4YV7A

Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmei_3018, target efi-511327) with bound glycerol
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
GALKIGFSQATQQSPFYVALTDAAKAEAQAQGDELFYADANGDITKQNNDVQDLITRGINVLVINPVDPKGVTPSLAAAEAAGIKVVTVDRPVESGAASFVGRDNKAMGELVGKAAVDTLGPDGGKIIEIQGDAGGAVARDRRDGFQAAVSGRPNITIVEGPYCDYIRSKAVTAMQDLLQAHPDLKGVYAQNDDMALGAMQVLAENNRTDVKVFGVDGLMEAVRAIADGDQYVATALNDPDAEGRLAIQTAAKVARGESVPEFVDAGTGLVDKSNASALVGQSTFAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Solute-binding protein
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title CRYSTAL STRUCTURE OF AN ABC TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM MYCOBACTERIUM SMEGMATIS (MSMEI_3018, TARGET EFI-511327) WITH BOUND GLYCEROL
rcsb
source organism Mycobacterium smegmatis
total genus 107
structure length 288
sequence length 288
ec nomenclature ec 3.6.3.17: Monosaccharide-transporting ATPase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yv7A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yv7A02
4JB0A 4LDZA 3O2QB 3QK7A 4RSMA 5FWYA 1ABFA 2MSWA 2GX6A 1XHEA 1PHRA 2R48A 1PNRA 1D1PA 2MYNA 1M5UA 1K68A 1GCGA 2JCGA 5IEJA 3FGZA 5TPZD 3H5OA 2FQYA 2BGGA 3TO5A 2AYZA 3HCWA 7ABPA 2F8TA 3TX6A 4ZPJA 2PL1A 5KWSA 4PZ0A 1CYEA 2YHBA 1Z25A 3IP9A 4N41A 4G0PA 1ZY2A 3H1FA 3L49A 1YK0A 1M2FA 4Q6WA 2N9UA 5IBQA 3EODA 3EAFA 3H5LA 2FKAA 3T8YA 3RH0A 4F3TA 1LBHA 3I5AA 4RK0A 3HXMA 3HDVA 3NNDA 4W5RA 3NNSA 3IPCA 5KQMA 3IP5A 4LX8A 4Z9AA 3LUKA 4WWHA 4EGSA 3CKMA 3OMXA 4Z0NA 2PUFA 3T6KA 4UHKA 1M5TA 4CBVA 3I09A 4ETNA 2HPHA 2VUHB 4JASB 3JS5A 1ZITA 1ZGZA 1JLKA 1USIA 4KQ9A 2QXYA 1UDRA 1U04A 2FLWA 2OQRA 4S05A 1A0OA 4OTZA 2X7XA 2FW0A 3HEBA 1SXHA 3RVMA 3H1GA 5EWMA 3IP6A 3QX8A 2PLNA 4MQFA 3SNKA 1MB3A 4N76A 4FE4A 5IX8A 4Z4GA 3DGEC 1BDJA 2R47A 5HKOA 4RU1A 2M1ZA 1MAVA 1USKA 5FWXB 3Q7TA 1D5WA 1PEYA 4JA2A 3OLXA 1RXEA 2WRZA 3Q7SA 5JS1A 1D4ZA 2IPNA 2RJOA 3BILA 2PUGA 2FN8A 2J48A 1DC7A 2WJWA 3L6UA 3MYYA 3LUCA 2MSKA 4RKQA 2PJUA 2QVGA 4DQDA 4EYOA 1EFAA 2B1JA 4RDCA 1TM2A 3URMA 4PE5B 4MQFB 2MSLA 4JP1A 1RNLA 3EGCA 5TQJA 4ZJPA 4E7PA 3CG0A 2FQWA 3CNBA 5CNIA 1DP4A 4EVSA 1A04A 2IYNA 3H5TA 2A9RA 3OLWA 2CHEA 2PUCA 2R4QA 5EWJB 5JNSA 4EVQA 4QYMA 3D8UA 4OLBA 1B00A 2QR3A 6CHYA 4QICA 2RDMA 1TMYA 2P4UA 3MA0A 2DRIA 5JNRA 2GBPA 3HZHA 4KK4A 5KQPA 1E6LA 1KRXA 3FFTA 3EJWA 3C97A 3CRNA 4O1IA 4RXUA 1K66A 1NXOA 2OENG 1ISSA 4MS4A 3C6QA 3QEMA 1Z12A 1JF8A 4H60A 3KCNA 1QNLA 2R25B 1TLFA 3TB6A 4FB4A 4LE1A 4LE2A 5CNMA 3BRSA 3FFWA 4E7OA 4H3HB 4MR9A 1PNTA 1I3CA 1IIBA 3QX9A 4KRFA 1NXWA 4NQRA 2E4UA 2FTKE 4MQEA 2QZJA 4YGXB 1LJUA 3OQOA 2H0AA 3GWGA 1SXGA 1JHZA 1YK1A 1JFSA 5PNTA 3MQ4A 2ID7A 2LBPA 4GPAA 1JYEA 3BRQA 3BBLA 3QEMB 3DLBA 4NICA 4EUKA 2XDYA 2JVKA 3OO0A 5JNUA 2FVYA 1URPA 3UUGA 4YWHA 3CTPA 1ISRA 2E4ZA 1QQBA 3O2JA 3KYJB 3JY6A 4MR9B 1DRJA 3MMNA 2GI4A 2KYRA 1OXKB 3BREA 3GYBA 5ABPA 3SY8A 2IPLA 4XXHA 2PKXA 4MS3A 3H5WA 3KLOA 2PL9A 2HQOA 4DN6A 5E3JA 2W42A 1QPZA 3LUGA 1BAPA 4H3KB 4GNRA 5GQSA 1LBIA 4EYGA 5B3JC 5T7BA 3C3WA 1EWVA 3I45A 4Z4IA 3A3KA 5KQGA 4YR7A 1F4VA 1APBA 3KSMA 5EWLB 1EWTA 3RVQA 5DCLA 3E61A 3LMKA 5IUJC 4IGAA 2WY2D 1GCAA 4YP9A 4HNSA 4KPYA 3VNBA 4HNRA 2CWDA 3N0XA 1LJLA 3RVRA 5TQ2A 2A9PA 2O20A 4MS3B 5FWYB 3DGFC 4XLTA 4F11A 3GBVA 4WXMA 1QQAA 1YMUA 4W5TA 1Z26A 4G86A 2JB9A 3DZDA 3QEKA 3HDGA 4WZZA 4ETMA 3S99A 4DADA 1QKKA 4L85A 1E2BA 1F51E 1FFGA 1JL3A 5I4CA 4G0YA 4LRQA 1D1QA 2PUAA 4JB2A 4MR7A 2FEKA 4KMRA 2JK1A 1FQWA 1FFSA 3RVOA 4G0OA 4PEVA 4YO7A 3T38A 1ZVVA 4KZKA 4D6YA 1EWKA 2IKSA 2QVCA 3G85A 2ID9A 2FMKA 3GV0A 3N0RA 5TQ2B 5IULC 4Y9TA 3SM9A 3OLYA 2E4XA 2FLKA 2NZUG 4KVFA 4YLEA 4RY0A 3NNNA 1ZHHA 3H1EA 1BDHA 2PUDA 4NCBA 4OLAA 3GA5A 4KV7A 3MIZA 2JVJA 5JNVA 2E4VA 3CLKA 2FSPA 3F7NA 4TMYA 3QLVA 4KK3A 2L19A 4EYKA 5KC9A 1Z16A 1YS6A 1JFTA 2JBAA 5EWMB 2AYXA 4IMIB 4N0QA 4RY8A 5ED4A 1JX6A 1L5ZA 2E4YA 1AB6A 4Z4CA 4F12A 1C0EA 3SG0A 1BA2A 1R8JA 2JRLA 3O2SB 3SQNA 1L5YA 1Z18A 2LUOA 1DZ3A 5B3JA 3KJXA 3LUFA 4LZLA 1DBWA 1PEAA 1W25A 4F06A 4YCSA 4Z99A 4FE7A 1FSPA 4YV7A 1GUBA 4OATA 3LFTA 2I6FA 1YTUA 2JBAB 1LK0A 5TQ0A 4G0XA 3HM9A 4N0PA 3QLUA 2PUEA 3M9XA 4RXTA 3T95A 3ILYA 5BRAA 1M2EA 2JVIA 4RXMA 3CU5A 3UK0A 3RVKA 1DRKA 5BQ3A 1Y1LA 3EDCA 3FMVA 3H5VA 1SXIA 4IILA 3H6HA 5IEBA 1OXBB 1FFWA 2A9QA 1E6MA 1JYFA 3TMYA 4YRZA 1ZH2A 4RK4A 3LUJA 3D02A 4MRMA 3LUAA 4MGEA 5IC5A 5JNTA 3OQMA 1JWLA 1YVUA 4P1ZA 1QP7A 1YIOA 2M98A 2VYCA 5D2CA 3Q15C 1P6UA 2IDMA 4P98A 6ABPA 1KGSA 1Z13A 3GT7A 1Z17A 2L17A 2MYPA 3N0WA 4G97A 3EQZA 4TLLB 2RJNA 3R0JA 4B09A 4OG2A 3QELA 4MPTA 2FMHA 3HUTA 2WMYA 1W9HA 1SD5A 3SAJA 4ETIA 1DBQA 1DCFA 4EYQA 5C5CA 8ABPA 2PMCA 2IPMA 4MS4B 4IF4A 3QLVC 2FMIA 3HJFA 4MAAA 1QO0A 2QW1A 2FXIA 3MM4A 2HSGA 3LUHA 1NXTA 3C3MA 5TPWA 2V0NA 1C4WA 4QYWA 3N8IA 4MS1A 2HQBA 3UKJA 1GLGA 3EQ2A 2FN9A 1BDIA 1KRWA 4MQEB 1TJYA 1JDNA 1QO0D 3FFXA 2ZWMA 1U0SY 4M88A 1KMIY 3FDFA 5IUKC 1U2PA 4IRXA 1NXVA 1NXPA 4Z4HA 1EAYA 3NBMA 3JPWA 3LKBA 3IDOA 3F6PA 1P2FA 4O1HA 4JAVC 4Q6BA 2QV0A 3LTEA 4RWEA 3O21A 4WT7A 4HYEA 1D2AA 1DCKA 5CNJA 5HM6A 5F64A 3O1HB 3A0UA 3KS9A 3QLUC 5HSGA 3CG4A 5TPWB 4ML3A 4PICA 4TLMB 3LOPA 4MS1B 3LKVA 5BR1A 4RK6A 1DC8A 5KC8A 3O75A 2PAFA 3Q9SA 1YMVA 1VPWA 2VUIB 2IPAB 3RVJA 1DJMA 4RS3A 4W5NA 1HEYA 5GOTA 4N47A 1BVHA 3JVDA 4IMJB 3F6CA 5JNWA 1A2OA 1GUDA 1AB5A 3OLZA 2L2QA 3IPAA 2LIVA 1U2QA 3K4HA 3HV2A 1ZH4A 3OLVA 5IUNC 3KTOA 2LPMA 1JDPA 4RZSA 3M6MD 2ZAYA 5DGCA 1RPJA 1JH9A 5T3YA 2FMFA 4W5OA 3N75A 4RV5A 3A10A 4KQCA 2WWVD 4F8JA 3CZCA 2H3HA 3E3MA 1DG9A 1U8TA 1PUXA 4D74A 1EHCA 2NT3A 3M9WA 3RVPA 1ZDMA 5FWXA 3RVLA 3HK2A 3A0RB 2YHAA 3Q41A 4O5AA 3NHMA 1YS7A 4MR8A 1VLZA 1ZESA 3GL9A 2L18A 5C5EA 1QP4A 5HQJA 4RY9A 4G0ZA 3CHYA 5DLEA 3H5IA 3HSYA 5KQLA 1E6KA 3CS3A 1Z2EA 5FBHA 4MR7B 1QP0A 1SRRA 2HQRA 1MIHA 4L4UA 3OM1A 3W9SA 4Z4EA 2RGYA 1S8NA 3JPYA 1NATA 2P9HA 4Q7EA 3TD9A 1P8AA 5DKFA 2IOYA 4RK1A 4PYRA 4HNQA 3OO1A 4KNYA 1ABEA 3N6VA 2PUBA 4XARA 3ROTA 1DCMA 1Z2DA 3CFYA 5BRJA 1QMPA 2MYTA 1P6QA 4MR8B 3IP7A 3KYIB 1TVMA 5EWJA 1T34A 3CZ5A 3MF4A 4NV3A 3QLTA 2QU7A 4ZYLA 1ZN2A 2A9OA 1ZGGA 3KLNA 4RK7A 4UHJA 3N53A 2F8SA 2FQXA 3JTEA 4TN5A 3OM0A 3GBPA 5DTEA 2NZVG 2B4AA 4KFCA 3HS3A 4ZMRA 4MLDA 1XHFA 5TE9A 5FBKA 2MYUA 3RQIA 3KHTA 4Z9BA 4Z4FA 4D6XA 4MLCA 1MB0A 3HVRA 2NUBA 3H6GA 3VNAA 1RZRA 3RVNA 1WETA 3ILHA 3I42A 3G1WA 3P9YA 4KREA 4JOQA 1Z15A 3NHZA 3C3KA 5CNKA 2GKGA 2WJAA 1VRVA 3B2NA 1JFVA 5TQ0B 4LDAA 1RZRD 4N03A 3KG2A 2GWRA 5KI6A 4XFKA 2FEWB 4EY3A 2LP4Y 2QSJA 4RKRA 2Q5CA 1H9CA 2WB4A 4WUTA 4OBBA 3HO1A 1XWWA 4WXEA 3OQNA 2PE5A 2HJ9A 4G0QA 3EULA 1CHNA 4LE0A 1NY5A 4MRMB 1ZAYA 4XAQA 3DBIA 3Q7RA 5CHYA 1RXIA 3JVIA 3KKEA 4EVRA 3O1JC 3O1IC 4MYRA 1NTRA 4ZMSA 3LUDA 4S04A 1DBPA 3QELB 4QPJC 3H75A 4NCAA 2TMYA 2E4WA 3ROFA 3DLHA 2CHFA 1USGA 2VK2A 2FEPA 4YS6A 9ABPA 1VKRA 4G0MA 4RK5A 5EWLA 5JS2A 1CEYA 3K9CA 4XASA 2CD7A 3F73A 1NXXA 3HUUA 3OMWA 1MVOA 1J56A 1JBEA 4W5QA 1NXSA 3RVSA 3GRCA 3O74A 2NT4A 5TPZA
chains in the Genus database with same CATH superfamily
2GYVA 4PR0A 3E3NA 2Y1LA 2JLQA 3F1KA 4X3PA 5IJXA 3GVCA 4LYGA 3K9HA 1XHEA 1XZPA 2YR0A 1DIOB 5BT9A 1VJGA 4F3YA 5JZVA 1E20A 4BX9A 3A4MA 4E5UA 4UDOA 3SQMA 1FF9A 3TOZA 4OFZA 5FOWA 3HCWA 3N5CA 3ABOB 1T9CA 3BX1A 3FDIA 5I7OA 1GD1O 2BCJQ 2P1RA 4RKFA 3F3KA 3RFXA 2VYVA 2GUWA 4B1FA 4ZXFA 1Z8DA 4ENPA 1RP1A 5B4UA 3SXUA 1QG0A 5EJEA 4OP3A 5H3CA 1TUEA 4L5JA 4MGYR 2IIBA 3WP0A 1YIAA 3PG5A 2EATA 4KQEA 4PC3A 4K0RA 1XZCA 3I5AA 2FFJA 3ASYA 1NPDA 3PHIA 4P2GA 5BV8A 5J58A 1QFJA 4RTPA 3IUMA 1OXXK 4X97A 2OMKA 5K3OA 3B8EA 1ZUIA 4PNHA 2RB4A 2ZRKA 2A0KA 4A2PA 5ECDA 1IQRA 4ETNA 4XYEA 3PNLA 2QXYA 2YH2A 3BMNA 3LT1A 1V7ZA 4MGHA 4BNDB 10MHA 3AL0C 1SXHA 2WWXA 3G2QA 4KO1S 5IJ0A 2YXEA 4CHGA 4U6NA 1GRQA 1MU0A 2C5EA 4IRUB 2ZSJA 4MJ7A 2Y67A 2YZNA 1JA9A 1J5EB 2AG6A 4HQRA 2Y77A 4ZOAA 2G5PA 2KI5A 4MV4A 5L8VA 3DZIA 3R3YA 4LI3X 4BBJA 4EPYA 2CT8A 2V5UA 1A76A 2ZIEA 1QS0A 4QWMA 4IXWA 4G0NA 2X15A 1YS9A 4GVXA 3WOHA 3AHGA 1BD4A 1P9WA 1P0MA 3EW9A 3ZHUA 1L7EA 4V3BA 2FWNA 4YRJA 2XRFA 2XMCA 1T5TA 3DOFA 2HSZA 4XUGB 2WJWA 5ES3A 4UEQA 2CD9A 2PU7A 2HK9A 4I4TA 1PGOA 2QVGA 1QVZA 4L51A 5CH8A 1HO3A 2BFEA 2GZ1A 4KR3A 2XMZA 2OBYA 4NBRA 4HH4A 2V03A 2Z4RA 2V7BA 2IYEA 3C1AA 4XCVA 1V6AA 1XDZA 5KSOA 3WGYA 5DBGA 4N3GA 1DP4A 4BO0A 1E3WB 3IVMA 4PG8A 1A04A 5G1OA 3K8QA 4HRXA 3MCTA 4IJKA 4NBUA 4EABA 1XCMA 3UMMA 3P0JA 1O5TA 3O4HA 5JSFA 5H81A 5LPNA 2H92A 3HZOA 3K6SB 3RANA 1J25A 4KGVA 2YW2A 3DQQA 4N5LA 4OIFA 3KKLA 1NC3A 5BVHA 4AZWA 1NN3A 2O2YA 5G2OA 5L7TA 4R2HA 1SHUX 2H7VA 4LF6B 2RDMA 1XJWA 2AZTA 3PJEA 1H42A 3HR8A 4MJXA 5H68A 4DIDA 5CCEA 2FPMA 4RLQA 1DFGA 1E6LA 1E92A 1S4QA 2GYWA 2XSZA 1YJXA 4WA8A 2C4WA 1WULS 2X5XA 1VG1A 3SVLA 1UF9A 1PZGA 1NHWA 2I2BA 3S2UA 3T0FA 3U26A 1OBFO 1G6KA 2BFBB 4P7BA 1U90A 3E7PA 4LPKA 2ZBQA 5DTQA 3JQ7A 2OBBA 3ORQA 3P9IA 3QVWA 4LQDA 1T6YA 1JQJC 3VVMA 4D96A 1I3CA 4GD3Q 3P0HA 1QV7A 3KVNA 1NMEA 3QHPA 4MUEA 1AM4D 5KNDA 5GAJA 4IHJA 4LOAA 1C1HA 1KKUA 2AA3A 4LKRA 4CF4A 3I8SA 1W581 4G4SP 5PGMA 3K4PA 1Z75A 3VSDA 4XIFA 3JD0A 4EUEA 4HR7A 4J0JA 1N8SA 2TMGA 4ER5A 2RGUA 2HO5A 1JFSA 1RWXA 3A14A 1W34A 1UBGA 2FPLA 3E4CA 2YYYA 2ZXUA 5F1YA 3TM5A 5FOQA 1YCGA 5JVDB 5LIPA 13PKA 3DUFB 4RTQA 4KEAA 4RYLA 1YJCA 3FDXA 2F3SA 3KKPA 2QTZA 1E2UA 2IPLA 1B23P 4GXTA 3PC2A 5EIXA 1H85A 3DMTA 4KRGA 1Z2OX 1C5KA 5D6OA 3HCFA 4ZJYA 3QLEA 2JGNA 1TT7A 4BDSA 1KO8A 4FW8A 1N0IA 2FFHA 2WIFA 2FEXA 3K5PA 3PNOA 2NOAA 4QGHA 2G88A 3IL2A 1KMHA 1XQ9A 1PR4A 1UXOA 1IOVA 1QYCA 2G07A 4CF5A 5CFPA 5IZ4A 1Y6RA 4KXUA 4FC6A 4YR7A 3E2PA 4DLYA 1EP2B 2IBTA 3UBMA 3GA7A 2JW5A 3GLKA 3KSMA 3ENKA 1UMDB 4QRDA 3IBTA 4EB3A 5IUJC 2BFOA 1NG9A 3G7NA 2DLDA 4IJUA 4YP9A 2DULA 3UICA 1FRFS 1WV0A 1Z0DA 5TGTA 2CWDA 4NBLA 2QX6A 5BQFA 5K0TA 3G0GA 5DYNA 3Q87B 1CRWG 3JQAB 3E7WA 1KU6A 4EJ2A 2AUMA 3BIWA 2WLTA 1CZOA 3TR6A 5JCOA 4HN2A 4QBKA 3GMDA 1XR3A 4HNGA 1Z56C 1LPMA 1TYZA 2ZXFA 3HDHA 4UBIA 2IU3A 3A8TA 3S2FA 1UWKA 2YY7A 1P3JA 4UHCA 1UBNA 4YRLA 3TNDA 4CG3A 2OB2A 3GXOA 3SJBA 1LFAA 1WMEA 3OTWA 3R5TA 3ENQA 1IZYA 4RPJA 3UANA 1Y1SA 3VKFA 4B6JA 1DIAA 5A5FA 3OCCA 3P8ZA 3EG9B 4R2JA 2B7BA 3RGWS 2HCJB 4EQ6A 3AY7A 2OAGA 2HIGA 3AHHA 1P3Y1 2GHRA 3LVRE 2GHQA 2O3TA 3N0RA 5ERXA 4C6SA 2WMDA 4JDPA 1DQYA 4Q48A 3WL3A 1O58A 2NZUG 4RHEA 2DT5A 1Y3CE 3LLCA 1P8JA 5AVZA 1QQTA 3NOOA 4BRSA 1U63A 1G9XA 1SXQA 1YU9A 3WSTA 2OHFA 1JRLA 2PSDA 5HR5A 1NI3A 1QH9A 3QUBA 1XKQA 4DB2A 2REQB 2ZYHA 1D0SA 1DO2A 4YP0A 1TM5E 1H2EA 1IB0A 2CSUA 3BIFA 4RH0A 3RPEA 3T12A 3RKSA 4OKIA 1PVVA 3OETA 3E3AA 3TYXA 1WBJB 3VOBA 9MHTA 1ZLXA 4I99A 5J2UA 3E15A 3OZGA 2VTBB 1CE8A 4OLHA 5FPYA 1ZI8A 1QGUB 2PGIA 2I29A 2YX1A 3O8OA 4CKCB 3MWEA 4RSRA 1BMFD 1KO7A 3FM9A 4EG5A 3NVAA 1W35A 2JIMA 3CF4G 2VCYA 1ZUNB 2QGZA 4Q03A 2J0SA 5JCZA 4R9NA 2Y1FA 2ETXA 3VC2A 4UBOA 3DPUA 3UMVA 5KJ6A 4JBIA 1IWPB 1ID8A 4DA8A 1KY3A 1DTEA 1WTAA 2Q1WA 2PLAA 2J3MA 3IHWA 3M6UA 4YBRA 2BTQB 4I1PA 3AWIA 4MUFA 3D8NA 5KJ1A 1GN8A 4IFBA 3LF1A 2ZRQA 1DPFA 5IP5A 4GL4A 4B79A 4BB9A 3ILYA 1GT6A 4C03A 4WN9B 4P7JA 5FO1A 1SXIA 2H17A 2IBMA 4AY2A 1UPBA 1XYGA 5TMBA 3GNSA 4O4IA 4A36A 2IZZA 1OU0A 4DIUA 3ZWXA 4EFNA 1O57A 4ALJA 4ZYUA 5DO9A 4BEWA 2ORIA 1MEJA 2C5LA 1JWLA 1OLXB 2HA0A 5H1YA 1JBQA 1QP7A 3RVDA 1C80A 1S2GA 3G2MA 4E22A 3HO1A 3RROA 2PKWA 3EQZA 5D87A 2RJNA 5LYJF 2IHNA 1QF9A 3FTQA 1H5UA 1K4MA 3KK0A 3G23A 3V6LA 1NMQA 4M0UA 3PA6A 3NHSA 3MFQA 1M7HA 2EL7A 1PT6A 3OQIA 5AJXA 3VR3A 4WNYA 2QD5A 3O3MB 1CF9A 3VUEA 1L5WA 3E2MA 5BMVA 2GN8A 1BKYA 1WS6A 1R9JA 4KNWA 3BS4A 5DNUA 3PV0A 1JXMA 5H8WA 1CR1A 3UKJA 4BP8A 2DR2A 1H6DA 2CVHA 3UYKA 4EQZA 2PGXA 4MQEB 1P4SA 2VH1A 4O8CA 1JDNA 4UDYX 3HWX1 4BMXA 1U0SY 1I6LA 1U2PA 1UMBA 2WWHA 1ZGJA 4QXMA 1G66A 5KKAA 4ZJUA 1T2FA 4QVIA 2HJWA 4MQLA 4YAJA 4CI0B 2D2EA 4RH3A 4JAVC 1WZNA 3IHTA 3PE6A 4XTCS 4F21A 1L8QA 3CVUA 3N2YA 4LWZA 1B26A 3NASA 4FDUA 4NTZA 5F5LA 3RHFA 1NVUQ 4B34A 3FCOA 4YVFA 3AUJB 3IJ5A 3W9YA 2H2DA 5HSGA 3STVA 1Y5RA 4ML3A 1C1DA 5KNDH 1NKSA 4XIGS 4C4RA 1X7WA 1YACA 3K2BA 4P86A 4WK4B 2R85A 5F9MA 2Q5IA 1X9IA 2VUIB 3IPYA 1WDWB 2CV1A 3ZVLA 4LBZA 5FYDA 1DEHA 1HEYA 2YINC 1XN4A 2BFMA 4KSYA 4CTMA 4W5NA 1NASA 3PUZA 3STTA 2CNNA 2XMQA 3BTVA 3LBYA 3OFSA 2QMHA 2OXIA 4MZDA 2ZJ6A 4RHUA 2LIVA 1U2QA 2ZRHA 2OZEA 3CEHA 2IEGA 3INNA 3RBAA 3QVOA 3AVPA 3F46A 4GYYA 1OGJA 2HUNA 3K8OE 3CBGA 3KTOA 4URWR 2AB0A 3UHOA 1EVEA 2MSNA 1Y6FA 4YRDA 4RZSA 2VZ0A 5FV7A 5BSUA 1SA0A 1Y1RA 2DAPA 1HTWA 2ZOSA 3PIDA 1KDRA 3TW6A 1T8YA 2B34A 2PEYA 4RV5A 5A3QA 3THWA 2QW0X 2OAP1 1MMFB 5D3ZA 4D9HA 1YT5A 1W96A 1I01A 3COVA 3EAQA 3MFYA 3H99A 5DOZA 4DCCA 2WMOB 1M67A 1NYTA 4OEHA 4OYHA 4RY2A 4Z8XA 1XP8A 4LSGA 1PJBA 1C9DB 2I67A 2QKYA 3SJZA 3W5UA 5HQJA 1E2NA 3PKJA 4EFLA 1Q0ZA 3CHYA 5KPDA 3MRXA 4WESB 4P4SA 1EK6A 1E6KA 1Z5VA 3QUSA 5FBHA 3FSJX 3BHJA 1O03A 2VJPA 4CKXA 2V0CA 3G5LA 5FOSA 3EB9A 1VZ2A 4E2FA 2UZ0A 1FS4A 4IGEA 1JKJA 1MN6A 2GJSA 2V9PA 3R23A 3B3FA 1HY3A 1QGZA 4M1WA 4PYIA 5EUQB 3TL3A 4P3KA 4JLDA 5LZ9A 2AR7A 1Q19A 3SSMA 2CE2X 1VE6A 3IIEA 4OAPA 4Q1EA 4QYIB 1W88B 3DHWC 1T4MA 1GZ3A 1B3RA 3TLBA 3ZS8A 2OG1A 4R1MA 4Q4LA 1UMCB 2AQHA 1ZBQA 2OORC 1E6WA 2B7LA 3IP7A 4JU9A 1M75A 4TTVA 5HUHA 4X62B 4JLKA 1IYZA 4LZWA 1K5PA 1MDFA 1V1MB 3STYA 1E0AA 2LIPA 5ARCA 3H17A 3PQ8A 5D84A 1Q14A 1ECJA 2FF7A 3WTCA 2IZOA 2XXBA 3OICA 3NHLA 3B2QA 2YFKA 3KUUA 2Y0PA 2FHSA 3G2OA 4HRVA 3DTVA 4XDYA 3ZE0B 2A3RA 1X1BA 3DH0A 1XHLA 4ZMRA 4DLLA 4PQGA 3WOVA 2B8NA 2MYUA 3ZVRA 3UJDA 1XG5A 4I5GA 2VRCD 4G41A 4MLCA 4NJEA 4EMSA 1RYZA 5LOVA 1UCFA 1EFUA 4J03A 1CXZA 3I05A 5AKJA 3I39X 3L7DA 5IASA 1WETA 3IT0A 4EB6B 1SUCA 2PT5A 3A32A 2YV4A 1Z2NX 5CNKA 1M6HA 5GP1A 3OOWA 3VPXA 2GKGA 3STHA 2ZRIA 4DCVA 3HH8A 4RJLA 4C4TA 1I3LA 4I1VA 1RZRD 2RH8A 1N1GA 1Z2AA 1PR1A 3NC1C 2GVNA 4PO9A 1TKBA 4EY3A 1MAWA 1D4AA 5K4HA 1X7DA 4RKRA 3ASZA 1TIKA 2J7PA 1TMOA 3QPCA 1P2SA 2FRVA 4M55A 4KO3S 4BEBA 1THZA 4G0QA 3WLMA 3C7DB 1LI7A 2ZJZA 4RIGA 4F38A 3H2BA 1AS2A 3FWNA 1JG1A 5IXJA 1OI7A 4FOTA 1UKAA 3OLQA 5HNKA 1Q1QA 3AWDA 3FR7A 5BNFA 4A2QA 3TRIA 4KWEA 2FRDA 4ZQHA 4AJ2A 2VDMB 2VQ6A 3JZAA 3M49A 5AUOB 2NUAA 4TLDA 3ZDQA 2PWYA 3LUDA 3OU2A 1NNEA 1Z6AA 1MVNA 2QORA 1KPGA 2VXOA 2V1XA 2ZUUA 4DEVA 4GGOA 1V8OA 1FU4A 1PZMA 4I66A 2B8TA 4D81A 4DNQA 2QQEA 1G7RA 4GQAA 4CT0A 2CW5A 5GZ3A 4YDSA 3SF0A 1CEYA 5DW0A 5AKIA 3QE9Y 2B7CA 1C3OB 2ZRJA 4JYPA 5J4LA 3MOGA 2UYCA 4WTOA 2AF4C 2XRZA 1G8SA 1GDTA 1SUIA 1PT7A 2ESRA 2PTGA 3I32A 3NHPA 2C1ZA 3MTEA 2D1FA 3DVQX 3IUJA 3O74A 4KH1A 2FOIA 3D6TB 4KUHA 4B6RA 2WSLA 2JHFA 1QG6A 3A2NA 1JQAA 3AONB 4TUYA 4ZT7A 3J80A 2ZUWA 1CVLA 1IHOA 5D3KA 2RH9B 4OQZA 2GJAA 4OK3A 4BQFA 5FLEX 3TR0A 2VRBA 3PPIA 5G53C 3T7IA 2O19A 1GYRA 4KOAA 4L76A 5HF5A 3ACDA 4J8PA 1SFRA 1T26A 2QLNA 4MTLA 5AVOA 4CFSA 1A97A 2EGGA 2I80A 3PL5A 3TRDA 4DCMA 4RGBA 3E03A 3UGTA 2IOFA 1Z25A 3IP9A 2AQ8A 3JZIA 1JZQA 1OKKD 1UJ6A 3V55A 2A0XA 2GO1A 4R0MA 4YBZA 3EGWA 1UK7A 4EA8A 4NQZA 3EXEA 3HCNA 4E51A 3E5RA 1TVKA 1PGQA 4DIBA 3L8ZA 2I66A 2EW2A 2PVSA 3BQ9A 4K81B 1P7CA 5JXJA 1TK2A 4FYXA 1JVBA 2AN1A 3UMGA 5CEJA 2AZ4A 4C5CA 3PJGA 3IAEA 4UMDA 3RADC 3R3VA 2PQMA 1D8TA 4KN8A 4OQ4A 1O2DA 3FLBA 2V7TA 3CNQS 4MUBA 4F8EA 1KEEA 4KQ9A 4A10A 2C94A 4O59O 1GU7A 2H2HA 1ICEA 3VYUB 1W4ZA 5LWHA 1M2HA 1TZKA 3DOIA 1NVWQ 3HEBA 4LDNA 2BFNA 5BQPA 5LBUA 4HVLA 2Q0SA 4MIKA 3A36A 3DE1X 4MKIA 2DEUA 1AZSC 4P92A 1GFWA 3I5MA 3IKLA 5HRAA 4HTFB 2PFGA 2R2GA 3GOQA 4HS9A 4JJ6A 4X20B 3GEHA 3NUZA 1VP9A 4HWKA 2V7QA 5B7PA 4JR1A 5FWXB 4N3CA 4JI5B 3Q7TA 1WVGA 4K3UA 1SQSA 2JIQA 2QEQA 3HI4A 1JHUA 4ZVKA 4BNMA 5FJJA 2VKQA 2RCYA 1XA0A 3RV4A 1K06A 1RACA 1BMDA 2B1RA 1X8LA 1W76A 3G0HA 2EKBA 2QVBA 4MP3A 3IV6A 4MYTA 4NH0A 1JLLA 1KZGB 1Y81A 3C41J 1TECE 4JSTA 2FR1A 5LQMA 1T9KA 1DTWB 4OJNA 5SYMA 1ONNA 1G19A 1PEDA 2WPNA 4PAQA 4Z0PA 5FNVA 1LWOA 4RD0A 4Y0AA 1L6IA 2GPTA 2HU7A 5ALEA 1YZGA 3PWTA 5CFZA 3EZYA 4GKBA 4ZJPA 1QCYA 3EGCA 5C8DA 3K9BA 1M1YB 2O5EA 2VEDA 3J81k 2FQWA 2Q1UA 1RJDA 2FPGB 4CKBA 2HTFA 4YJ3F 5E1OA 1IQPA 3IUNA 3A1UA 3B7PA 2D7CA 3UAXA 3KAQA 2AKAB 3IO5A 3LW8A 1ZD1A 3CSDA 1VKZA 4J75A 4LY3A 4UHFA 3WWDA 2FSUA 4ASUD 4PNEA 4XGNA 2XQJA 2RHBA 5F51A 3TCNA 1C9EA 2YXLA 3AEUA 4GM4A 4KIWA 4TWBA 1B00A 3HBLA 1IE3A 1N0VC 1BTOA 1L7VC 1BN7A 1XTIA 2AQIA 2PR2A 2XKJE 3L8HA 2IEAA 3MJHA 3TQRA 3W5HA 2ZSFA 5BSWA 1VKJA 1UDAA 2P9JA 2WSSA 3TNLA 3GG9A 5IN5A 2O8BB 1TT5A 4UPDA 5AJVB 4TYMA 2Y6VA 1VQ1A 3GFQA 4R2WA 2DY0A 1ULAA 2C5AA 3LGXA 4L4ZA 2O2SA 4LJ5A 1XAJA 1B6RA 1K66A 3FPKA 3TZ6A 5I7RA 5F2KA 3UEOA 4L3WA 3BIOA 2R6HA 3UFXB 3OC6A 1SPBS 2QGNA 1FK8A 4CMKA 1TLFA 3NETA 4X44A 1Q5PA 1J00A 4I8DA 1PK7A 5CA0A 4C6RA 5LQKA 3R8XA 2EP8A 4KSCA 4KRFA 5KNBD 4CMEA 3DVSX 2QB5A 1U7ZA 3ZXUB 1SY7A 2I33A 5A7HA 3LLVA 4P4LA 4IDOA 3K31A 4F7DA 2ZIXA 3ITEA 3D5EA 3ZE6A 4Y1GA 2GA8A 2WYWA 3IQGX 4HGZA 3KQKA 1Z68A 4FCVA 1SCKA 4WADA 1T2AA 3V1YA 1X3LA 4LXGA 4CETA 2JI4A 2ZBDA 3KLMX 4G89A 1QVWA 1SUPA 2V8BA 2WSBA 4MGZR 1GTRA 1GFZA 3K2IA 3BBLA 1YWGO 3D8TA 2NIPA 1CJSA 4BN5A 4OHRA 1ISRA 1FOEB 4MR9B 3S2YA 4YCMA 1C9MA 2Q0HA 3CX3A 2KMLA 2KYRA 2P3OA 3LAWA 4GR9A 4BL5A 5LD2B 2O0LA 5KYWA 1MX3A 4HGOA 1CUFA 5FFNA 4QPDA 1IZZA 4YTEA 5LA6A 5HBGA 1KH2A 4BAUA 4B6SA 5ILOA 1PJRA 3I2IA 3CNEA 2YTZA 1G8YA 1U9ZA 1T1RA 3P2KA 3Q5DA 3ZBQA 4DN6A 4H7FA 1GAXA 4IO1A 1QBGA 2B9VA 2Y05A 1BVRA 3AI3A 3ESZA 3F3YA 3MCUA 4HZUA 4KJXA 3UG7A 4MOWA 3VR4H 3I0NA 3QHAA 4M1MA 5DX0A 3HP4A 4GGPA 3FLEA 3ERCA 1CUBA 2C3PA 2W93A 4RIIA 1F4VA 1NULA 4FEGA 4E5SA 1U2ZA 4ZYYA 5FD8A 1ZNXA 1EFVA 1ZRSA 2G0AA 2G9VA 1Z47A 4CV3A 4D9KA 1PJ2A 3OT4A 1F8YA 1FMJA 3LIPA 1LW6E 1MNQA 2TYSB 5I48A 1U2TA 3EEIA 1IJFA 3TF5A 1VIVA 3HVUA 2AR0A 2BMEA 2R6GA 3U7QA 2FQ1A 2IYQA 4XLTA 3AUXA 1YONA 1BS9A 1E6EA 2X9NA 3OP1A 3CT4A 3MT8A 4TTRA 5ALPA 2ZSBA 1JG4A 2VPIA 4IXMA 4P2BA 3H9EO 4G1MB 3DZDA 5HZKA 4URZR 4KGDA 4GM0A 1F51E 1U28A 1JW9B 3ABSB 5P21A 5SY4A 3RREA 3CX8A 3LDHA 4DA9A 2J5RA 1SG6A 3DLIA 3KWMA 4LJYA 1EYZA 4NXNB 2I4RA 1RYNA 5ALTA 5EKTA 3M8KA 2I54A 3IQZA 4O4LF 4YXFA 1S2DA 1JAZA 2G25A 1I4WA 4RV9A 1ZVVA 2BM1A 4GZMA 3D6FA 4D6YA 3U3KA 1UBEA 2ZWVA 2VHYA 3DMPA 5H80A 1UOOA 2CGEA 5G4KB 4WEQA 4YLEA 4BP1A 1OXUA 2HXSA 4ZRDA 2HCBA 1L7AA 3NR2A 2DSNA 2SCUA 4OXIA 2D1QA 3L92A 2P27A 4WK6A 2TS1A 2B4KA 1Y0BA 2YHSA 4V38A 4YRFA 4E12A 1YZTA 1Z0SA 1V5WA 3E5NA 4Y6PA 2ZETA 5DYIA 1D2NA 3H7AA 4KGXA 3UW1A 1HYEA 3INRA 4Y9RA 2IYOA 2IUSA 2WZDA 5AESA 5B1YA 4RTNA 3P32A 1N2EA 3C5CA 5F2OA 1JX6A 3PR2B 2AFVA 4W8OA 5ED4A 1X1TA 4B75A 5I8PA 2HB6A 3NWBA 3VU3A 5FEMA 1NP3A 1LNQA 4ERXA 4QU0A 3UB3A 2BGMA 2AXQA 4JS0A 4YYZA 3ZE2B 3M6XA 1I7NA 2I1LA 2XQVA 3V8QA 4YY3B 3PK0A 5BT8A 5ALZA 1JI0A 4P5EA 5FPPA 2EFEB 2HK8A 4LV8B 3ST7A 7AT1A 4IKOA 5ALKA 2I6FA 5AH0A 2O3RA 3W6PA 1GEEA 3CRZA 3CSSA 1EESA 4C21A 3AVUA 2UXDB 5BRAA 2ZDQA 1UJ2A 3T1YB 3IDQA 4I6GA 3CU5A 3TIIA 1EFLA 2W6JA 5K09A 3RVKA 2EYUA 3DVAA 1TLTA 3JWJA 3LRXA 3LWDA 4UVHA 3VNUA 2JNWA 5JMTA 4DV2B 4BGIA 1R0XA 5J2TA 2CLCX 5A5VA 1UINA 5EUBA 1Y7TA 4DMFA 2YYSA 4JB8A 1N1MA 2SNIE 3O8QA 3CMCO 3TOVA 2XKKA 1PZNA 4KTVE 4QC2A 6YASA 1KQPA 3HFJA 3PVCA 1CFJA 1YIOA 3GU3A 2CCKA 3BSFA 3N8NA 1BFUA 1KO5A 2HF8A 2W83A 1SO8A 2F43B 1CNFA 2XIQA 1Z13A 3GT7A 5I9NA 1N3BA 2MYPA 5D86A 1N2CE 4TZ6A 1GPUA 4DKJA 4TT8A 2QLJA 3IAS1 3SXPA 1VJCA 2YXBA 1X2BA 1ESMA 3S70A 4C7VA 2W8BB 4MO2A 2XAUA 2CZQA 1ZCJA 2GO7A 3HU1A 1VE1A 3JYNA 5AKZA 2E89A 4KIGA 4M1SA 1XA4A 3A1TA 4QJIA 5IDVA 4D97A 4I8IA 1FYWA 1F9AA 5IJAA 1YB7A 2EJUA 2BHRA 1QU2A 3IJRA 4UNSA 4BNWA 1BE0A 4W8HA 1TF2A 1JNXX 1C4WA 4I9HA 1NLMA 2C7BA 2PGNA 4H6PA 4S24A 3S1LA 3W1VA 4D44A 3A05A 3D3QA 2ID4A 1TM3E 1N2ZA 1NBOA 1YULA 4ZVNA 1QC5B 2OUIA 2RHOA 1VHDA 4HXEB 1TUBB 4YJKA 3TUZC 3Q6NA 3VKWA 3MMPA 3O03A 3GVIA 2R79A 1FRQA 2PK3A 2CXNA 3HR7A 1MRNA 5KJCA 1G21B 1FP4A 2C9YA 5E95A 4AW9A 1B15A 3H2GA 4FOOA 1CD5A 3O21A 1H22A 1T4CB 1AQNA 1XJQA 4X60A 3I64A 1IZ7A 3O4IA 4G6ZA 3QG1A 4D56A 2BOVA 5HFNA 1Q1EA 2H2GA 5BWNA 1E5XA 5TQVA 4TLMB 3VXKA 3KJQA 3ESBA 4LSWA 1WHSA 3AKDA 3LKVA 4IEEA 1BJRE 1PZEA 3H84A 2FW8A 2XOKD 2R6DA 5I5GA 1BW9A 1K8YB 2QMYA 3NTUA 2XOXA 3HKEB 3OH8A 1RC8A 4N47A 1TZMA 2IDZA 3AUFA 1L5NA 4GYKA 1Y6QA 3J81A 1JG2A 1W36B 5KCMA 3SE7A 2W6NA 5JNWA 2L2QA 2BUAA 3HBAA 2XWPA 3ZWMA 4CFYA 3D4NA 4A0FA 4WDQA 1BKSB 4BBAA 4HB3A 4IHJF 4GMGA 4KGZA 3AF6A 2BL4A 3WNVA 3ORHA 4U8HA 5JSKA 3KQNA 1UBJS 4RTKA 1Y8RB 2GRJA 3MJDA 3OEWA 4KMSA 3LX5A 1MFPA 1W85B 4DAOA 2BAGA 4NYIQ 4YV2A 3CZCA 3BERA 1QYVA 4V2IA 1ADYA 4YALA 1QZTA 1P4JA 4HAXA 2ZUCA 3DEHA 2XUZA 2GFIA 3PXUA 3INTA 4PCLA 4U7TB 4O2RA 1P2GA 1UDBA 2WAMA 2PNFA 1AIPA 3A2KA 4AS1A 1G3QA 2R8EA 1TF5A 2FW6A 3W2IA 5KJEA 4ZZ3A 5DLEA 3H5IA 4G5RA 1N5MA 3H1PA 1SRRA 1MIHA 1KHHA 1OLSB 1K5HA 1XCOA 1W0CA 3FX2A 2R1VB 1ODSA 2BGUA 2VF2A 3WNZA 1K89A 5LN1A 1DAHA 1FUYB 2CBXA 3EEFA 4IRMA 2Z2KA 3T4EA 1XX6A 1ABEA 5DCWA 1YHNA 1RWWA 4TMTA 2XUFA 1PR0A 3IUYA 4Q1BA 1MW9X 1U0GA 3AKCA 3ORRA 4K6MA 5EQDA 5EXPA 4CCYA 5M04A 3JAKA 1CIJA 1K7FB 2Y1XA 4MB6A 4WPGA 1P0IA 1Z07A 2JFXA 3ZLTA 5LLDA 1R16A 4EH1A 2I9KA 2I2WA 3MF4A 3RAPR 3X1YA 3ZGXA 5DM2A 4ADSG 1D9ZA 2OG2A 4KE8A 1Y7IA 3A25A 3TWOA 2JJ1D 2FA9A 1W5AA 4B6QA 4CKYA 1W0KA 3SZUA 1UODA 1IK6A 4MVJI 2J85A 1FUEA 1UKCA 2FQXA 3K2EA 4CW7A 3OM0A 4D92A 5IH7A 4HMOA 3EXIB 4MLDA 1SVIA 1SBCA 3RQIA 4CTJA 3O0DA 5JHGB 3CGGA 4ND8A 4DHEA 4UBJA 3HVRA 2YYAA 5F9HA 4L75A 1PR5A 1EP3B 3IILA 4TVKA 2HEGA 3I42A 2X7HA 3JZFA 4G9EA 1DIBA 1PS9A 1Z15A 1PSDA 1C4KA 1W52X 3C3KA 3HMKA 3K09C 3AGPA 1KJJA 1ZRNA 4EMUA 4A23A 3IGFA 2IOQA 4G1VA 1U98A 3LP8A 3LQ4A 2B6HA 2G9NA 1AS0A 1M34A 2JFFA 3FROA 4W6QA 4OJQA 4NLLA 2WF6A 2YJ5A 1JJAA 4IDCA 3WIOA 2R6JA 4J0DA 4KO4S 2BEVB 5T4HA 4QE3A 4O4HA 3TM4A 1X0XA 5ECWA 4B5LA 1HFJA 5JSZA 1NMYA 2F4NA 4IXNA 4GXNA 4LQLA 3P2YA 2PE5A 5CAEA 4DV7B 4ZT4A 4LOHA 4BC1A 2VXCA 5F98A 1JKXA 1UBTS 4OHWA 1G59A 1RAEA 1NG1A 3P4YA 1DKQA 3QVGB 3IR6A 3BMOA 4ZOCA 3KTAA 1UZAA 5J2UF 4NMHA 1KOFA 3M0EA 2PT9A 4IH4A 2I6QA 4LZJA 2YZGA 2Z2XA 4GUDA 3ZHOA 1KJWA 1Z5GA 4RSGA 2XTJA 3AI1A 4G65A 4JBHA 4ZOLB 2Q41A 4C05A 1T9DA 2P6NA 3MTIA 4R2KA 2GCPA 1AF7A 3DE0X 3PVZA 2H1VA 4Y1RB 5D1NA 4DPLA 3QM1A 4GZ3A 3Q2IA 2ZVQX 4XYMA 3GPDG 2QMEA 2WJVA 3CWQA 5JSYA 1VXOA 1LQUA 1CUEA 4EHJA 1YDGA 1CDZA 1JHDA 3QPVA 1UKZA 4LHVA 5BR7A 2X40A 2JFNA 4NEQA 3X1XA 4U2EA 2AJ8A 1GPYA 4UTOA 3DEZA 5CT9A 2FCRA 4KB5A 4W5QA 2ZYWX 1FMCA 1GFSA 2A58A 2O52A 1I4LD 1V5FA 1OAOA 1UT6A 3KJFA 3WLIA 4RSMA 5DFAA 4BUJA 1TW2A 4ED9A 3JASA 2UXCB 1ABFA 2NAFA 4TMKA 3RSHA 4X84A 3SKYA 6GPBA 1Z2CA 4O4IF 5C3UA 1RWOA 2ANCA 3PHBE 3WTBA 3ZU3A 1L5RA 1POXA 3FPJA 2YZ7A 2WF7A 3DEFA 2ZJ1A 1JAHA 1JZSA 4Q9AA 1HZZA 2A1TR 2AOUA 3AEYA 1QIKA 1HLGA 1HYQA 3GVPA 4MKRA 2JGIA 1CEQA 2NSHA 2V45A 3U7JA 1TZCA 4DYDA 4EWLA 4MVCA 1S2IA 2W71A 3N2GB 1IY1A 3I2FA 2F3PA 4OP1A 3T94A 1L3IA 2QRKA 3U3OA 3FE2A 5FUYA 5E2AA 4CL8A 1QX3A 4B8ZA 3HXMA 4L5AA 2R8ZA 1A4XA 1ZMBA 3ZE1B 4H7HA 5JECA 1NNUA 1R4NA 1ZOPA 2HBYA 4MPPA 1RRCA 4Z0NA 4N5IX 4NARA 3WZMA 3G02A 4HAZA 5BPHA 1ZH8A 3JS5A 1NUAA 2ET6A 2Y6UA 3H3JA 3RJ5A 1USIA 4N3BA 3U61B 1ORDA 1Z0KA 4LWQA 1TD9A 3W3AD 3W6UA 1GZDA 2D7JA 2Q5QA 2QW8A 2X7XA 2GAFA 3KO8A 1UXJA 3BWCA 2RSLA 3PQ7A 2Y8EA 3DM5A 5G4LA 5CCDA 3VOAA 3RFCA 2HX1A 3QX8A 5AQEA 2VQSA 1GR0A 2H1HA 2HZ7A 1RW4A 4DZTA 5HKOA 2NYVA 1TC2A 3MAAC 1Q11A 2ZG6A 1X7ZA 5EZYA 4QUGA 1QYXA 3P52A 4L95C 4TT3D 4Q7QA 4M38A 2O5CA 2AJDA 1PAUA 1JSCA 5TVKA 1RXEA 3VHXB 1UOQA 1D4ZA 2CJYA 2YBEA 1IM2A 1F60A 2OV3A 4QYSA 3WZ2A 5JD4A 5KYYB 2IH4A 3JQ9C 2WHPA 1LA2A 4M49A 3BK1A 1AKEA 2PRYA 1JXQA 4EFKA 1FDIA 1SC3A 2Q3EA 4EYOA 4DTCA 6REQB 5CPFA 4DIFA 1X7YB 4M22A 3WICA 2GARA 1UFQA 1JE1A 2A78A 2AN9A 4Q9DA 4E7PA 1NU6A 5BYKA 1N78A 4FNGA 5BUZA 1DIHA 4L6IA 1PQUA 2ZYTX 1SZJG 3CKLA 1EQ2A 1LLDA 4JXZA 2IYNA 1DUIA 2YY6A 2Z57A 1PE0A 3RT7A 2VKTA 3M6WA 3KJHA 4G5YA 4F46A 2W5UA 4Q3EA 1RKUA 2I7TA 3NLLA 1CFZA 1F3LA 1TQ8A 3CF0A 4JEIA 1RPAA 3BGSA 2DBZA 1M6EX 1FC0A 2G28A 3TIFA 4BGEA 3I76A 4GBJA 1CQJA 5FL7A 1YMQA 5I9MA 3BH6A 4M3NA 5KVAA 3GGGA 4MHSA 4PBTA 4F85A 5K3EA 3HFGA 1M10A 1UM8A 1J5XA 5EL0A 2GAIA 2J0VA 5L3SA 4EEKA 1K8QA 3RS5A 4DQKA 3WIDA 1SAYA 2AN5A 2G1UA 4FB4A 2HBZA 3PUIA 5CNMA 4FHCA 1DXHA 3TBKA 1I2ZA 4BYGA 2VHZA 1NXWA 2HHAA 4FE3A 4BN0A 5TF0A 3TQOA 5KYGA 3RTDA 4WNCA 2CUZA 2H52A 1I80A 3G9TA 2X41A 1P61B 3OZSA 4FOLA 4QYXA 3B8HA 3G2LA 2GXUA 2REOA 4HXGA 4TTQA 3LT2A 3HYSA 3K0KA 4YP1A 1AHHA 1RJGA 3CTMA 2XXJA 4EA6A 1L1QA 4Z7NB 3GLFA 1N2IA 2H0AA 2CNDA 3GWGA 3B3JA 3LPDA 4BE7B 3LM8A 4OGGA 3RF7A 1IEWA 2VIIA 3A3PA 5HS6A 2LBPA 5ICGA 5IF9A 3QE2A 1JYEA 1WP9A 3DLBA 2O9JA 1HLFA 2CC2A 4PNZA 4EX7A 3OOHA 3ZNOA 3U7FB 4CM8A 2E2WA 4YMWA 1PLLA 4K0KB 4V3CA 3SXJA 2Z5VA 3KQYA 1FP2A 1N2HA 4ZTZB 2D6FA 1BIFA 1CB7A 2DR0A 1XDUA 4B85A 1IK4A 3GUYA 1T36B 2CUTA 3SY8A 1VB5A 4DQXA 2WZCA 3I9FA 4CEHA 1KI1A 4YUVA 4EMBA 2ZSIA 2A94A 1DC5A 4ENVA 2VCHA 3ZDAA 5F7XA 5FO0A 5EKDA 1D2CA 4ND4A 5B3JC 1U5BA 2I7CA 4WOKA 4YPVA 2NVOA 3DBRB 3EGIA 4JYZA 1A9QA 1E2PA 2DCMA 4BLWA 1X1RA 4TXMA 4BNLA 2JKYA 1NXQA 2WIBA 4XWAA 1CHDA 3B36A 3R7WB 3JZDA 5FOTA 4WLEA 5FI5A 5IAOA 1KXJA 1XTBA 2KPOA 5SZJA 3E61A 2B69A 1RZ3A 2Z9CA 3GUHA 3WMXA 3KT0A 5ECGC 3GJQA 3JU3A 3WHLA 3S6JA 3SX4A 4D3YA 2B9EA 3WO1A 3G8CA 3T1TA 3ZPXA 4AUMA 3U60B 3AKYA 3NT2A 2A9PA 1L8LA 4ESOA 4CIBA 1Z7BA 4MS3B 5HJ5A 3DE2X 3S8YA 3QKRA 1TL7C 4JL6A 4J0HA 4JYAB 1GNLA 4F11A 2EQAA 5D01A 5G02A 1GU0A 3ROGA 1JS1X 3QEKA 3ES9A 1XMPA 5ESDA 4NCJA 4DADA 4EJSC 2WUEA 1E2BA 1VZ3A 2H18A 4KXVA 2YWGA 3ZVKA 3A6PC 3NP7A 1AK9A 3C7TA 2QE7A 2IUEA 4DLNA 4FYPA 3U3XA 4NXMB 2EARA 2C83A 2C58A 1RXYA 2YVUA 2ZZNA 2V7GA 1E99A 4OLFA 5DX1A 4MWGA 2WJIA 4INJA 5D3MA 4RPHA 1A82A 2JK1A 2OHOA 3EOBI 4G0OA 4PEVA 3MC1A 4UQPA 4U7WA 2WJ6A 4PLFA 2Q1TA 3TLYA 4D8VA 1RLJA 1NBMA 2AR9A 3H9UA 3LI2A 4CV2A 3D59A 2ID9A 3THYA 5TQ2B 1MOSA 3EXFA 4F3KA 1NV8A 2X8JB 3JARA 5EHNA 4ZTBA 3FTEA 1CKEA 4YAWA 4Z54A 4BXOB 3SHFA 3EUEA 3PNKA 4OLAA 2OCYC 3CV3A 4B74A 4IYRA 3GA5A 3I6IA 1IOLA 3VM6A 1KVSA 1T4GA 1DAFA 2V8OA 1FPMA 3MIZA 3I30X 4IFIA 4LVCA 1B8OA 4C0JA 2Q7XA 1KNXA 3SR0A 4XWOA 1GNPA 1YC5A 3TQSA 2Z1MA 5A6SA 3TNFA 1T1IA 2QY6A 3KQQA 4M7OA 4Y9UA 3R6DA 4TUYF 1GNTA 5CBPA 1XMXA 3GN2A 3TVDA 2V1UA 4KWTA 1AQLA 2P5UA 2QRHA 2YUIA 3OZCA 3LECA 2CFSA 1OPXA 2Y1OA 3B1WA 4B2PA 2PS1A 1JKIA 2EBUA 1F8FA 3AXSA 3QE0A 4TRRA 2VSXA 3F0TA 4LS3A 3WK5A 4BV9A 3SI7A 4C4SA 1G3MA 3IUSA 2FG7C 4N3AA 4QXRA 1JH8A 2NTEA 3I34X 4QARA 5JZMA 3KE8A 4G23A 4BQEA 1XLTC 1E2KA 3PDIA 2RH5A 4YMSA 3JQGB 3ET5A 5IHPA 4Z99A 1T3ZA 4KTTE 4X91A 4OQFA 3TCKA 1EVKA 3BZBA 4FZRA 5H16A 5BY2A 2G9RA 5TQ0A 5IG2A 5JTTA 5K8UA 1JR3D 4CLRB 3FZYA 1P4GA 3LBFA 4TTAA 3L41A 3TEJA 4OUDA 3CPJB 4GYJA 4W9NC 5DEOA 3H5VA 3KVOA 4CT4B 1ZL2A 4B3BA 5LD2C 3DDCA 3CR8A 3OP4A 4HF7A 2ZEJA 3HCCA 5LB2A 1A9ZA 2EW1A 5AM3A 2D5BA 4XI9A 2BMJA 4KLRA 3BJMA 4D8UA 1E1LA 3ZHCA 1JYFA 4N3NA 4ZRMA 3AZPA 3D02A 1G1AA 4DRYA 2VDKB 2PUTA 2ZIAA 2PKCA 4NNJA 3UFBA 3WKDA 3VU0A 4WBNA 2A33A 2VPZA 3WGTA 2GLTA 1KE2A 3FUVA 2NVUA 3V4PB 4TLLB 3JX9A 3L4KA 3QIAA 2Q8QA 1UFVA 3CEPB 3QIVA 3ONDA 4NZMA 4U5XA 3CLHA 3PLAE 2FMHA 2NO4A 4P8RA 4G8BA 4PS0A 1VMIA 2OFFA 2QJWA 3B70A 2JKZA 5BSTA 5TXGA 2YHUA 1ITZA 2WZBA 2ZIGA 3ANSA 4MARA 4RHFA 4N4AA 3D8RA 1DGQA 3GLGB 1SD2A 1LX6A 2FMIA 4NZOA 2NP7A 4PZDA 3RSZA 3W34A 5A9TA 3TPCA 1CQWA 4Q9HA 1NA5A 4F93B 1YR1A 1U3DA 3IH5A 3RU3A 3FTFA 5FNVF 2C97A 4C3OB 1YI0A 2HQBA 1BOOA 1XAGA 3QE4A 2G09A 1E96A 5CJPA 3HGQA 4D42A 5KQMA 1QTRA 4H31A 2H5EA 5EZ5A 4L5BA 5AI4A 1K9VF 1E1DA 4D9CA 1GU1A 1ZL0A 1C9JA 2CLHB 3ED5A 4L72A 5AVQA 1O95D 3NEAA 5EESA 5EJIA 4TKZA 4DTIA 3R5HA 1E9SA 3IDOA 3OX2A 3LK7A 2ZE7A 3QRWA 4ND7A 4WCDA 1RR6A 5IKMA 4DV4B 3QPDA 2YOFA 3GGDA 4QWWA 4BV3A 2QXTA 1XXHB 2P3LA 4IX1A 4LI0A 4MK4A 5IT4A 4FJ2A 3URKA 5K0FA 3TEFA 3O91A 1G20B 2EFHB 1TD1A 5KYVA 3K9GA 3RC1A 3T7DA 3EQ8A 3SM3A 4Q4CA 4M8SA 4Y2QA 1HTTA 3LC0A 1GXSA 1U0EA 2QLMA 3IVGA 3RYIB 3U3DA 3NOXA 1U2RA 3Q8WA 2FMXA 4EUFA 3TCXB 4P34A 2ASEA 3CUKA 1G4HA 4L22A 5DI9A 4BQPA 1JJ7A 1L7DA 1N4DA 4U4AA 2DSTA 4HUTA 2A0UA 3IQIX 1IN8A 4IH1A 4RABA 5FUQA 1AMOA 1HFWA 1E4OA 1J8MF 2VDRB 3L0DA 2IS4A 3WIVA 2CUKA 1GRRA 5CA0F 3WB9A 3CF4A 2WG2A 2WQZA 4KRXA 5LZ4A 1HDYA 3PXEA 4FYWA 2CZGA 4AJHA 4E46A 2JLBA 3HV2A 3QFRA 1RVV1 2AFHA 3GK3A 3WBJA 1T9AA 3K92A 1VLMA 2O0HA 1BCRA 4CMIA 1UEIA 3ZK7A 4GO1A 3DYBA 1W4LA 3BWMA 3VHLB 1TO1E 3BA1A 3IP1A 1XRPA 4LYDA 4PFQA 4B2IA 4BQOA 1X15A 3OQHA 1F06A 4BCCA 1E8MA 4QHSA 4YHHB 3DBHA 1MZPA 2D8AA 1WKCA 1ZDMA 1OYOA 2GOYA 4XR4A 4IJWA 5KIAA 1EUCB 1UMKA 1WX1A 4GXRA 5C1PA 1W29A 4ER3A 1LTQA 1R4MB 3H9BA 3JV7A 4IAOA 4NBTA 3GL9A 3M4JA 1KQNA 3RRYA 2FWJA 3KXLA 4G67A 4UOZA 1CUYA 5TARA 1EA5A 1DO8A 1ND6A 2Q5OA 1G5QA 2QWXA 4G1EB 1HE8B 4JSYA 3DKIA 2EZ8A 1EFPB 2WIKA 2HQRA 4B45A 3C70A 3VH4A 3WBKA 5LA6F 3LY7A 1SRQA 2CXTA 3L8CA 3AZOA 4IIYA 1JHOA 4UM9B 2DFKB 5B1EA 1H1LB 4P3YA 3CQ9A 4MVJG 5HFJA 2ID8A 4FR5A 5A6VA 1FSGA 3PHLA 4QQ8A 2C2HA 4KNYA 1ZICA 1PJSA 3LCJA 4GRIA 3PWKA 4R8MA 2QT0A 2V7XA 4YMIA 3RSQA 4F5EA 4B76A 2W43A 3VSEA 1C30A 5HIIA 3UWDA 1QMPA 2AQKA 3VYVA 2ZAIA 3FJYA 3KYIB 3MS2A 2XGSA 1SUWA 1GR1A 4BVJA 4O2AA 2YV5A 3DDSA 1JXOA 2V65A 3CZ5A 1P5HA 3FNBA 4NV3A 4C7XA 1DQZA 4GLOA 1G5FA 3ZV3A 3IE2A 3GRPA 4PHGA 2F1KA 1IOWA 3SR3A 3RLFA 2PCLA 5J63A 1JIQA 2A6PA 3I9JA 3L9XA 3IBSA 3LV8A 1GZ6A 1U11A 5ALDA 1JAXA 3WSWA 1TB4A 4YRMA 3JTEA 1MT3A 2HIAA 2B4AA 4KFCA 4UXHA 3EFHA 4NH4A 1ACLA 1XHFA 2I4OA 3RYCB 3ORFA 2VJYA 4WHMA 5GY7A 1F6BA 1VG0B 2QJOA 3AINA 4B4OA 2WQ7A 2WYUA 2C7QA 3VU9B 2HU8A 1KQ3A 1UDXA 4MKFA 2PT7A 4DMLA 5I9IA 3AJ9A 2QUAA 3IXQA 4RHYA 4QASA 4MHTA 4YCLA 2Y1DA 4KX3A 2WM9B 1U2GC 2ZCJA 2C00A 1ORTA 1W5FA 1V2HE 4HNUA 4TXNA 5A5DA 4MQUA 5E8RA 4IIUA 4RCYA 3QOXA 3E70C 4E3ZA 5EGNA 4ZHQF 2QLTA 2C84A 4LYJA 1T8UA 3OM9A 4WLNA 3U81A 4GICA 3WGGA 3H0KA 3E1KA 3ZDFA 1XWWA 2JANA 3HJBA 3PITA 2C5FA 4WXEA 3QENA 3TE7A 1WXEA 3NHBA 4EG7A 1MW8X 1C81A 4KX5A 1GTSA 2PMDA 1O5IA 3AERB 1CPYA 3IOEA 1QIIA 3UV3A 5JQGA 4OJKA 2WUGA 1WRBA 4BU1A 2H1OA 5A5GA 2JA2A 3BE4A 3HHEA 1QIMA 5I51A 2QRVA 2Q4EA 1YNOA 2JEZA 3R9XA 3HN7A 3KT8A 1HQKA 4FFOA 4Q7JB 4JJAA 4C88A 3VVBA 1WY7A 1QYDA 3DFKA 1BROA 5JRJA 4EEZA 1E4EB 4FKZA 3ICPA 2FFBA 2NO5A 2OBXA 1XDGA 2LKDA 4LW8A 2BKVA 1XSEA 2J87A 4DL9A 4Z53A 1XZMA 5B4VA 5D00A 4YRGA 3I0ZA 3SQWA 5AVRA 1K5DA 2WYHA 2ZITA 2FWAA 2PPVA 2WM2A 2GPAA 2ZB4A 1XEWY 5JLAA 1MVOA 3LQFA 1YQ9A 5BUSA 3FHCB 1QCZA 1Y4UA 2WT4A 4HRAA 4QTUB 4RVFA 4ZV9A 1Q57A 4GKJB 2E87A 1RXCA 2X6QA 3TQQA 3BK7A 1DAKA 3TW4A 2ORVA 2C9CA 2GX6A 4NNPA 1ZP6A 1LBSA 2QVZX 5J2TF 3SVZA 4AU1A 4GPTA 2FG6C 3AEZA 3AEQA 2VQFB 1WB5A 3GUVA 3PC3A 2H9AA 3OPYB 1PD1A 3ZY5A 5J4HA 1OVGA 1I1QB 1CX9B 1P9NA 2ZPUA 3CXRA 3EF0A 3K7EA 5HTKA 1MJNA 3TQCA 4IHKA 1N6OA 3SIRA 7ABPA 5H4GA 1X8JA 2Z08A 3LQ2A 3VNSA 2BM9A 4PZ0A 4WW0A 5KWSA 3A1WA 4P08A 3BF8A 3IQHX 2AI1A 1ZMXA 2EBHX 2UZIR 1ENYA 5DBEX 4F97A 4IOKA 1ECLA 4ZYVA 1J8DA 3FYCA 2RG1A 4V0KA 2WT9A 3UMBA 2C0PA 2AG0A 2OWDA 2RD2A 3TI9A 1J8VA 4X95A 3W90A 1FNMA 1AKQA 2M2IA 3ZDRA 3HY3A 4O1MA 3VU8A 2OHVA 3PHGA 3U3ZA 2XDAA 4BKQA 4BKMA 1ISMA 4IDDA 5JADA 5FA6A 1ZSVA 5FHQA 3EC1A 2OFPA 2FUEA 1NZFA 3A06A 3O73A 1EM8A 1JLKA 3KYCB 4OK5A 4C76A 3E48A 1MF7A 2XT6A 2EWVA 2ZWOA 4WZAB 2FW0A 2P4EA 4HKTA 3AV0B 4CM9D 1HDGO 1KIAA 1CJCA 1T5OA 3VTKA 1CQIA 3RKUA 1XYYA 5DCUA 5KVQA 1HGXA 3GRYA 5TGZA 3OT1A 3M4NA 2PIDA 3EY9A 2WJYA 4NBWA 1ZQ9A 3CZAA 3O8BA 2WKWA 3KUKA 1BDJA 1SVSA 1YOBA 2J45A 1OBHA 1YZUA 3KDAA 3L8GA 1XZBA 4U0JA 3TQIA 1XF9A 5JFOA 2H1FA 4RPGA 2ZBUA 3C2QA 2QVXX 3K72B 4QDTA 1IBKB 1QH8A 1NFFA 1TQHA 4C3VA 3OEHA 3NXSA 1EH5A 1NUUA 4DJEC 1IXZA 3BILA 5H83A 1CVRA 4URHA 1XD8A 2E6KA 4FNAA 3MYYA 4DKXA 1RJ9A 2ODAA 3D7SA 3TLEA 3K73O 1AQJA 3M33A 2DFVA 5AIBA 4YP6A 2ECKA 2O2XA 2VRCA 4ZCQA 3AUAA 2E0IA 2Y9MB 4G1FA 5CVCA 5KU1A 3RODA 4CTOA 3LG2A 4MKZA 5GZ6A 4KJZA 3D5TA 3OZTA 1DC3A 2XDWA 1P9LA 3BJIC 2W6QA 4PSKA 4C08A 4PANA 1R0SA 5A2GA 4DMKA 3M6VA 4YLYA 1H3NA 3GLSA 3GFFA 3OLWA 1S3SA 2YYZA 3G2IA 3LH5A 4EZIA 1LDNA 2R1TA 3M9LA 5BSGA 3JALB 3S7ZA 1SKQA 2RIRA 1CETA 1DKLA 3N2LA 2NO6A 2GHTA 1VLHA 2O50A 2IPOA 3STWA 2VF8A 3U48A 4I5EA 4PZYA 4UPVA 3BRWD 3OF2A 1P44A 2YN4A 2CNBA 2FPXA 1V45E 2CFTA 3D3EA 1LDEA 5E2BA 5FF9A 3TX2A 4O63O 3V8RA 4CU2A 3N6RA 1LK7A 1O87A 1P2VA 5KWIA 4PN7A 4B3FX 2K4MA 2B8WA 4DR2B 3A11A 2Y71A 2GN2A 4KO2S 1W49A 4XRRA 2OENG 1TA4A 1ISSA 1QUFA 3O38A 1RHJA 1N9ZA 2CVPA 4LE2A 2OUKA 5E7IA 4E7OA 4ZQCB 3ZE7A 3G5AA 1N7HA 4QPZA 1WJGA 2P91A 1QGYA 1XFAA 3DV0A 3EGXA 3EIUA 1Y63A 2HDHA 3K0CA 3QFCA 2JJ2A 2FPOA 2B5VA 2FTKE 2H8GA 3GZNB 2OD2A 4JQCA 4YRSA 1NN5A 2VHVA 2ZR0A 3NOVA 7GPBA 1G8GA 1EEHA 1JR2A 4M86A 4ZYZA 2I2AA 4N8EA 3AHFA 3ABQB 4P83A 3REGA 2Q27A 2J59A 2G1PA 1RYMA 3N05A 5DN9A 4H3VA 5EMKA 4AURA 2I76A 3N2KA 5JC1A 3P71T 3PIRA 2AC2A 2ZRBA 1FFXB 1NVGA 1Y80A 1H2RS 5K51A 3ONEA 3CTPA 4X6YA 3UNXA 4CR8A 4HX5A 3S4YA 3NJ4A 4LHYA 2WAYA 4YPOA 4PLGA 1SCIA 3BB3A 3BREA 4JJIA 4ZPXA 2OZLB 1PTKA 1FE8A 4EHFA 3NJRA 3PWSA 4HAOA 2CNWA 1N33B 1VFNA 2Z9BA 1K2VN 5TEWA 3KLOA 4B40A 2BKEA 2J3EA 3TNYA 2B2XA 1WM1A 3NW9A 1NVDA 2HI0A 3PP8A 4H3KB 3T9BA 4FFNA 3ZWKA 4OD0A 2AXPA 1RE1A 4MZXA 3FUXA 1OBOA 1QG2A 5KTOA 1GPH1 3N7AA 1TCCA 1L8AA 4UKDA 3FZGA 2FKNA 3OZWA 2YWJA 1UBSB 2QG9A 2JFWA 1OCEA 3QU2A 5DSXA 8AT1A 4ZARA 2OOKA 4US0R 4OI1A 3UATA 2RI0A 4BNZA 2JIDA 1ZOSA 1C1XB 3NVKI 2XE7A 4FZ5A 5CDFA 1WEHA 2IHJA 3D7NA 5C34B 4DSAA 4WFJA 5CB4B 3KQVA 1D0VA 3CJQA 1EE1A 4PC1A 2C92A 2JI8A 4OV6B 1BFKA 2E21A 3PQ6A 4O4HF 2Q3JA 4QFBA 1JEAA 4LGYA 1X7XA 3WLSA 1JYSA 3T3GA 2O8FB 1Q7RA 5KQSA 2W4IA 1JFFA 3FCXA 5E9QA 5FLKA 2HMAA 2RG7A 4LJLA 3BXOA 3PDJA 3GD5A 2DTXA 2CLLB 5KOJB 2FZEA 3GCXA 3G88A 4ZAWA 3DB2A 1ZX1A 3QU9A 4HUJA 4YMHA 3ADPA 4M8LA 4EBFA 4KWHA 4EYEA 3I6BA 3RC3A 1NYQA 3MGAA 1GA6A 3RS7A 4POOA 5IULC 4MDHA 1XQWA 1SURA 3F7MA 4FLFA 5DN6D 3NXKA 1EGMB 1QPBA 1NIPA 3BHIA 5JRZA 4HWRA 1V4BA 1XMSA 2QGFA 5J43A 2WOOA 4MB2A 1PV1A 521PA 4AZSA 2NO1A 4I6EA 2Q49A 4L6AA 5DGDA 1F3OA 2ECQA 2IF0A 1I36A 3OJCA 3MTQA 2O0KA 3I2KA 1ODLA 1OVMA 4XGKA 4AP5A 3MW8A 3RIMA 3DZFA 4MV3A 3B20A 4TMYA 1OREA 1M83A 5CT5A 1PNVA 3PFFA 3BMNB 2GPWA 3F1LA 2I3BA 4EHHA 5JMWA 4ENRA 1TRHA 3NVMB 4EYKA 1Z16A 4HGYA 2LR0A 1R4AA 3DULA 4BNXA 4BJ3A 3ZWDA 4RZQA 5IJ0B 5LJLA 1RVDA 3ZVNA 1L4UA 1SG0A 1RKXA 4RTRA 2BUCA 4X61A 3BXZA 3REOA 1T5BA 2J32A 3EVBA 3HVIA 2C5GA 4BUCA 4CIWA 1PZFA 1RPNA 2FJPA 2X5KO 4XWTA 4Y6LA 2DFTA 3H2JA 2ZE6A 4MUNA 3ZJTA 4OBWA 3ESXA 3GP3A 3NORA 1R1DA 4LSZA 4LHEA 2ES4A 3WNDA 1I30A 2R65A 5AD1A 1JLMA 3FOEC 3K5WA 2V98A 2OCGA 1N6KA 1FSPA 4P35A 3ZN2A 2JLYA 5M7EA 4I4TB 1QHXA 3O83A 2J0UA 3HA2A 4MYSA 2JBAB 4J4HA 5TR9A 3USES 1IAVA 1D6MA 3QLUA 4UUMA 2BFEB 1N5JA 3OIUA 1GPAA 3T5TA 4QSMA 3FFAA 2WOJA 1HURA 4QATA 2V3VA 2BGJA 5AKYA 3CH5A 2RIPA 2IYUA 3MWFA 3NV9A 3EDCA 3C6XA 4MUKA 3FKQA 5AXAA 3EIFA 1FSZA 1XIVA 3UMRA 3X1DA 1XAHA 3LBAA 3HP1A 4K6FA 4YPFA 1JB9A 1XQXA 2NTNA 5HRUA 3T7EA 3OZVA 1ADFA 2C98A 3PNBA 1I2CA 3T1OA 3WFIA 3LUJA 5K20A 4FX5A 3MBIA 2GM5A 2Z1NA 4MGEA 4P1ZA 5FTNA 5BVHB 2VYCA 3NUQA 4JNKA 3QFFA 1T5DX 1WXDA 5D2CA 5GVRA 4DXAA 2IDMA 4OU4A 5B7NA 1T6NA 3RFUA 2BM8A 3EA5A 3ILSA 3WIBA 1XCBA 5EMJA 4M7RA 4H7PA 5EZYF 5TIIA 4HLQB 3CB2A 4CUJA 4ETIA 5LLSA 1DBQA 2B21A 3U4DA 2QPLA 4GSLA 3IIKA 3FPBA 2QTVB 2WSYB 1HNXB 2OXTA 1DJLA 1AV7A 3IAXA 1UQRA 2VJMB 3MM4A 5DF1A 3O8LA 4Y30A 1OR8A 3JQ7B 4H1HA 5AJTA 2EX1A 1UZLA 3H4TA 4QPNA 3ZY4A 1J1ZA 1G5RA 2QVYX 4HDRA 1EX9A 1L5VA 4QBIA 4QYWA 3ZW7A 3M4YA 1ZK2A 5EPEA 1BDIA 3QKTA 4DQUA 1ZNQO 4QOFA 1KMIY 1HYHA 1O6FA 2JZCA 4GZ5A 4UDNA 4Z4HA 3MBKA 2PUHA 3NBMA 4AY3A 5HMMA 2DJ5A 3QKSB 1Z34A 2GBCA 4B3DA 2PWAA 5L3ZA 1SK9A 1T4DA 4WMLA 1U31A 2INGX 3UAYA 2IZ1A 5TC4A 1T13A 2H4HA 3E22B 1RHMA 2CBZA 3O4FA 3UJPA 3EIHA 1EFRD 2DYKA 1SBNE 3VVCA 1VDZA 2OE2A 4DB4A 2MU1A 4LJ8A 5GZ1A 2H11A 3HU2A 2FYTA 3IT2A 2ODBA 4YRPA 2X0IA 4ZCRA 3ANYB 3K96A 4C3UA 3CVOA 1ZN9A 1PJ8A 4PYLA 5JJCA 4JZKA 1JSRA 4DWJA 1QE5A 2IF2A 1UR5A 1I24A 2F4VB 1A4UA 3K6RA 4JT8A 2FSSA 3ZDYB 2E1RA 1JB1A 2QP9X 1P1RA 3ND6A 1KMHB 1P7ZA 1V43A 3NI2A 1L7BA 1E3SA 3C3YA 3UOGA 1NUSA 4UM5A 3WSVA 4H1WA 1Z5OA 2ORED 1R3UA 4CFZA 1S1MA 1CUWA 2QN1A 5ALSA 3O4GA 5TGDA 1KPIA 3L6OO 3ND8A 4FSDA 4ZN6A 3UT0A 1NF3A 5KHOC 3LCUA 5HE8A 4WVFA 1DLIA 1E18A 3BL8A 4Q4JA 4QBGB 2ZSDA 3BXEA 1GZHB 2YRWA 5AJZA 4BHTA 1N3YA 5C7IO 3JAMA 4DLPA 1OSNA 4A8PA 1QVAA 5T67A 4A2CA 1PJLA 3EXHB 1FUUA 3SSOA 4GG1A 4AWXA 1QP4A 1E0KA 3LD9A 3DL7A 4G0ZA 2RAPA 5IH3A 1C0IA 1J2EA 2Z5GA 3LDAA 1P33A 1Q1AA 1KL7A 1K88A 3DV9A 1K98A 3P19A 5ESWA 2QAIA 4RMJA 4TSKA 3TFWA 2B6NA 1YH3A 1MJ5A 2Y0EA 1VIMA 4JVOA 4RL4A 3DNPA 4IIHA 5ADUS 5JLJA 4KPEC 1VXRA 1ZPDA 1G3UA 1VTKA 1Z4KA 1Y82A 2FR8C 1NLFA 1E9FA 3DHYA 5CM2Z 2C82A 1YB1A 4QXPA 4ZANA 3BXPA 3D6JA 3GRFA 3HRIA 1Z22A 2V6GA 1JEQA 2ZBRA 3OHSX 4XARA 3RM3A 2O8CB 4MA0A 4QX6A 2EP7A 1BWRA 4YREA 3DAPA 4PX2A 3VPSA 1QE0A 1ZH0A 3NWOA 5I47A 3CZMA 1EA7A 2NUPA 4J4BA 4D25A 1OI4A 5EXEA 2FW9A 3NIFB 3JQ6A 5REQA 3ZDEA 5IJ9A 1F8GA 3EGDA 3MGKA 1YKSA 1MOZA 2GAAA 2VK8A 3VDQA 3TLMA 3HN2A 1OWOA 2ZKIA 1J2RA 1VJ0A 4NFYA 3TDKA 1REQA 5BN5B 4CZ2A 1T35A 2NZVG 4GT1A 5BWLA 1F14A 1NKTA 3VDRA 4PWYA 2YC2C 1KHTA 1FTGA 3MEQA 5IXSA 1Z8NA 3QVKA 3AF2A 4JLOA 4JJKA 5AXBA 4IUYA 1P75A 3OCZA 3GLIB 1Z8HA 3F47A 3ILHA 2XNDD 4WNIA 5EQJB 3NHZA 1R8QA 3BAZA 1Q17A 4WOJA 4C7OB 5JAIA 3IURA 1F5NA 2HLHA 4LDAA 5JU6A 2LDXA 4FPXA 2V7WA 3BORA 3NUGA 5F73A 3A31A 4EGCB 1HRKA 1INLA 2YBDA 2ZVJA 4NC9A 5GGYA 3VFDA 4BASA 3ICEA 1E3TA 1TVCA 1EUZA 2QAGA 1OX4A 1RS0A 2FZWA 2QU8A 4CIXA 4HAVA 2PGJA 4TXJA 2XBUA 2WE7A 3NH6A 4U9IS 4GMKA 5T4BA 3EC2A 3S2GA 2FU5C 4I2NA 4MUGA 4RZ3A 4D9EA 1GA1A 2J9FA 2YJNA 1OH5A 3BAFA 4RVSA 4ID9A 2DBYA 3ILVA 4I3FA 4M46A 2CL7X 2R0QC 3B51X 5C8VA 2LWIA 2RC6A 2BKAA 3EASA 4WJKB 1NTRA 3DO5A 4G84A 4DMGA 3PI7A 1WLYA 3UJNA 4DR4B 5JASA 4HJXA 1XJ5A 2FPIB 2P9EA 1GNVA 1R15A 3IIIA 1I14A 3FHOA 3OU7A 4R7TA 4H1UA 1R6AA 1SHTX 5JOQA 2VZ9A 4R1SA 3ZXIA 3OQIB 2QD4A 5BW8A 1ZN7A 5D7BA 5FFMA 1BWPA 1R0RE 5LXTA 5BMVB 2N3ZA 2BFAA 2X86A 1UKYA 2OORA 3KQPA 2VYND 3OMWA 4J3FA 4WH0A 2PG3A 4BLQA 1IVSA 1E2FA 2KE5A 2YNMA 2RK3A 3OFKA 1DV2A 4FX2A 2VT7A 1Z5PA 2RI6A 4ZDIA 1Q1GA 4EW2A 1AVTA 1KO1A 5JSHA 1G63A 2CVZA 1IRXA 2Z09A 4XLLA 1ECCA 1D1SA 1UFRA 2Z2JA 3FWPA 4G09A 1D1PA 2O3JA 4UDXX 5GVSA 2G1AA 2EKQA 1WMFA 3K1AB 4CQLB 1R0ZA 1GCGA 1H0RA 1HQDA 3WGLA 1WSDA 2C4VA 5A9SB 4EKNB 5HIAA 2OYSA 1IL0A 1J70A 3W78A 2J09A 2SECE 2Q21A 4WBNF 4OSEA 1KH1A 1L5MA 2II6A 3ZWQA 4N41A 1N1EA 1UQUA 2YWXA 1EHIA 3SZLA 1AV6A 2POQX 3OMLA 1F0PA 1J0AA 2QZ9A 3O3OB 4Y3UA 1I3KA 3RTGA 1MIOA 5K1ZA 3TIGA 1GKYA 2O8DA 2NU8B 4X45A 1BO6A 1I32A 1MR3F 4CCSA 4UAJA 2YKGA 3C3DA 1EXDA 3TSAA 3COPA 3GGJA 4K46A 4REOA 1NOKA 5HDBB 1N25A 2QJRA 3O31A 2KS6A 3SC2B 3WDMA 2R4TA 1PO7A 1MX5A 2I4MA 1Z88A 2ZB2A 3BDIA 3BJEA 1ZM3A 2O1WA 1L7MA 1UPFA 3NYWA 4GI1A 2OCPA 1ZKDA 3PF8A 4O3FA 4WXRA 3X1JA 1DBVO 1W4AA 1TU4A 3FDZA 1T2NA 3WK8A 4BFSA 4RE6A 4L57A 1Y1QA 2QRNA 4XIYA 5FBLB 4FM9A 2HA7A 2ZBFA 5LKAA 1I2AA 1I3MA 1SU7A 2Q07A 3O8RA 1PI3A 1RHUA 3UYLA 4V2UA 4ZYXA 3THWB 1KJYA 1O94C 2N42A 2OHJA 4S35A 2GEFA 4Q37A 3K3PA 3IDSA 4UZSA 1L4FA 5FNZA 4EDFA 1I33A 2QV7A 4I9GA 4GZ6A 4Z4GA 5DE3A 5B6JA 2VBFA 1T43A 4IM7A 2G04A 3A26A 4I3HA 3PKIA 4CLXA 4DW8A 4WOBA 2NZWA 3TLAA 4CCAA 1F20A 3I1FA 4CRWB 3KZMA 3C3XA 4D26A 2FQQA 3C7AA 4L0DA 2HNKA 3KSDO 4P4SB 2WVAA 5DTIA 2J48A 3CLUD 2XWJI 2OGWA 5LQSA 4DWWA 1ZGHA 4HDQB 4M87A 1PR3A 4J16C 4EW1A 2B1JA 4MLZA 3FOFC 4AMVA 1JKJB 3URMA 4C9BA 4QREA 1YQWA 4KG7A 2JC3A 2W70A 3SGLA 1K7EB 3QOFA 3NO4A 2F1HA 4POAA 2J6BA 3C8ZA 5EIAA 1GGHA 4XD2A 4C01A 1G41A 2MINA 3FBGA 5JFTA 1HT2E 3I9MA 2V58A 5F2EA 3T1VA 3VPBA 2AG5A 3F9IA 5DLPA 3UKOA 3HRHA 4TLEA 3CRRA 3V80A 1VRCA 2OHGA 1LPAB 3PNQA 2DFDA 3AJ8A 2UKDA 3ZHZA 2OCDA 1B7GO 4TWAA 1E4VA 1GDHA 2UVQA 2FHPA 3EW7A 3MA0A 4FZVA 4ECAA 2D5LA 2O7SA 3TXYA 5U9CA 4RM3A 1SMKA 3IAM6 5JCXA 2B4TO 4AS2A 4ILEA 1TW3A 1YOVB 1V25A 1NBEA 3GJRA 3DTVB 2WSIA 1YVRA 2D5IA 4JJGA 4DNOA 1KAGA 4RXUA 4X24A 1NBWB 2FWIA 3IP8A 3VPAA 5A5EA 2FLVA 4E0BA 1HYGA 3F4LA 1R8SA 4BO7A 4H6XA 2UVPA 1WB4A 4AROA 5IN4A 2PTHA 5FULA 5EJ5A 5LOVB 1AN9A 3OKFA 4UNNA 2IU4A 3N2IA 4OB7A 4BCBA 2VDUE 3PIIA 1IOZA 3KXKA 1I7QB 4UFOA 2ORYA 4BRZA 3HDTA 2OK8A 1ILEA 1FTYA 2A5JA 3BZUA 4HGQA 4RM2A 4ZGWA 2X5NA 3KVYA 4AQYB 1X7HA 1EZZA 3CC8A 4PXAA 5HILA 5KWEA 2C9DA 3RC9A 4PHHA 2EGUA 4QRIA 4Y7DA 4E21A 1PQYA 2VPQA 3E8XA 4YT5A 3VBEA 3OJFA 5LQRA 3P96A 1L1FA 1PFYA 3S55A 4O2AF 2JVKA 1MZVA 3MJ4A 3L79A 2P62A 5GV8A 4N6GA 4D8TA 1A72A 2XCTB 3WS7A 1KDPA 3KYJB 1ZCBA 4G01B 3TRHA 4BNUA 3GYBA 4QUBA 1I0ZA 2G5GX 2IHYA 3AHEA 1KFBB 2OSBA 3AVQA 3HWRA 3IOMA 1SU6A 1OA1A 4ZI7A 1TU0A 2I99A 3MELA 1ZFNA 3VNVA 1N5RA 3ET4A 3ETNA 4NENA 5CYOA 4B33A 1TAQA 8ADHA 4IV0A 1M74A 4TQAA 5CBKA 1Y9AA 2ZS7A 3SYLA 3QX7A 1H8HA 3C3WA 3MUEA 5T4FA 1KGDA 2AI3A 3H13A 5EE0A 3KKKA 3IP3A 4BOYA 1JG3A 2XUKA 4I5FA 2GYYA 3I9V1 3KPUA 4CKWA 5FADA 1YB2A 3NRCA 1T0HB 1O0CA 4RESA 3V8VA 1VPEA 2WYOA 4EJ6A 5JATA 3MCAA 4JU8A 1FTSA 3AP2A 2CLMB 1D9XA 4UTNA 5FLXA 3SE0A 2Z6QA 1CUGA 2W0MA 4BJHB 5JS1A 1SELA 4UHHA 4AJNA 4U7HA 1QSGA 3FBTA 5A1TA 4WXMA 4LJRA 3KZ1E 2B98A 3QF4A 3LLSA 4YJHA 3TKLA 4OHPA 4KXMA 2ODWA 2V4MA 4PLWA 4EJFA 1NR7A 1ZHFA 4RHTA 3KPJA 5JQGF 1E98A 4MB0A 3CLTD 1YRLA 3SOPA 4DDMA 1A5SB 4G0YA 3LPNA 4LRQA 1L4HA 5BR4A 1GL6A 1AXGA 2G9QA 1DX4A 2RGBA 1TPZA 2QTRA 2XX3A 4LCEA 2V96A 1TAGA 4HX2A 2VDOB 3SEQA 3AL2A 3M3HA 3T38A 4OQDA 1WNTA 1ECPA 3EXEB 4KZKA 1I0IA 3AR3A 1VCNA 1WSBA 2W2NA 2HY7A 2NO7A 3C6YA 3SM9A 4Z1OA 8ATCA 3HUDA 3AEXA 3EX7C 3B48A 2IH2A 2PZAA 3PQEA 4QZVA 4J1QA 3TPFA 5JPIA 2GZRA 1WLSA 1UUFA 3CNLA 3DTNA 2I1VB 1SZCA 1Z5WA 3HXQA 1N3IA 2C8LA 2JVJA 3UAZA 3WKCA 3C85A 3CLKA 5CX4A 1CW2B 4ZEOA 5H4HA 4CI9A 1DJPA 1KEEB 4J2OA 3ROXA 4FFBB 1TCAA 4DBVO 2EIHA 2CLKB 4H17A 5ALFA 3WHIA 5IVPA 4OA8A 2OESA 4FDVA 4P36A 3ZK9A 1I2BA 1ZGCA 5B4TA 1ZJWA 1K0FA 2IYFA 3UAVA 4D9MA 1W36C 3A9SA 2CUNA 2PX0A 4BE4A 1FVFA 1OY1A 2QQFA 4GF5A 3RUCA 1DIGA 1QMGA 5B5SA 1PZHA 5BNZA 3BTSA 3EPJA 1PHPA 3SG0A 2JLWA 2XUQA 5MDHA 1L5YA 2XUIA 3ONNA 1WHTA 5H0IA 1YDEA 1J2JA 1FLVA