4YV7A

Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmei_3018, target efi-511327) with bound glycerol
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
GALKIGFSQATQQSPFYVALTDAAKAEAQAQGDELFYADANGDITKQNNDVQDLITRGINVLVINPVDPKGVTPSLAAAEAAGIKVVTVDRPVESGAASFVGRDNKAMGELVGKAAVDTLGPDGGKIIEIQGDAGGAVARDRRDGFQAAVSGRPNITIVEGPYCDYIRSKAVTAMQDLLQAHPDLKGVYAQNDDMALGAMQVLAENNRTDVKVFGVDGLMEAVRAIADGDQYVATALNDPDAEGRLAIQTAAKVARGESVPEFVDAGTGLVDKSNASALVGQSTFAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title CRYSTAL STRUCTURE OF AN ABC TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM MYCOBACTERIUM SMEGMATIS (MSMEI_3018, TARGET EFI-511327) WITH BOUND GLYCEROL
rcsb
source organism Mycobacterium smegmatis
molecule tags Solute-binding protein
total genus 107
structure length 288
sequence length 288
ec nomenclature ec 3.6.3.17: Monosaccharide-transporting ATPase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yv7A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yv7A02
2BGGA 2RJNA 3CLKA 4LRQA 4F3TA 5FWXB 3A0RB 2PUEA 3RVQA 1KMIY 1Z26A 1ZH2A 4MAAA 3N53A 2GKGA 5BRJA 4ETIA 3O2JA 2LUOA 3MQ4A 2FQYA 3D8UA 1Y1LA 3SQNA 4KRFA 3QLUC 1YIOA 5KC8A 2H0AA 1NXOA 4EYOA 1DG9A 1D4ZA 4HYEA 4MR8A 1XWWA 4Z4IA 3LUCA 4RKRA 1A2OA 2OQRA 3ILYA 4LDZA 4H3KB 1M2EA 4MS1B 1Z17A 3LUKA 3QLUA 5IX8A 1QKKA 1U2QA 2A9PA 3Q41A 3RVJA 3DGFC 1BDIA 1M2FA 2ZWMA 4QYMA 7ABPA 1EWKA 4MQFB 5D2CA 2Q5CA 5EWLA 3N8IA 3Q7TA 4Z4FA 1Z15A 3CNBA 3MF4A 2PL9A 3QLVC 4YR7A 1QP0A 1ZVVA 4N47A 4QPJC 3O21A 3IDOA 4RK1A 3O74A 2GBPA 5KI6A 2L18A 2PLNA 3IP7A 1YMUA 3QLVA 3QELB 4TLMB 2IYNA 3MMNA 5TPZD 3QX8A 3BRSA 4QICA 3EGCA 5HM6A 3HDVA 1L5YA 4YGXB 3UUGA 4OBBA 3LTEA 1EWTA 3D02A 2X7XA 4RXUA 1DCFA 1XHEA 1Z16A 3GV0A 3KLNA 4IMIB 4RSMA 3GT7A 2FKAA 4LDAA 3SG0A 1D1QA 1YMVA 1ZDMA 3ROTA 2PE5A 2HQOA 1NXVA 1QQAA 2R4QA 4MS4A 4NV3A 3NHMA 2LP4Y 5T3YA 4PYRA 5TQJA 2E4ZA 5FWYB 1JYFA 5JNVA 2E4XA 5B3JC 2JBAA 3QEMB 1BAPA 3QK7A 2FMFA 5DLEA 5DKFA 2QU7A 4RDCA 5JNSA 3RVPA 2LIVA 1HEYA 5B3JA 1TMYA 3G1WA 1PNTA 1D5WA 3BILA 2PUDA 1NXWA 3RQIA 1RXEA 5DTEA 1KGSA 3OQOA 4N41A 3OLZA 4JB0A 4PZ0A 1GCGA 1YK0A 4RY0A 4N03A 3KS9A 1ZN2A 4XXHA 5DGCA 5TPWB 1MVOA 1QMPA 4RWEA 3EQ2A 3GA5A 3B2NA 2JVJA 3NNSA 4UHKA 5PNTA 2FW0A 4W5QA 3VNBA 4WZZA 3FFWA 4ZMSA 4G0YA 1D2AA 4EYKA 1TM2A 4ETNA 4EYQA 1PEAA 3N0XA 4YWHA 1OXBB 5JNWA 4WUTA 1DC7A 1RNLA 1A0OA 1ZY2A 2NZVG 3EODA 3CG4A 2V0NA 3H5TA 3H5LA 3KYIB 4MLDA 4G0ZA 4MR8B 4TMYA 2R48A 3H5VA 1QP7A 4H3HB 1EFAA 4FB4A 5DCLA 3RVLA 5FWYA 2WJAA 3KG2A 1A04A 5KQLA 4MYRA 3DLBA 3VNAA 2JVKA 4G86A 2E4YA 2WRZA 3QEKA 3CFYA 1SXIA 4ZYLA 3DGEC 2AYXA 1P6QA 2RDMA 1ZH4A 3KJXA 2LBPA 3O1IC 3KYJB 1B00A 1QPZA 1GCAA 2QV0A 1DRJA 1DRKA 3BREA 4G0OA 4RU1A 5BRAA 1QO0D 2L17A 1T34A 3MM4A 1DP4A 4JAVC 2MYNA 3S99A 2QSJA 3N0RA 4LE1A 5JS2A 3O1JC 2FLWA 3JVIA 1ISRA 1FFWA 2IKSA 3RVKA 1P2FA 5HKOA 1USGA 3OLXA 4E7OA 1S8NA 4L4UA 1W9HA 1URPA 1ZITA 1MIHA 3OQMA 1USKA 4RXTA 3O2SB 4KV7A 2FMHA 2FQWA 4EVQA 1FSPA 4RZSA 1ZGZA 1FQWA 3JS5A 2XDYA 4NICA 2RJOA 1JFSA 3GYBA 1DBPA 2FMKA 3H1FA 4KVFA 5TPZA 3UK0A 2FMIA 3JY6A 2LPMA 1YK1A 3CG0A 4LE2A 3HCWA 1GUDA 4YLEA 5C5EA 3GRCA 4MS4B 1PNRA 1JYEA 2IOYA 3CTPA 3LUAA 4XLTA 1KRXA 2JBAB 1KRWA 4TN5A 3I5AA 1SD5A 3EJWA 4KNYA 3G85A 3LKVA 1L5ZA 1H9CA 5FBHA 3A0UA 2RGYA 2MSLA 3C6QA 3H1GA 3CZCA 4UHJA 4DADA 3HM9A 4H60A 3MA0A 2ID9A 5JS1A 4MRMA 4FE4A 1MAVA 5IUKC 4N76A 3HSYA 4KZKA 4TLLB 4Z0NA 3HUTA 3HVRA 3JTEA 1JL3A 2F8TA 4P98A 5IEJA 1JWLA 1EHCA 3GBPA 2E4UA 1K66A 5CHYA 1DC8A 1BDJA 2GX6A 1RZRD 4EVRA 1E6LA 4JB2A 2HJ9A 1DBQA 1JF8A 5TQ0B 2QVCA 5HSGA 2MYUA 3O1HB 1WETA 2PUGA 4Z4GA 3IP5A 3L49A 2PKXA 2A9QA 1ABFA 4HNRA 5E3JA 4KREA 1ZAYA 4M88A 4HNSA 4YO7A 1CEYA 3C3WA 3HV2A 3LMKA 3DLHA 1AB5A 2HSGA 4MR9A 1AB6A 4G0PA 1Z13A 5ED4A 1JH9A 4NCAA 3H5OA 4RY8A 3HEBA 3M9WA 1MB3A 4L85A 2QW1A 4YRZA 3BRQA 3MYYA 2W42A 3OQNA 1PUXA 2CD7A 1YS6A 2WMYA 3SAJA 1VRVA 4IGAA 4ETMA 4P1ZA 4Z9AA 2FEPA 1ISSA 2L19A 3E3MA 3LUHA 2FLKA 5EWMB 1LJLA 2B1JA 2PJUA 3K4HA 5GQSA 5IEBA 3DBIA 3M9XA 4MGEA 4G97A 1D1PA 5KQMA 3N6VA 1F4VA 1BA2A 4LZLA 2FEKA 2R25B 1SXGA 2QR3A 3RH0A 3TX6A 5KWSA 3IP6A 5CNKA 3A3KA 1YS7A 4WT7A 1DCMA 1U8TA 2M1ZA 2AYZA 3EQZA 1GLGA 3K9CA 1QO0A 1E2BA 5KQGA 3HZHA 2I6FA 5TQ0A 5JNRA 3GL9A 1RXIA 3E61A 1JFVA 2FXIA 2NT4A 1C0EA 4F12A 1J56A 3H6HA 3IP9A 2FVYA 5IBQA 9ABPA 1U0SY 1JBEA 4RK4A 4MQEA 3Q7RA 2H3HA 3QLTA 1E6KA 5TE9A 1PEYA 1VLZA 3MIZA 3H6GA 4RXMA 3EDCA 3BBLA 4EY3A 3L6UA 3SY8A 2NUBA 1LJUA 1CHNA 1SRRA 2IPAB 4HNQA 4LX8A 3FFTA 4RV5A 3F73A 3EAFA 1ABEA 5EWJB 4EUKA 2CWDA 1U2PA 4JOQA 4PEVA 4O1IA 3KKEA 4MRMB 1Z18A 2QXYA 4KPYA 2E4VA 3OM1A 1Z2DA 5EWMA 3Q15C 1RPJA 1JX6A 3LUDA 2IDMA 1NATA 1QQBA 3TD9A 1Z25A 1NXPA 1Z12A 2JK1A 2IPLA 4G0QA 3CZ5A 2VYCA 4YS6A 4OTZA 2CHEA 1LK0A 3CHYA 4ZMRA 3CS3A 4ZPJA 5IULC 4E7PA 2FQXA 4IF4A 4Z4CA 2MYPA 2F8SA 1QNLA 4Q7EA 1W25A 5CNMA 5TQ2A 1Z2EA 3FMVA 4IILA 3N75A 2HPHA 5IUNC 1RZRA 1M5TA 4B09A 4YP9A 1NXXA 3EULA 3OO0A 4MR7A 1PHRA 4KQCA 4MR9B 5F64A 4S05A 3H5IA 4G0XA 4EGSA 4W5OA 3CU5A 1F51E 1TVMA 2PUFA 2PUBA 1JDNA 3CKMA 4O5AA 5EWJA 3UKJA 3TO5A 4Z4EA 1JDPA 2J48A 3JPYA 5C5CA 2FN9A 5HQJA 1IIBA 2VUHB 1DJMA 3HUUA 4WXMA 4O1HA 5I4CA 1NY5A 2HQBA 3Q7SA 3I42A 3F6CA 3LKBA 3T6KA 5BR1A 3R0JA 4NCBA 4RS3A 1SXHA 2A9OA 2KYRA 3I45A 4PE5B 2GI4A 3LUJA 3SNKA 5JNTA 1YTUA 1VKRA 3HO1A 2NT3A 4QYWA 3H75A 2CHFA 4ZJPA 1TJYA 1YVUA 4WXEA 4JA2A 4XFKA 4MLCA 4W5RA 4Y9TA 4RK5A 1UDRA 4OLBA 2O20A 4LE0A 1JLKA 3KCNA 4OG2A 2ZAYA 2OENG 3NHZA 5KC9A 3ILHA 3HJFA 2M98A 3OMWA 3FGZA 4ML3A 4MQEB 1E6MA 4D6XA 4W5TA 4KQ9A 2B4AA 1LBHA 4IMJB 3IPCA 1P8AA 3CRNA 3OLYA 5FWXA 3C97A 4Z99A 4JASB 2FEWB 3M6MD 3P9YA 5FBKA 3HS3A 3NNDA 5JNUA 2MSWA 5GOTA 3KSMA 2PMCA 3RVNA 8ABPA 3KTOA 2MYTA 4MS3B 3W9SA 4F06A 4YV7A 1BDHA 3LUFA 3KLOA 2IPMA 1OXKB 1JFTA 4PICA 2PUCA 4MS1A 2VK2A 3OM0A 2QZJA 4MPTA 3ROFA 4CBVA 1NXSA 3RVSA 4NQRA 2VUIB 3RVRA 5T7BA 2JRLA 1DCKA 3DZDA 4MQFA 3LFTA 3NBMA 4OATA 4RY9A 3HK2A 2P9HA 3FFXA 1TLFA 4KK4A 3O75A 2WY2D 4Q6WA 1M5UA 2JB9A 5KQPA 4OLAA 4F11A 1EAYA 4WWHA 3NNNA 4FE7A 2FTKE 1NXTA 4G0MA 4Q6BA 4D6YA 3HDGA 2E4WA 2WWVD 1USIA 1R8JA 1FFSA 5TQ2B 2R47A 3A10A 3N0WA 3QELA 2MSKA 1EWVA 3GWGA 3OO1A 3C3KA 5IUJC 1BVHA 5CNJA 1NTRA 4F8JA 2ID7A 3LOPA 2NZUG 4RK7A 4KK3A 3F6PA 3H5WA 3I09A 4MR7B 2JVIA 4DQDA 4EVSA 2PAFA 1ZGGA 1CYEA 3FDFA 1ZHHA 3T8YA 1DZ3A 2JCGA 1C4WA 1XHFA 1VPWA 3JVDA 2IPNA 4JP1A 2QVGA 3KHTA 1QP4A 4MS3A 4KFCA 2WB4A 1I3CA 3JPWA 3OLVA 3F7NA 1ZESA 4N0PA 3GBVA 3O2QB 6CHYA 4S04A 2YHAA 4XAQA 2GWRA 2L2QA 4W5NA 2WJWA 3OMXA 2FN8A 1APBA 4EYGA 1LBIA 1U04A 3QEMA 4XARA 1K68A 5CNIA 3RVOA 5ABPA 2PUAA 4GPAA 1P6UA 1MB0A 2FSPA 3OLWA 3T38A 3H1EA 3TMYA 3IPAA 4YCSA 4KMRA 3SM9A 4IRXA 4RK6A 5EWLB 3T95A 4DN6A 3HXMA 4RKQA 4D74A 4GNRA 6ABPA 4N0QA 3RVMA 1GUBA 2A9RA 2HQRA 2PL1A 4Z9BA 2DRIA 2P4UA 5BQ3A 2N9UA 5TPWA 1FFGA 4Z4HA 3URMA 1JHZA 2YHBA 3LUGA 3Q9SA 1DBWA 5IC5A 3TB6A 2TMYA 4RK0A 3QX9A 4XASA 3C3MA
chains in the Genus database with same CATH superfamily
1GT91 4OP3A 1FMFA 2AL7A 5JTUA 5SICE 3ZD6A 2FVXA 3RG8A 4J0HA 3UV7A 5F9MA 3WL3A 3ZQJA 2RGGA 2BFEA 2BDTA 3F8WA 3NTLA 3REFA 2X0RA 2DE0X 5LB2A 1Z63A 1I6KA 1HDYA 1YIOA 2PKYX 1K8QA 2WKQA 2XYQA 4MJXA 4W9RA 2C42A 5F23A 2J3KA 3R44A 3BAFA 4PPGA 4Z4IA 1UKAA 1WXHA 4L8FA 3HG7A 2QQ5A 1ESNA 4F7DA 4Z3OA 2OGTA 2DTXA 4BFZA 3KZMA 4J9UE 3S2UA 1VL6A 4CLDA 1CVLA 4X1IB 1JMKC 2A9PA 2FZVA 1R9MA 5EMKA 4C9BA 3MEQA 3ND6A 4IO1A 3TW6A 1RRFA 4WNAB 4JLPA 1IOWA 5JMTA 3M6LA 4PHGA 5ALVA 3LX5A 4LCBA 3OZUA 3S68A 2IE0A 3DBRB 2BMEA 2X58A 1CV2A 1UMKA 3OJFA 4J0DA 2JH3A 2R7LA 4PGHA 3THYB 3UWKA 2NXJA 4XX0B 4GM4A 4PC6A 1DTWA 2VC2B 3C3PA 3IP7A 3AF4A 1E1NA 2FK7A 3GEMA 3MZ0A 5DOVA 4J0IA 3T1OA 5G1NA 3TQIA 4UUNA 4ALLA 3MRXA 5K8IA 1RHJA 2ZIXB 2VO1A 2B4QA 3T1NA 1XG5A 4X97A 4KE8A 2XCUA 3SIPA 1G66A 1FF9A 3EC1A 3FCXA 4OBBA 5LXTA 3BHJA 2VFAA 4FMDF 2PKQP 1E9EA 3LNTA 1KP3A 1KZGB 5JWHA 1XQ9A 1DCFA 1JJAA 4Q7LA 5EIXA 2HV8A 4JZYA 3LCRA 1AK2A 1FLVA 2FJ0A 2QS9A 3QYFA 1C50A 4TTTS 3HJHA 1QWSA 1KU0A 1WXIA 3ROTA 3JQ7B 1X2BA 1PBTA 2HJVA 2RB4A 3T7RA 5B1YA 4NV3A 1ZD9A 3HQ4O 4EX6A 3H9BA 4ASUD 4X1IA 4QTYA 1NNEA 3P9CA 3TECE 4WJLA 3QK7A 1ACMA 3QUTA 5DM2A 2ODQA 4JCOA 4AI6A 3DBRA 2RHLA 4F93B 5KVCA 3FOBA 2OV1A 2BFPA 4NESA 1LRKA 5ESWA 1H9AA 3L0SA 1GPDG 3DP7A 3KTAB 3THYA 3G1WA 2AN1A 2GRUA 2WI8A 3RQIA 3WKCA 1F0YA 1WUJS 2RONA 4W6QA 2B1QA 9MHTA 1TE2A 1GCGA 4F4IA 3CX3A 2IODA 3HWWA 4Q82A 5EZ6B 1N34B 1TNDA 1OI3A 1R3DA 2JFZA 4DNPA 3UTCA 2R0QC 2Y1GA 3FN4A 3IJEB 1HOTA 4BO7A 3VDQA 3OEHA 1TZJA 5EG5A 5IABA 4BDTA 4I8XA 3KUXA 2JAQA 1AGRA 1H1LB 1D2AA 2B0CA 1IQRA 4MX8A 3ZWPA 1RQGA 2WKRA 1PEAA 3N0XA 4CR6A 2OB2A 4RTJA 3KVVA 4MUKA 1WOYA 4R3WA 1NBEA 2X40A 4LGVA 2CL7X 4PG4A 3NYWA 4JBXA 2FFQA 1RNLA 3V8EA 1NYRA 2NZVG 5ALXA 1R66A 3CR7A 5HK9A 1W4ZA 5EMJA 2VR1A 3BF7A 2O2CA 3H5VA 3JQ7A 3MT0A 2VK1A 4HX5A 2QENA 4DLZA 1NN0A 5B6IA 1N2GA 4YJDA 4DMKA 4NF2A 2H7VA 5IKEA 1DAPA 1LK7A 2PA0A 3ODGA 1ICEA 4NVRA 4O2RA 5H68A 1BE0A 4PXAA 1X6VA 1RBQA 2YDYA 3PNBA 1U7ZA 1XXHB 2GCOB 4J2TA 4CMGA 4LZNA 1MJGM 1SVIA 4LDJA 1JDBB 4OSEA 4YWJA 4KEAA 3O91A 3FWKA 5L53A 2WQ7A 4U8HA 4AC9A 2J09A 3LHFA 4LXQA 3LCMA 4QPPA 4RLFA 4ZI2A 1ZW6A 1ZS9A 5EMNA 1U2EA 1QPZA 4DHWA 4JYAB 1Q6YA 1DUSA 1PZGA 2OXFA 3NU1A 4WD3A 3ER9A 2A0WA 2DAPA 1W87A 4G5RA 3OE1A 2GBGA 5D84A 3B36A 4R2XA 4MEAA 1P1CA 1AUVA 3ZKWB 4C2TA 4CMCA 1R8YA 1N1DA 2C2WA 4XPZA 3I34X 3GJ8A 2NUTB 1VMEA 2X4DA 3UXHA 1URPA 3QUQA 1ZITA 1MIHA 5IM4A 3IE1A 2LTAA 4K1LA 1IHOA 1XK6A 2OFXA 3B7WA 4IHJA 4NS4A 2P6PA 2VATA 1H65A 1XQYA 1MG0A 1VYTA 3Q2KA 4KUGA 1EVYA 4M7OA 2PQ0A 2GR9A 3X1KA 3ICEA 3TLAA 1W2WB 1Q7BA 5CLLA 3EIFA 1NV8A 1G9SA 1K06A 3UJ7A 1SQ5A 2BFAA 3KZ1E 4PX5A 4RTRA 5FO1A 1DX6A 2DBVO 1J4AA 4MP3A 2HEGA 3E0QA 1L4EA 4GVXA 3DVRX 2X8JB 3RSGA 5AI8A 4C7BA 1IHXA 4XQ0A 5EIFA 2AV6A 1S7CA 1OV6A 1XXHA 2JBAB 2QMHA 3LPNA 3LUPA 4TN5A 1XP5A 3A04A 3ECSA 1FFBA 2HMSA 4UQPA 2BFDA 3R76A 1R9NA 1P7YA 3I04A 4A5OA 1J0CA 1CT9A 4MB0A 1MA3A 2R6JA 3G3EA 3G2LA 2FKNA 2OGUA 1FFHA 4PYIA 1J8MF 3A4LA 3P2JA 4CCWA 1ZNYA 4LNAA 1WCV1 3OPYA 4JJ8A 3HUTA 2HHHB 1GA4A 2J3QA 4TPKA 1S3SA 2WHYA 2F8TA 3FM9A 1U9CA 4K2AA 4QYSA 1NUHA 5K8LA 3PUWA 1VPTA 1Z6GA 4TMTA 4X63A 4P80A 4KQIA 5JSQA 2D7DA 1R0BA 3BMNA 3ETGA 5BVHB 4ISCA 5T6MA 2HHLA 4DCCA 1BE8A 1Y4SA 3NXKA 5LA6B 2VJYA 4Q9IA 4EECA 2WYVA 1PFUA 5D3QA 3TTXA 1PL8A 3UJAA 3PVZA 2HN9A 2XJ4A 5ALRA 2A9QA 2C2KA 5L8VA 3FKSD 1O6CA 3UG6A 1XFDA 4PAWA 1T4GA 1J49A 4O2AF 1K7YA 5CTAA 1EIWA 4MMYB 4BB6A 2X8JA 1L8AA 3QXGA 4FTWA 4PG8A 1WXDA 2DPYA 5FB3A 2HSGA 3SMVA 2XZOA 3KKZA 1K63A 4HY3A 1JH9A 1XEAA 4KMSA 3P9RA 1J99A 3JQCA 2CNDA 3M9WA 3BDVA 1VB5A 4JMLA 4KIJA 2PWZA 2J5QA 4HUJA 4CL8A 4KRFA 1OLSA 1OX6A 1PAUA 4PYOA 3QKIA 1VLMA 2OCIA 3NTRA 4D56A 1P5HA 4FYMA 4M8IA 1NR7A 2FAXA 4PSCA 4WH0A 4O0LA 5C0OE 5KHOC 1T4MA 5F3DA 5IVKA 1PS8A 1QG0A 4JA0A 5TF0A 5GQSA 3K4HA 4ZOLB 2DPMA 2ZB2A 1IHYA 1LU9A 4L28A 4BMOB 2HJHA 4Y9SA 2Q4OA 2ZE6A 1X7GA 5GAJA 3UMJA 5EL0A 3E3LA 4LIPD 4MRNA 2AVNA 3BH6A 3HKDA 3DXXA 3AFIA 1YJ5A 3FIJA 1DXYA 1DAFA 1L7EA 2YS7A 5BVHA 4FC6A 1V41E 1YRLA 1RXIA 1ZKMA 5LA6A 2X0IA 1LDYA 3I2YX 4PLWA 5ARDA 3TXAA 3G0DA 4BAUA 3MGAA 1EE2A 1LBSA 2AYYA 2FVYA 3GCZA 4JK3A 1JLHA 4RHYA 5JE8A 2F1OA 3ZV5A 4BDSA 1IZ8A 1JZSA 5C18A 1W85B 4B84A 2WD8A 3JQAA 4Q93A 3ZQUA 4YMHA 1JR6A 2IXFA 1E7QA 1D2GA 1X74A 4MQEA 4RTLA 3HCFA 4X6UA 2H3HA 1E2KA 1EBFA 4TTJA 5ALLA 1T15A 2VP2A 4WBNB 1HM5A 2Z9DA 4DQ0A 4A1OA 5TQVA 1UEJA 3N86A 2IZ0A 3BXHA 4U5QA 1E2QA 3IDAA 4AJJA 4DRYA 5FUVA 4JLSA 2BFFB 1LC3A 2JRCA 4FGKA 1V4VA 3RS4A 5AVVA 4IFBA 4GZ6A 2YBDA 2P3QA 2BDUA 2I33A 3BA1A 1VJ1A 1MH1A 2NU9B 5FQOA 4HQNA 2Q8QA 5J2TF 5LQDA 4YBRA 2OKCA 3B3QA 4YJFB 4QLBA 4PZPA 4ZOLA 3CX8A 2ZPTX 3HDYA 2K6GA 3AESA 1NXPA 1RWVA 2WZCA 3TOSA 3DCJA 3QV1A 3NBYC 4RPHA 3TLEA 1ZNXA 3OU2A 4HMOA 3DEYX 3KR2A 2EJWA 4FIZA 4J1TC 4RSGA 3VR5H 2Y0BA 3IP8A 5EMHA 4DIEA 5KOHB 5CD1A 1QTNA 1TPYA 1BE1A 2FQXA 4DCSA 1XLVA 4UM9D 5KKCA 3EIQA 3LRTA 1O6GA 2IYVA 1ISJA 4V0KA 2JCYA 4QT4A 4ZXPA 4B7UA 3PQFA 2ID4A 1DBRA 3GDGA 1W85A 4EZIA 5FA8A 1X7ZB 2XLCA 4IZIA 4ZYWA 5C9ZA 1MO2A 1ZBQA 4TYQA 3LA8A 3O1LA 1DEKA 4QBTA 3L7IA 4RAOA 3GLHB 5JC8A 3EG9B 1FFDA 3EB9A 4XUCA 3G88A 3QWFA 4B3RB 2W6CX 2J5BA 4JR1A 1U2SA 2FW1A 3GX1A 1R6XA 4Q16A 2J30A 4S0ZA 5JJ5A 5KYGA 4XCVA 2XMSA 3GU3A 4TUYB 4BC1A 4O5AA 1WWKA 4QJ3A 2J31A 2NU9A 2WT9A 1N7IA 3KOWA 1MXFA 3DDNA 1YL6A 1UOQA 2EFCB 2V7QA 4J6FA 1NW4A 4YJFA 5DMXA 5HJ7A 4OXYA 1C7EA 3KQTA 3HYNA 2B8JA 2IITA 1NJ1A 5LMCA 1SKYB 2ZROA 3FUWA 4WY5A 1YC5A 1WDLA 3HM2A 3I2IA 4K26A 1BFKA 3VR3D 4PE5B 1YAHA 1A5BB 5B5SA 4Z7QB 4N7MA 5KTKA 2GRJA 3UMMA 1E0DA 3WHLA 4WUVA 4DWWA 2N47A 2NSYA 5I45A 1VZ3A 3NPAA 1DTEA 3SIXA 4DLTA 3GBSA 1U1FA 3T3MB 5AW4A 4YI3A 3ELDA 1M83A 3CW8X 1SUAA 3PNYA 4LN1A 4CM3A 4J16A 3PP8A 5BR7A 2C4MA 1SBQA 1I30A 3M4JA 1C3LA 1Z4KA 1L4BA 2RHCA 3F3SA 4I4LA 1AD2A 1NNUA 1QIJA 1X7DA 5K3AA 1F06A 3D6TB 3WL4A 5IVHA 1BXZA 4XGNA 3H97A 4PLHA 2GZDA 4BLUA 4CWAA 4GPD1 3CY6A 2ESRA 2G5GX 5E1MA 1BMQA 2R79A 1QLJA 5IWAB 2W6ZA 2RK4A 1OF1A 1KZ4A 5CXXA 3BFPA 4N0DA 4NMWA 5I7AA 1EKXA 1HE3A 1YULA 2H1LA 1E3LA 1YCHA 1U2TA 3VZCA 4FB5A 3V42A 2D3TA 2YWDA 5ESDA 4B6SA 3LLMA 1JKFA 3DPUA 3T41A 1FX0B 1N2CE 2XH8A 3T5GA 1ZX1A 2FZGA 5HFJA 4CIYA 1E1MA 2QUBA 3I64A 1UFVA 4KO2S 1UK9A 2Y66A 4FD3A 5THKA 3T5PA 1SXQA 3RVSA 2FR8C 1U0NA 2QJWA 3CCCA 3GFRA 1BD3A 4U7DA 4ZYXA 1Q0UA 1O77A 5ULLA 3VHLB 2X14A 3CH4B 3WMXA 1L3IA 2PWPA 4ZC1A 2CUTA 2MINB 3DZFA 4WMLA 1K98A 5LP6C 4WK6A 1EAYA 2QGFA 3ENQA 1FRFS 3EXIA 4MUYA 4HF7A 4WLEA 5ED0A 3EZ6A 3VR2D 1B93A 1J42A 4JD5A 2B2NA 1OI4A 4TYMA 5H9WA 2H1VA 1OH5A 5IUJC 1U80A 1AT1A 1VPDA 4OAQA 1XFAA 4GOND 4K03A 4DJTA 4E2ZA 2ZZMA 3BJRA 1X0XA 1JHXA 2EGUA 2QN1A 1VXOA 2XV1A 3IKVA 1VCNA 3B51X 1UIMA 4GR4A 1JV2B 4IIJA 4XSHA 4BV2A 3KR9A 4C4RA 3SX0A 4G1VA 1PVDA 2JZCA 3JW8A 1WRBA 5CVCA 5AM5A 2O8BB 5ES3A 3HVJA 3KLMX 3ZWXA 4C1NA 1C4WA 4NPHA 2XAAA 4BGDA 3BXOA 4HLCA 2I4RA 2EP8A 1XZGA 2G82A 2QQ0A 3GCGA 3MN1A 4P2BA 4ME6A 1ZHFA 4D4IA 5FT9A 4XJXA 4F9EA 1AUQA 2GN1A 2ZDGA 4L5IA 2VPPA 4KFSA 4R40A 3WQQA 1M1UA 2VDRB 3Q3JB 3E2MA 2W2LD 3A05A 3B1YA 3SVTA 2Z4RA 1VBKA 3CUKA 1S89A 2ONCA 3OMXA 3OTGA 4NENB 1UK6A 3VR4A 5A7GA 1M73E 3VYUB 5COAA 4AVYA 4XARA 4F96A 4X84A 1IN5A 2OMKA 2QD1A 4RD4A 3WNZA 2CJXA 1P6UA 3OLWA 1GZ4A 2X8BA 4M0EA 1U90A 4B4DA 1BD4A 1R4AA 2W2XA 1W94A 2Q6KA 1E2NA 5JROA 3TAUA 3WLPA 5DGTA 3ADPA 3ZVNA 2GFQA 1X7WB 1MNQA 2GD0A 1XJ0A 3NJRA 2BLLA 4N0QA 1EXVA 3K4PA 4MV9A 1QB7A 3KOZA 3O4VA 1ZCBA 1QG4A 1OJLA 1GUBA 3FLMA 4D0LB 1V39A 2W6QA 2PL1A 2VDVE 1B0ZA 4HB0A 2V6GA 3D6FA 3URMA 1K5HA 1AN9A 1SBTA 3ESAA 3PLNA 1FU8A 2XADA 4E32A 4DIMA 1VE9A 2FSFA 4B48A 1OBOA 1I4OA 4YT2A 3IQEA 2RI1A 3ANMA 4FYXA 4LDRA 3R4CA 2E6KA 4RMJA 2DETA 4MDEA 2ZOSA 4NE7A 3C7TA 1EDBA 1T9CA 1M1XB 4FVTA 1DO2A 3KZKA 2CMGA 2B9VA 2XZTA 1FRNA 3PE3A 5CW1A 1ECLA 5F4ZA 5J40A 5EXDA 4MR8A 3QNMA 5FOUA 3K31A 2WMDA 4MWCA 1W36C 1PKXA 3ILYA 3ABQB 4RZXA 4LYAA 3UMGA 1SXJB 2GZSA 4JENA 4FNAA 4OM8A 4NENA 4L9RA 2WWWA 2ZRGA 3ET5A 3LUKA 2FWAA 4JFRA 5FNVB 5BXYA 1CX9B 5IX8A 3ELYA 2PUTA 1N3BA 4C78A 3PHBE 4QT0A 3ZY5A 3B6ZA 2BVNA 1U8XX 1RRCA 1P33A 4IJMA 2QG4A 1FDTA 2RHOA 1L6IA 4DXHA 3HPRA 4I55A 1U8CB 2YMPA 4BWGA 2IX3A 1ICIA 2YHSA 1UOPA 3FYSA 1Z15A 3P9IA 4RVHA 2FX3A 4V03A 1JE1A 3KR0A 5DWDA 4FOSA 1O0BA 1D6JA 3OX2A 1NOKA 2HA7A 4KQKA 4ZALA 4D46A 1J90A 3TZEA 1G4AE 4XVRA 3EQ7A 3ZBTA 3GUVA 1PZNA 4DBZA 4CMIA 4PAOA 1HZZA 3L8ZA 3R3YA 3SZGA 1WPXA 4UAVA 2FNAA 3EGCA 2YCBA 1K75A 4OJKA 1L5YA 5HM6A 3AVWA 2X41A 1Q0RA 1ZH0A 3MSCA 5HUQA 3LP5A 4E5YA 2Z1NA 4M9XA 2J87A 4IMIB 3E84A 1JG2A 2MU1A 3LYLA 4FHZA 4HPXB 3HCEA 4HDRB 4ARSA 4L95C 5I8WA 2EW1A 3OJXA 2BWJA 4YP1A 2OWDA 3UC5A 3KQSA 3HB7A 5D00A 2HTFA 5BSTA 2UXBB 4ZOAA 2ANCA 4IIDA 2JGIA 4AW9A 4H4EA 1X86B 4BKRA 5JQGF 2P9FA 4IGKA 2F1HA 5BQOA 4YA6A 1GXSB 2WU0A 4DDTA 5ILOA 4BKMA 3A9VA 1OFHA 4MW6A 5C5DA 1GVHA 4R4JA 1XF9A 1Z75A 2QTWB 5LQAA 1Z6AA 5TC4A 5JRZA 3OFNA 4UZFA 3SD7A 2IL1A 5DKFA 4DPKA 5ITWA 4R8MA 4N1AA 1OAOA 4UM8B 1IQPA 2YXEA 2F59A 1KY5A 4EG0A 1NKSA 5F21A 1AJEA 2OCAA 2YWBA 3Q7QA 3SX4A 3TE7A 2F3QA 1MNAA 1RQ7A 5JAZA 4BLTA 3SJCA 2YY7A 4FW8A 5TPWB 5C2JB 1AMOA 1DJQA 2I2BA 1I2AA 1WW8A 5FADA 1Y1KE 1X80B 3KCQA 1PV1A 2YJTD 4CI9A 3WIEA 4K87A 1T5OA 2Q1SA 1DT3A 4TSFA 5HRCA 3U6KA 3BWYA 2N3ZA 3EFEA 3HA7A 4QDXA 1LQ2A 4ND4A 4HZIA 4OKIA 3MCUA 5FTNA 2QQEA 2XMQA 4MVJA 2QAGC 4ALIA 4KAJA 3QI2A 3RO7A 4XEUA 5JNWA 1WZNA 2DTDA 4UEQA 2YH2A 3OT5A 1A0OA 4LOKA 1JIKA 1NBME 2PXCA 3EODA 4YCDA 3ZNQA 2TMDA 3MCTA 4LDNA 1ORRA 4AS1A 3PRYA 5IN4A 3TL3A 3GLIB 1FQOA 4I5FA 4BIMA 1WE2A 2QU8A 3MLBA 3U1BA 4HS4A 1TPZA 3ID6C 5G41A 4M76B 5FUBA 1NHWA 1RW4A 3JQ8B 1SQGA 4QD3A 3STTA 2NOAA 4A0HA 1G8MA 4EMSA 3ZLBA 3RC9A 3TS1A 1AZWA 3V4LA 2QVBA 4BLPA 2WJVA 2OOKA 5C1OA 2E4YA 2JFOA 2X0NA 4XR9A 1OI2A 1IXRC 1DEAA 2G36A 3L0BA 2HFJA 3QXJA 2C8KA 5HDBB 3KL2A 1QYWA 5K2OA 4ZARA 1PEKE 3PGXA 5E9QA 5ELXA 1DRKA 3NATA 4KQWA 2OKGA 3H2IA 1UMCA 5IJ9B 1CUAA 1P4JA 2BEVA 3VFDA 4C5BA 2VTKA 3GFVA 1X80A 2MSCB 1E77A 4L0MA 5D6OA 5B4VA 4KKXB 3N1UA 1ISRA 2XYRA 4V1CI 1GFWA 1EP9A 3EQ8A 5JCXA 2WTUA 3X43A 4AXBA 3A3OA 1KFBB 4A1FA 2I8LA 4KUHA 4HAOA 3HUFA 2GEJA 4AKHA 2V3WA 2I80A 1FRVA 4YRPA 3HP4A 3ICOA 3L04A 3LQRA 4V2UA 5MFZA 1AXGA 1MHPA 2QKYA 1WVMA 5DW0A 1S3IA 4MKXA 1YQUA 3NHFA 2JH9A 3KQUA 4H6XA 1JJ7A 2FMKA 4KVFA 3SNHA 3UK0A 1YV9A 1V26A 1OGIA 4Q7MB 4KHPB 3GLIA 3JYNA 1HL3A 4LE2A 4KQJA 4LCEA 1VJRA 1ADYA 2ENWA 1S8FA 5K4HA 3CTPA 4P83A 2IWHA 1UIRA 1KRXA 4KXQA 4KGXA 4NJOA 1MO6A 2BGLA 5D7BA 1J06A 4N3NA 4IDOA 1YB2A 2SKDA 4I36A 1L3BA 4ZJYA 4KNYA 4QODA 1ZR4A 1Z4NA 2A1TR 1YFJA 4JR2A 4F97A 3FCYA 2QUKA 3RUEA 4ENPA 2AG0A 3OZRA 2GCNA 3WR5A 1H69A 4BWVA 3OY2A 4BCDA 3M6FA 3NC1C 2MCFA 3HRHA 1XCOA 4HWRA 3MJSA 3CN7A 3BD7A 3PQCA 1VCIA 3C3EA 4L07A 4B3XA 4FGZA 5FWNA 2W98A 1L8XA 2VJNA 3BL6A 4BV9A 1D0VA 3HXOA 5C1IA 1A4UA 4GI2A 4O63O 3SC6A 5ANRB 4DWOA 4I9GA 3SE7A 5EJ9A 2O0HA 3PGMA 4IDDA 3EOAI 3O8QA 4L78A 2R62A 3BTVA 3OIFA 1T8UA 1QXSA 3SR3A 3LQYA 1RKXA 2X8LA 3DMNA 2O8NA 3HCCA 2RHHA 5BPFA 4JL6A 5LZ7A 5JS6A 1AMNA 1KKLA 3O3MB 5TQ0B 3LE8A 4QFDA 4PAMA 1XE3A 4IKPA 1JFRA 1WKCA 2E3JA 2PKXA 1EB9A 3S1LA 1CUJA 2GM5A 3D0RA 2W48A 2J9RA 2QUHA 2GZ1A 3EIHA 3WAKA 4ZI3A 1PJ3A 2C97A 2VF8A 4LHWA 2PX4A 3CSSA 1ZAYA 4EGJA 1QF6A 1EX7A 1TYAE 2QPAA 3TSYA 5I01A 2VUSA 3KPYA 3EF3A 1B7GO 1P0PA 4H7FA 1UBMS 1VKNA 3VR6H 1GGEA 1G21B 4HVLA 1IY2A 3I6QA 3SICE 3C6ZA 3DQQA 3T12A 1Z9BA 2AQ8A 3HBJA 3SSNA 4GUAA 2QW1A 3NOQA 5CLFA 4LBWA 1TAUA 1IOLA 4Z2AA 2NXNA 3JAKA 1N2OA 3L6DA 3WYEA 5JUWA 3SAJA 2ZBPA 2AJBA 5FPYA 4MVXA 4P1ZA 4GMFA 1ZGBA 1CQXA 3T3HA 3KQWA 4OI2A 2IUUA 3EGIA 5E9JA 4UMVA 5LKRA 3EXHB 4JT2A 2Y77A 3O92A 3KEQA 3N8NA 2CZGA 5KOJB 3JTMA 1NQAO 5BO5A 4TV9B 1YWGO 2V58A 5DSXA 4CN9A 4BKUA 3M4XA 2HJRA 3DYIA 2JGDB 3WGOA 2D5CA 1YS7A 2QSYA 3EQZA 3LT4A 2WE8A 4KODA 4O08A 4FDTA 5EFOA 4EKIA 2NVWA 5E7MA 4X90A 3NBXX 3WLJA 5TQ0A 1HKUA 2WPNA 2YVUA 3IALA 3ICWA 2MSDB 3IQWA 4Q3CA 1W6RA 2OORA 3L0CA 4ZRDA 2R8BA 5LIPA 3IP9A 2NO4A 4JIMA 2HV9A 1D0IA 3MSXA 2KS6A 3JYPA 1QDEA 3NASA 4Q21A 3WS7A 3NAMA 2Y1FA 2ZIGA 1P9WA 4ZXFA 3UEOA 2BE7A 4XOIA 3WNQA 1DKMA 3WSVA 1E6KA 1ONPA 1G21A 1R6AA 2BR4A 5CCXA 1QU3A 1NV9A 3I37X 1HTTA 3R7FA 4R6WA 2NVUB 2ECKA 4HX2A 1O54A 5K4AA 4X7RA 1AZLA 2QHXA 2JLWA 1P1KA 1E2JA 4EPWA 1WG8A 3FFTA 4D3XA 1UM9B 3KE8A 1LSSA 2GJ9A 3LZCA 4MUEA 4DIUA 2OHFA 3WGNA 1NG1A 5AJXA 2HHJA 3M6AA 4LX0A 1Z18A 4OX9Y 4KPYA 3V1UA 4R9NA 2ZUBA 4C4ZA 5DFAA 2Z2XA 1QQBA 3SK0A 3HKCB 3Q9LA 4DMUB 3H87A 3QU4A 3DT8A 5KOJA 1F9EA 2IU0A 5LM3A 2XT0A 1Y5LA 5K3FA 1MXHA 1NASA 3E70C 4RZUA 4DDKA 1LK0A 1ZWKA 2A33A 3OHPA 4XJTA 4CTOA 5J4KA 1G7RA 1Z36A 2LDBA 4RIEA 1L7AA 3L4JA 3AMVA 3O90A 1C2YA 4W5WA 1IU9A 1COZA 3KVOA 4IF4A 3U5TA 3SU8A 3L02A 1TEVA 3RSCA 2C77A 4U00A 1DAGA 5TQ2A 2P27A 5LZ4A 3WADA 1AKMA 3NWEA 1GYQA 1HDIA 4Z2YA 1Q0TA 2RAPA 1XNGA 5HBRA 4HNAA 2I7TA 3N2LA 5DLDA 3H7IA 4GXNA 3KEOA 1FNCA 1SMKA 4JNKA 3DHWC 1A5ZA 3IAM6 1V5WA 2GAAA 1T4DA 2BHLA 1H2HA 3IVGA 3K0CA 2IDKA 1EVJA 4EKNB 4QNRA 2X3FA 3FJYA 5AVXA 2WR8A 5KWVA 5FNVF 3CU5A 4A9AA 3U31A 1UAGA 4N65A 4EW3A 3RS9A 2PUFA 2PUBA 3QLJA 3WMEA 2DZDA 2J48A 3FCSB 3PHHA 3JVVA 1E2MA 2HA5A 4H3SA 4DIBA 3MIIA 3DNPA 4FDVA 3HI4A 4GWKA 2W83A 2AFIA 1N6HA 1IBMB 3PQ5A 2EYUA 3HKCA 1LS1A 3HB4X 5TS2A 3MG9A 2VTDA 2OWEA 1S2DA 4B34A 3KB6A 3TTTA 4DMLA 1C29B 4OFZA 5B6JA 4C43A 5CA0B 1JSLA 1PT5A 3AUXA 5LBIA 3VR6D 3AP3A 1YCDA 4PU0A 4J43A 4WKGA 1SNYA 1Y3FE 1AQLA 1N5KA 3FMIA 1PGNA 3A2MA 3IESA 3P9SA 3ILXA 2FZ4A 2I9PA 4CQLB 2PKCA 3SEQA 3WZMA 4AJ9A 1NYTA 1Q44A 4ZOCA 3H1AA 1PQYA 3A6GA 3IX7A 2QRZA 4QREA 5IC6A 3ENVA 1CP3A 1P8JA 4NU6A 4QTTB 1L5LA 4EHHA 1Z5NA 3MAJA 2INGX 2HDOA 1X39A 4I4CA 4MQ6A 3DM9B 3U3KA 5BORA 4TZ6A 2V9ZA 4ROTA 1A7UA 1D2HA 1WB6A 2A94A 2DBRA 4R84A 1VRWA 2K7FA 3ED1A 3DVAA 4ESVA 2EG5A 5FEMA 3SX2A 2I34A 4P0QB 1VECA 3GGDA 3RFTA 1GA1A 2DT5A 4E13A 2V1XA 1NBMD 4TM8A 3DBOB 1E60A 1T6XA 2X3YA 2FW8A 3DFKA 3OQIA 5JJKA 3RD5A 5CH5A 4IWXA 4EJ2A 3EA0A 1TW3A 1L8QA 5J59A 4MITA 3ZE2B 1AMUA 4DLKA 4K9DA 2WUGA 1GNSA 1K9SA 2PXHA 3VDRA 1NXSA 5CA0A 4EHKA 5TX7A 1L2TA 3SKYA 4ARZA 1HQCA 3FYUC 1VJGA 1M2HA 2K87A 3HKBA 4IPTA 3TINA 3PFNA 3M0EA 3HK2A 3TB4A 3HXLA 1KYTA 4TXMA 4OQFA 3QVWA 4QPCA 1ACLA 4Q6BA 3PE4A 4Q9AA 1LLCA 5A4FS 1EFKA 1WV1A 5FKJA 4G5QA 3OO1A 2IFTA 3GH1A 1Y3BE 4B6EA 3K70B 3AINA 3BD8A 4CMJA 2BV3A 1GGKA 1A4RA 3OF5A 3ONDA 2H6EA 4H2DA 1XAIA 4P3NA 1ZMXA 2SHKA 3DF9A 1CY0A 1GILA 4BPBA 3QJ5A 1M1NB 1ZHHA 2G88A 2YVLA 3CXRA 3PGA1 1N6OA 4QGSA 4JYPA 1G8KA 3E7FA 1EUZA 3HI6A 3QXSA 4B17A 1CVIA 3UK2A 5FLEX 1VPWA 1F9AA 4XEHA 3C3AA 2YZ2A 3K09C 4FGSA 1YI0A 1T8YA 2X5NA 4HJRA 4JU9A 1Z0AA 4D81A 1TCVA 1T3HA 3GGCA 3FCEA 6CHYA 5JZMA 2GWRA 3UH0A 1VMAA 1RJEA 1Z2AA 5GM1A 2FEXA 4BNYA 5CB8A 1ATZA 4QUGA 2O2HA 2X3UA 3ACCA 4MGKR 1A9XB 1LVHA 1HSZA 3DZBA 5E2BA 5EP3A 1A72A 5LYJA 1L4LA 2FFAA 2G5CA 2IBMA 1FDUA 1JXMA 2BKXA 1N36B 2J85A 3PA6A 1LTQA 3KELA 1TK2A 4QJ5A 4IAOA 3EEIA 4ATNA 2D1SA 2HBRA 2VRBA 4J07A 4B4KA 5C46F 3HXMA 1YA8A 1N1GA 1JW9B 1ATIA 1PEDA 2DFPA 2Q21A 3O2NA 5DHSA 5DYNA 4C0HA 3CF4G 1WIWA 2O1EA 2M6SA 2YVAA 5D3ZA 4JEIA 1GQYA 4ZTUB 4M9UA 2FOIA 5HJ2A 1K7EB 4HLUC 2A9RA 3A9RA 3E82A 3II6X 3MNFA 1UXHA 1KYXA 8ADHA 3HCDA 1UJMA 2XOEA 4Z4HA 3U19A 1JHZA 1QWOA 3Q9SA 5C52B 1E4EB 1LPAB 1FJXA 2DECA 4PBTA 4GI3A 1YQWA 4NLLA 1M0EA 2GKOA 5JDCA 1G60A 3MT8A 3X2FA 4A4DA 4CF6A 4DB4A 5CVVA 3N07A 5KTMA 1B6SA 1EFRD 2FN4A 2L0XA 1V8FA 1KMIY 4AM8A 5LQUA 1QCCA 2GN8A 2KJQA 2EG9A 3GVIA 4FSDA 4JI5B 5AKIA 1V8OA 2AXQA 3A9SA 4C7KA 2H0AA 2XQKA 5H3LA 4XWAA 3AK4A 4UVEA 5EP4A 4KRGA 3TAHA 3QBDA 2C7PA 3E3OA 3GMIA 3WB0A 1IDOA 1Z17A 1U2GA 1DT5A 2HI0A 4ZPXA 5FV7A 2WJYA 4ZREA 4AICA 4X62B 4QEDA 3TZBA 4E0BA 5HMMA 2H18A 5HIMA 4HMQA 2D06A 2Q1WA 2O14A 4CKZA 1NW9B 1PU2A 3E7XA 3F67A 1ZUNB 4I9HA 2I1VB 1EWKA 1VJTA 1WABA 1GPJA 1OA0A 1QCYA 1QK4A 4DY4A 2JCBA 1PR2A 4YRGA 4Z4FA 1HFKA 4QGFA 1HGXA 3GJXC 4N47A 1LDGA 5DBGA 3ISVA 2G72A 2ZUVA 1WMFA 3NGLA 4MHSA 3TG8A 1GHTA 1P3DA 3FA2A 4EPXA 1BKYA 2JFFA 3R7SA 1G18A 4UTXA 4DREA 4R9RA 2ILTA 5JASA 2CHVA 4L4ZA 1LA2A 3MMNA 3A6JA 4IOKA 3N2YA 3MD0A 5IH7A 1GUAA 1XU7A 2WU8A 5EQFA 5KAPA 1KDTA 1SPBS 4CM8A 1UKCA 4RPKA 3GLFB 1YIDA 3QE0A 4MLZA 3VR2A 4J76A 2XEXA 2YV2A 1XTJA 4HEHA 2XUAA 3Q7IA 1I4EB 1TM5E 3BKWA 3KLNA 2DFKB 3QIAA 1QHIA 4TTIA 3A2LA 3W6OA 4YLYA 4R31A 3D6MA 3DMRA 4PNPA 5JY1A 1KQPA 1XNHA 3MS7A 3QYPA 1NZJA 2ZJ4A 3KB8A 4FXPA 1YGPA 2J6BA 4WEOA 1E61A 3GT3A 5DULA 1L5OA 1YFKA 4Y67A 2GILA 5K2MA 1NVWQ 2B8EA 2JGFA 1Y8QB 4P0PB 4FGJA 4QTXA 3PGLA 4WKPA 1FQKA 1ZUNA 1JA0A 2XE4A 4LVUA 1BAPA 4X3OA 2BZGA 4NFSA 2VAVA 4BQFA 1SZDA 3HCBA 1VIMA 1W5FA 2NU6B 3KB1A 3KBBA 1WVIA 3NV7A 3OT1B 4R16A 3SQMA 4QWWA 2W2LA 5LBUA 4TV9F 1C7IA 2Z6UA 1QE3A 4TKVB 3WRXC 2FSIA 3EN0A 4QX6A 4C87A 2ZT7A 2F43A 1GZ7A 1NBWB 3OQOA 3HA2A 4CLOB 5I7SA 1CUEA 3ZV4A 1JI3A 2R65A 1ZN2A 4NOLA 4NL4H 2X2OA 4EG3A 4DDMA 5CGZA 4KAXA 4X6LA 2COKA 4JY7A 4OMFG 4WOKA 1KVSA 4E21A 3NTUA 1TQHA 4HMPA 3LU1A 1FVHA 3KQQA 2WTBA 5JMOA 2IU6A 1V16B 1LDBA 4NPAA 5AK0A 2W6ID 3D1VA 2QTVB 4HB2A 5ALHA 1G5IA 2PFKA 3ILSA 5TJHA 1E3MA 1ZW1A 2H59A 2V54A 3CN9A 4Y6QA 4Z9FA 3H5TA 1SWVA 3UICA 2HHCA 1PR5A 4ZHSA 4P08A 3TQHA 3QG5A 2V3VA 2W58A 5GONF 1U2DA 2Q6TA 4QM7A 1GGFA 1V3QE 3PYXA 3UJPA 1PGQA 1ZRMA 3DB1A 3OIDA 2XVAA 4QOSA 1RXYA 1XZIA 3KG2A 1IE3A 5M3BA 1QPBA 4C3OB 1KVRA 1C5KA 2I6GA 1HYBA 2VWGA 4XDHA 2YWJA 1QAMA 2NU6A 2ORWA 1Z68A 3ETLA 4FI3C 4PIPA 5EYPB 4KTTE 5H4HA 1L5HA 4B31A 2EZ4A 3IUMA 4PHHA 4CFYA 4ERXA 1P6QA 1TCBA 2ATIA 3QE2A 3HZZA 4MH0R 1C81A 2LBPA 4NJMB 1ZCAA 2FPIA 2XQIA 3MJEA 4AJHA 3RAFC 1G4HA 2J4FA 1COWD 2YQ4A 2C95A 4ZVNA 1EH5A 2AQIA 2J0SA 4ZQEA 4UFNA 2J0UA 3M3DA 2AB0A 2QZSA 4Q18A 1IXYA 3VHXB 3AWIA 3E1KA 4IXTA 3I0ZA 3KV1A 4FYPA 5AI5A 1W9HA 2LGJA 4PV7A 1TIPA 1G3QA 4D4LA 2GJSA 4DGQA 2WNSA 2WU1A 4JU8A 2ZUFA 1Z0SA 3I3SR 3JRXA 4YVFA 1FSPA 1RDFA 2PG3A 3ORYA 2NNLD 4OQQA 1V96A 4KWCA 1GQRA 1P2GA 3G9QA 4Q47A 2H11A 4KNWA 2XMDA 3JY6A 4JLBA 3KXKA 2AZTA 2AF3C 4RKWA 3DFIA 2R7AA 4NKRA 2XIJA 4R1MA 3IJ5A 4EGFA 2B5WA 3JWHA 3ESXA 3EC7A 4W82A 3STHA 3PX2A 3ADCA 1OSNA 1PR3A 1Q2XA 1RJDA 2AR7A 2G80A 3LQQA 4PQEA 4TTAA 5IAEA 1I8TA 1ZD2P 4YX9A 2DHRA 4EI9A 1U5BA 3MBKA 5DO9A 5JHGB 5M7EA 3MQ2A 3SVLA 1L1QA 1EGHA 4GLFA 3AY7A 2H2DA 2HDHA 4GWGA 4JH0A 1HT3A 1R0ZA 1BJRE 2XQFA 3E2IA 3Q87B 2B92A 3R6TA 4K40A 1WZCA 2ZIWB 3IEVA 2OTCA 4MRMA 1CR2A 1O9HA 2QQGA 1GRCA 5LZ9A 4JCCA 2WHXA 3MWFA 4KZKA 1WULS 1Y6FA 2J8ZA 1JAHA 3OQ1A 4NBSA 2VKQA 4BC0A 1Z2NX 5BP7A 4UUPA 4QOFA 4ZIRA 4B79A 5EN4A 5BMVB 4AP6A 4PWZA 4JDUA 3BX1A 4MIKA 4TTPA 3S6JA 3WLAA 1KVUA 4F9FA 1JKMA 2AG6A 4JI6B 2P40A 2G76A 2GX6A 4TOIA 1C1DB 2Q50A 3DT6A 4HAYA 2AF4C 4KYTA 4B8YA 2P2YA 2IYWA 4FIDA 1GPBA 1A8HA 1E3QA 4QBGB 2GRAA 1G8JA 4YC7A 1TA9A 2VCEA 1YZLA 1YHNA 3G2KA 3KZVA 3X1MA 1I5EA 1Z0UA 1Z4LA 3JQPA 1W4RA 4OMDA 5KJ1A 2RGRA 2WFLB 4BLRA 1PFYA 3KIPA 2GLUA 1QR6A 4IP0A 1E5VA 3PXEA 3HRIA 4DVJA 4YO7A 2Z8ZA 3NPMA 5DI9A 2QGNA 4RIGA 1H3EA 3WKBA 1M34E 4EG1A 3O8DA 3HBAA 3KVRA 5HHTA 1X1SA 1JXAA 2AFVA 1MJGA 1G5QA 4NE2A 4RVOA 3TOVA 3WHPA 3G8CA 2H7YA 3MYYA 3K0SA 2V0CA 2FEAA 1EX1A 4R0NA 1MZPA 1YQTA 4YCAA 2WMYA 2VA9A 3FWYA 4LBYA 2OCGA 3VSBA 4ENTA 3D64A 5EZYB 4ZO7A 3ZGYA 1C14A 2WZBA 1WL8A 4OK6A 2FLKA 4WQMA 3COWA 1GU0A 1F14A 3Q3CA 1WTAA 1T2DA 4EH1A 4UPDA 4B6FA 3RS2A 3OI7A 3W6ZA 4F85A 1AKUA 4TLEA 2AG8A 1LWOA 1G1MA 4IH4A 3PX7A 3HGMA 4B7XA 1LV7A 1C1DA 4AY4A 1BMDA 1X15A 5AM3A 1YBVA 1SG9A 3AIMA 2I6FA 3F6EX 3ZYZA 2XMCA 4IRMA 1JFVA 4F2HA 5B4TA 2BFCA 2BZSA 2DQZA 4YREA 1OILA 3RFFA 5DXJA 3U6BA 1VKJA 1ZEJA 2DJIA 3WLNA 4KTVE 1U3DA 4U7JA 3UHFA 2QN8A 1GD1O 1QV6A 2XHEA 1Y3HA 3GZNB 3SKVA 3IVRA 3PEWA 4N49A 2PSJA 3E18A 4LFCB 2V5VA 3K5HA 1ELOA 1Y6ZA 4URWR 2O07A 1N9GB 1ZD3A 4A6PA 2HRCA 5LIRA 1JHVA 2OMEA 3FY4A 1WTCA 4B2IA 5L45A 4C0XA 1EFPB 3ZHTA 4ZZ3A 3INTA 1CHNA 1KEWA 3GJQA 1IWPB 3L8MA 3HYLA 3L1JA 3F73A 4DCTA 4KOAA 4JI1B 3RFVA 3LT2A 2POQX 4JLAA 5E4YA 2CWDA 5BNZA 5F35A 2OXIA 4X65B 3RAEC 3LF2A 3E35A 2QVZX 1J8YF 3MCAA 4PS0A 5C53B 5J47A 3MUNA 1IVSA 1YDGA 2NZWA 2V74B 3CW9A 5IM5A 3LUDA 1VLVA 3LT0A 3JARA 5E8RA 3P45A 3AHCA 5AW8A 1XMOB 1UBJS 2A9KA 2OFFA 1NAHA 1SOUA 2FZ5A 2UZIR 4UCQA 2O8EA 3B70A 2PNJA 2B6NA 3CMCO 1FMJA 2VXOA 1QIMA 1T2NA 3CHYA 4CKBB 4W8HA 2IY8A 4GMDA 1TF7A 1V5EA 4GR5A 4XM2A 1ZUIA 2JLSA 3QENA 5FHQA 5C34B 2I4IA 3X1DA 4Z4CA 1MRZA 1QZ3A 3WA7A 1YR9A 1JQLB 2C3YA 1AQYA 3G6WA 2YHIB 1UKYA 4LAFA 4KW7A 4Y0NA 2F8SA 5CNMA 1W25A 4CUKA 3RRYA 5EUCA 3AIIA 3GZNA 4ENUA 1P91A 1G2OA 3AYXB 3B12A 1SBNE 3KYDA 1B41A 1GFIA 1T9AA 4IZ6A 4MCIA 1NYQA 1PL7A 1N9GA 2RSLA 4AO6A 4IQFA 3I39X 3GEDA 4FBMA 4IWNA 3KALA 1L7OA 4M3NA 2AK3A 4D9IA 1RQRA 5F64A 4IEIA 4JXXA 1OFGA 4ZDWA 3KHUA 4XIIA 5DXAA 3S2SA 4DR7B 3LY7A 1X14A 1PYGA 4QRIA 5A9SB 4MRAA 1EQUA 2IZ6A 2NX2A 3UKJA 4EDFA 1KJWA 4Y6PA 1QRAA 1GTVA 4CIXA 4YT8A 4AYTA 1Y4DE 4CLHA 3OPMA 3QZUA 1VBMA 4J6EA 5K03A 3Q8MA 2XF8A 2QYSA 4EAQA 1RE1A 1SOVA 3G2OA 2C84A 2PXAA 3I1IA 3Q7SA 3D7SA 3VDNB 1U1GA 5K09A 2ZRMA 1NDUA 3R0JA 3TLKA 1T2UA 4B45A 1MX9A 3LUJA 1YB5A 1QCDA 3SYKA 3KUUA 7MHTA 1H9BA 2AN4A 1ARZA 1WJGA 2C57A 5FULA 4DEVA 4JV5B 4MV4A 1T2FA 4UE6A 3OG9A 4CKBA 2Y6UA 3F1LA 3PE6A 3VNQA 4IVPA 3EBPA 2BHTA 1GV0A 1K5DA 2FGJA 2PSHA 3EW9A 4IXWA 3ZU4A 4WCDA 4LA4A 4NV1A 3A3NA 5INTA 1U0TA 3F1KA 5LSAA 3TGPA 2PCLA 1RCUA 3AY6A 4KSBA 1UPCA 3ZE6A 4S1VA 3SM3A 3SP1A 1GZSA 4ML3A 1DEOA 1D2NA 1SA0B 3AR6A 3QVLA 1E8NA 2B4AA 3S55A 2RBGA 3PDJA 1W5TA 1UKZA 3K9WA 2NO6A 5FWXA 4S12A 3ZD9A 4R2HA 4LQLA 4Z99A 2Q5HA 2YWEA 4JASB 4O4JB 1K4KA 7ADHA 3NDJA 3AY3A 3NNDA 1GAJA 5JNUA 2RKWA 1ZL0A 1QHXA 5EGSA 4UFPA 5JECA 3RRXA 2R85A 1CS0B 1JLMA 4W1SA 3WVNA 5IAOA 2PS0A 5DDIP 4QG7A 2XE8A 1RMYA 2CKMA 5HCUA 3DWEX 2PUCA 3SHWA 4EJ6A 3SXJA 1GZHB 3DHVA 4IJ6A 1TCAA 5FUYA 1MB2A 1X9HA 3PL1A 4TQUS 4YQFA 3LO8A 1QIFA 1VTKA 4CF4A 2MT9A 4X61A 3WFIA 2I3ZA 4H9GA 3MJFA 2UYYA 5T7BA 4L6IA 4QOHA 3TTVA 1L5WA 4ZT4A 4C0JA 1JQ3A 1XMPA 2VHCA 3NBMA 3TTYA 2YRWA 5ALTA 3MOIA 1EGVB 4V1CA 3GWZA 4R2IA 1KR2A 3OCJA 2PZ8A 1M5UA 2KLHA 2ECPA 2PZBA 3ANLA 2J41A 1FVFA 2IYOA 3K1ZA 5CLHA 3P9PA 2NZJA 4BJ6A 3HP7A 3PLRA 3LC1O 5C4MA 2G9QA 1USIA 3EOZA 4D6PA 4EZEA 3WL5A 4BX8A 4BQEA 5B2FA 5DASA 2GK4A 1IY1A 3AETA 1NBAA 3UN1A 4KQEA 2W2KA 1OLXA 3FNFA 1SA0A 3MTJA 1AA6A 2EQ5A 3AHDA 3K1AA 3OIGA 3UBMA 3AG6A 3WI7A 3UT5B 2GEVA 3C1OA 4F8JA 4YECA 4DQDA 1PI3A 5ENZA 3NX4A 4GS5A 2DFLA 3D0OA 3GFSA 3ZNNA 4O4JA 4TV8A 4YDQA 2WHRA 5HS6A 2DFVA 2MMCA 3A6KA 3BZWA 3PEVA 4QTUB 2I3GA 3JPWA 3CX6A 3F7NA 1T8WA 4CKCA 4R9UC 4UE3S 3PUXA 4ZAYA 3BMXA 5CBPB 2NLOA 1GGHA 4YRRA 4ZOEA 3TTUA 1P19A 1HX7A 4V3CA 2H48A 2ICAA 4WFQA 1C9MA 2G1KA 3GHHA 4FUQA 1R9JA 4HADA 1K68A 1XTVA 2Q6IA 2PUAA 5ECGC 3FETA 4G09A 4H7JA 4H18A 4KC0A 4DN6A 2A1TS 3L0YA 2PD4A 1GITA 2VA8A 3KKLA 1H42A 4NP6A 4RD0A 3RYFA 1LW7A 2CK3D 3QOWA 1QHSA 3L1HA 3R5JA 4M37A 1IBSA 4ZYTA 3OKPA 1L7BA 4JVMA 2DRIA 2X5KO 1HDXA 2Z08A 2I5PO 5IAKA 3CZ4A 2FHSA 1PV2A 1RM5A 2GF0A 1IN7A 3KC2A 4V0OA 4WHMA 5EJ7A 2VQFB 1AURA 2CFIA 4ARUA 2RH4A 1JIJA 1N5OX 4F2PA 4R9SA 5AW7A 3RADC 2Q6OA 2X0EA 3QX9A 4UHHA 4AJIA 3FRIA 4H7KA 2QTLA 4I0WB 4QATA 4QQ8A 2NTNA 3CUVA 4CM9D 4Y0AA 3QQ5A 4COOA 4EHAA 1G7TA 2J9GA 5D5QA 2J6CA 4O4LF 4JX8A 1L5QA 2Q0QA 1UBOS 2QRQA 3ZDDA 5K05A 1FBNA 1YMQA 1P3Y1 3CW2A 5DX0A 3K73O 3TZHA 1E5QA 4RF5A 2FE1A 3ZXSA 4RTNA 3TKLA 4C0WA 2CYCA 4IWYA 2H7XA 1A2OA 4I46A 5JVDF 4IDEA 1M2EA 1QH1A 5TXGA 3RJ5A 2EKBA 3VJLA 3LDFA 2WSSA 2HKIA 2G7MC 1IQ0A 2I87A 3RTBA 1ULTA 5JARA 3Q41A 3CRZA 4Q01A 1ETHA 5DM4A 4AQDA 2CJWA 3HWSA 1AK9A 2VWPA 2JBHA 3AO0B 3CLUC 4Z49A 2ZCJA 3WY9A 3Q8KA 4OLHA 3BFKA 4MVYA 3W5IA 4BFCA 2VZ8A 4F4CA 4DV5B 1NLYA 3K05A 2ECOA 3NLLA 2A3RA 3OFJA 1HEUA 1RQPA 1UBKS 3F96A 3U7GA 2QD3A 1A1SA 3E05A 1JT9A 3UZUA 4CM4A 3PHCA 2VH1A 2BL4A 3PNOA 4U8GA 2SCUB 3VZRA 5L3SA 1FNSA 3GCDA 2PPLA 1CIJA 3BRSA 3WLLA 3BF8A 2PL3A 3OZIA 3EYWA 3V7WA 3WLRA 3F3YA 2JHPA 4J29A 1WPQA 3PPVA 2YXDA 4GM1A 1IUNA 4P5DA 3RS7A 3G5AA 3IUYA 1R0LA 5AVTA 1JWBB 4ALNA 3R75A 5CDGA 2PH3A 1BW9B 1PW7A 2C2HA 3BXXA 3KAPA 2HCTA 3N8KA 2JLUA 5L3QA 1RYBA 2DOKA 2HA0A 4OUDB 4WVLA 1PNQA 1QOPB 1BVRA 4FLFA 4KRYA 3R3UA 5LMZA 1CIPA 1FMTA 3C3XA 4O2BA 2I6SA 4EI8A 1W0KA 1QP8A 2YWRA 4AN0A 4RA9A 2W8ZA 3OURA 1Y9DA 1FP1D 2UVDA 3EGWA 4BAZA 2XVMA 4UBOA 5BYKA 3T1YB 3VMMA 3OD5A 3BTUA 3GNTA 3THWB 5AVKA 2F48A 3DDCA 1FU4A 4B35A 1L4HA 4A82A 3HXQA 2O5RA 1AKVA 2OK7A 3D4IA 3PQ4A 4PLYA 1YO6A 1OUMA 5T5QA 1DFHA 2HDWA 3F8TA 4WBSA 2OO5A 5D86A 2AFHA 1MVOA 3COSA 1LGYA 3GA5A 5DGXA 3CV3A 4KO8A 3B2NA 1MC8A 3IEKA 1NYLA 4Q3LA 4YP5A 2W6PA 3DLPX 3E9YA 4W5QA 3VNBA 1JKIA 2J08A 4MQBA 1YI8A 3LPDA 3E15A 3KT0A 4HRVA 4RTQA 2ABWA 2WVJA 3VU3A 2J3LA 3BJMA 3Q5DA 4OXRA 4MQMA 1TQ8A 3QX3A 3C2QA 4CG1A 2ATXA 3AOEA 5I7EA 1ZRNA 1WB5A 2FX5A 4LJ8A 3U39A 1A5AB 1B42A 4ZI7A 1E32A 1QANA 3N59A 4ND6A 1M1YE 4TLBA 3M6UA 1ZOSA 4FHGA 5F73A 3PEYA 4R8RA 1GGMA 1P4GA 2V4MA 4PLFA 3VZSA 5JMWA 2CNWD 5K1ZA 1EFRA 5H5JA 4PR0A 2AJ8A 1QHYA 1TA4A 1E6CA 2DFNA 1AUXA 2ZJ7A 4L8VA 4PBRA 4W1PA 1AK1A 4CL2A 1NR5A 5HE8A 2AUMA 5FR1A 4HDOB 4MEJA 2WT8A 4GUDA 4YGYA 3VZBA 4XVQA 4YRLA 1SN7A 2VT2A 1BRTA 4DSAA 5BY2A 5LXTF 1B00A 1F12A 3P71T 2AR0A 4OHKA 4FZ5A 1LRJA 3CPHA 3PEFA 5CFZA 1DLJA 2R8XA 3IHWA 2FZWA 1CQZA 2C5GA 3W3ZB 2HQ1A 1G6Q1 3EFOB 4CIVA 3AM1A 1GLNA 2VK4A 1TAQA 2RGXA 1T0BA 1J0DA 2WTNA 3IKLA 2B69A 1HQKA 1ZICA 4R2JA 5CVUA 5LCXA 5JQWA 3ICCA 1J0XO 1P44A 1FLAA 1V8BA 2XJ9A 2ZBGA 3C8MA 3CNEA 2WIGA 5GJBA 1ZSYA 2EAUA 4QASA 2JZNA 2PGIA 3IUQA 2PWYA 4TM7A 4A0GA 1DI0A 5B2ZA 2H1CA 4NABA 4AY6A 2AEJA 1L4YA 3B1ZA 2LNDA 1E2UA 1ZNWA 2G7ZA 2UKDA 1BX3A 2I2WA 3LP6A 4JXJA 4XGQA 1EFVB 1JTFA 3T3EA 2VDWA 1NMEA 3QKRB 4I1IA 4ZFNA 1PR9A 2QBYA 4N18A 3HCWA 1UL1X 4YLEA 3LUAA 2XA2A 5BW4A 4BB0A 4UMFA 1G3UA 3J7TA 3BA6A 3MTBA 3L79A 1XN4A 1S1MA 1Q14A 1MIOA 3ANXA 3GLTA 4RD1A 1OT3A 1Q1ZA 2EJBA 3FRJA 1LS6A 3A0UA 3FHLA 3FZGA 4OMCA 5ERXA 6GPBA 2MSLA 5SZKB 1Q16A 1UJCA 3ZZ1A 1G8SA 1RM0A 1P2VA 3D6UA 3HM9A 4H60A 1J6UA 4D0RA 3DBVO 3V55A 2FUCA 1U0GA 4G2TA 4GGOA 3HCNA 1T2VA 4Z0NA 1YR3A 2XHZA 4GI7A 4RVSA 1ZVJA 4R8VA 3TLGB 3B1KA 3EFOA 3SF0A 4YLGA 3K9FC 3SDSA 5IXJA 2SECE 3EA4A 4IYJA 1Z2CA 3CA8A 3LIIA 2XGGA 1M5RA 2QG6A 2OBFA 2XUFA 3WX0A 4EJSC 5JPIA 2ZR8A 2IDZA 3DCIA 4OBEA 3GPBA 2ZE7A 4ITUA 3H16A 4IF6A 3D8SA 4DRZA 5LD2C 1T35A 4HGOA 1EP1B 4JB8A 2C82A 2IOFK 3CTMA 1IBKB 4Z4GA 5ILGA 3RC7A 3QUAA 1KKUA 1W4LA 5FOWA 2V6MA 3V80A 5C1BA 4QSMA 6NULA 4N5IX 1R00A 5AW9A 3BXEA 3O9VA 4BXOA 1E3SA 3RIYA 4ARCA 1GO2A 2WF9A 3EUFA 1TZCA 3UWPA 1O0CA 1EIZA 2X77A 4JI8B 1EQAA 2P90A 2W6IA 1WSBA 4GKVA 4TT8A 3RYIB 3RUDA 4MR9A 4X6XA 1F4PA 1PO7A 1AB6A 3MRSA 4P0TA 4EB0A 3U61B 3H7AA 3I58A 4QTZA 2BN4A 5AM1A 4YRZA 4JR0A 4HDSA 1EDEA 3JVUA 4XIFA 3SZUA 2OCBA 3B82A 5K0EA 3KU1A 4AN4A 2CD7A 4ODIA 4RH3A 3WLSA 4BFXA 2M6RA 2YXLA 3MERA 3O4HA 4LJYA 5C3MA 3ZK7A 2WVGA 1O8CA 3W1WA 1ISSA 4QDTA 1EEHA 4P4SB 1XRNA 4WESB 4AZVA 2QT1A 4C03A 4BECA 4YJ2F 5HYVA 4G25A 3OCYA 5JSYA 3RTCA 3WGKA 5HEKA 1E7SA 1NFFA 3CLUD 3VR0A 2E21A 2WM8A 3QYJA 3ORRA 2BCEA 5JBIA 3CR8A 4KLAA 5JY6A 4S1PA 2JI6A 3TQRA 1MX5A 4EY4A 2P0EA 3DOHA 3P9NA 5CNKA 2M1ZA 1ID8A 1XHLA 1QJ4A 3A1TA 2HX1A 3H8WA 4IG4A 2BTOA 3U4HA 5EQTA 4BHTA 3K5PA 4LHYA 4LMBA 5BYJA 4CT0A 3IEMA 2NT4A 1P81A 2M6KA 4EATA 3IERA 2VOJA 5EVJA 4E2FA 1UBSB 4EJMA 4LBVA 1AHHA 2O1XA 2OK8A 4YAKA 3FOEC 2ZYWX 3RHZA 1U0SY 4MW0A 1WCXA 2PIAA 1IB0A 2JGKA 2XUIA 3G49A 2Y27A 2EW2A 3PK0A 4OA5A 1FX1A 5DN9A 4Z0HO 3K6RA 5HMLA 1KWGA 4TSKA 1HQDA 1PTJC 4HH3C 2H2HA 2X13A 1DG3A 1LQTA 2J3IA 2PRKA 1RTKA 2RI6A 4C6TA 3YASA 5BYAA 3K9BA 3W79A 3V5NA 2VAXA 3ZGOA 4LX8A 3UWSA 3FUCA 4R1NA 3IE0A 1P72A 4Y6SA 3D2BA 4ICIA 3DZIA 3EXFB 3K32A 2HGZA 3QGMA 3OLQA 4OKSA 1FYVA 5DHPA 1PW5A 5EXSA 3DAPA 4O1IA 1F2TA 4FKZA 2XXBA 1Y8RA 3N3BC 1N92A 2VP5A 2WVHA 1Z2DA 3B1XA 3K53A 3LLUA 3PEEA 4N0MA 4P4SA 4CEHB 2YOGA 1NATA 1T1JA 4FFOA 2GPAA 2OZLA 4TRRA 4RYDA 1AKYA 1LLUA 3IP3A 1ADCA 3OZEA 1AH2A 3RIGA 3BQ9A 1TEXA 1S3GA 3WGMA 2J5KA 3RSLA 1IK6A 2JJ8A 3EBOA 2GPBA 5JO9A 2YYZA 1JQ5A 5BN3A 4L5AA 3T7EA 3VOSA 4BKPA 3QVGB 1UANA 4OQXA 4TTSA 5DB4A 4Y8VA 3RT7A 3KKOA 3WMWA 2O1WA 5FRDA 4CCYA 2PV7A 3GI1A 4BB5A 1EU1A 1K5GA 1R4NB 2XWBF 3PTZA 2EWWA 3LT5A 1IUPA 3P7MA 4LGYA 1SCAA 3E03A 1CR4A 4OP1A 4XA8A 3K8OE 5ITZB 1YFLA 3UW1A 1J1UA 1FFYA 3ZJYA 5AKYA 3M6WA 3S4YA 3GVXA 1UBGA 2JDID 5E38A 5AUQA 4QRDA 1S2IA 4YP9A 1WZEA 3E4CA 4Q1EA 1ONOA 4KE6A 4WLNA 4BO4A 1R10A 1RBZA 4CFZA 4G0XA 3HNPA 3ZV3A 3FUVA 1EB8A 5LJIA 1N8SA 1ZM9A 2DG2A 4FJ1A 2CXOA 3EXFA 4JL8A 3WOHA 1E63A 1PZXA 5KJCA 4G56A 4JB3A 4S1WA 4ENVA 4XYBA 4TZ0A 1RZ3A 5BUZA 3B53X 2P6MA 1CWUA 4PC7A 5DV9A 3ZE7A 4DT1A 4CEHA 1NY5A 2WM9B 4J1QA 3V8VA 3LS2A 2RHGB 3F6CA 3N0VA 5CJ2A 4A27A 4Q9DA 3T9CA 3GK3A 1G2IA 4D4HA 3AL0C 3NC4A 3Q5GA 2GXQA 3GT0A 3ZUPA 2C0QA 2NT3A 4IDAA 3ZWAA 4EO9A 5L4LA 1E7MA 1R0WA 5FUWA 1AKWA 5FUXA 1T9ZA 1PCXA 3W9YA 1YVUA 2Z5VA 3MPUA 1Z6XA 4HXGA 3K2BA 3NS7A 4P5EA 3U7IA 3T9BA 2SKEA 1GNLA 1OI7A 1OPRA 2JAOA 1JLKA 4FYWA 2C3OA 4G84A 4YT5A 3WP1B 5KJFA 2JW5A 1R4NA 2BBTA 3I0NA 3UFXA 1SJ9A 2WF8A 3GLUA 4I4TB 4QQFA 5ITZA 3ESRA 5DIZA 2FN3A 3FBGA 1TUBA 4LYHA 3RS0A 4C14A 1WSDA 1BE6A 2XUGA 3FVRA 4ZCRA 3C45A 1XR3A 4W5TA 4M8NE 3DE5X 5FJIA 5T4EA 4CIBA 5AVJA 4KQ9A 2H4ZA 3GUCA 1UZLA 4QYXA 2E85A 4L50A 1E6UA 3WL7A 4WSOA 2YYYA 2PEZA 4C3VA 1FS6A 5E0KB 2X8WA 1UBLS 2AVDA 2NACA 3AHEA 1OXVA 4N3AA 4P36A 2OYRA 3KSRA 2VTEA 3RBAA 1MTOA 5E9AA 2IHTA 1F38A 1EINA 5ELMA 1R1DA 3EDYA 3FFAA 4PLTA 3LJKA 1ZD5A 1D8TA 3EPPA 4B32A 4MUFA 3HUDA 3ROFA 3KSDO 2JJ2D 4AYWA 2AWOA 4TMZA 5F51A 4CBVA 2GM3A 1AG9A 2BISA 2VRCA 4KYIB 4F5EA 4MKRA 4HAVA 3KT3A 1SUEA 5GINE 2NPIA 4MQFA 4L8YA 1YE8A 4ZRMA 4BQPA 4Q7QA 2O3SA 1S2OA 2FJUA 2J45A 4KK4A 3EG5A 2CLCX 4Q6WA 4KBYA 5D3MA 2AMLA 3ZHUA 2WUFA 2ZSIA 1Y5MA 2Y6VA 4MO2A 4RY2A 4UHFA 4U9HS 2G63A 1TFRA 4FOPA 2Q46A 4TZKA 5B7QA 4KR6A 3EVEA 3M81A 3DD5A 3OSUA 2B3TA 2QN6A 1I33A 1BVHA 5F2EA 1ZD4A 2HMAA 3EX7C 4UCFA 4UQLA 3WRXA 3R09A 1W88A 5DF1A 1RMQA 2WG1A 2C98A 3OECA 4BUJA 4D9EA 3LOQA 3UOWA 4KK3A 5LNK6 3EWAA 2OGZA 1JWAB 1U31A 1X1TA 3K0AA 3N2GA 3ST7A 4B76A 3T8YA 2FPGA 2NVBA 2YIMA 3AW8A 4P38A 1GZVA 2VSXA 5GPBA 3A8TA 5E1OA 1KAGA 1UUFA 1QP4A 5T8KC 4AZ3A 1AGXA 1HT0A 3BWMA 4MCAA 4FCWA 3QSYA 1K4YA 4IM7A 3EIXA 4IUDS 2EQAA 1XEXB 2AKAB 2B6HA 3WHIA 1VE6A 4S04A 4FMCB 1OYWA 2ATEA 2YHAA 1UF9A 2VQSA 2HT1A 4ZCQA 3V8BA 3D5EA 4G07A 3JQDA 2X2EA 3D7MA 2XIQA 2YN0A 4GKJB 3AB7A 4B3IA 3TW8A 2ALJA 4FT4A 4D7AA 3G68A 2XUHA 2IUSA 4EG5A 4NYJQ 3A27A 3CGGA 3D1LA 5KTSA 3BRWD 2UU9B 4LJLA 4FD2A 3PQ6A 1TT7A 3S7ZA 4O8ZA 1MB0A 5H8WA 1MT3A 4IZOA 1CY2A 4DS3A 4XWOA 1H0KA 1MQSA 2NPOA 4MDHA 4YMIA 4OFWA 13PKA 3L4BC 5KBYA 4GLOA 2AS0A 3G0CA 4GNRA 5KYWA 1ABBA 4LZAA 2ZUUA 4CG0A 3DV0A 4NWIA 5HE9A 2V03A 3TN7A 1K4MA 5C5IA 5MGBA 4DKJA 4GLBA 1JFLA 3BWCA 3ZX4A 2Z2JA 1MOQA 3PKIA 4CKWB 2C4TA 5CA1B 2UDPA 3K1YA 4J2HA 1JVBA 1OYOA 2TMYA 2ZU0C 3BPSA 4CQMD 5JSFA 4XASA 3ZCRA 2OP0A 4AYXA 2BE9A 3VKFA 4AY3A 3CRMA 2ZS9A 5K8CA 2P2LA 4N48A 1EG2A 2IS4A 5JD3A 3CKKA 3M4YA 3OKAA 1AOXA 3SXUA 1RZVA 1XZPA 4PG6A 1BQ4A 3O2JA 3ZHYA 3BGIA 3JASB 1JTVA 3PC8A 3U1TA 3KBOA 1Q12A 2H2WA 4LYDA 3RUHA 4RTOA 3Q85A 2C7GA 2O7RA 1GLVA 3R6WA 5CP8A 2GHRA 1N5JA 2NU8A 3VH4A 3GEGA 4NULA 3LGSA 4QU8A 4RFVA 5F77A 4X60A 4AMBA 3ZQ6A 1NX6A 1DHRA 4JJ7A 3TLCA 1Z6PA 4A73A 3TFQA 1P4AA 3LDGA 3DGFC 1M2FA 1EXWA 3EVAA 4HAIA 1JNYA 2CHUA 2ZITA 1ZJ5A 1NJGA 1VFPA 2F1IA 3UAGA 4HPJB 4M9CA 1UBUS 2WPDD 3EMVA 4BE7B 3CXUA 2A84A 4CZ2A 2GO1A 4Q02A 4YPFA 4Q7JB 4OI1A 3MAGA 4H7DA 4XCQA 4OYLA 3V9PA 5FUMA 1DEHA 1N3LA 1Z06A 3IDOA 1GUFA 2P75A 3LC2O 5CDYA 4FHDA 2UUPA 3DL4A 2GBPA 4Y9UA 3S2GA 4KR3A 2PLNA 4G5HA 4WNIA 1FP2A 1BX0A 1BXKA 3AYZB 4ON9A 3EY4A 4O3FA 1B4DA 1UPUA 1Y7PA 4YPOA 3PJDA 5B64A 4CKWA 1N6RA 3U9TA 3SBXA 3E22B 4G5GA 4B81A 1CK4A 5JJCA 2DJ5A 2V98A 1J7KA 4M54A 1WSWA 2JGMA 5JAOA 1JQAA 1W46A 2GK3A 4B4WA 3EASA 5KX5B 3EH1A 3NHBA 2RHDA 2Z04A 1JR3D 1Y80A 2D2VA 2J9YB 4QUJA 1VL8A 1RE0A 2I4TA 4E15A 4G6ZA 1DVRA 1YZHA 1I7QB 2EC5A 4Y3UA 2DUJA 3T3IA 1FUEA 4DM4A 4X94A 4MS4A 5G4KB 2REOA 4I19A 5LL6P 2FWPA 4K0KB 1B2LA 2E4XA 4A23A 3E9ZA 3DC2A 3B13B 5AICA 3C85A 4I4IA 4HDKA 1YVPA 2NXWA 1S5PA 1MKYA 5ESRA 2EZ9A 1Q1NA 4PFKA 1M0WA 4HQLA 3FF1A 4G01B 3D3KA 4M1KA 1IJBA 1OHHA 3LSYA 2IH2A 2CHQA 1UPBA 4Y6RA 1TU4A 2RCNA 3RKUA 1TMYA 2K2QB 2JIBA 4BTVA 3RS8A 4MW2A 2G1PA 3MWGA 1C0LA 4GLJA 4EARA 2ZFUA 4LVOA 5REQB 2YASA 3PKZA 1TX4B 2VEDA 1YE5A 3JV7A 3EHEA 2O3QA 3P0HA 5H02A 4FU0A 5CDUA 2C2OA 3TRDA 3LDUA 1Z4OA 3EWNA 4NBNA 5SYAA 2G07A 5JFGA 2OXEA 3L7DA 3BORA 5EXTA 4BVLA 2Q49A 4EYKA 4CF5A 1TM2A 4U2FA 1HWYA 4YWHA 2HRQA 5I9LA 2X86A 1X7HA 6ADHA 4Q9HA 2XWQA 4G5XA 1KH2A 3I92A 1T5SA 3OHMA 4JHXA 3PX3A 3BEDA 1CE8A 2ZYAA 1X8LA 3MELA 3R5FA 3L5KA 4I55F 3O94A 3UMVA 2G9ZA 4KGDA 1USVA 3FBTA 2LDXA 3DSRA 4YQYA 2GAFA 1GGJA 4CM9A 1A8SA 2QJOA 3NV9A 1D6MA 4JOCA 3RVLA 1Q0ZA 2B1RA 4AWXA 2CVZA 3BE4A 3W1VA 4LW8A 2C5SA 1NIPA 1MABB 1RPAA 3G9XA 5GZ3A 3BM5A 1QHNA 4Q00A 5JAIA 5IRCD 4A03A 2FUKA 2VPXA 2OZVA 5DM70 3FTPA 2Y68A 3OFSA 2K5UA 2C7BA 2VHVA 2ZI9A 2VRNA 2DC1A 1REQB 5KO2A 2C9BA 5BUSA 1K6XA 1RRGA 3ZJ5A 4GT1A 3KJXA 4FX2A 2Q4EA 5HZMA 5C8VA 4N8DA 1M34A 4BVKA 3TJMA 4RZ3A 1EVIA 4NYMR 3U17A 1UH5A 2V7VA 4RORA 3ZHZA 1ISFA 4V0ME 5H0IA 3H9JA 1Z74A 1Z62A 1MAWA 1C8LA 1VPLA 5JS2A 2VCYA 1KBQA 1E64A 4PGFA 1H2EA 3IO3A 2B8NA 1ZRSA 4JS0A 2R5WA 4YFVA 4DNOA 4E7OA 1CY4A 2XTMA 4WA7A 5F76A 3A6ZA 2PDAA 2OAP1 3ZI7A 3IA7A 2GAIA 2VXBA 1UMDA 4PYLA 1ITZA 2WM2A 1NNI1 3CVJA 3GAAA 3MAAC 4I1YA 4NICA 1UAYA 1KARA 2NV2B 1NBIA 3BRCA 5HQ3A 4XYGA 4G67A 3UK6A 4CM7A 2N0SA 3CG0A 3O3OB 1GTRA 3ZDEA 3QNWA 5ALUA 2IUTA 3UUWA 3TQSA 3NKFA 4JEHA 2XUOA 2P30A 2TMKA 1JVNA 1MAHA 1MABA 1UBEA 2IXAA 5JT1A 2I6QA 4PRLA 3LXRA 4KE7A 1UZMA 4LWZA 3H4VA 4ENSA 4QOEA 1DAHA 1QG6A 3MUFA 2TSYB 3COPA 2YJ4A 3LKVA 1Q7CA 3PI6A 1FSGA 1REQA 3RBZA 1CZNA 1NF3A 5H82A 2I9KA 2JC3A 1Z5PA 5FEUA 1DCTA 2Z5FA 1H6BA 2IY7A 5HF8A 1WCIB 2WG2A 5C4GB 5JPDA 3BCUA 1QF7A 3QPUA 5EJ4A 1DQRA 3KJGA 2AG5A 4MVJF 1V37A 4PTYA 5EPEA 3SQOA 2O2SA 1GPNA 3RTDA 2I03A 4WACA 4XTRA 4RHEA 3ENZA 5BMOA 1TYEB 4BJ5A 1U3TA 4KWTA 5GOZA 1ZMRA 1I4WA 1KQOA 1U1CA 4L75A 3IRVA 4Y2RA 4DDUA 2XRMA 4BLWA 3TRJA 2JGNA 2DPXA 5FTJA 5IVPA 1FUKA 2OAQ1 2Y1CA 4X0EA 1Q7RA 5CHYA 1N5RA 1HKHA 1II8A 5AESA 4YP0A 4QOIA 3U4MA 5AR1A 1FMCA 2QN7A 1BWRA 5B3AA 2VSYA 2C5AA 2NQ8A 2FYTA 3RFXA 2GEBA 1NJ8A 5EAIA 2WAAA 3DEKA 4JGGA 3U7HB 4EUEA 1XDSA 4J91A 2H9YA 1GARA 1V9SA 2G9VA 2PLRA 2PSSA 3ADOA 3IP5A 4MIOA 4AZWA 5JCOC 1O03A 3WK4A 3WBBA 4K9MA 2GH1A 1LFAA 3TSWA 4U02A 1NY6A 2H0RA 4QUBA 3W8DA 2C54A 4HXYA 1XYVA 4GYJA 2FG5A 2WUVA 4DV6B 3CEMA 4XIYA 2TRSB 1FYFA 4WZBB 4EG4A 2N46A 5EIWA 1SC9A 1LLFA 5EFZA 3AF0A 3PDWA 3Q0EA 3L92A 3TE6A 2IRWA 4DQXA 2IHBA 1DOAA 3KRTA 1SC4A 1T91A 3TW4A 4FWTA 1D09A 4AKSA 2RD2A 5KYUB 3Q88A 1GCIA 3K0EA 4U2BA 1P5RA 2IPXA 4OM7A 3SEAA 3RTAA