3CG4A 1DCFA 1XHEA 3H5WA 4EY3A 2MSWA 1LJUA 1ISSA 1P6UA 1U04A 5B3JC 4WWHA 4JASB 4JAVC 4KVFA 1D4ZA 3MM4A 2PMCA 3KTOA 2PE5A 2PL9A 1GUBA 4MR7A 5TPWB 4DQDA 3DGFC 4Z4FA 3IP7A 3H6HA 2IPLA 2B4AA 3EQZA 5TPZA 2FLWA 3ILYA 1BDHA 3ILHA 1QNLA 2VK2A 1U2PA 1GCAA 2LP4Y 2HPHA 2ZAYA 3O2JA 5KI6A 1MVOA 2PUDA 4QICA 3MA0A 1EWTA 3O2QB 5IC5A 3GA5A 4E7PA 6ABPA 3A0RB 4KQ9A 4G0PA 2QU7A 3O1JC 3F6CA 1URPA 2JBAB 3FGZA 4RKRA 5IX8A 2KYRA 3CG0A 3HUTA 4G0QA 2E4ZA 2FMKA 2MYTA 5TQ2B 1E6KA 4JA2A 3HDVA 4Z9BA 5EWJA 3UKJA 3BILA 4H3HB 4MR7B 4L85A 4ZYLA 4S04A 2PUGA 1M2EA 2A9OA 4RK0A 3KSMA 5KQMA 2PJUA 2M1ZA 1DRKA 3RVMA 4HYEA 4QYWA 1EFAA 4KMRA 1FFWA 1U0SY 3H1EA 5IEBA 1PEYA 2ZWMA 2GI4A 1JHZA 4EYGA 1DZ3A 2HQOA 1QP0A 2GX6A 4FE4A 6CHYA 2FQXA 3CKMA 1Z26A 3HUUA 1L5ZA 3KG2A 1NXXA 4YWHA 4OG2A 1Z17A 3C6QA 3OO1A 3N75A 3MMNA 4TN5A 3LTEA 3LUKA 4D6XA 2A9PA 2IPNA 3OM1A 2FEPA 1C0EA 4N41A 1U2QA 4RY9A 3SNKA 4RDCA 4KNYA 2N9UA 2JBAA 2WMYA 3RH0A 4P1ZA 3NBMA 1DRJA 2WRZA 1BDIA 3E3MA 5TQ2A 1YMVA 4NV3A 1M5UA 4LZLA 3C3KA 4N0QA 3QLUC 5EWJB 1KRXA 1JDPA 4XLTA 1MB0A 1QP4A 2FKAA 1XWWA 2FLKA 2O20A 4YLEA 4F12A 4EVSA 1RPJA 4KK4A 5EWLA 1PNTA 1XHFA 3QLUA 1MAVA 3QX9A 4G86A 4RY8A 3QX8A 4Z99A 3OLZA 4Z4HA 1J56A 3CNBA 3H5OA 3I5AA 1NXTA 3DBIA 1A0OA 4RK7A 1JH9A 5IBQA 3KHTA 1NXOA 3HV2A 1VPWA 1L5YA 1ZH2A 2VYCA 3SQNA 5CNKA 1P2FA 1PUXA 3EGCA 2L2QA 1HEYA 3TD9A 2QSJA 1ZAYA 1NATA 5BRJA 5ED4A 2WY2D 5JNVA 5T7BA 4MR8B 4G0ZA 5IULC 3JS5A 1YK0A 2FN9A 3H5IA 3URMA 2GWRA 1BAPA 1U8TA 3IP5A 1T34A 2JVJA 3FDFA 3M6MD 3CS3A 3O74A 1JYEA 3FFTA 2L18A 4ZMRA 3TB6A 3H75A 3EQ2A 3CU5A 4NQRA 5EWLB 5CNIA 1ZGGA 4NCAA 4MR9B 3KJXA 1NXWA 1PNRA 4W5OA 3OQNA 3O21A 4KRFA 4YV7A 3OQMA 5JS2A 3HDGA 2JCGA 3QLVA 3GBVA 4G0MA 2M98A 3D8UA 3T8YA 1ZESA 3LFTA 2WB4A 4RKQA 1JFVA 4Z9AA 4B09A 1TM2A 3EJWA 4XASA 4EVQA 1LJLA 3OLVA 4MR8A 2FEWB 2LIVA 4Q7EA 1UDRA 1JX6A 4F3TA 1Z12A 3N0RA 1R8JA 1DBWA 5FWYB 1ZGZA 2RGYA 4EYQA 1QO0A 3A10A 3CLKA 4D6YA 5JS1A 4N0PA 2E4YA 1TJYA 8ABPA 4TMYA 3MF4A 4MR9A 4TLLB 4YS6A 1VRVA 1D1QA 3NNDA 3GBPA 5T3YA 4Z4EA 1QKKA 2OENG 4YO7A 4ZPJA 1FQWA 2E4WA 3LUJA 2R47A 5JNRA 2I6FA 1DCKA 3C97A 3HXMA 1K66A 1Z18A 4XAQA 1YIOA 4O1IA 2IPMA 3W9SA 2AYZA 4FE7A 3K9CA 2FMHA 3HVRA 5HM6A 2NZUG 1ZY2A 2CWDA 4ETMA 3T95A 3L49A 1SD5A 3H6GA 4OBBA 5GQSA 5FWYA 4N03A 4E7OA 4G0OA 1M5TA 3GL9A 2R25B 2A9QA 3EAFA 2PUBA 2NT3A 5JNTA 2F8SA 4RK6A 2OQRA 1Y1LA 2WJWA 3G1WA 1YS6A 3QLVC 3H1FA 4G0XA 5KC8A 3DZDA 1FFGA 2RJOA 1USGA 4OLAA 3KKEA 3S99A 1DBQA 3RVQA 4RY0A 1BA2A 1GLGA 3N53A 3SAJA 3DLHA 5I4CA 4F06A 1JFSA 3Q7RA 5FWXA 2F8TA 2L19A 4LX8A 1DC8A 4Q6WA 1ZVVA 1JF8A 5DCLA 5BRAA 4NCBA 3MIZA 4F8JA 4GNRA 4PYRA 2IPAB 2GBPA 4IGAA 3I09A 4LDAA 3LUDA 4MAAA 4EGSA 4YRZA 5IUJC 3HS3A 1QO0D 3A0UA 3RVNA 1K68A 3F6PA 2NT4A 3KLNA 3KYJB 5HSGA 4EVRA 4JOQA 3JVIA 4RWEA 4IMJB 5KQLA 3R0JA 5DLEA 5DGCA 3CHYA 4YCSA 4YGXB 1IIBA 4JB2A 4ZJPA 4RXUA 1RNLA 2AYXA 4Z0NA 4TLMB 3N6VA 1LBHA 4LRQA 5D2CA 3LKVA 3H5TA 5HKOA 2PUFA 1SXIA 2VUHB 4DADA 1QPZA 1NTRA 3OO0A 1KGSA 3HZHA 4PZ0A 5BR1A 5FWXB 2E4VA 2VUIB 3O1HB 2PLNA 5B3JA 5DTEA 4Z4GA 1BDJA 2CHFA 3TO5A 1ISRA 4CBVA 2R48A 3NNSA 3G85A 4G0YA 4XARA 4MQFA 3RVOA 1GUDA 3N8IA 4YR7A 3OM0A 1ZH4A 2QXYA 4RK1A 1W9HA 1MIHA 2QV0A 3LUAA 3DLBA 4UHKA 3BRQA 3GWGA 4H3KB 4D74A 1ABFA 3TX6A 3DGEC 4FB4A 1S8NA 3FFXA 1ZDMA 2ID9A 3H1GA 5C5CA 1ZN2A 4KREA 3LUHA 4H60A 3IDOA 1APBA 4JP1A 3OMXA 2LPMA 3NHMA 1JL3A 3RQIA 4S05A 4WZZA 3KS9A 3Q41A 4MPTA 1DJMA 1SXGA 2QZJA 3RVLA 2BGGA 1YTUA 3IPCA 3CZ5A 2W42A 2HJ9A 3K4HA 2PAFA 2B1JA 1DC7A 3B2NA 3EULA 1E6LA 2TMYA 4WXMA 3KCNA 1YK1A 3HCWA 3OMWA 1MB3A 1E6MA 2FW0A 3CZCA 4MS1B 4MQFB 4YP9A 5PNTA 3SM9A 1A2OA 2NUBA 3CRNA 3N0WA 2RDMA 3FMVA 2ID7A 4RS3A 2XDYA 2MYUA 4ML3A 4MLDA 3L6UA 2LUOA 3GYBA 4O5AA 3RVSA 5TQ0B 2H3HA 3QEMA 4NICA 3LUCA 3TMYA 5CNJA 2E4UA 1EWKA 1DG9A 4LDZA 2R4QA 1YVUA 2FMIA 3O2SB 1PHRA 4WT7A 3EDCA 3M9XA 3I45A 4RXMA 4LE2A 4IILA 4O1HA 4RU1A 1TMYA 4P98A 2P4UA 3BBLA 2H0AA 5IEJA 1USIA 5JNSA 4RZSA 3SG0A 3F73A 3D02A 4KPYA 1TVMA 3JPYA 4RSMA 4MS1A 2PKXA 5FBKA 4WUTA 1EHCA 3RVRA 3M9WA 1F4VA 2MYNA 3OLWA 3MYYA 4KK3A 7ABPA 3H5VA 2PUEA 2L17A 1QMPA 1C4WA 1EAYA 3I42A 3RVPA 1LK0A
chains in the Genus database with same CATH superfamily
2Z0MA 4LYAA 4URWR 2TECE 4YEDA 1CQJA 5TQ0A 3L0CA 4OYYA 4LZAA 2ZS7A 1C7QA 1EP3B 1P6XA 2Q2WA 3ITKA 1P4JA 4LDJA 4MQ5A 4IGKA 3LOPA 4QYMA 3STTA 1Z0IA 4NFLA 3JAMA 5FXMA 3PYMA 4EX7A 1ZD3A 5DYTA 3RU9A 3W3ZB 4R9UC 5CT4A 2VOEA 3P32A 4M9UA 1I13A 2HLNA 5HJ5A 1WIWA 3QPDA 1J97A 3OA2A 4FUTA 4G41A 3ZHQA 5EWMB 1EX9A 1ZU5A 1ORHA 1G5IA 2AT1A 3GZNB 3EW9A 1JLKA 2IH5A 1RXIA 1N8KA 1MJFA 1OWNA 3IQDB 3MJ4A 2PYDA 5E1OA 2FPKA 3ZWQA 4W5TA 1PVDA 3MJTA 3EB9A 3QMVA 3D4LA 4DA8A 2QMYA 2PKQP 1DXQA 4AYWA 3IEMA 1I1QB 1JR3E 3N2YA 3P9SA 1KDYA 4EM6A 2Q46A 1ZJ6A 3OPYA 1U4NA 3NPAA 2O0MA 4DABA 3FF4A 1NVVR 2HQRA 3G9UA 1R9GA 5ETJA 1A2KC 1SQFA 3WGYA 2Q7DA 3I4CA 5AK6A 3L6DA 4PXAA 2P2CA 5JV5A 3D4BA 3KPJA 3WYFA 4BMYA 1MO3A 3Q5GA 3PNOA 4KB5A 3G49A 3UPTA 1RZRA 2WNSA 5FQOA 1FTGA 4HNQA 3FJOA 3ZDFA 4MI1A 3E61A 4WN3A 1E2BA 3PC8C 4PHFA 4MYRA 2IU0A 3X1XA 4TMXA 5G0SA 2GKGA 2QVCA 2XT0A 3KP1A 4KTTE 1YULA 5EKXA 4CIVA 1SQSA 3T61A 3O8RA 4Y8VA 3GUVA 2GF2A 4IV0A 2B0CA 2Y9PB 2WYWA 2PEYA 3MWFA 1BMDA 1RKVA 3DT8A 5KDLA 5THQA 4DNOA 2LRHA 2WV7A 4TUYB 1JA1A 3WYNA 1G8YA 3L9WA 3IILA 3SHWA 2E21A 3EFEA 3EXHC 3X1MA 5K0SA 1FRZA 1HGXA 1HL3A 1ZM2A 3JQ7B 3QPBA 5LOVB 4AJIA 3E27A 3L7YA 3ZU4A 1Y1SA 1QH8B 3HBJA 3F7NA 3PF9A 3V2HA 5ARDA 1RP7A 2DSNA 1O77A 1F2TB 5CDGA 1AX9A 1OMOA 2AG0A 4QTXA 3RRYA 2WZDA 3R6GA 1KORA 3IUNA 4ZYZA 1OYWA 3ODPA 4TL9A 2E7ZA 1M0SA 5KU1A 3VOBA 1YU6A 3Q9LA 4EW3A 4GKKB 4NJEB 4S24A 1AB5A 3CUVA 3W78A 4DGSA 3EFOB 4B73A 2GN6A 1G6KA 4QDKA 2YTZA 3F7OA 5IF9A 5HE8A 1FVXA 3TIIA 3U2QA 3KQMA 5I9SA 5COAA 4BUZA 5F9HA 1BRTA 3OLYA 4RM2A 4I9FA 5JADA 4B6SA 2BJVA 1NW8A 3SKVA 2C95A 2AWOA 2B7CA 2AYYA 2CD7A 4BNIA 1G7RA 1GARA 1JXMA 1XQYA 4JHXA 4PG6A 4UUMA 4DR2B 2I67A 3GQBA 4UHDA 3A4VA 3SIPA 4V0SA 2AV6A 2IDZA 4D5EA 3T1TA 1QTNA 5BNZA 3AVUA 4ZCQA 2AQIA 5L7WA 1IONA 3F1LA 2WMOB 4BNNA 5KNDA 4BCCA 4FFDA 1UC5B 5A0FA 5BMVF 4MHTA 4CKWA 1PJAA 3A4NA 4TLAA 1J5EB 5ALPA 2EFYA 3AJAA 4H77A 2NU7B 2JIQA 2PJRA 1FMTA 1WUJS 4IDFA 2IHJA 5C37A 5CD9A 2NOAA 3IUYA 1G1MA 4J0HA 5I48A 2Q3EA 3K30A 2IU3A 4MA4A 2IXBA 5JO9A 4KXQA 2OCYC 1CLUA 1DL5A 1EE1A 1JQ3A 3GEIA 1AKMA 4CFSA 3RTAA 4MARA 4E51A 4QFDA 4YXFA 3J81A 1X1RA 4K26A 4V39A 1GRCA 5FF9A 3BRWD 2XAAA 5B58T 3KTOA 4EA6A 3KTDA 4MR7A 1JAXA 2JHPA 3HJBA 2VPXA 1T9CA 4Y2XA 4Z4FA 1NOJA 1ZCAA 4D3DA 1Q20A 3RROA 1II8B 2H4ZA 3FNIA 1KJYA 1NY6A 3ILYA 3IUBA 4IW3B 1P39A 2P68A 2WBLC 4C05A 1LLCA 2P30A 2A1TS 3BWMA 4JJAA 3N05A 1KR5A 1ZNYA 4JBGA 1RBZA 4G26A 2XUKA 2XEXA 5TEWA 3EPKA 3KQPA 2HRZA 1XTQA 3AETA 4RO0A 2ZSKA 3NM4A 2OYCA 1AO0A 1R4ZA 3RK1A 4AY5A 5IARA 1E9BA 4K1LA 1CDZA 4WY5A 3DMDA 3DV0B 1XMXA 1W0JD 1PD0A 1URPA 3EFHA 5AMXA 2WD7B 3FGZA 3NTXA 2J5QA 4HXGA 1XXHB 3MXOA 5ERGB 3CG0A 4AC9A 3E70C 4QARA 2H7XA 3A4MA 4JJ6A 4L02A 4W63A 2JFBA 2IBTA 2LTAA 1DTWA 3DBRB 3VM6A 2QQFA 1NN5A 3H2BA 1A5SB 1B8UA 2C96A 3OOEA 2WG0A 1GG9A 4ZV9A 2D62A 1SUBA 2A9OA 2BI8A 2GD6A 3DBVO 1UJBA 1EXWA 3WLKX 4AK9A 5GOZA 2H1HA 1LI7A 1KKLA 3H9BA 4INAA 4MW4A 2FZLA 2GPYA 1B42A 2XRYA 4IQFA 4QYWA 2AJ8A 5ESXA 4B4UA 3PQ3A 3ANSA 2D0IA 2RCNA 4NBRA 4M0UA 2NG1A 2W4QA 3R0ZA 2GX6A 4FE4A 5B3KA 4E5YA 2MT9A 3L0IB 2C29D 1JR4A 5JDIC 3WRYC 3OEHA 5EPOA 5ARBA 3MMSA 4EG5A 1CP2A 2PKEA 2CFCA 1B16A 2CCGA 1GZHB 1CZNA 3F5MA 1M5RA 4BC1A 4RY9A 4W1PA 2V5AA 2NUPA 3ENWA 3LT2A 1ZJ4A 4OXRA 2IP4A 5AK5A 4V1CB 3ELWA 2HV9A 2RC5A 3PTAA 3DAGA 1JALA 1CZHA 1T4DA 4OQYA 1BHJA 1POXA 2C2KA 4XM1A 4YA6A 4HXYA 5KHOC 5DTIA 5L8VA 2D0PB 3K09C 3D6AA 4PC3A 4R0MA 3BJZA 4MWGA 4EEKA 3R3VA 1NQUA 4FHZA 2GEKA 4UU7A 5ALLA 4BO6A 2IP1A 3BWCA 1TZBA 1XWWA 4OPMA 3RK4A 1N5JA 1HT1E 3HYCA 3QYFA 2O20A 3AXSA 4JT2A 3SR0A 3ZKAA 4QWWA 4M9RA 1OW3B 1IWOA 2BSXA 2H7YA 2XW6A 1ZM9A 2BDUA 1RJEA 1XHFA 4RY8A 1E8DA 1MZPA 5FOXA 3DV9A 2YZ2A 4HNVA 2VNSA 4IO1A 4FZ3A 5FA6A 2ZUBA 3WAKA 3A04A 3EBLA 1XNGA 3O82A 3WLJA 1DO0A 3JR7A 5FUQA 5AOAA 1S8OA 4IL5A 4ZAXA 1MX3A 1NMSA 3HCBA 3TEJA 2GS9A 4KITB 5BRJA 4UM9B 1IXRC 3FVQA 4Y2YA 1W36B 2GT1A 2R44A 2F1OA 4R01A 4F8YA 5FL3A 2W6CX 2WUVA 3CLHA 2XBMA 2ZIXA 2ENUA 2RK4A 1JEDA 3DKPA 3IT1A 3L6OO 3PHIA 4ZRMA 4Y9DA 3VR3A 1ZK4A 1UEJA 3OUUA 3M6MD 1JE1A 2ISCA 4LPKA 3GF4A 5CDFE 1QBGA 1WDMA 2WWIA 2WJZB 2JFHA 1FXSA 4MRAA 2AXEA 4ZREA 2Q3FA 2UXDB 1SXJB 3A9UA 5C35A 5C7IO 3EPJA 3HFJA 3AUTA 2B61A 4BVLA 2NVWA 2JAXA 2HCJB 4H9GA 1EFKA 3QWAA 4MB6A 4WQMA 3TNFA 1JEYB 3VX4A 1PNRA 4ZOLA 3E9CA 1SZDA 1Z7EA 4FLMA 5DW0A 1T9HA 3ADKA 4BBZA 1GA4A 2PN1A 4JOCA 1OREA 1TZJA 4WK4B 2PVSA 1W48A 5CK5A 3VO9A 2P9ZA 1Y4SA 1EMDA 3BDAA 2BIFA 2EJTA 3EXFB 1TJPB 4H7PA 4J90A 5G40A 3ZY2A 4B09A 5ALYA 3L7MA 5HRUA 1UFRA 4ID3A 5KSPA 3MT7A 2WYIA 1C8KA 2VJYA 5LFAA 5JZVA 4KPGA 1TGVA 4KAAA 4DFDA 4OQDA 2QUKA 2WNHA 2ZS9A 3D6TB 4NJMB 2XYHA 4P93A 3RUHA 1DBWA 1TECE 4KR0A 5IAOA 1U0EA 5DNVA 3U16A 1OBOA 1GUZA 3BWVA 3QKUA 3A10A 4JLSA 4PO8A 3SBDA 4C3OB 3CLKA 3AZQA 5JSZA 3WGIA 4W4TA 5HCUA 1HLDA 1E59A 2YIDA 3AKEA 3FGNA 1T5SA 2HC9A 3ODGA 4AZVA 8ABPA 3EVTA 4F84A 4UNRA 3UYLA 1QK4A 2IIBA 4C6TB 1L4KA 3DVRX 4IF6A 2HIGA 2HRQA 3CA8A 3NT5A 4Z4EA 1Q84A 3QFFA 4CN8A 1FQWA 3EUFA 2YASA 4HV4A 3ZH9B 2E1PA 1VE6A 4GYKA 4EGJA 3BAZA 4UXHA 2Z30A 3BIFA 4JI4B 3KQWA 1SC3A 4DQKA 1GG5A 1OBVA 2HQ1A 3KNZA 3WGKA 2OZVA 3BGSA 5HM6A 1YDEA 1Y7TA 2HJWA 2UVDA 4KQMA 5C8YA 2AL7A 5HR5A 3FTEA 3PFFA 1XELA 3HU2A 4XA8A 2QRVA 4OX9Y 1NVDA 2QX7A 2XMPA 2X77A 4YMLA 3NTUA 1DG3A 4H7IA 5FOVA 1U3WA 1N2BA 1M5TA 1BKYA 3JWGA 4P7FA 4Y2JA 2FNAA 2NT3A 3ZE6A 4RK6A 5C3UA 5DV9A 1A8PA 2EJUA 3SFTA 4G24A 3PJDA 4Z7QB 4RQTA 1ZSYA 3QH4A 3OG9A 3U3KA 2ZJBA 4H16A 4H4EA 2GYWA 4YO8A 1M1XB 3P9NA 4DSOA 5IHPA 2NSJA 4HWKA 4ZDIA 1QP8A 2Y77A 2BGUA 3D1LA 2V7BA 3M1YA 3QY0A 1JFSA 4G0UA 1RQ2A 5I51A 5C8YF 1QIHA 3GJYA 2GBPA 4IGAA 3MSCA 3QSYA 3R6DA 5LP1A 2C8LA 2C59A 3KDPA 1QO0D 1F2VA 1IMJA 1X1DA 3NI2A 4IUBS 1KI2A 821PA 1KWKA 2ODQA 5EMNA 2DKNA 3VSBA 3MTAA 4MYDA 3RC9A 3TINA 1ZJYA 2B25A 4XYLA 1E7WA 5KQLA 3AVXA 2YWRA 1OWLA 1EFRD 3MCVA 4JN6B 4BCDA 5FO0A 1G6Q1 3AFNA 2BFBA 1FDRA 1E2PA 4RXUA 3NCTA 3TLYA 1K7SN 1RNLA 3FETA 1AG9A 2AYXA 2EYUA 3LBYA 1JGTA 1R50A 4JJEA 2BUCA 2B4RO 3W4IA 3WMRA 3HO6A 1LVHA 3H5TA 2WJGA 2C3MA 2C5BA 5HS6A 2NM0A 3AEUB 3JYQA 3TOCA 4C7XA 5BOSB 1O97D 1TU3A 1G3UA 2E4VA 3U7QA 2Q0SA 3WLOA 4CEJB 2J9XB 1M0EA 1MOZA 1UQTA 4JFAA 4XB1A 3NDJA 3NTOA 4F85A 4L9RA 4EIWA 4L5JA 4R6XA 2GBCA 2X5NA 4OSOA 4DIOA 3LAWA 3G85A 4IKPA 5BWCA 4TSKA 3UMGA 1GUDA 1F2UB 2R8PA 4XSVA 1UIMA 1J24A 2DUWA 2FZ5A 3AR6A 3I9OA 4TWZA 1WPRA 4JYBA 3RKSA 2OY0A 3CX8A 4IHAA 4WKOA 5JSYA 1E89A 4L50A 4JI1B 5JMTA 2AFIE 1M33A 2V6JA 3TM4A 3EVZA 4BIMA 3NBFA 2NZYA 3KHKA 5KJCA 1ABFA 3Q98A 4MDEA 3P4YA 1DELA 4IS3A 1E98A 1HMPA 5FR2A 1G21B 4JQZA 4BIIA 2OVBA 4N12A 4DCMA 1BN6A 1K8ZB 3NHYA 1DC4A 4FIDA 3F5FA 5FNVF 3SZGA 3WI7A 2DC1A 3DOHA 3OOSA 4FYXA 4KH0A 2PUWA 4I55F 3DD1A 3BCHA 5CR9A 1NW4A 1BEUB 1TW2A 3DZKA 1DC7A 4C0SA 3HN6A 5BSTA 1NQXA 2C57A 1DDGA 3DF7A 3KCNA 1ZC4A 3W2GA 4RF5A 5AXCA 3HUDA 1OAOC 3GK3A 4FSXA 4IDHA 4RVSA 2JZNA 4UE6A 1C2YA 1NJ8A 4DV4B 3OZDA 4B4KA 1XTZA 1DKUA 1NUSA 3ZJTA 3AVTA 2NUTA 4J1NA 5GJCA 1YB7A 4RC9A 3U1VA 3MJHA 5CW2A 4DSTA 2LGJA 5CLHA 3KKZA 4F9TA 1WHTA 1Y9DA 3GYBA 1U3FA 1XUOA 2MDTA 3ZVMA 3QJYA 5B1HA 3HV0A 2VWGA 2NYVA 5K3FB 1V3VA 3UCFA 1YF3A 4QYSA 1HDIA 4LMPA 4R83A 4NEGA 1XA3A 1QR2A 1ICIA 4ZVUA 1DCTA 1K6XA 2PGJA 3RGGA 1FBTA 5BO5A 4LJ9A 2ATCA 2C5GA 3T4UA 2ZRPA 1V8OA 1KGDA 2QIPA 3FFBA 3GZ4A 3G13A 4ZMBA 1E2HA 4D3YA 1MJHA 4CG1A 2VYNA 4DMHA 1U0LA 1WLYA 4X63A 4YROA 3WBJA 2IODA 5DYGA 2JIOA 4J7CA 1OUMA 3VYTB 3VYVA 4AZ3A 4FDUA 4PO3X 1XL0A 3DEHA 1PDWA 1LJ8A 1ZM4A 3GGPA 4U7FA 2MYNA 2XYPA 1NPYA 3H5VA 1SXJC 2L17A 3ND6A 1OI4A 2QRUA 3UV3A 5BSGA 4UAGA 2NXJA 1FFBA 1H69A 4Q9DA 4YQZA 1NVKA 3VU8A 2J3IA 5A02A 5FH9A 5L51A 4TYNA 2XCTB 3U44A 6ADHA 3W3AD 3V6LA 2WTNA 3RBXA 3UMSA 1Y3AA 2C4KA 4MGYR 1VA4A 2WWRA 2YOFA 4DKJA 4LXUA 2A9RA 1Q0SA 2Q3BA 5FNVB 1U6JA 1U2DA 2GAOA 1UC9A 2VHCA 2XNSA 3BSWA 1NUUA 3OJ0A 4EG8A 1W5SA 2C4HA 3IELA 1UJ5A 3LHDA 3THXA 1CUDA 1Y63A 4BKOA 1QG6A 3EDQA 1KU0A 2ZB8A 3LSYA 1B7GO 4P4NA 4J0QA 2MSLA 1A9XB 1V8ZA 2PLFA 4KJZA 4I14A 4RLHA 3VDRA 4G5RA 4EITA 1Y3DE 1KYQA 2RGDA 4G9BA 3FOAA 4HQFA 1JWAB 3ZE8A 3KK0A 2PU5A 4CR7A 1QO7A 4LJYA 3LXXA 1IOLA 2VNJA 4GPTA 1Z25A 1NIJA 4M7WA 4TQAA 1PQPA 3E2IA 5F1PA 4L0CA 1PEDA 2CN1A 2O6HA 2HJRA 1PR6A 2G82A 2GCIA 4AUEA 5A4AA 5BW8A 1IZ0A 4ZVOA 2ZJ6A 1XCOA 1IBSA 1L4LA 2QTTA 3ETGA 4BQIA 3U4CA 1YZKA 4ER3A 1I6MA 3IEUA 4MUFA 3OCVA 4QUBA 1L7BA 3WISA 1D09A 2DWOA 2ZZNA 1GLNA 3PPVA 9LDTA 3E8MA 4MWSA 5F5LA 1VPDA 5A9RA 2JIRA 1U1EA 1UKVY 2I66A 4DUYB 1I9GA 1DIAA 4C1BA 4HDQB 1ICEA 2Y1GA 3ZIAA 1N36B 2ZBEA 4E46A 1KXJA 4DV1B 3QELA 1G7CA 1SUFA 5FTNA 2UUPA 1NW9B 3QVJA 1CJBA 2VJQA 4DBVO 4DM4A 5AUQA 3IBFA 5D6NA 5DNUA 3UUWA 1XZLA 3ZGXA 4UUPA 3TIFA 4YCBA 1YQ9A 1RYFA 4LI0A 1PIWA 1OJ7A 1KAHA 1M6YA 2CNWD 2WD8A 1QK5A 4IG4A 4LGMA 4QE3A 1OXXK 4HG2A 1N0VC 4E5SA 4YT2A 3SPXA 2EP8A 1UMBA 4B47A 2IOYA 1IDOA 5D00A 4ZVVA 3OFKA 5J2UA 4IHJA 5LA6A 1WVMA 3VOAA 3SKXA 5AK4A 3N86A 3QFCA 1IG3A 3FGPA 4O4IA 5BYAA 2JEZA 5DGTA 1L1RA 4P4SB 2BEUA 5F33A 1UJCA 5FFFA 3UHAA 3M4JA 2AR7A 1BH6A 4KO4S 3PYXA 3T34A 3N0VA 1Q83A 5CAEB 3TVYA 5J4HA 2HUNA 3UHOA 3UUGA 4UNQA 1RIFA 1TK9A 4AJ4A 3LDHA 3DP9A 1MC8A 4Z0TA 3WRVA 1PR4A 3JRWA 1MJ5A 4CI9A 2I5PO 2ZUEA 2HRBA 3GJXC 3W5SA 4UMDA 2R6HA 2YWEA 4RIGA 4IXWA 3NC0C 4MKGA 3ESAA 5BY2A 2AFHB 4MV8A 2GAAA 2F3PA 4IOMA 3E1KA 4BO0A 2YV1A 4PVDA 2J4FA 2W2XA 2ZYRA 1GNTA 2AK3A 2D4AA 5KTKA 3PNVA 1Z4NA 1PJRA 1ZP6A 2AN1A 1PGNA 1NRIA 2ADOA 2R5FA 4LSMA 3RAEC 5EUMA 3KWLA 4QQNA 1BROA 3TJRA 4EZIA 1C8VB 3H0KA 5B37A 1E9EA 2DPYA 3KKMA 3NLLA 4LA4A 1C9DB 2WJPA 4U9UA 1WUIS 2HBZA 3LY9A 4MPRA 4QC2A 3RT7A 3Q85A 1NLFA 4D5GA 4W1SA 2ZVDA 1Z5ZA 5EXSA 2J3QA 2R85A 3RYHB 3H5WA 2PUJA 2X2FA 4ZAZA 1LJUA 2ZP1A 4DXHA 3QZUA 3O84A 2NU6B 1E0SA 1JTFA 5L53A 4WWHA 2QE7D 2NLOA 4WNYA 2FHPA 2C2YA 1SBIA 3L43A 3PCRB 5AKIA 3OFSA 3AFOA 1RQPA 2ZWIA 5CDUA 2QGZA 5HFNA 1FUUA 4HP8A 4DLBA 4XZ3A 4ZXFA 1FP7A 1I2BA 1KOGA 1CS4C 3ZDRA 3ENNA 1UM8A 1PZHA 1Y1TA 3ELUA 4G1VA 4X9XA 3JAKA 5J5AA 3ILHA 1JZTA 2X86A 5CCDA 3DD5A 4LMBA 3RS2A 5FJJA 1G3QA 2ZE6A 3O2JA 4LMAA 4QUEA 3GPBA 3D3NA 1P4AA 3S81A 3JSAA 5IT9A 3OJCA 1EWTA 3O2QB 2HA3A 1YFKA 3B7PA 3ERCA 3JYNA 2YY7A 5CLJA 1VCIA 3R8FA 1SQ5A 2R7AA 1U3UA 1MBZA 1C1DA 4HWSA 4TXMA 2BBOA 4M76B 6ABPA 1WCIA 2QTNA 4CLHA 4D44A 1ZJ5A 1W94A 3U4QA 3I9NA 4BFTA 2UVQA 3D8RA 4AMUA 4P58A 1ZCZA 3T1YB 1NC3A 5C80A 2R9VA 4CCAA 5EINA 3HYRA 4ERNA 4DHEA 4IZHA 1TO2E 4CU2A 4IIUA 3CKLA 4GOND 2XMSA 1L7MA 1KS9A 1UWVA 2IUSA 5KQMA 4MVJG 1YACA 4QXMA 3G88A 1RWOA 3HCRA 5SICE 4KMRA 3IVMA 4NOJA 1U0SY 3CRVA 5IEBA 1PVOA 1P91A 3A31A 5A6SB 3C4QA 3D1JA 4GOLD 2QS9A 2QMUA 4B9AA 4ARAA 3VPAA 1Z17A 3KDAA 4JWKA 1VKHA 2VSXA 3PHCA 2BUAA 2C94A 2EG5A 3VAZA 3PNPA 3BIJA 3K4QA 4Z53A 4OA8A 1WB6A 4J4TA 5KYYA 4W7SA 2IU6A 3LXMA 5AW9A 4N41A 4IDOA 1W75A 2KWIA 3SNKA 4RDCA 1XP8A 2WMYA 1HA3A 2HZ7A 3GIDA 2IPOA 3NBMA 3F71A 4IIFA 5E3IA 3DZGA 3DZ8A 3R5KA 4NV3A 5LQAA 5LKRA 5DM70 2YMQA 3QV2A 3UJ9A 4B3SB 4UBKA 1XTIA 4KXNA 5EWJB 4IQGA 5EPEA 4UM7A 2FKAA 1OBCA 1PSZA 2GEDA 3W0LB 4LZNA 2YH2A 3EQ7A 3ZR4B 3SZRA 1UBOS 3DHVA 1YE8A 2YQ4A 4WJLA 1LX6A 1KP3A 2QL6A 3CNNA 1U8XX 1G16A 1I3NA 3WV5A 3LPMA 4LWZA 4WVLA 5FQNA 3UAYA 3GVHA 3ZNOA 1W8DA 4I2VA 4PLTA 1Z2OX 3KHTA 4JYCA 3QI7A 4CI0B 5A4KA 4B84A 4DDHA 1U3DA 3BC1A 4MDHA 2OHHA 1TC2A 1MVLA 3F9CA 3I83A 1CU1A 1JA0A 5D87A 2IV7A 2PUVA 4OL9A 4D4LA 2VYVD 4TKVA 2RHCA 5DN6D 2AF3C 2I2CA 4IQ4A 4MR8B 3EVCA 4RMGA 3PNLA 1LC0A 3PPXA 3N8GA 5AKKA 4KN8A 1U9IA 5DNAA 1HDCA 2AI3A 4GO1A 3R3UA 4FFOA 2Z09A 1C4KA 2AR0A 4QEKA 2OYRA 8GPBA 4DG9A 5EP4A 3MJCA 2HU5A 4LF5B 4MHSA 1MB4A 3GW8A 4RWZA 1G8AA 4INPA 5JYEA 1ZINA 3OCUA 4DC0A 3FFTA 4C0AC 5BQFA 2EJCA 1G9SA 5FYQA 1I1NA 5JAMA 3CU5A 2FEMA 4C4SA 1FUEA 1O8BA 2GCOA 5J63A 3TRKA 3J81k 5LMUB 4MR9B 4IXDA 3K0HA 3U3XA 3OCXA 4GLLA 5U1PA 3ZE2B 3U5ZB 4J16A 2LVBA 2OCBA 3QTBA 4LDPA 3ONDA 3NTLA 2NGRA 1M9NA 4HX5A 2D7DA 1O6GA 3B89A 1GPBA 1X1CA 3G9ZA 4KZPA 1AK2A 2XCIA 2H8KA 5EFZA 2FE4A 4P7KA 4PX9A 2HSDA 4E3WA 4GEKA 1OFUX 3C5VA 4L75A 1WKBA 4O33A 5TNXA 4BO3A 4W82A 4JKYA 5EJ8A 1CERA 1MDFA 3HB9A 1HNWB 3KZKA 4EFDA 1X3LA 4IV5A 2MINB 3U3JA 1LQ2A 2FEWB 2I4OA 2XNKA 1XBTA 3H1BA 1YD7A 2CLFB 2QZ9A 3P5SA 4F3TA 2C78A 1R8JA 4WPGA 2WTXA 4RV9A 1UBNA 1IYZA 2W2LA 3BTUA 3MAAC 4MTCA 4FFLA 4TTRA 1NV8A 1XD2B 1G5RA 1S3IA 1SNYA 3S1SA 5DHUA 3HBAA 4CM6A 4PCUA 5KYWB 4JXXA 4AFNA 1WMFA 2DWCA 5HZKA 3PU6A 1VRVA 1X42A 2W7TA 4OOFA 5E4TA 1GL6A 1R0BA 2HNAA 3GBPA 3BGDA 3GLVA 1P18A 3H65A 3IDZA 2ZI6A 4GWGA 3ZK8A 2WYVA 4DRYA 5AJHA 8MHTA 3DHYA 1OX5A 2PGXA 2L0XA 2B6NA 4RFSB 5ELXA 4KQ6A 2AYZA 2QTLA 4Q4HA 3N0TA 5BYBA 4DYVA 4UZEA 3HA3A 5G1NA 5IT0A 1ISMA 2UZ4A 1BN7A 3HCDA 5FI5A 1N5OX 3QNWA 2QD2A 1SEPA 2AFIB 2CFRA 5DRTA 3T06B 2ZU6A 1CETA 3DOFA 3G0CA 5EXEA 4R40A 5AK0A 1M34A 2LCFA 4E7OA 1ADCA 2VQ6A 3GL9A 5K7SA 2A9QA 1QCCA 3ZBQA 3MT8A 2F8SA 2RHBA 5DN6A 3VXKA 3BWYA 1R6AA 1DJPA 4LHXA 1ZA1A 2E9SA 4N4AA 4NECA 4NATA 3H2HA 5F98A 5JJKA 1DBQA 4D1YA 4GMDA 2PX5A 4X3CA 3ZWKA 1VQ1A 1ORRA 2I2FA 1KH1A 2Q7XA 3IQEA 4FGSA 2ZVQX 3VO2A 3PA6A 4Z8YA 1DC8A 4MW7A 1RRMA 2RHTA 3JZAA 3FOEC 5BWOA 4D8YA 2RH4A 3IBYA 4ADSG 5HUQA 2CXSA 4RPCA 3GMDA 1I14A 3FYTA 3FWHA 1KO8A 3KXKA 4TM8A 4JOQA 4EVRA 3JVIA 1RPAA 2ILTA 1GZ3A 3RIYA 4ENQA 1C9MA 2WIJA 4B2IA 3WB9A 4N5IX 4OJKA 4GZLA 4YMWA 1VLVA 4UHBA 5FWNA 5ICGA 2IYFA 2NSLA 4CHGA 1H8HD 3M6FA 5JU6A 1A77A 2VNHA 2ODWA 3W7BA 3CJQA 4AO7A 2FWMX 5I01A 4MPJA 4L6IA 3GD5A 2QM0A 3EPHA 4U00A 2C7GA 3QJ5A 4G67A 1XTJA 2AE2A 4WY8A 4RTPA 2PUFA 4ESOA 3K31A 2DMRA 3PGXA 4ALJA 5FWXB 4B4VA 1L4MA 1ETHA 1V6SA 3TO5A 4CBVA 2BM8A 4Q3DA 3WK6A 1L4UA 3U7IA 4DMFA 2C2BA 2AEJA 4PANA 3KE9A 2GHTA 3KR9A 2GYUA 4KFUA 3N8IA 1T9KA 5FPHA 3UC5A 3F4LA 4CLOB 1ZH4A 1D6JA 1DOZA 3BICA 3D4NA 3JTMA 1GKUB 2C7PA 4FFRA 1C4OA 4F21A 3R09A 3UKDA 1BMFA 2W22A 3ESXA 3IQHX 1ZVJA 4H3VA 1CUCA 1W19A 3LUAA 4LXGA 1IC6A 3UOWA 3AFMA 3KRTA 2VBGA 3IBGA 2MOKA 3S0JA 4HWTA 4DUGA 1JW9B 1W35A 2C3YA 3JARB 3FB1A 1RE1A 4YRNA 3QTLA 2MR6A 4URZR 4MUKA 2GPTA 3COZA 2QAGB 4FBMA 2BGGA 3C3BA 2W8BB 3K4HA 3L7KA 1DOAA 2AGVA 1CUXA 2PAFA 5HIAA 2IT1A 1UXIA 1XZMA 2H0QA 3KOOA 3MERA 4DYHA 4Q4DA 5AQEA 1MB3A 4HN4B 3H9UA 4QREA 3OOYA 2ORED 3B38A 4I66A 1VSBA 2BFFA 3N0WA 3NU1A 1SR8A 1W4ZA 4MLPA 1S2IA 2BJWA 4QO7A 5DWQA 3I01A 2ZG6A 1D2NA 1GT91 1T5DX 2MCFA 3II6X 1TEXA 5TJHA 2MYUA 2PLRA 4DV7B 2K7FA 2PZ8A 5FJIA 5TLSA 3DULA 1XVLA 3TNLA 2H3HA 4FYVA 3AVWA 2Z9DA 1X77A 1AGXA 2P9TA 1GAWA 4FEYA 3QU4A 3K1JA 1EWKA 4B2PA 5FNZA 5IYZF 3NTQA 5COBA 2R4QA 3CSUA 3O38A 3M6LA 4LY3A 2JFUA 4RXMA 1NUQA 3GNLA 1SPXA 1P7PA 4KQEA 4MVXA 5EJEA 3S68A 3WLRA 3TX2A 1SXJD 1TMYA 1N4DA 4BCBA 1V71A 1GA6A 2I87A 3E0QA 1ZN9A 4ZYVA 3IT0A 1Q1GA 4FEEA 1FP1D 3HACA 4IVRA 2UVPB 2ZVJA 4MS1A 1JDTA 2HJGA 3UWSA 2HV8A 1RLOA 4LRXA 3L41A 3LG2A 4XTCS 5HKAA 4FWTA 2XPCA 4NBWA 5KUTA 2BW0A 1LK0A 2ZBDA 3K35A 3VHQA 3OP4A 3U37A 1Y6GA 2I1QA 3P0FA 3BB4A 1S9DA 1R0RE 3HB5X 4LYYA 3TTYA 3NNNA 3IHLA 2VAMA 3DEJA 2F55A 4MP6A 1JPUA 4F11A 4F5EA 2D1YA 4JYAB 1NVTA 5BNIA 2XWSA 4WXHA 4G01B 3PSHA 1NAHA 1OXTA 3E3AA 5AHXA 5E3HA 5AQ1A 421PA 5B7QA 1ZUHA 4KC0A 4O2RA 5E2AA 3UMVA 2QLMA 3E7WA 1L7PA 4IH4A 5BR8B 3TUJC 4TLCA 2RHHA 2C1XA 3O5AA 5JO0A 2WTAA 4BO2A 3PUXA 2AJLI 5EQTA 5C0OE 1FXWA 4ENSA 3DLAA 3HKEA 1B2LA 2XGMA 3O4FA 2OORC 1X8LA 3N2KB 4S1NA 2QGNA 3IB3A 4BUCA 2I62A 3VI3B 3NOOA 4E30A 1EFHA 2VDJA 4NBTA 2WJAA 1Z4PX 1IOZA 5D1NA 3KSUA 1UFVA 2A59A 5COQA 1A7KA 1HH4A 1I4EB 4RIHA 2PPVA 4EI9A 1W88A 2H2IA 4H27A 3WWYA 2FWNA 4M0LA 4KYIB 1MOQA 3OIDA 1N3YA 1ULSA 3JD1A 4UCFA 1WEHA 3AG6A 4ITVA 1Y5LA 4N18A 4GI1A 3M49A 3A9TA 4P7JA 1EDEA 1JILA 3HFGA 3HPQA 3M4YA 3OX3A 5KKNB 5KQRA 4M60A 3ELBA 1VPLA 3QUTA 3UH0A 3SIWA 1H4VB 4TM7A 4ASUA 3CLTD 2Q3JA 3EFOA 1SKQA 3MRXA 1CUAA 4YDQA 4HLUA 1R6TA 3CUYA 3FPHA 4X6LA 1G5PA 1Y3HA 3ICWA 1PK9A 1Y6RA 4LYFA 1MN6A 1TCAA 4AN1A 4FQ7A 2AKYA 4MV1A 1TA9A 1Q1ZA 3P9YA 4MEBA 2X8BA 3LCRA 1CNMA 3R3SA 3T94A 1CY7A 5CDSA 2Z56A 4CMGA 1FTQA 2OCXA 2XGOA 4G4SP 4KQJA 4Y2SA 4WTOA 5F78A 4YB8A 4D4KA 2R84A 3QM1A 4MYTA 5D8DA 2MSNA 3RU7A 3ZTWA 3GU3A 1QHFA 3EXHA 2PZEA 5DRYA 5WRFA 5A5GA 5LWHA 3T38A 4YRPA 4M1QA 3K0FB 4KRYA 3ZDAA 1JDZA 2VTDA 1ZHHA 4TS1A 1V16B 2G7ZA 5EZSA 1G6OA 5CLFA 1ZOPA 5IZCC 4D0NA 3DAHA 4C08A 3IR7A 4UOQA 3F49S 4DV0B 4JOSA 3NIFB 1DIBA 1IEWA 1EHIA 1VE7A 2WYOA 2PSFA 1FMJA 3KAPA 2QTAA 2QJWA 2HSGA 1XU7A 3ELYA 3NETA 2BEKA 1SOMA 3VPDA 3QA9A 3L4SO 1XEAA 4N40A 3G7SA 3HP7A 3ZZNA 2PS9A 3IAUA 4KRGA 4FINA 5LJIA 3H99A 3COVA 3Q7SA 1FSPA 4FT2A 1IXSB 1FFSA 2A1IA 2OBBA 4FGKA 3SSOA 3PWTA 1I0LA 3DT6A 2FZEA 1KY3A 2HKIA 4HNSA 4Y2QA 3UAZA 3AR8A 1VMDA 2CMGA 4XW2A 5AKYA 5TPWA 2FKNA 4KBYA 1XQ6A 3FR7A 4MKHA 3X43A 3IAXA 3OOHA 1U8ZA 3KB6A 1PV4A 3SICE 1JV2B 1K7CA 2VK1A 3IVGA 4NOMA 4YWJA 1DE0A 2VYND 3CSDA 4BQOA 1U8UA 1Z2AA 4I7EA 3K5HA 2H1OA 1GA1A 3K8QA 4W5RA 3RFFA 3AQ4A 2PJZA 5G4KB 2JVKA 5J4VA 2Q99A 4F1KA 4U8HA 3HC7A 1ZM3A 2PZGA 1A4RA 4D9HA 2LBPA 1NJ6A 1Y81A 1U0NA 1JUDA 3TW4A 1WOYA 1XHEA 3UK6A 2DWUA 2FK7A 1N1DA 2ZYUX 3S8YA 3K3PA 2NP7A 2Z2XA 3DFIA 3M2TA 4EHLA 2UZAA 5KYVA 1IPEA 2CFOA 5KU7A 4DCOA 5KSYA 5IVKA 1KU6A 4ND5A 3RE1A 5KNBH 4P54A 4DV3B 2DHCA 3WLAA 3FCCA 1D6NA 3EXEA 4D57A 2HUPA 3H5NA 4U8GA 2FLWA 4PS1A 2GHQA 1L5QA 4PSVA 4EFKA 3ORSA 2PQ6A 3L1IA 4XH9B 2IEIA 1QYDA 2EXXA 2IYQA 4HXFB 4KV9A 1UKYA 2E5WA 1GZUA 1N7HA 1KFJB 1I8TA 1F6BA 1H5NA 1RWMA 1AUPA 3CM0A 1KDVA 4ACAA 4EB6A 2V54A 4UUOA 4X1IA 5CH8A 1JKJB 1FQOA 1BXRB 4QUGA 2UZ3A 1QZTA 5T8KA 5IH7A 4K9OA 1LRJA 1PJLA 2QN8A 2GN1A 3GLGA 1RHMA 1K97A 3IP8A 2JBAB 3D1VA 1RC8A 5AFSA 1NONA 1RZ3A 2CLKB 1F0NA 1JKMA 1I30A 3NT4A 4ZU1X 2JIMA 3W8NA 3D3EA 3Q40A 1E5LA 3CN9A 5KOJA 1DKPA 1VKZA 1WS6A 4ZYLA 3JYPA 3K2EA 4IFTA 2JCSA 1LRLA 4ECAA 3M9LA 4Q34A 4UC0A 1PU2A 3NH6A 2DU8A 4NENA 2P4SA 3LY5A 4BV8A 2VUTA 5JLJA 4EY6A 2AXPA 2XXAB 4IFIA 4B35A 4DMRA 5IDQA 3ZWVA 3V8VA 3S28A 1OSNA 2I76A 3ASZA 3EF1A 3ZLJA 3ILXA 3VHXA 3PNYA 3I1YA 3JQGA 3KHUA 2P2SA 2OM2A 5KNCA 1L7QA 1C3XA 1N2JA 3B5JA 3CNHA 3LW7A 3FMOB 3RG8A 1A1VA 3PEEA 1QHSA 1XZDA 1X2EA 2FXVA 2P6OA 3FWKA 4YT5A 2UXCB 2BGJA 1FLDA 1SOWA 1RMTA 2H1FA 1S2LA 2Q1UA 3P0HA 3QX7A 1EWYA 3RYFA 3GGSA 3GDGA 3IQWA 1ABBA 1BDIA 3H4IA 3AM4A 1TTQB 2X5OA 3ORFA 5BWMA 4M1SA 1YDFA 1OLUB 3A6KA 2VRCA 3PGJA 2OV6A 4JC5A 4KWCA 3MFQA 5EIWA 4F12A 1IB0A 2OR3A 5KHAA 4ZCRA 5AVWA 3RRJA 4LEIA 3QYJA 4ZVQA 5ALGA 1L7DA 2IOHA 2NNLD 1II9A 3NBZC 3P52A 4F45A 5LQKA 4Z4HA 1KJJA 2YYSA 2JAOA 1XZNA 3H5OA 4MDYA 2NQ8A 5AJYA 3GJZA 1D1SA 1ZRMA 1D7OA 1IHDA 2Q4DA 3OJXA 2HZBA 2YHUA 5FFMA 3TOZA 3HA2A 4JBHA 4MA0A 4ID9A 2WILA 1ZH2A 2ZAGA 1QVWA 2VYCA 3KPWA 4GBGA 5F7JA 5LYYA 1W46A 3C5EA 4P3OA 4AIRA 1G2IA 4B45A 6AT1A 3JQAB 1PGOA 2NO6A 1XR3A 2R8BA 4EHAA 4EHDA 3AF4A 2BMWA 4LVCA 5K09A 3FUCA 2A5GA 3UKOA 3CZ4A 3T52A 3LXRA 3W1WA 1JHMA 3WL5A 2YWBA 4DQXA 2FN9A 2G28A 4OFWA 3N2IA 3H5IA 1W85B 1RKXA 3G0OA 3OEEA 4LZZA 4JJZA 3SHQA 1ZCBA 1N5KA 1YVDA 5CVTA 1TTPB 1A7AA 2B3DA 3FKJA 5EMLA 1ORIA 1XSEA 5K0ZA 5KOYA 3E35A 3IQGX 3QMWA 3T9DA 1VDMA 2EATA 1R16A 4G23A 2WKRA 4V03A 1RSZA 2WUDA 4BNVA 3C8DA 4PRYA 2ZAOA 4L74A 1HSZA 2VDUE 1CRWG 5M2QA 4NAHA 3ISTA 4QU8A 4M8KA 4GL4A 4N0DA 4WCFA 3DB2A 1GSAA 2J7KA 2C04A 3OZSA 2QPOA 2VRNA 2Y76A 1L4HA 1UBMS 2A57A 2ST1A 1ACLA 1WMEA 4PG4A 1JFVA 2EKBA 3OQPA 1E3QA 4FHCA 3P9IA 4QOFA 5KWVA 2F3QA 4MB2A 2GESA 3SCZA 4RNDB 3H1AA 2Q4EA 1S2GA 2OWEA 4AYXA 5BYKA 1LS1A 2I2WA 3GLTA 2H4YA 1B0ZA 1GNRA 3ES9A 4LJKA 3MOSA 2ZIWB 3JYLA 2P5SA 1R6VA 1E20A 2QYOA 2KQUA 2H18A 3BTSA 3ORQA 5H81A 3R7NA 1IUOA 3HXKA 3QKRA 4DLLA 3GEMA 1GL3A 1JWBB 1T6BY 2HWWA 3ASVA 3ZV3A 5K3OA 2P40A 3A1SA 1W34A 2X0JA 4KKVA 1I0IA 5CEJA 4N5NA 1KVTA 3RWMB 5NULA 4JJGA 4G07A 4L4YA 3A9CA 3EK2A 4FR0A 4C7OB 5CURA 2C5AA 3AF6A 1C7JA 4JYPA 1UDXA 2D2IA 3SJ7A 2CGEA 4KSCA 5ADVA 1OFUA 2I6FA 2C4MA 2QG6A 2WJJA 3A4TA 2QMHA 3QVOA 4NMHA 1XDSA 5E95A 5F52A 4JI6B 3HXMA 3HTXA 1U3TA 1VSTA 3KALA 2IPMA 3PRHA 4L51A 4O3MA 4V3CA 1GKLA 5EG5A 4P6VF 3HVRA 2MIIA 4NCKA 3U7GA 4DSAA 4JYMA 2ISQA 3EXAA 3ORHA 2RGEA 5ECGC 2HREA 1SD1A 3LP8A 3RKUA 1ZKMA 2ZJ0A 3OCWA 2CHQA 3F4BA 1PL7A 1C9EA 1U11A 1YCHA 4Q3NA 5HRCA 1XLWA 4D8WA 3FOFC 3UK1A 3F47A 3WBKA 4FGLA 4IWYA 4LHZA 1LBTA 2O1SA 2A84A 1N3BA 3W4JA 1Y1LA 3G1WA 5J5VA 5HW0A 4AULA 1ZHFA 3H1FA 2H08A 4RF2A 3RJ5A 3STUA 3Q7QA 5PNTA 4ZIRB 4H17A 3PQ4A 3TFQA 3NMUF 2OBMA 4YECA 5FBRB 3GRFA 5THKA 1GTMA 5JZ9A 3N53A 1NG1A 2P11A 3S5JA 4F06A 3KUDA 1BWQA 1ZA2A 5THXA 4E32A 2BFEB 1UINA 1XMSA 2VP5A 3EUAA 1BEZA 2Y4NA 4BZQA 5DCLA 3VC2A 2A9JA 5SYNA 1CQPA 1ADBA 4MV3A 4UFPA 3IEIA 3VUFA 3G2LA 4ZD6A 1QIJA 5JH7A 3C8UA 4HUJA 3N8DA 5K0FA 1W5TA 1Z8HA 2I0FA 4Y30A 3B2EA 3LGXA 2CKMA 2YRFA 1I7NA 4R1MA 2G76A 4RY2A 1N6OA 2B2XA 2ZATA 3UWMA 1K9SA 3N70A 3MS7A 4GZ3A 1WO8A 3KEOA 4FOTA 5C1OA 5AW1A 1M0TA 4R1LA 3DKKA 4O3FA 4HB0A 2WUFA 4FD3A 1MAHA 4YCSA 3CX4A 1YJCA 2VPQA 1H2FA 1NP7A 1ZOOA 2XCLA 2XUHA 2B34A 1Z6ZA 2ZOSA 3HO8A 4J6FA 4JB2A 4Q9NA 2DQSA 5TT1A 3ZV6A 1FW8A 1A8SA 1U8AA 2XZPA 2OGWA 4MPPA 4MV6A 4QGBA 1PWYE 4TLMB 2Z5GA 3L07A 3WIEA 4NIMA 1OH8A 4R7ZA 3PP8A 2WKWA 3TCNA 1QG0A 2EGGA 3DEKA 1YBMA 2HA6A 5FWAA 3C5HA 2GXSA 1P9LA 2EF1A 4PAWA 4H15A 4MOWA 2EL9A 3IAM1 4L9AA 3U31A 2ZFUA 3F6BX 3BMNB 1VL6A 1Y42X 2P0AA 3WGJA 5IF3A 5JS7A 2CT8A 2P6UA 3QWHA 1JIKA 3RVBA 5LNK1 3C74A 2DTDA 2ZYHA 3SK0A 1ZW6A 1P5JA 2VPWA 3L40A 5H1YA 2ODNA 5H02A 3TZ6A 5CB0A 1QF7A 4JLNA 1ZBQA 2AG6A 4GC9A 1UK9A 4FPXA 5KVSA 2CWWA 5AVSA 4LZPA 3VR5D 5J2TB 3QHPA 1U8YA 1DUIA 5LZ7A 5MGBA 3DL7A 1YB5A 3FLAA 1RRPA 3M82A 2GUGA 1YCGA 3R1IA 4FX5A 4P5DA 5AI4A 4CDNA 5CXQA 4PX2A 2VWPA 4ZI7A 2QUJA 1JSXA 5BNWA 5F7OA 4B46A 1KQPA 4BKRA 3NV9A 2I8AA 2ZYDA 1Q0LA 1OOEA 4X1YA 2VH5R 5AVXA 1R12A 5FBVB 1O0BA 1OR8A 2N1MA 2Z1DA 5KDOA 1VXOA 4FS3A 4ITUA 2FOLA 4Q3BA 3SZUA 4D46A 2BN4A 1YQQA 2WU4A 4HQLA 1LNQA 1N5RA 2P77A 3C4JA 1Y7IA 3I53A 3GEDA 3PIRA 3RIGA 3AU8A 2OAEA 1EUDA 5B30A 5TY0A 5HFJA 5B7PA 3RVSA 4J3NA 4F72A 2X23A 4CLRB 5BNTA 5IABA 4MROA 2O5EA 1FNNA 2BMFA 4OQNA 4EHHA 3AKYA 4UM5A 2QAGC 4UDYX 3LUCA 1M1ZA 1PNVA 2VAVA 3OPQA 3HWX1 5G1OA 1CE8A 2H1CA 2XYVA 4LDZA 1L3BA 3AOEC 4R9VA 1YVUA 2FMIA 3A2LA 4WY2A 3RODA 2GZSA 3OFVA 3ZYZA 5FNVA 1YR7A 4DR6B 1KYVA 3WDLA 3BWXA 4ZC1A 4ZJZA 1JKFA 2ACKA 2X7JA 3E9MA 1JYSA 1ZIDA 4QGAA 4UUAA 4RYLA 3Q9UA 4ALNA 5JPIA 4QTUB 1NT4A 2VDOB 1DIGA 3OZAA 3VZDA 3FTCA 1A9PA 2QTVA 3DPIA 3EYAA 1A4UA 3CZMA 3DNFA 3H13A 2WM2A 1ZGAA 2AG8A 5EHIA 1QZ3A 5AVYA 4LY6A 3R3WA 4D9IA 1M7HA 5BW4A 2A3NA 3RVPA 2B2NA 5EE9A 3L7IA 1FSGA 3D5EA 2AX3A 4K2HA 4RFLA 3QIAA 5G02A 1H8EA 3EVNA 5KYNA 2IYZA 1P7VA 4BRSA 1U2GA 4W8OA 3ZWDA 5BV7A 3BRSA 3SSNA 1KFEB 5JBQA 4Q3EA 1G5FA 5KOIA 1V1MA 3EA5A 3SY8A 2QT1A 2AXQA 4R8SA 2O7SA 2BGKA 1TZMA 1WZEA 4DZRA 1Y8RA 2QTZA 2VG8A 3K2QA 4UMEA 5EE1A 4IJKA 4R1OA 3FOZA 2QENA 4ENRA 2XMGA 2DQ4A 2PS0A 1Z7YA 1QAQA 1U2DC 3VPBA 3Q0TA 2BHRA 3D8TA 3NDRA 1R0YA 3VJRA 1VYHA 1IUKA 3KQTA 1PGQA 2MWMA 2O0KA 4Y1EA 1NURA 2Q2OA 2VXYA 2YXLA 4GIBA 1M1YA 1MX9A 3PEUA 3AR3A 5KSOA 5LWQA 3VO1A 1JB9A 1X70A 4JC0A 4REQB 1ZR2A 4WJZA 5IK2A 3HE3A 1ZNWA 2OHJA 3PGMA 4BX9A 4ZDJA 4HYTA 1JLLB 1WB5A 4G4SO 1DS6A 2RH5A 1W73A 2D1RA 3W79A 2YXBA 1ISHA 4PPGA 1ISPA 4IHJB 5LA6B 3RFTA 5LMNB 4DR7B 1WOMA 2FX5A 3C7DB 2C8VA 4XR9A 4O4IB 5I7EA 4JFRA 3ZHOA 5DOVA 4MUHA 4NLLA 1IDN1 2LV8A 2H2DA 3BWDD 1WTAA 4XWKA 3SJZA 3ZE1B 4RF3A 1QIIA 5CAEA 1WA5A 5K4GA 2VR1A 2C7QA 2BRUC 3FYDA 3H8WA 4FU0A 2ZUTA 1AKVA 1OC4A 3BK7A 2C31A 4Q39A 4MW9A 4XYBA 2EZ4A 2VSYA 3IAFA 1KZ6A 5LD2C 1P5FA 1SG0A 1PEAA 2WAYA 4DILA 2CHEA 5F7XA 2FFBA 1YFJA 1K8RA 5DOZA 1SRRA 1B4DA 2RJNA 4JCCA 4KZKA 4HDKA 3EEQA 1BU5A 1PLJA 2E49A 5EXXA 4F2PA 1DJOA 5HQ3B 1TEHA 4JB3A 3TSCA 1TZ2A 3O75A 3GT7A 2SHKA 3NWEA 3OBIA 1E4OA 1V5EA 3OU7A 4RGVA 2CUKA 4IQ8A 4BNFA 4CG3A 1P2SA 9ABPA 4DC9A 5T4EA 4F6RB 1XZIA 3W77A 5A1JA 5LZ2A 3QIVA 1JBEA 4I4IA 3OQVA 5J47A 2PXXA 3U4GA 4B75A 3LM8A 4XX0B 5D86A 2DZDA 2E4XA 1XRJA 2ILVA 3P9RA 4A23A 4D43A 5AVRA 4ARCA 2RGXA 3JAWA 3I37X 4Y6PA 1DX9A 2XDAA 2ZQ5A 1PJ2A 2GAIA 1ND5A 3A4YA 3AI7A 3H6KA 3L8YA 2W70A 4C07A 3L4JA 3AHIA 3BZUA 1KF0A 2D13A 4HH4A 5KQPA 1A76A 1K4MA 2X14A 1G8SA 2CZCA 5FUVA 2YJGA 1KI1A 4LJ7A 1WTCA 4BNHA 1SXJE 2FFQA 1O6BA 2GN9A 2IXGA 3D3KA 4IMIB 1I6KA 2FTKE 2WAMA 5KVCA 2VP4A 1GTRA 4Z9XA 2PTGA 1X3SA 2AMVA 2GDZA 3MYRA 3PITA 4HD8A 1N33B 4Y1GA 1QH8A 4BNYA 5BN4B 1GQFA 4WXYB 3FMIA 4UHFA 5KVAA 1WG8A 1WABA 3EIOA 5CGZA 5EJ5A 2WIBA 1V9SA 3SBOA 2EBWA 2H6EA 3FFWA 3FOCA 4OKNA 1TL7C 1H93A 2GNPA 3WMGA 1EM8B 5ADUS 2BI4A 2P6PA 4JSTA 4FOPA 4QKQA 1P62B 4JUFA 1WPXA 4BB9A 3U3DA 3T7EA 3LS2A 5FPQA 3M4ZA 4TROA 1IWPB 1KAEA 5DVZA 4TZ0A 4MTLA 2W00A 3E5NA 4KCGA 3TSOA 1FDWA 1VKNA 4NOKA 1TVCA 3OKPA 3N7UA 4XWGA 5EJFA 4A7PA 4KW7A 3PFHA 2AI1A 5CW1A 2B92A 2P7HA 2R8RA 2WU8A 4Q1CA 4EW2A 1RYMA 1VRCA 2JGEA 3NOQA 2EW1A 2AH5A 1F20A 1UPFA 3VR4H 3GPLA 4IHKA 5B1DA 2V1UA 2JFPA 3W1VA 3VA7A 3UT6A 2JS7A 2PA3A 1QJCA 3DMTC 4ZK6A 2BR3A 2JJ2A 3R9WA 3NCHA 1V7QA 4EA9A 3QE2A 3DMYA 1GZ7A 1QNLA 3O2NA 1LRKA 4LTNA 3TSZA 2VQFB 1BDHA 1E32A 1GCAA 3LVRE 3EPRA 3SIRA 5BSFA 5DBGA 3ROPA 5J58A 1F0PA 2PUDA 3MA0A 4RZQA 4CVNA 1OI7A 1X6VA 3AEQB 3VR0A 3NTRA 3RNLA 2X9QA 3SYLA 5JECA 4Q1BA 1HORA 3O3OB 1OU4A 4GW3A 4F7WA 5L3SB 2ZTVA 1LGYA 3CPSA 3IAHA 2ZK7A 5KYYB 4QIHA 4ARZA 2PZAA 4I5GA 1LNSA 1WDLA 5FX2A 1JQJC 3VR5A 1L8OA 5JYCA 5KSWB 3TQIA 2Z98A 1U8EA 5CVDA 2FY8A 2Q41A 5BVGA 2V1XA 5KCZA 2C5LA 4TXHA 4IIXA 3PA8A 2VJKA 5E4FA 3ZI7A 2W58A 5DIFA 4EPXA 3DMNA 3ZVLA 4U2CA 3RVDA 1R88A 3SOZA 2D3TA 2HDHA 4RGYA 4XJTA 1DC3A 1R0SA 5HHTA 1SIOA 4GVLA 2XNJA 1KYWA 4BB0A 2QL9A 4HUQB 5DULA 2DBQA 3AIKA 1LSOA 1DINA 4RADA 3KYCA 3T9AA 3DAFA 3CKKA 3CV3A 4KYUA 4WFIA 1H9CA 4WGGA 4DG5A 3U09A 1V5GA 2OL4A 1Z26A 2WPNA 1P4HA 3I2JA 3NM6B 3ONVA 1IY2A 3LYLA 3OTGA 3PUWA 5JS6A 4X5OA 4NYJR 3GNTA 3H5AA 3L06A 5I8WA 4GOXA 3U19A 4TN5A 3FB4A 4E1VA 2AVNA 3MAJA 1VKJA 2IPNA 1AA6A 1N8SA 4D81A 3RSOA 4YXWA 1Z2CA 4R3WA 1YR8A 4BLUA 1AMUA 4Z54A 3K4PA 1YUNA 2ZJ8A 5T67A 1NP3A 2GJAA 1XDWA 3PC3A 4PYMA 5E9AA 2WDZA 4LQCA 3UGKA 3UOAB 1VHTA 3OCCA 3QOYA 4B71A 3UA4A 1IZZA 2O50A 2YRXA 1SK9A 2WA1A 3G3EA 1I3KA 3QBTA 3UB4A 2C9ZA 2VQSA 2K7ZA 3VNQA 5EJGA 4D4HA 3D6FA 1RS0A 3OZBA 4CE6A 1T6YA 3QX8A 3ZDDA 3ASUA 3AUFA 4I8XA 4RGBA 1ZEJA 4CMKA 4ETWA 5K6AA 3I01M 1L6IA 1JT9A 4H0NA 2YS6A 4JY7A 2YWHA 4R7TA 4YUWA 3GT0A 4I55A 3PGLA 4B31A 1LDEA 3B5EA 4W9RA 5IBQA 3KVYA 3OUZA 3ZWOA 1MEJA 5C7YA 2IY7A 4MNTA 5HILA 1ORVA 4H0CA 4BE7B 2QD1A 3KLMX 1GILA 5JVDB 3JYHA 4TRRA 1NATA 5T7BA 1K89A 5JNVA 3R0XA 1CZRA 2XTMA 3EDOA 3N5CA 1KAQA 1UL1X 1V5IA 1RI1A 3JS5A 1UKAA 4ITRC 1UEXC 1YVPA 1KI6A 4GP6A 4NHOA 5EIEA 4XLLA 1K08A 1VDZA 1EGMB 2C4UA 2R1VB 1E9SA 2RI6A 3IP5A 1J2YA 2B4YA 3PZRA 2JVJA 3T7IA 2J0EA 4FTWA 1Y33E 5GIOE 1TK3A 3I1IA 1A27A 1QIEA 4QXRA 3CO0S 2H85A 3H2IA 3QHQA 1GZ4A 1TGYA 1Y6JA 1NQAO 3V1MA 1N2CE 5AM3A 1OF1A 3OCZA 1LQUA 4YV7A 3LDAA 3GBVA 4CT5A 3NKLA 2GHIA 1FU8A 1OA1A 4HDRA 1Y3CE 1UOEA 1ZESA 3L82B 1CYDA 4QBGB 4F91B 2HDWA 2WYUA 1T8RA 4CM7A 4PSAA 4Z9AA 1Q95A 2G9UA 1RPTA 3LX8A 3WGMA 4P4UA 2EW2A 2QB5A 1OXMA 3MLAA 4CLEA 3AGPA 3A06A 3NOXA 2I3DA 2DBZA 4EG1A 5FRDA 4DCSA 4FMDF 4R9RA 4BNDB 1VSUA 3N0RA 3DO6A 3UJPA 1M6VB 1AKUA 3MUOA 1XRPA 2IYLD 2O05A 1OYYA 2RGYA 1QO0A 3DW3X 3GUHA 5KMGA 3N3AC 3I5MA 1K27A 4FFBA 4JV5B 3TN7A 5KQSA 2IYEA 2YC2C 4Z1OA 2J9GA 3D5TA 3QVKA 4U9HS 2RBKA 5TS3A 4EGCB 4TMYA 1IIRA 4RZIA 4TLLB 3KU4A 1TW3A 4YMHA 2C20A 1OI2A 1MH9A 1I2DA 3DR3A 4ZOLB 3SE0A 3WHIA 2CXPA 4B7UA 1UKCA 2XRZA 4RZ2A 3TEMA 4RKFA 5AW6A 1IBMB 2O7QA 3O8LA 2R7LA 2XUPA 3DL4A 3ENKA 3EVGA 3EXFA 4XFJA 4Y1RA 3RRXA 4OB7A 3SXUA 2Z5LA 1GIAA 4ED9A 4EO9A 3ZLTA 4JLOA 5F1YA 4YV0A 3PX2A 1WSAA 1C8BA 1PDVA 5CX1A 3LDUA 3I73A 4JJFA 2B2CA 4HNAA 1L2TA 4TYPA 2DFDA 4GBED 3TOVA 4IDEA 4KI7A 5AICA 1N0WA 4N5DA 1A8QA 2JIBA 3ZKWB 3OFND 5GQSA 1V95A 4GBJA 1PR1A 4GDFA 3VKHA 1UMDB 5KX5B 4TKUA 2ZM5A 2DH6A 4M54A 4BXOA 3ZDBA 2QN1A 3FZGA 1P0MA 1P5RA 3OM8A 4IDDA 5JDCC 4EI7A 3QLVC 2WJ3A 2GAJA 1N2OA 3ZEIA 2VT2A 1FFGA 2Z08A 3GR6A 1GITA 1SVIA 4C6TA 5BN3B 1Y9EA 4OK5A 2JCVA 2SBTA 1H1DA 4J49A 1HXHA 4NMXB 3TI7A 1PS0A 2DP4E 4YMVA 4ND2A 5I4CA 2D5BA 4CTJA 2QRZA 2ZCJA 5ESWA 4GUAA 2OXEA 5K0EA 2X8AA 3JQCA 3M33A 3FX2A 3UM9A 1OBFO 1U7OA 4IX9A 5TS2A 1HL7A 4X1KB 4A5SA 1XZHA 2A7XA 2BMDA 1FC0A 3H3FA 3BKXA 4ILEA 1ADYA 4X00A 4X92A 3ANXA 3HS3A 1MC4A 2QYSA 221PA 1CUSA 3NPMA 5JI3E 3IEVA 1BQ4A 4R0NA 3PQ5A 1OKKD 2B8JA 1Z37A 3X1ZA 4CL0A 4XWAA 5LB4A 5FV4A 4TWRA 4WBSA 1T9GS 3FAZA 1FSZA 5F4BA 3SF0A 5D01A 3D6NB 5GZ6A 1DAHA 1N3IA 1KQNA 3ZDZB 4BQRA 1JVBA 4FFVA 2X22A 3WFJA 2OG2A 3R44A 1P0FA 5EJ9A 3P9PA 3EYWA 4PLYA 1O89A 4V0LA 3RTBA 4BQQA 1HZZA 4FJ0A 1HYGA 3QFRA 1HRDA 2IYWA 3PHJA 2H07A 1SXIA 1UBFA 2Q0XA 4HRAA 4YDHB 4ZVLA 4BWGA 1QPZA 1B43A 2AR9A 2PRYA 1O95C 1BS1A 2ZSHA 2VUIB 4TRJA 1KAGA 3CJTA 1WW8A 1WLSA 3FJYA 4C4AA 2FX3A 4GXRA 4CQNA 4KQHA 3D8BA 3FDZB 5IDYA 3UICA 5AP9A 1RCFA 2D00A 3G6WA 2PRKA 1KH3A 3FUVA 2GM4A 3MJFA 4JD5A 5J2TF 2O4UX 3GJ3A 2Z8XA 2RKBA 1K98A 4MYHA 3RG2A 1K5PA 1AZWA 1T9BA 3L5KA 1GJRA 2FI1A 3DZBA 4I2NA 4KQ1A 5KJ6A 3ZNPA 3NAMA 1Z6PA 4ZQHA 3DLBA 1ZRNA 3BIOA 3A2MA 2YV4A 3NEJA 3NHUA 1PR9A 1ZDMA 2IZ1A 4GT1A 3UB3A 4PCAA 1MOSA 5CB4F 5FOQA 2VF7A 4NV1A 3IDOA 1APBA 4QYTA 1MRNA 1XOIA 1GTG1 5HF5A 3EWNA 1MO4A 2QVZX 3WP1B 2I4IA 3TQHA 2JGKA 1E4YA 3RWOA 4HAWA 2VJNA 1GRVA 1AF4A 3B9BA 2KI5A 2HJ9A 1B41A 1VZ3A 3AIMA 3PI6A 3IV9A 1DAIA 3FMFA 3WJ7A 2C1ZA 2O1EA 2I2XB 4IAOA 1Q21A 1UOPA 2F67A 2J59A 5EZ6B 2Q7OE 4E2ZA 4EG3A 4DR4B 1X7ZB 3TR6A 2BY4A 5F77A 1LFDB 1K6JA 3HLYA 2GTPA 1J0BA 3DXXA 3CRNA 1QQ5A 4TV9B 3TRDA 5JYDA 2VK4A 5DX1A 2QTBA 4JLDA 4WMLA 1QCZA 5L3QA 2PT6A 3V8NA 1BX3A 1Z82A 3QKSA 3GDFA 3LW8A 4NU5A 3SOPA 5JG7A 5CT9A 1TF5A 3MUEA 4MP3A 4O5AA 2DOKA 1FQKA 3EVFA 3LCUA 2QRGA 1I80A 3V4LA 4ZZ1A 2GWHA 5AM2A 1EQUA 1XMPA 4M1ZA 1JPVA 1U0FA 1VJ0A 1TB4A 1EBUA 5HXAA 1B26A 3DNPA 4UVHA 4PZDA 5B6JA 1T2VA 1KETA 3BMOB 3CSSA 1FP4A 3HEMA 4ZJYA 1GSOA 4PBTA 4D3XA 4RTMA 1OA0A 2QUZA 2VJBA 1A8HA 3P0IA 3UEOA 3CLTC 1SXQA 1VE3A 4MW0A 4BNLA 4INOA 1CDEA 3CH4B 3RCBA 2PKWA 1A9QA 3QYPA 1QFSA 3FKQA 5T4FA 1OFIA 3ADBA 2F8MA 2IIPA 2E37A 1T26A 3EZXA 5EJMA 3M3DA 4EVIA 2RBGA 2NVBA 1LI5A 3N39C 3UW3A 4EG4A 3GP5A 3G89A 2PUEA 4RLFA 3GN2A 3K05A 4RPGA 3ZWYA 1CNEA 2TS1A 3U26A 3UB2A 2NQ2C 1M1NA 4EYQA 1DBRA 4QU9A 4I5FA 1MENA 3BH6A 1J0EA 4KE8A 1IZ9A 4MS3B 1Y1KE 1Z2DA 4UEJA 4QJ3A 1CJUC 1GPKA 4PC6A 5D5QA 1BO6A 3WSWA 4CIYA 2I1LA 3DPUA 5BSWA 3QHAA 4MV9A 3F2VA 5DBHX 1R3UA 3G0HA 2FVYA 5FR1A 2YKGA 4LJ8A 1PWXA 4KR2A 3ZG6A 3PUKA 2YICA 4IHQA 4KWEA 1ZGCA 1EGQA 3MRVA 3TJMA 4H0FA 2NP6A 2V7GA 2PBRA 3GRRA 1BW9B 2I6SA 4Y1FA 1D1PA 3PDJA 2DG2A 4XOUA 3LPAA 4M55A 1IL0A 4BNXA 3E5RA 4CLDA 1B0UA 5AOCA 1FVFA 2VNAA 3OEWA 1AQIA 1OZGA 1QYIA 3BXFA 3IMGA 4RV4A 3P0RA 4BLQA 1VLHA 1GQRA 1PFGA 3A9SA 1XCGB 3X2EA 3VH2A 2HGZA 1UPAA 1J0CA 1Z2PX 3S8EA 3C3PA 4KG7A 1G291 2HF8A 3KQNA 1EFTA 2WICA 3BZBA 1CY6A 2WD9A 4H3SA 5FI0B 2QTHA 4HFJA 3MCWA 3WL6A 3ZHUA 1EUYA 1DLIA 1LLFA 1M8JA 2CEKA 2VJCA 2TMGA 2ZI4A 3U44B 3AEYA 1H2HA 2R68A 3EF3A 3PKZA 4F04A 1PF7E 5B4UA 5FTLA 4IYRA 1FDSA 1P33A 1KSFX 1PJCA 1YHZA 2R5NA 2XT6A 1NKVA 2Q21A 2C4TA 4BN0A 1PGJA 2Z58A 1DWOA 4F8EA 4CIWA 4B44A 1EQAA 2VDWA 4HTFB 2C9YA 2B36A 1D5WA 1U81A 4J1SA 3V7YA 2HO4A 4CL2A 2BHTA 1TU0A 3NORA 1R27A 3TNJA 1C4XA 2RSLA 3GG2A 2CLLB 4GYYA 4I4LA 4LBWA 4W8HA 1UODA 1A9XA 3CZAA 1IM5A 1CDOA 2MSDB 4DT1A 3RAFC 4EUSA 1KJQA 4BO5A 5A4FS 4ARSA 8ATCA 10MHA 4KLNA 1PT9A 3FSGA 3U4HA 4DIEA 3N87A 1ACJA 4NPCA 3TRHA 4E4RA 4MLCA 5CTJA 2X13A 1J8MF 1XJWA 1JXOA 1MUUA 4JMPA 4EA7A 2FPIA 1C3LA 5CA1F 1DX6A 1YDHA 4KI0A 5FBWB 4U1RA 1PTKA 2REQA 4K6HA 4R2IA 3H8VA 1J90A 5EYPA 4XXHA 3RHZA 4CKBB 1P8AA 3GV0A 1ZEMA 1P80A 3H83A 4ZCMA 1SVUA 4LAFA 1H4QA 2NXNA 1WXIA 4YK7A 2SECE 4NV0A 2AUMA 4AG5A 1IVYA 1W5AA 3WKBA 4BU0A 3WGGA 1CUHA 3A32A 1V7CA 4G8JA 3SIXA 1RWQA 4HOYA 4V24A 4IIYA 1GR1A 3ZDCA 4ZFNA 2PSJA 3EIFA 4KMOA 4LFAB 1X74A 5DCUA 1N1EA 4QEZA 1DQSA 1P75A 3LVBA 2FHSA 3EIWA 3HADA 4RJIA 4A92A 2P4HX 4KFCA 2A4MA 2H3EA 3K5WA 4W5HA 3W7VA 2JRLA 1T0IA 1Z0JA 1FSFA 1ZITA 1KI7A 3LO5A 3P20A 4G25A 4QBIA 1F7UA 4P33A 1ZVKA 1H2WA 2P4QA 2Q6OA 3GJ5A 4I1SA 4HGZA 1U7TA 4DF3A 5DYIA 1ZNQO 3NHAA 4HNHA 2FZKA 5E7QA 1Q1NA 2X0IA 4OXNA 3NAQA 1T0PA 5DHAA 3NAGA 5H3CA 2I2AA 5KQGA 1AV6A 4HAZA 1J0XO 5BT9A 4D4MA 1CJTC 3A6GA 3KDSE 3KKKA 3G1UA 5EQDA 2FDRA 2XNCA 1COWA 1BVHA 1PG5A 3AOGA 3M70A 2FQWA 1U5AA 2QZPA 5FEUA 1CXZA 1DFIA 3BT7A 2QHXA 4D0SA 4X90A 3UJ8A 4AKSA 5K5EA 1FZTA 1TPYA 4B3MB 1YFZA 3FDXA 3DKVA 3HG7A 5E7IA 4RHYA 2AEEA 3PXDA 3RIHA 2SCUB 4EB6B 5HA5A 1ABEA 1BXRA 2JFVA 1HNNA 5I4KA 1Z35A 2FRDA 2GK6A 5J3JA 1DCFA 1VGVA 1ZS9A 2BISA 2WSYB 2ZRJA 4JBWA 1NJSA 1SBYA 2EQAA 2NXWA 3DYIA 1KE1A 3ZOKA 3T41A 1KJ9A 3V4ZA 4JASB 1XTPA 4Q7KA 4HLQB 2ZUSA 1JHPA 2BKAA 3FNFA 4MXDA 2ODTX 5FI3A 2G08A 5C4MA 5KYTA 1HQKA 1L5RA 1VPTA 5TQ0B 1OLXA 4D79A 5H4GA 4DQDA 1EXNA 3IP7A 3RJZA 5JWHA 1VI5A 4OJNA 1BE6A 1GCOA 2UV8A 5IFKA 2GF0A 3I2IA 2PIDA 1KO5A 4YAJA 3NOVA 1Q22A 2VK2A 3K96A 5TJ9A 3DE0X 1R10A 3WGTA 5A4DA 2XXAA 1VJRA 1MVOA 4LS3A 2ZDQA 2WQZA 2J9FB 5MF6A 4TQ9A 3B1FA 4IDQA 1K92A 5DTQA 4QDTA 3RU3A 3CRQA 1XROA 3QBVA 4OXYA 3SZ3A 1JHAA 3KSDO 1B73A 2PD6A 3A0RB 1E1LA 2WP0A 3B7WA 3DZCA 1U1CA 5AJWA 4BRWA 3RYHA 2G36A 1DT5A 1E1MA 1BJTA 1PQ4A 1Q7CA 5SZKB 3V5NA 4Q19A 1M7BA 1L7OA 3OZIA 5HKKA 3U1TA 5IX8A 4CCWA 3E3NA 1T4CA 2E4ZA 2EOAA 2NYRA 3N2LA 3A3PA 3UOGA 4CQMD 4YGYA 2H2GA 1O5IA 1Z62A 5E6RA 4XIFA 4S04A 3L02A 3VFDA 3TZEA 3H11B 4XJSA 3GBSA 5BQPA 1FNCA 5AVKA 1RLIA 4GZ6A 4A9AA 3KOXA 1S5PA 2OK7A 1TXGA 2OLEA 2WIKA 3LOUA 5KOHB 1G20A 2P1DA 4Y2UA 3DNMA 3LOQA 3OECA 5AI5A 4MB0A 2Q5QA 4ALLA 1SB9A 2UUBB 1EU1A 1ZQ1A 3LYAA 1VRWA 5BV2P 5C1DA 1DZ3A 2HQOA 3F2IA 4I50A 2QVYX 2FQXA 2BMVA 1Q3HA 2JIDA 1N6PA 1XZJA 2PH7A 3CQ9A 4OG2A 3C6QA 3TFWA 3V1UA 4ERXA 4G1UC 4RM3A 3WBBA 5TMBA 4PYJA 3I3OA 3GMTA 4JU9A 3IHKA 4AWAA 3BS4A 1WCIB 4MYCA 1J00A 4X41A 1UJNA 3QVMA 3O3MB 2O5RA 1EUZA 2FP4A 1ENZA 1O4VA 1XQ1A 3W2IA 1PSWA 4UTVA 1TCVA 5A3QA 2GBIA 3LWBA 5DM60 4BKUA 2A0KA 5IJWA 1XLTC 2HPZA 2Y1OA 1CCWA 1GTVA 4XQEA 4P1ZA 5EA2A 3RUFA 4LXYA 2PMKA 2G5CA 2WRZA 3ROEA 3TIXB 3PFWO 1M5UA 1W85A 1XAJA 3LNTA 4EFNA 3SXJA 3FKSA 4WKNA 3TZKA 1JDPA 3V46A 1QP4A 1I7DA 3O8OA 4DIKA 1E9AA 3PDCA 4P32A 3D7RA 2VHEA 1YA8A 3U0BA 1SKAA 2XCRB 4F92B 1X7YB 1HKHA 1T5LA 2A5LA 3NHRA 1FP6A 1HEIA 4GH5A 4PGAA 4OP1A 3CEPB 4LXIA 3N2EA 1L5HB 2WWWA 3U3MA 1TJNA 1MMFB 3OQIB 4RK7A 3KYBA 3HV2A 3MWYW 1U2TA 1A8UA 3SQNA 1D07A 1TAQA 1U0OC 3R0QA 2XQKA 4XKJA 4G8BA 2C2OA 2CLHB 3CCCA 4CTNA 5KO2A 4WESA 5LLTA 4MWZA 5ED4A 4AJ2A 1Z34A 3I9LA 4FYIA 4XGKA 1X92A 4HH1A 4EKEA 1T0JB 1EJ0A 3AIOA 3C5WP 1A9TA 2C5HA 4XQ0A 3TZQA 3CUWA 1TCCA 3LV8A 5L4NA 3OF5A 4HMOA 3GJ6A 3N8HA 4IYJA 3S70A 4CV1A 2DQKA 3K9GA 3RLIA 3MQ2A 1JMYA 5ED0A 3UAVA 2PRZA 5FBZA 3TB6A 4OK6A 5EWLB 3BFPA 4XDHA 1N5MA 5B53A 1CKEA 5FUWA 3WZ2A 4IGIA 3K9BA 3K16A