4YV7A

Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmei_3018, target efi-511327) with bound glycerol
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
GALKIGFSQATQQSPFYVALTDAAKAEAQAQGDELFYADANGDITKQNNDVQDLITRGINVLVINPVDPKGVTPSLAAAEAAGIKVVTVDRPVESGAASFVGRDNKAMGELVGKAAVDTLGPDGGKIIEIQGDAGGAVARDRRDGFQAAVSGRPNITIVEGPYCDYIRSKAVTAMQDLLQAHPDLKGVYAQNDDMALGAMQVLAENNRTDVKVFGVDGLMEAVRAIADGDQYVATALNDPDAEGRLAIQTAAKVARGESVPEFVDAGTGLVDKSNASALVGQSTFAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF AN ABC TRANSPORTER SOLUTE BINDING PROTEIN (IPR025997) FROM MYCOBACTERIUM SMEGMATIS (MSMEI_3018, TARGET EFI-511327) WITH BOUND GLYCEROL
rcsb
source organism Mycobacterium smegmatis
molecule tags Solute-binding protein
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
total genus 107
structure length 288
sequence length 288
ec nomenclature ec 3.6.3.17: Monosaccharide-transporting ATPase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yv7A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yv7A02
5TPWB 4Z9BA 2CD7A 4MS1A 1I3CA 2CHEA 1U2QA 3EJWA 1D5WA 3M6MD 3NNSA 3W9SA 3CKMA 1ZHHA 4GPAA 3KSMA 4RK0A 5CNIA 4OG2A 2QU7A 3Q7SA 1PNRA 3LUGA 3CFYA 1BDJA 4LE0A 1FQWA 4MQEB 4Z4CA 5C5EA 1JLKA 9ABPA 1NTRA 4P1ZA 2PE5A 1GCGA 4YCSA 1Z12A 4YRZA 1QP7A 3O1HB 1F51E 4ETMA 3HDGA 1DJMA 1ZGGA 4HNRA 4DADA 1Z26A 5JNSA 4XARA 3G85A 1APBA 4W5NA 1NXSA 3CZ5A 4MR8B 3IP7A 5D2CA 1GUBA 4QYWA 3LUJA 1IIBA 4JAVC 1SXIA 3KTOA 2JVIA 4IMIB 1PNTA 2WWVD 1F4VA 3HXMA 4EVQA 1EWKA 2FN9A 5GQSA 2BGGA 2FMHA 3D02A 3OLXA 5GOTA 2PUFA 4MR7B 3RVOA 4QPJC 2IOYA 4FE7A 2HQOA 2FVYA 3M9XA 2PMCA 3EQZA 3LUDA 1MB3A 3O2SB 3N0RA 4N76A 3ROTA 2QVCA 1VRVA 3IPCA 5JS1A 4JB2A 1GLGA 1QQBA 5KC8A 4MQEA 3EDCA 3LOPA 4RSMA 3IP6A 3JTEA 4LX8A 3KG2A 2PUAA 3DGEC 2JVJA 2HQRA 4EYKA 4HNSA 3TB6A 8ABPA 2H0AA 4XFKA 3DLBA 3QEMA 1EWVA 4E7OA 4MR8A 5CHYA 4TN5A 4OTZA 4MLCA 3O75A 1VKRA 3P9YA 3LTEA 4FB4A 4WXMA 1YIOA 5CNKA 1QPZA 1DCKA 3H5OA 2QXYA 2W42A 2F8SA 2FMFA 3LUKA 4Z9AA 1P8AA 4KK3A 4G0PA 3OQNA 4Y9TA 3MIZA 4LE1A 4N03A 4MLDA 5JS2A 3FDFA 3EULA 3ILYA 1DRJA 2A9PA 3HCWA 3UK0A 3FFXA 6CHYA 2QW1A 1C0EA 2MSLA 2AYZA 5ABPA 3MA0A 4EYQA 1A2OA 3CHYA 3QX8A 3RVJA 4W5QA 2FLWA 1DG9A 4O1HA 3OQOA 4KPYA 2PLNA 2JVKA 4YO7A 4KQ9A 1NY5A 2MYNA 4B09A 3SM9A 1JDPA 3H1GA 2JK1A 4N0PA 4RY8A 4RXTA 3Q7TA 4H60A 1RZRD 3EODA 3CU5A 4D74A 5KQPA 5IUNC 1YS7A 4F3TA 2RDMA 1E2BA 5FWXA 2N9UA 3QLTA 2FQXA 4G0XA 4YGXB 3A10A 5IULC 3GRCA 3LKVA 1AB5A 2HSGA 4HNQA 3H1FA 1M2EA 2RJNA 5IC5A 3HJFA 3L6UA 3RVKA 3SY8A 3QLUA 2GWRA 1JX6A 5TQ0B 1URPA 3OMWA 4NV3A 3LUAA 3GL9A 3VNBA 1YTUA 3RVPA 1ZN2A 4JA2A 4JOQA 2PUGA 4KQCA 3UKJA 1ZVVA 3HO1A 1DBWA 4TMYA 5DKFA 2JB9A 2RJOA 3MYYA 4Z99A 5EWLB 3RVRA 3QLUC 4S04A 4PYRA 1S8NA 3LUHA 1YK1A 3GYBA 2JCGA 3GT7A 1SD5A 1DZ3A 1KMIY 4KV7A 3OLWA 1CHNA 2E4WA 1NXWA 4MS3A 4RK5A 1DCFA 2O20A 2FEKA 3O1JC 5CNMA 1KRXA 3H5TA 3OO1A 3GBVA 4LE2A 4MAAA 3H5WA 4G0OA 4MQFB 1ZH4A 4PEVA 3F6PA 4PE5B 4S05A 1USIA 4ZMRA 1DC7A 3FMVA 4FE4A 1GUDA 4IMJB 3RVMA 2NZVG 4GNRA 4WT7A 4ZJPA 1Z15A 4YP9A 4KFCA 2QSJA 4G0YA 2FMIA 5KQLA 3JY6A 2PUDA 4IGAA 2R48A 1D1QA 2HPHA 1JFTA 1J56A 4JB0A 3N6VA 1P6UA 1EFAA 2FXIA 3Q15C 2M1ZA 2LPMA 1DBQA 4WWHA 5EWMA 2JBAA 3LUFA 4O5AA 5T7BA 3HEBA 1K66A 2VUHB 2E4YA 1RXIA 2GI4A 1YMVA 2V0NA 3H5IA 2GKGA 1Z2DA 3LFTA 4RK1A 1Z18A 3GV0A 3QLVC 1BVHA 1JFSA 3RVNA 3H6GA 2OENG 3K4HA 4H3HB 4MRMA 5FBHA 1D1PA 4KMRA 3RQIA 3G1WA 3O1IC 1DCMA 3LMKA 1FFGA 3MM4A 2RGYA 3NBMA 4RK7A 4M88A 5HQJA 4IF4A 4OBBA 4CBVA 1QQAA 5TPZA 3O74A 3SNKA 4RY9A 3D8UA 1B00A 1LBIA 3QELA 5IUKC 4NCAA 3NNNA 3QX9A 4L85A 2PUEA 1QNLA 3HUUA 3TMYA 3HUTA 3A0RB 1LK0A 1ZY2A 3MMNA 1ISRA 4MS1B 2Q5CA 3CNBA 5DCLA 2JRLA 1VPWA 1PEAA 4N41A 5TQ0A 3CG0A 1EHCA 2WJAA 3BRQA 4MPTA 4Q6BA 4TLLB 4N47A 1JBEA 1SRRA 2QV0A 4F11A 2P9HA 2E4ZA 4LZLA 3HM9A 3BBLA 1TVMA 1H9CA 2WRZA 3C3KA 2ID9A 1DP4A 5BQ3A 3RVQA 4XXHA 4KNYA 2MYTA 5IEJA 1ISSA 5TQJA 3C3WA 1JDNA 4YWHA 4MR7A 4HYEA 7ABPA 3N53A 2E4XA 4PZ0A 2TMYA 2M98A 3OLVA 4MS3B 1QO0D 4RDCA 1M5UA 2PL1A 3TO5A 2E4VA 2GX6A 3QLVA 2MYUA 1PHRA 2B1JA 3KYJB 4G0QA 1OXBB 1VLZA 1ZESA 3N0XA 4Z4FA 2NT4A 2IPNA 3BILA 1BDHA 3KHTA 1C4WA 3T8YA 2FEWB 4YV7A 2PUCA 4RS3A 1JFVA 3JVDA 3NNDA 3QEMB 2WB4A 4ZMSA 5KQMA 5KQGA 4TLMB 1AB6A 4RKQA 5DGCA 3SAJA 4W5RA 5TQ2B 5E3JA 5BRJA 1JYEA 4RY0A 2A9RA 1FSPA 4RU1A 3VNAA 1A0OA 4N0QA 5I4CA 3HS3A 3HDVA 5IEBA 4KZKA 3Q7RA 2E4UA 3KLOA 3N0WA 1M5TA 4NICA 1JWLA 1HEYA 4L4UA 1ZGZA 3N75A 3KLNA 3I09A 3H5VA 2IDMA 1OXKB 2FEPA 3DZDA 3H75A 4KK4A 1USGA 4RKRA 2NZUG 1D2AA 3O2JA 4RWEA 1CYEA 1JHZA 1T34A 3H1EA 3BREA 4LRQA 1TM2A 1DC8A 5ED4A 1R8JA 3F6CA 1XHEA 4KRFA 1P2FA 2F8TA 5KI6A 4Z4EA 3GBPA 1KRWA 3DLHA 5JNVA 3DBIA 2PJUA 3T6KA 4Q6WA 4DN6A 1QO0A 1M2FA 3IP9A 4LDAA 1USKA 1LJUA 4UHJA 5T3YA 5KC9A 4UHKA 4ML3A 3QK7A 3OM1A 2A9OA 2VYCA 4LDZA 4YS6A 4IILA 1K68A 4OATA 1L5ZA 3O21A 4D6XA 4XLTA 1KGSA 4RXMA 4RXUA 4G97A 4WXEA 1MIHA 2MYPA 2LP4Y 4EUKA 5HKOA 2A9QA 2NUBA 1PEYA 1U2PA 3N8IA 2J48A 3O2QB 5TPWA 4XAQA 3CLKA 3FFWA 1RXEA 2LUOA 3Q9SA 1GCAA 5EWJB 4W5OA 4H3KB 2OQRA 4WUTA 1ZITA 3ROFA 1MB0A 1SXGA 5HSGA 1ABFA 2GBPA 1ZDMA 3SG0A 3NHMA 1BAPA 4MRMB 2LBPA 3QELB 1TLFA 1L5YA 1ABEA 1DRKA 2HQBA 3JVIA 3KCNA 4G0ZA 2PL9A 5KWSA 1E6LA 2I6FA 3JPWA 5DLEA 4JASB 4EYGA 4EYOA 4ZYLA 4WZZA 5IX8A 4KREA 2X7XA 1XHFA 1EAYA 2WMYA 3QEKA 5TPZD 3FGZA 3BRSA 1Z25A 5DTEA 5BRAA 2QVGA 4XASA 1ZAYA 4MS4B 1Y1LA 2LIVA 5IUJC 3TX6A 1WETA 2CHFA 1Z13A 1Z16A 2MSKA 3EQ2A 3EAFA 4EY3A 1Z17A 1NXTA 1MVOA 3JPYA 3SQNA 3C3MA 3IDOA 6ABPA 1TJYA 5EWJA 3HV2A 3RH0A 2QZJA 3ILHA 4ETIA 1QP0A 2WY2D 2PAFA 4F12A 2FLKA 3F7NA 5B3JC 5FWXB 3CS3A 4Q7EA 3UUGA 5EWMB 1JH9A 3OO0A 1RNLA 5PNTA 5JNWA 1LJLA 4JP1A 1BDIA 4Z4IA 1U0SY 3GWGA 3CG4A 3JS5A 4G0MA 4G86A 5JNUA 2CWDA 1NATA 2FMKA 2MSWA 3MQ4A 4P98A 4Z0NA 5BR1A 2VK2A 4OLBA 1MAVA 3LKBA 1PUXA 4MGEA 1RPJA 3EGCA 3H6HA 1P6QA 1U8TA 4D6YA 2H3HA 4YLEA 3I45A 3C97A 1SXHA 1A04A 4KVFA 1BA2A 4Z4GA 2NT3A 1XWWA 3A3KA 3M9WA 5JNTA 5TE9A 2IYNA 3E61A 2FQWA 3KYIB 3MF4A 2FW0A 3FFTA 4EVSA 4OLAA 4F06A 3OMXA 2FTKE 3HZHA 5C5CA 2QR3A 1FFWA 1DBPA 3A0UA 2YHBA 2AYXA 1LBHA 1Z2EA 2YHAA 4MQFA 4ETNA 4Z4HA 4QYMA 1ZH2A 5FWYA 2HJ9A 2B4AA 1W9HA 2FSPA 3GA5A 4NCBA 4EVRA 1NXOA 1E6MA 3CTPA 5JNRA 3RVLA 2L19A 3S99A 2IPAB 2PUBA 3LUCA 5F64A 4MR9B 2KYRA 2ZAYA 4RZSA 3OQMA 1JL3A 2R47A 1QKKA 1TMYA 5FBKA 3OLZA 3R0JA 1YS6A 3IPAA 2FKAA 2P4UA 2FN8A 2ID7A 2L17A 1D4ZA 1QMPA 3L49A 3OM0A 4IRXA 4PICA 3T95A 5IBQA 1JYFA 3KJXA 3URMA 3B2NA 1YK0A 5FWYB 4W5TA 3HK2A 2IPLA 4YR7A 3C6QA 1NXPA 3KS9A 4MYRA 4RK6A 3TD9A 3DGFC 2WJWA 2IKSA 3T38A 1FFSA 1E6KA 2JBAB 4F8JA 3NHZA 1RZRA 4RK4A 1W25A 4MS4A 4DQDA 3E3MA 4NQRA 5HM6A 2L2QA 2IPMA 2PKXA 3CZCA 4QICA 1U04A 4RV5A 5CNJA 3H5LA 2R25B 5EWLA 1UDRA 4O1IA 1CEYA 3F73A 1YVUA 2R4QA 1EWTA 1YMUA 2FQYA 2L18A 3CRNA 3K9CA 3Q41A 4MR9A 3I42A 3KKEA 1NXXA 3I5AA 2VUIB 4ZPJA 5TQ2A 2DRIA 4E7PA 5B3JA 3IP5A 3RVSA 3HVRA 1NXVA 4EGSA 1JF8A 3HSYA 3OLYA 2ZWMA 1QP4A 2XDYA
chains in the Genus database with same CATH superfamily
1GNPA 3PFHA 4N01A 4INAA 2PRYA 4MQMA 3B7WA 5E3HA 4E0BA 4EARA 1Z88A 1UUFA 4RK0A 3KQMA 1M3SA 1ZM4A 3OOHA 4ZO8A 1JLSA 2V5AA 1LQUA 2NXWA 3EXHA 4ZI7B 2HCTA 4TTVA 2GNOA 4OHFA 4LE0A 3GGGA 3D6UA 1ZN7A 1ZZEA 1LF5A 2HJRA 4WNCA 3L6EA 4EG0A 5AKXA 4ETMA 5D5QA 1YCHA 1OA0A 2GF2A 2HA0A 1V37A 2O2YA 4TTPA 4AJIA 1AJEA 1RWMA 3G2MA 1W6UA 1MJHA 1EP3B 3SHVA 1U8ZA 3PUIA 4UDNA 1GUBA 2BEWB 3U7JA 3BPSA 3F3KA 1MZVA 4XOIA 5ITZA 3DM5A 1P61B 1G42A 1R6TA 3VJLA 5I9BA 1QIEA 2Y0PA 3G8YA 1EWKA 4KH0A 4EVQA 4M0KA 4QPJC 2CT8A 1D1SA 2DFTA 4IVPA 2XI4A 3U40A 4A8HA 1DUIA 1ZP6A 3H3FA 4K6HA 2GPJA 2KM1A 3QOFA 1X7DA 2C2KA 2ZI5A 1BHJA 3IAFA 4TN1A 5DHFA 5C53B 4N6NA 2BEKA 2QD2A 4KE6A 4RUKA 5DW3A 3LT0A 5IJ0A 1S89A 2EOAA 3I6ZA 3O9ZA 3OAAA 4Y2HA 5B1EA 5HUHA 1SBQA 5TIIA 1KAEA 4IS3A 1GM5A 3R6GA 1ZVQA 4GX5A 3ZXIA 3DLBA 3I2HA 4C3VA 3QUQA 2OPBA 3HL0A 3O0DA 3RFCA 5JAHA 1F9EA 1GAQA 3BXPA 4XX0A 2XBLA 1P2DA 3K0CA 2SCUB 1DEXA 5JADA 5LPNA 3TR6A 4WXMA 1VYHA 4MZDA 4P2BA 4IFEA 3WL3A 2WYHA 2CXXA 4PINA 2GEKA 4HDAA 4AZ3B 5HE9A 2Y0CA 2AZMA 1FX0B 1L7MA 3FLBA 1RCUA 1A77A 3OQNA 4MA4A 2W8ZA 2C1ZA 1W2WB 1DX9A 2N42A 3DXFA 4HY3A 2HSJA 1UFKA 1IK4A 1EWRA 2JGEA 3SKXA 2ZRBA 3VR3A 3UVEA 3EULA 2RH9B 3OZFA 4U2KA 1LSSA 4WGFA 1IATA 4Y2RA 4I9HA 3WLPA 1XMXA 4I5FA 2AZTA 2Q2OA 2QW1A 3CZAA 3QVGA 4OGFA 2C95A 5DI3B 2BN4A 3ELBA 4NJMB 1Q7CA 2OFXA 5ABPA 5FKJA 2FLWA 4V0SA 1NLUA 1HZJA 3H0EA 4PAGA 4FYYA 1SBYA 4RE6A 3RFVA 4BX9A 4A15A 3PI7A 3NTRA 5BP7A 1QH9A 3THOA 1GQFA 3K1TA 1QHSA 4AQYB 1IG0A 2NU6A 3DZCA 1OX4A 3F6EX 1WUKS 1D07A 2YN2A 3I5MA 2IIBA 4BV2A 4F5DA 2D7CA 1CIJA 1NUTA 2G25A 3BSSA 5U4QA 4L22A 3HJUA 2Q3BA 2V6JA 3WIVA 5K0SA 1QHNA 1SG0A 5JRZA 1N33B 1R9NA 3GEHA 5JIBA 2I6QA 4YXWD 3H8VA 1Y89A 4I0WB 3T0IA 3U39A 5DASA 3ECAA 3QJ5A 3HJFA 5EHXA 1XMOB 4HAWA 2PPVA 3MPUA 1LV7A 5ADWA 2YR0A 5CA1F 4HGRA 2LKDA 3DAFA 4BNMA 4U7JA 1C2TA 5B1SA 5P21A 4G4SP 3RRNA 5AMXA 2ZRNA 2IHZA 3TLGB 2WE8A 4UQLA 3C3AA 2WHPA 1M0TA 4JA2A 3L6DA 2IEIA 2BFBA 4PPQA 4LJ6A 4NVRA 3R3SA 5AW8A 1R3UA 5IYZB 2GUGA 5DKFA 5DMHA 4RTRA 2I8AA 3QLUC 3CIOA 4MDEA 4O2LA 4BQEA 4ZHQA 4HUQA 3RAFC 2P2ZA 1KMQA 3HU5A 3IL2A 5DISB 3CKKA 3B7PA 4ZODA 4EHKA 3ZD6A 2CHUA 4I1OA 3FNGA 5ED0A 1SELA 3H16A 3GWZA 3L4BA 4YJ2B 1GYPA 4CR8A 4DCTA 1GSOA 2BZSA 1P75A 1SCUB 5EUBA 2VNHA 3S2SA 2PLRA 1EFHA 1OC4A 2AFHA 2G83A 3DB2A 3EZLA 4KXLA 4P5DA 4PE5B 4MQLA 5FD8A 5LZ8A 1T6XA 3AB7A 5KTTA 2XRMA 3K9FC 1GUDA 3HV0A 5EZYF 3ZJ4A 3UHAA 5CB6A 1CB0A 1O1YA 4NLLA 3U7EB 1ESCA 2Z8XA 4GWLA 3MTDA 4Q16A 1XTIA 3H2SA 5D3KA 4BYMA 5EJ4A 1T6BY 4U2BA 1U94A 2GZSA 5AKJA 5LLTA 2P40A 3I3SR 4GZLA 3G0CA 2QQ0A 5DF1A 2AXPA 2FZ4A 1U63A 1AN0A 3UHPA 4GI3A 5BSVA 3VRHA 4E32A 1NIPA 4L1KA 3VPXA 5A7HA 3PDIB 2QRLA 4H6XA 4DMFA 2O3JA 5FUWA 5U4XA 2BI7A 3GJSA 3RHSA 4Q48A 2PKEA 1TJNA 2RHTA 3K4HA 4H3HB 4LJ9A 1H05A 1Q2XA 1E4EB 1RIIA 4YMUA 3ICCA 4OKNA 4CG1A 3IPXA 1MIOA 4U0JA 3S0JA 1JYSA 2GZ3A 2Q1YA 3RC3A 4E5PA 1T6ZA 5CLJA 1ZU5A 1NDQA 3LVBA 4TXMA 2QRMA 5L3QA 2YBDA 3RHZA 4PQRA 5HIIA 3H2HA 1RJ9B 3VYVA 1J0AA 2AN4A 4TM7A 4M54A 4RQTA 2QBYB 1M8FA 3JD1A 3STHA 5CBPA 4NATA 5GM2A 5J4YA 4NL4H 1KPIA 2BP7B 4JUBA 5LA6F 2V6GA 4R98A 4XWAA 3T7IA 1C1HA 2JI9A 1GSAA 2WJHA 3D2BA 2DPYA 1R37A 3H7IA 4X8LA 4YXFA 2OHXA 1V1MB 1R12A 4R5MA 5TMPA 3W5DA 4BCBA 2WJAA 1CE8A 2OESA 4X90A 2E5FA 1E1NA 5KYYB 3FCUB 3OPQA 4Q3CA 3AHGA 1KS2A 1AHHA 3NP9A 3AVUA 4DSNA 5THXA 3CLUD 2AW3A 2WA2A 4JROA 2UZ3A 3L1HA 1PR3A 2C4WA 3EEIA 2CCKA 3UEOA 3EIXA 4P3YA 2GN6A 3WYBA 5A02A 1HE2A 1TZCA 1E3WB 2YS7A 2ZUWA 2DBZA 4Z0TA 3WZMA 2NAFA 2NTNA 3O3CA 3ZZNA 4PSVA 5H9VA 3T4PA 3D54D 5K3FB 3OTOB 2X2PA 3NC1C 3HXTA 1WDWB 4TVOA 5KTSA 6ABPA 1UKCA 4YCNA 1KI7A 3M6VA 2OCPA 3OLVA 1EJ0A 1P1BA 4MS3B 1EJ6A 1U0FA 721PA 4F91B 4YRJA 4ZOLA 2B9VA 4ZGWA 4O8ZA 3O8RA 2AA3A 2ODQA 2X4LA 2AFIA 1O94C 3A6ZA 2DCMA 2IZ7A 1M76A 3EOBI 3FLAA 1PWZA 3GDFA 2PSEA 3N0XA 4J2TA 1JQJC 2I3AA 2WV9A 4MDYA 4NWIA 3GFQA 1IN4A 3O4VA 5CM2Z 4E07A 5F98A 1G21B 2AMVA 3D4LA 3K8QA 4HGOA 2W83A 3O8OA 4RULA 1MD9A 1AKTA 1AHIA 5DNDA 4DJAA 3EF0A 5KQMA 4FGKA 3HPQA 4GR9A 3SI7A 4BFCA 1GZSA 2QXTA 1XI2A 3IPLA 5ECDA 4W5RA 1MEEA 2HJHA 4MB0A 4X3PA 1VECA 4RY0A 3OM9A 1GLVA 3OFKA 3LX8A 3TLCA 1QG4A 1IYZA 4O6VA 3J7AC 3FVVA 2PGAA 4XX0B 2VRCD 4PCUA 3JU3A 4JYZA 4MUMA 2Y4NA 2P77A 2RIPA 3N0VA 4X1YB 3SWWA 1XF9A 3B9QA 4PVDA 3D9QX 1KDZA 3OSUA 4XLLA 4A6PA 3UB3A 1E3DA 3CINA 3PC4A 3UPUA 4LHXA 2JIBA 2VDPB 1ZGZA 2WU1A 3IQFA 4XE5A 2X8WA 3EVEA 4W1QA 1OXKB 2UZ1B 3BCRA 1C9JA 1B0ZA 3O2JA 1XDDA 3PPIA 1MGOA 1ST2A 1M2KA 1CWUA 5DM4A 3SYNA 5I7EA 1UQUA 1YB5A 3MMXA 4DJTA 4YT8A 5CFNA 2NW6A 5AJWA 3C2QA 1UP6A 4KRFA 4I2VA 1QXSA 1KH3A 4LOAA 2YWJA 1KRWA 3FOCA 3C8HA 4WH0A 3BZBA 4YJGB 1CVLA 3KPUA 4ZOCA 3T6KA 4Q6WA 1XL0A 4QDUA 5LQRA 1QIKA 2HV9A 4Q7KA 1ZA1A 1TF2A 4RHUA 5L4SA 3NDBB 3T1TA 2EXXA 2CHGA 1NURA 3AJ9A 4KG7A 1O54A 4LDZA 2XUQA 3EBLA 2UZ4A 3ETHA 3FNHA 3OEHA 5ECWA 5T6MA 1FXWF 1WPRA 3AERA 2PMWB 5K8JB 4NYIR 3FPLA 3OMLA 3ANXA 4XQCA 4MJXA 3T7JA 4FWBA 5AVZA 2JKYA 1MIHA 2MYPA 1Y9ZA 3B6ZA 4LHWA 4DYHA 1DPFA 4DIDA 4XM1A 3FSGD 1J70A 3N8IA 3O2QB 3U3ZA 4FXPA 4OV6B 3H11A 1NNSA 3Q9SA 3H2GA 4AS3A 4BFXA 3HXOA 3VKUA 1XLVA 1VL0A 3HLKA 4EENA 2F3PA 4JB8A 3HI6A 1NW9B 5F7JA 2VOEA 1FVXA 3DVLA 3M34A 1Z0UA 5HUJA 1BAPA 2WW8A 4XJXA 2D5LA 4I8XA 1WMEA 1U3FA 4EFDA 4U8GA 4K87A 4KP7A 4BV9A 2XDQA 2UV8A 4PHCA 3D0OA 4WV3A 1TKCA 2X9NA 1TFUA 2NIPA 2NUPA 2F59A 2ZYSA 2DFPA 2G76A 3KSZO 1QDLB 4MZXA 4WZZA 1UKAA 3HYSA 4GOKA 4IV0A 4NENB 1FY2A 2D1YA 3U49A 4O33A 2OO5C 2PKQP 2FR8A 4DARA 3ME5A 4LYEA 4KQIA 3TM4A 2DMRA 2JZCA 2WUFA 4K2HA 2LIVA 2QN2A 3AUFA 3I37X 4DPLA 2BR5A 3HR7A 2TSYB 3KJFA 4ES6A 1FNDA 2N46A 4JOBA 3C3MA 5EKUA 4RFVA 3QFFA 621PA 3NYWA 1NQUA 1STOA 1X1QA 2AI3A 2HU7A 2J30A 5AHRA 5EWJA 3VR6D 2WP0A 1QDEA 5AVTA 5AK4A 2BH9A 4YLYA 1UQRA 3ZHBA 5C35A 3HB7A 4QYIB 4WZ6A 4RIIA 3NALA 2ZUTA 5CJ2A 4G9BA 1AQUA 3K6SA 1SXQA 3CX8A 4BJHB 2GPSA 5FXMA 1JH9A 1Q91A 2LV8A 5C0OE 5T5QA 2H4HA 3RBAA 4OYHA 3KTAB 3THXA 3LI2A 2B5VA 3K35A 3WWZA 1Z29A 2VJCA 3C0KA 5EKTA 4QNRA 1T3HA 3C8ZA 5J5CA 4YQYA 2DFVA 4DDMA 2MR5A 2XZTA 5JNUA 2W22A 5B58C 2Y1LA 2MSWA 4OJTA 3FKSD 2NO6A 1X8KA 3AONB 5AK0A 3MAJA 4Z0NA 4B6EA 4FSDA 5JO0A 2Z56A 3E9EA 4CR6A 1FC0A 1QG6A 3EHDA 4Q9DA 4JT2A 1W36C 2G3YA 4GI2A 1XR3A 3TNLA 3UFXB 1KQNA 4LF6B 4ER6A 4JY7A 1M6NA 3X43A 4DLZA 1F2TB 1NI5A 2JGAA 4AY6A 1QVRA 5TE9A 3FYDA 4ZXPA 4TQUS 3VU3A 3WQBA 1BXGA 2FQWA 5BNWA 5IKPA 1D0IA 1WE2A 3ZUPA 4OLAA 4IZ6A 5IHPA 1I7DA 3PUWA 5ALQA 1UZLA 2R1VA 1CG6A 4D4JA 1V35A 2IP4A 4X6LA 1NUSA 4DYVA 2CNWD 1BROA 1FCJA 1JMKC 1VLQA 4ARUA 3V7NA 1PGNA 2PGIA 3T3EA 3U6BA 2EX4A 4EVRA 4LC1A 1P2BA 2VHZA 4Y1RB 5KINB 2JFXA 2ZSIA 2MSNA 3CC8A 3ZWCA 2CK3A 4GXQA 1O94D 4CFYA 1EINA 4AS2A 1V3VA 1DKPA 2ZBPA 5FBKA 1Y80A 2X8BA 1C8LA 4F96A 3GUYA 3O7WA 4IOJA 3B3GA 2DAPA 2C1XA 2YY5A 1B14A 1GKUB 2NVUB 2F55A 3BH6A 4ITUA 4WNAB 3T9FA 4PICA 3EPPA 2PX4A 1JYFA 4QPPA 4F9TA 5J4KA 2HLPA 5FWYB 4B33A 3WQQA 1A5ZA 1XZJA 4BHTA 1NXPA 2QAJA 4DA8A 1JHAA 2GTPA 1KIFA 1PDWA 2G9ZA 3M3PA 2YIVX 3PC6A 4MV5A 4P3OA 2HBYA 2VC2B 4I55A 3K94A 4YAGA 5H9WA 2H1WA 1PHPA 3P8ZA 5JBQA 3WL7A 1NAIA 4QGGA 3DKKA 4BTVA 1YWGO 1SEVA 4YFVA 3GIWA 4C0QC 4MKZA 1NVDA 2Z5VA 4H31A 1GU0A 4D57A 3THWA 2C4MA 2OSVA 2OWEA 1P45A 1KDOA 2GD6A 3GGPA 3KUKA 4ZYUA 4N12A 4CL2A 2EIHA 3QENA 4NZ9A 1YBAA 2XDYA 1KYTA 3A4VA 4ND3A 3JZFA 3TEJA 2Y93A 4KW7A 4YB8A 2ZXFA 4C1NA 5IU6A 2ASVA 1P9WA 1CJUC 1ZHFA 4TMTA 5CNIA 5HRUA 4LGYA 1SVMA 1ZSVA 3E8SA 1M7GA 3WYNA 4ZCMA 2XDWA 4PYQA 3FRJA 3VSBA 3EIWA 3EGDA 4WJKB 4H1WA 2O5CA 1JLKA 4RMGA 3NWOA 3UTDA 2AN1A 4JJIA 1K9VF 4K9MA 3TLEA 3QPUA 5C4IA 5EE1A 4DADA 3KX2A 2RB5A 3Q6NA 5FO1A 4GL4A 5SICE 1D2GA 4FYKA 5TMEA 4LS3A 3PXEA 3TW0A 1QB7A 2H85A 2V9ZA 4OJKA 1E7YA 3LUJA 3PV0A 3KVNA 4BFYA 1EUQA 4UW9A 5JD4A 4D0SA 2JIZD 3SVZA 4M89A 2IFTA 1XALA 1HDZA 3DMTC 3OOSA 4G8CA 4GOMD 4RENA 3O8NA 4KXXA 1Q1AA 5A04A 3E3AA 2Y1OA 3EEBA 3KZNA 3JQ9A 1HV8A 2D5IA 1L5HA 3AUXA 3G2OA 3NBFA 4MUYA 4CM9D 1E3MA 2XMCA 1UAGA 1D2RA 2BMJA 4L27A 1T5OA 1BWQA 2GAAA 3K6JA 5HFNA 3SN6A 5HBRA 4WKGA 1VTKA 3ROTA 2DBYA 5KNDD 2UUCB 3W6UA 1T3GA 5BWOA 1SAYA 1AU9A 2R3SA 2Y1XA 2ISQA 4C29A 4KPEC 1QQBA 2O8CB 1UBKS 3EDCA 4RSMA 1VBMA 4WCVA 4IQ8A 5EQJB 3ZY3A 1VP3A 4YAFA 4L9AA 1RRMA 3MJCA 4MVJD 3TB6A 3JVEA 1B4DA 3BIWA 1GL7A 2OEPA 5AWFC 1RABA 2OHOA 5T57A 1DAIA 2MU1A 1JHYA 3C5WP 1P4HA 2R8XA 3G5UA 4NBKA 2PKWA 5AK5A 1RS0A 1YQDA 3R8XA 2ETXA 3KO8A 3LHIA 1VKRA 4LNUB 1F6WA 1V5EA 2ERXA 1VBFA 2P78A 1KZHA 4DMRA 4HTFA 4QUHA 3TL2A 4COKA 1MQ8B 2BOVA 1C4OA 2DSNA 3BD9A 1IY0A 4R9UC 5F5LA 5H80A 3EGVA 3T7TA 2F4NA 3VYTB 4OGKA 3SCZA 4KK3A 2YZKA 1P0CA 2C00A 1MJ5A 2HUNA 3UO8B 4TT3D 1T35A 2HC9A 1W8DA 1IN6A 1T8UA 2VF4X 3OUZA 5FYDA 3WGMA 4PW0A 3TLJA 3D64A 1G5RA 1TU3A 3U6KA 3PSHA 3ILYA 2CL0X 3D0KA 3DSRA 1BMFD 3WIOA 2WWYA 1EPUA 4FDLA 2XB2A 3AVTA 3DE7X 3TCKA 1V2HE 7GPBA 2MSLA 2J9GA 3LNCA 3GLIB 1QMGA 1CKEA 3AW9A 4U7GA 3W0LB 4E12A 4PC2A 3WGZA 3KSAC 4V38A 4OQLA 1EQAA 4YACA 5JDIA 4P54A 3L1JA 2MYNA 3EAQA 3AQ4A 4AXXA 3LT4A 3RLFA 2YXEA 4Q9AA 4A1OA 2MMGA 4RD2A 4J0FA 2HSZA 4KXQA 2QJRA 1MJNA 3AHCA 3E2IA 3PQ6A 1KY4A 4KODA 5DPMA 3QRWA 1Q1NA 3AIIA 3HSKA 5B4TA 4FBMA 2C5SA 4YGXB 4XYBA 5KWVA 3KJEA 5A0VA 1AB5A 4L73A 2DWUA 3GCWA 3UUEA 2YXNA 4DL9A 2KI5A 3UF0A 1ZQ1A 1OFUX 2WOOA 4F92B 1PYDA 1YZHA 3KPVA 5TF0A 3JQGB 3T15A 4LJRA 1YJ8A 4RD0A 4ZQBA 1C30A 3EZ9A 4UNNA 1HDIA 4YREA 4HOYA 1EUCB 3C3EA 5ALDA 2Q28A 3LXUX 3HB1A 1U8FO 4CLOB 3PQ4A 1S9HA 3VHXB 4CT5A 1H85A 3KT3A 3LUAA 1OT5A 3P0FA 4EPXA 2E5LB 4JBWA 3M5PA 5DBFA 1ZUNA 4K40A 5H0IA 3OZTA 2B8WA 3WMXA 3H5NA 2A30A 2V7EA 5ALMA 3WLAA 3EVDA 4B6OA 2CBGA 4C5BA 4JHXA 3OJWA 3I64A 1NYQA 1M2WA 1P4JA 2JB9A 5B6IA 2AGVA 2JIDA 4PC6A 3IUNA 2PBFA 4PYRA 5AW9A 4C4RA 3IR7A 1ID8A 3VKGA 3DBRA 4YP7A 3N8GA 1BWPA 3GN2A 3KOOA 4MINA 3ZX5A 1Z2CA 1YJAA 3DOFA 3KXLA 3D7MA 5B12A 5KVSA 1NBMD 3K2QA 4UU8A 1UBHS 4DM3A 4DXDA 1FZQA 1PR6A 2ZR8A 3CT6A 1DO8A 1N57A 4GQIA 1KRXA 3PF8A 4YRNA 1DKRA 3GJ6A 4P58A 4PEVA 1SKAA 5CT8A 4AECA 3BEDA 4RHEA 4XPZA 1JZQA 2AWNA 1D03A 4AYTA 2PEZA 3ZNOA 4DCVA 3REGA 3A9TA 1HE1C 5DEIA 1CZHA 4KFCA 3OQPA 1OYWA 1JPUA 2A0YA 4DR2B 4F97A 4PXAA 4KX3A 5TEWA 4C0KA 2IOFA 3V2HA 1IQPA 3ZQKA 1SC9A 2R48A 1X7GA 3A9VA 4A8JB 4ZYZA 1DC6A 1UM8A 1KAQA 4BZQA 1U8YA 4TLAA 2WJGA 4PHHA 4PLHA 5EP1A 2W6PA 3SM3A 4NBLA 2E4YA 3JQAD 3IMFA 2XQKA 3QLVC 4ZWNA 3K31A 3G9XA 3L7YA 2Q7XA 4I4LA 5T41A 4C88A 3FYHA 3DHYA 4GM1A 4OBEA 1FDIA 1TKAA 3GLHB 4MI9A 4PG7A 3T52A 2GTIA 2V3CC 4R9NA 4DSOA 1TQ8A 1WQ3A 1ZD3A 4XQGA 4W8HA 3UGJA 3OQ1A 3ZHVA 5ELXA 1UC5B 3PFNA 4NBTA 1M34E 2JANA 3OX2A 4QNMA 1B43A 5FBVB 2C2GA 4BN5A 4TMFA 1I1QB 4DGSA 3HM2A 2AZXA 1I1NA 4YJ3A 4KX5A 4AJEA 1E58A 1E2JA 1E1YA 3A3OA 3IAAA 4Q7MB 3FZQA 3H19A 3RSGA 1N0WA 4V1CB 1IOVA 1N5OX 1E32A 2OZVA 1O6CA 2YTZA 1KYVA 3DZ8A 3KQLA 1GLNA 4MKRA 1GTRA 3QX9A 4U2CA 4NCAA 4X93A 5F35A 2PUEA 1QNLA 2G80A 4WK6A 3I5YA 2VP9A 5E8RA 4BE4A 2DETA 3W77A 2I91A 1OH6A 4E5VA 2QGNA 1WBDA 3L8ZA 1UKYA 2J08A 1OT3A 4URHA 1QYCA 4G5RA 5BT9A 1ENZA 2RGUA 4MV3A 3TRIA 3QF4A 3CSSA 1XZBA 4JI8B 3G9TA 4MPTA 3CEAA 4E70A 3AJEA 1BJRE 2QD1A 4P83A 3HR4A 1SRRA 3Q3JB 4H3SA 4DCMA 4DS3A 1E0AA 1FQJA 5FFMA 1WPGA 3JD2A 4F11A 3WX0A 1HLDA 1N3LA 5AW6A 4UHCA 1KWGA 2XYHA 3B1VA 3BM5A 1EVEA 1FJHA 1CJTC 4LJAA 1H9CA 5TNXA 1TYCA 2AI1A 5GJVC 3DNFA 1FBTA 2IXAA 4IO1A 3STTA 4F5WA 2Q46A 1EP9A 3LDHA 4UTRA 5FI3A 2CLHB 4MJ3A 3WJ7A 4JEHA 4B87A 2QE6A 1I4EB 1YQXA 1GRVA 3N53A 2QZPA 2CJXA 4PYJA 4G5FA 5CFZA 1KO7A 4KR0A 4TV8F 1NM5C 1EA5A 3IERA 3BXOA 4KXFB 1OILA 2RHLA 3UATA 3THYA 1X7HA 1KHHA 1DS6A 2QLLA 4KR7A 1ZWKA 1D04A 2VPZA 3BMQB 1U2ZA 2ZEJA 1EGMB 2AFHE 5HMMA 2PK3A 4INJA 1JR6A 1OGIA 3NJRA 4O29A 3SMQA 3ZBQA 2YN4A 3AT1A 1JR3D 4BVEA 2CV2A 2VH1A 4D0RA 3QU2A 4P3NA 4WZAB 4CKEB 4ZK6A 1TZKA 3BE4A 3KUDA 4ISBA 4IWNA 3A2KA 2BONA 2JLCA 2G72A 2JIQA 2ONYA 3PYXA 1IZ0A 2TECE 4HJXA 4XWGA 2VP6A 3REQB 4UTXA 2XUGA 5EJFA 2EGGA 1ABBA 5AKEA 3HDVA 3IAM6 2C59A 3Q7RA 1XAIA 4K5QA 4LNUA 5J4HA 3CMMA 3WRXA 1N4AA 3FI9A 1I1OA 1QCZA 2WWFA 2OP1A 1YI1A 4ZDKA 3TZHA 4HWKA 2MDTA 1VBNA 3N05A 4D26A 1QF9A 2FEPA 4PYKA 3WSTA 4YUXA 4U00A 3GLFB 2SKCA 4Y6GB 4DNXA 2BGIA 1SHUX 2EFCB 2BBWA 2R5FA 1D7AA 2W2PA 3OEED 4LX0A 5FIUA 5ADHA 4QWMA 3N7TA 2WSBA 3PK0A 4YYEA 2LDXA 4DEYA 6REQA 4G85A 1BCSA 2ZSDA 4CCSA 1DWOA 1KQ3A 1ZIYA 1PFUA 1TDJA 1EFVB 2HI0A 3C3BA 2XMPA 4YRPA 2EW1A 1CVIA 2BTOA 3WOHA 4C0WA 4Z4EA 3G9QA 4EG3A 2NSLA 4EI2A 2FZ5A 1Z22A 4WJLA 4MDFA 1GT91 1XQ6A 1BJTA 3DBIA 3W8RA 4I4TA 2DERA 4RQUA 5AJTA 4A6XA 5F1OA 1JXQA 1XN1A 2F1OA 4DLUA 3Q8LA 2ZT7A 1E20A 3F78A 5BV7A 4X94A 2P90A 1W5EA 1X7YB 3QK7A 4YDQA 5C1OA 2WSSA 4J91A 2V4UA 4BCCA 4DFDA 5KWEA 1KEZA 4MRVA 3L7AA 5C1IA 2YWEA 4Q02A 4MTCA 3OCCA 1RQGA 2YNMC 4OATA 5KYWA 4YX9A 4DUZB 4MRAA 3IT0A 2FI1A 3LYUA 1YCGA 2M9MA 3GB9A 3C5VA 4GDFA 2QX7A 1I6LA 1L0BA 1XDSA 2HRZA 4WFIA 4PZCA 5AYVA 1FNSA 1I36A 3Q6MA 5K1ZA 4AB1A 2VJMA 4L6IA 1FXUA 1SB8A 2GCPA 1GG8A 3SDBA 5EP3A 3T3MB 1EUCA 3SMVA 4YQEA 4D98A 2FZEA 3QW2A 5AW0A 3K15A 1YNOA 3HLTA 4KIJA 1YQQA 3CCCA 1W85B 1T1GA 2DHQA 2V1UA 2I2DA 1IUPA 3RC7A 4QM6A 2RH8A 1G64A 2ZQZA 4TSRA 1QO7A 1ZONA 2F2TA 2KSQA 3IOEA 2O8VA 1Q74A 3NH9A 4NBUA 4ZARA 5H81A 5IZ4A 3K8ZA 4OHYA 4KREA 3ZV7A 1XHFA 3AJDA 3T4UA 2X77A 3Q98A 3A58B 3LDGA 3HA5A 3MGCA 2BFFB 1FEZA 3O03A 2HNAA 4HMOA 3I5XA 3IDZA 4D9JA 2DLDA 1ZAYA 2BGWA 4O2BA 1H2ZA 4CLEA 4CEHA 1T26A 5EHZA 1Z6PA 1L5SA 1Z16A 2ZI4A 5JYCA 1RI3A 1TCAA 2P6OA 2XQGA 3EMBA 3NYIA 4DEXA 1M5RA 1XJCA 1QYVA 3OUTA 2HK9A 4BZWA 4BTEA 4YQZA 2X1VA 3AP3A 5JS8A 4R8KA 4FJ2A 1DADA 1OGYA 2ZYVX 3SC3A 5B57C 4ENPA 2QTNA 2GAJA 2O2JA 4URFA 3RJMA 1JVBA 2QD4A 5K51A 1EM6A 3UXHA 2R7KA 1HFEL 4FPXA 4OQNA 3UPTA 3P2MA 2HWYA 1O58A 5EQTA 5TSDA 2IDZA 4FSHA 5PNTA 1U0GA 4MSUA 5DNYB 1JIVA 4BVFA 4PYIA 1VGQA 1XAHA 3PVZA 3LAWA 4IINA 3MJSA 5CHEA 3HJNA 4BB6A 3LH5A 1XHLA 3UJBA 2ZIWB 3V4SA 4AZ3A 2JGRA 4PLTA 3GXOA 1FSZA 2JLSA 2IEZA 4PBTA 5TMBA 2NU9B 3B1JA 3GQBA 4BFUA 5CFMA 2LCIA 3C87A 4P53A 1EZ1A 4JGIA 4J1TC 5JEEA 3G49A 3WIUA 4CT4B 5G3ZA 1XRRA 4AF6A 3X1MA 4AG3A 3GPDG 4U4AA 1RQPA 3DAHA 1NUHA 3ESZA 4BWGA 4CKBA 2ZUBA 3U1VA 3VHRA 1UOQA 5KIAA 4OP3A 1KZGB 4RJIA 1FU8A 1F2UB 2QMUA 3TBFA 4QU8A 4D9MA 3GIDA 5KTRA 4YECA 3JQBC 1ATIA 3IVCA 3H3JA 5FF9A 2CZQA 3R0XA 5BUZA 3ASVA 2Z0MA 2H08A 2P91A 3B3QA 2I62A 3CJRA 4N9WA 3RDPA 3IKVA 2AYXA 3E9RA 3IRUA 3SLRA 4DRYA 1OY1A 2AJLI 2FWJA 5HIMA 3DOJA 2HIMA 3HFJA 4YBZA 1WV0A 1W9HA 4GU5A 4J90A 1MV5A 2A6PA 2CJPA 2O6HA 3FFBA 1Z6QA 2W6JD 4FYHA 3RVLA 2B7CA 2XRFA 2Z43A 2IPXA 4MWGA 4BAGA 4IDOA 3RBVA 2N75A 1WWKA 1F0YA 4BWYA 4TUYF 2ZYWX 3K9QO 4C21A 1F0KA 4OSOA 4GKVA 1B26A 1TMYA 1I14A 1U2GA 2QQEA 5ILGA 1GZHB 1XP8A 2J45A 3AHDA 4PO9A 2VRBA 3QKRA 1M6EX 1YDGA 1ITZA 2Q3HA 2VNIA 3DEZA 1D4ZA 1N0VC 2W2QA 3EC2A 2BMWA 3QQPA 3DE6X 4ENSA 4EF5A 3LD9A 1G8PA 4KACA 1P44A 4G1MB 3TRDA 3DKPA 5KOHB 3KS9A 2CVPA 3HVHA 3NTOA 3P9QA 5A6SA 2J9YB 2VP3A 2WJWA 3HBLA 5JQWA 4RD1A 3QF7A 5H3CA 2OB1A 3GVXA 1AGPA 4M3NA 5JJKA 2QRVA 1DQSA 3E3MA 3PEYA 1CR6A 2POCA 3TZQA 2DXIA 2CXNA 3T5CA 2A9FA 3E81A 1HNZB 3O26A 1UWVA 5F9HA 3GLRA 5C32A 1XU9A 4D8WA 3LBYA 5D7BA 3SF8B 1E1CB 1QF7A 1W93A 3GJ8A 1R0XA 2I6SA 1N3YA 4I5IA 4ENRA 5LQDA 1E2KA 4AZ0A 1G9SA 1RLIA 4IXWA 2HU8A 4BNWA 4DR1B 1YOVB 5TVKA 3KWFA 3IQGX 3DC7A 4UCQA 1U2QA 5CXQA 4CQMB 3UWPA 1R4AA 3A7EA 5ITZB 2MSCB 1RWNA 3BSFA 2FX5A 2LWIA 1C3XA 3Q7SA 3WNBA 5B1IA 1EVJA 1FTSA 2VF2A 2I22A 3CX6A 4OOFA 5BNZA 2W2KB 4U63A 1SHKA 2O7QA 1SVWA 2R6AA 4HN4B 4I1UA 2RAVA 4P7JA 3DNPA 5LA6B 3VGJA 1WXFA 3FW1A 2CHQA 3P2OA 4GC9A 4P1ZA 2J5KA 3JRWA 4O1MA 3RSLA 3H3XA 2W2LD 1J1IA 1VI5A 2EKZA 1RHJA 3UAOA 3BJIC 2ZB2A 2XT9A 2FGJA 4KLAA 5ILQA 4ZZIA 3I9OA 5IJ0B 1C7IA 1XNJA 1B93A 1OKKA 2W2TA 3L0SA 1YKSA 4QYWA 5ALRA 2OCDA 3B6JA 3KTOA 2JVIA 1Q5PA 1T8SA 2H00A 1JR4A 2IUFA 2Q3MA 2YHSA 1UQTA 2GYYA 2ZDHA 4LDJA 1KSJA 1F4VA 1H2YA 1RWXA 2YFKA 1EUDA 4P3XA 3PDWA 2FMHA 3PNLA 2PA0A 3QVKA 4O2BF 3BMCB 2PUFA 4EGCB 4IDAA 3CTMA 2G8LA 2WIKA 5JD6A 4V3BA 4BGEA 4EGQA 3IIMA 2CDRA 2ZI7A 2CXOA 1BD4A 1JI3A 1O2DA 2WJIA 1YR2A 3MK31 4M7OA 5DTMA 1VL8A 5T4FA 5LMUB 1E69A 2ZAGA 1M6YA 3ZXSA 2NPFA 5JSHA 1KQFA 1RBMA 1ZKMA 3CA8A 3QV2A 4RGVA 1JU4A 4KO1S 4LV5B 1EX9A 2X5JO 4UMFA 5G53C 1G1AA 2G4CA 2Y1WA 1A9YA 1XTRA 3ETEA 1U0JA 2OO5A 2QA5A 1OKKD 3NX4A 2IYEA 5KUTA 3R9XB 3L6RA 3BB3A 2AX3A 2XE6A 1CUVA 3DVAA 3UYLA 1WCWA 1U6IA 1X77A 3HWSA 3NQ41 4OYRA 2HJGA 2VXYA 2ZIXA 3I9V6 4TMVA 4WCFC 2F48A 4UVGA 3WK9A 3L4EA 4WOCA 5LKRA 5GONB 1QC5A 3CUTA 2CMHA 5KYUA 2E4AA 3OIGA 1VP9A 4XM0A 4ZOBA 4RLHA 1WZ2A 3V4FA 2CVHA 1T4GA 3HABA 2DT5A 2QL6A 4J4TA 1VMAA 2FF5A 4GBMA 4LRXA 3I23A 4PZYA 1U9JA 1V16B 4LJYA 1A4RA 4A8JC 1A5SB 1J97A 1PYGA 3IX7A 3MCVA 5BR7A 3CVVA 2EDCA 1JDBB 3R0QA 3LY8A 3OICA 1M7BA 5AXBA 3ZJVA 1HT1E 3A9UA 4TV8B 3HCWA 1E66A 3OHMA 1JILA 2W6OA 5ESXA 2ERYA 3BD8A 4YRQA 2LNDA 3F5FA 2RHMA 3E1GA 5CB8A 3OPXA 2O8FA 3GC6A 2YOHA 3B20A 2PLNA 3EVZA 3PNVA 4KQ9A 4XWTA 4WBSA 1G4UR 5JSKA 1DEKA 4YRMA 4UMEA 1E4OA 3WWPA 2UDPA 2GYWA 1Z5WA 3TSOA 2B2CA 3RD5A 3IV6A 3ABZA 4I7EA 3QMMA 2EC5A 3Q7TA 4JYMA 3WFZA 3G79A 2I54A 2WPNA 4PNEA 2VBIA 4YJHA 3ZE8A 4CFSA 4L8YA 4RFSA 1DB3A 4EKEA 5IUNC 2HWUA 2GS9A 4G0XA 1DBSA 1BOFA 1KPHA 4BV3A 5IULC 4HNAA 3BXGA 4KLRA 2ZGVA 3AYXB 3LKVA 3N8NA 1VSBA 1X19A 3QTBA 4HT3B 4XIYA 2J87A 3EBOA 1H8ED 3WLMA 2AD5A 3VC2A 5AI9A 1SU7A 4CGYA 3ZWMA 2V45A 3HKDA 1DIHA 3I0NA 3G6KA 1IY2A 4WNYA 4LYHA 3E9QA 3F90A 1DBRA 1IB0A 1MVLA 3RE1A 3ND5A 1VDMA 2BHTA 5JCZA 3RVPA 3ECCA 4KQMA 2RGNA 1KVQA 1UM9B 3DMYA 1CUWA 2X5KO 3GAAA 1TYBE 2HUPA 4O08A 1XMVA 1ZMTA 3DL2A 1I2ZA 5H83A 1UZMA 4TMYA 2BTEA 3P96A 1DLIA 3FUCA 3OIUA 2F64A 1E6WA 4FBLA 2OCBA 1JLLA 1S7GA 1JQ3A 2EWWA 4FR5A 4J94A 3BSWA 2DM6A 2ZROA 3D4PA 3FVQA 3PA6A 3PXGA 4EMBA 4AICA 5A5DA 4KV7A 1FOEB 1OTYA 4OY3A 1JHMA 1OYYA 1U7OA 1GZDA 1R9GA 1TOAA 1XTZA 1UXHA 3I2GA 4ID3A 4XW2A 3SFTA 1WB9A 2FPUA 4PG4A 1O6FA 4RZ2A 3UFBA 4EX6A 5I51A 1DAEA 1RRPA 5A9SA 5CDFA 2VJLA 1ULZA 3BB1A 2CCGA 2JLUA 3H9GA 1ZOOA 4M21A 4EECA 1US8A 4X8OA 3ZWPA 3D1VA 3WL4A 1EDDA 4FE4A 4NONA 1K3FA 3G89A 2NZVG 3TJZA 4R1NA 1Z15A 1OR8A 2Q3JA 2I5PO 4GPIB 5EUCA 2ABWA 2QSJA 4CUZA 4G0YA 1UPAA 4NU6A 3AJAA 1ADBA 1W8IA 5C34B 2VUTA 4ON9A 5H82A 3U9TA 4FYIA 4ALLA 3U61B 4Z2YA 3O8LA 1P1JA 2WSLA 4RKWA 1B8OA 1QGED 4CMIA 1NVEA 1Q7EA 4HH1A 3NYRA 4O5AA 1YFZA 5K3AA 4IDGA 1N2BA 1N3IA 5JCJA 4KFSA 1F6BA 1MEOA 1C9MA 1IY1A 5JT1A 4DREA 4LISA 2CSXA 3M82A 1WA5A 5FBHA 3NM4A 1N2CA 4KMRA 1UKZA 3G1WA 3IQEA 2NZYA 1DMSA 3DJFA 4OIFA 3NW9A 5F2NA 3SU8A 4YJ3F 3AM5A 4OBBA 3ZS9A 5CEJA 3M6IA 2C42A 2NUPB 3WMWA 1Z75A 4YVFA 3BRCA 1ELOA 3RYTC 3EW7A 3RRBA 5C5IA 5LOVB 1PR1A 1Q1EA 2D8AA 2ETVA 3E4CA 5DT9A 4D2IA 3L7CA 4DR6B 2I9KA 2I4MA 3RUIA 2JBHA 1G5HA 1A5BB 1PDVA 3S8MA 2O2XA 3P9ZA 2QMYA 4DBVO 1T5BA 3T1YB 4G25A 5HX7A 4QVIA 1PZNA 3KT8A 3KHKA 2PZKA 5CDSA 1UDAA 3CLSC 4FGJA 4MLPA 1TYDE 3DYIA 2RG7A 4Q05A 1GSHA 3MWLA 5AW5A 4Q6BA 4C0SA 4DR7B 2WC1A 5KJ1A 4IIEA 2H9YA 1EXWA 1L8AA 3PUKA 3WLRA 2GO1A 2K2WA 3DZHA 3DUFB 3LP6A 5DXFA 1UDBA 1PLKA 5JE8A 4IICA 3I3OA 5AUOB 1PX2A 3OZAA 3ANTA 2H1LA 2WDPA 4J29A 4PZLA 5BO5A 3HKCA 1X14A 2ID9A 3COJA 5FLKA 2VYVA 2YWRA 4EW6A 1VI6A 4IIYA 3CT4A 3KLPX 3WA6A 5FWAA 3L7DA 3ONEA 3NU1A 4DCSA 4EO4A 1MF7A 4LWQA 3T3HA 1XKLA 4CN8A 5B4UA 3CSUA 2JFYA 4I5DA 4P4LA 1P19A 4NC9A 1D3AA 1UR5A 2B6NA 2WFLB 3IQDB 1U11A 1YE5A 4A0SA 2BSXA 2P1DA 1RLTA 1GUFA 1TVEA 1X8XA 3B6KA 4GR4A 1P72A 1T3SA 1OHHA 1Z0KA 5B3AA 1LNSA 2CFOA 3O3NB 4WY2A 2FG5A 4PHFA 3EDOA 1YCDA 4M98A 1CR4A 2WIFA 1BDHA 1QV6A 2I78A 3KVVA 2I9PA 5JEDA 5L6MB 1O95C 1XVUA 3NHYA 4UDXX 4ZMSA 2E0IA 4KYVA 4OJQA 1RMTA 1KSHA 4TLMB 5KHAA 5K0NA 1TCUA 1U7PA 2R1VB 3ZHQA 1ZGJA 2AN9A 2XV1A 3L5KA 1FMFA 3S5UA 4L9SA 3T5BA 5BRJA 4YRRA 3K09C 1WUYA 3LBAA 1KO4A 1OAOC 3PHGA 2A9RA 4I4CA 1R0ZA 4RU1A 4A8TA 1RXWA 3N2NA 1EGHA 4AZVA 3A05A 1N8SA 1O8BA 2NSJA 2Q4RA 1A9OA 4NFLA 5JSZB 2BE9A 4ZI5A 3EBPA 1PWXA 1ODFA 1U99A 3LC2O 4AUKA 4HDQB 3TI7A 4RANA 1UBJS 1C8KA 1L8XA 1Z7WA 1IJKA 3A4YA 2EJVA 2Q4EA 1QU2A 3W5AA 5JRJA 1GITA 1KAGA 1YB7A 2EWMA 4CKWB 4C2AA 3LBHA 1CR2A 2D54A 1K97A 3CR7A 5DIZA 3L7LA 1TW3A 4E13A 1FJXA 2FSFA 3H75A 4IOLA 4QQRA 1A69A 1RKVA 2JKZA 4LWPA 4RACA 4RWEA 4ZRDA 3F5MA 5AVQA 1CYEA 1M1YA 1Z8FA 2WWIA 2OUKA 4RZXA 4CF6A 4UVIA 3TD2A 2ZP1A 1PR0A 1P33A 3HH8A 4E3ZA 3MWEB 2DR3A 1AXRA 3E05A 3F6CA 4M37A 5TJHA 4PU0A 3ILSA 2YYYA 4G8DA 5KI6A 3K16A 2R7MA 2XWJI 7REQB 3U16A 1JEEA 3LLUA 4W5HA 4HKTA 1RRFA 1YH3A 3GLTA 1FNMA 4PS0A 4TL7A 1W36D 2E7ZA 2Q41A 3PI6A 1Q1QA 3C1TA 3VZPA 4DUGD 1Q7RA 4CMBA 3WA7A 3WMGA 4BWFB 3E03A 5K4HA 3ZCQA 2B5WA 3SBOA 4UQPA 1M75A 3GVIA 4RSRA 3NKLA 1TM3E 4H08A 1N6LA 2HN9A 3ZGXA 3K2EA 1P0PA 1KC3A 3FA2A 3SSMA 1XTVA 2A9QA 1RXSA 4AX8A 3VOBA 2J48A 4P4TA 4CMHA 1DXYA 1JI0A 2QZZA 3MTAA 3QWBA 4GWKA 2Q45A 3TL3A 3V80A 1PNOA 2JEYA 2QB5A 4K0KB 3GD7A 2AOXA 1EFTA 3IJ5A 1ESDA 4DQKA 5H3HA 4MJLA 4WLFA 1A27A 3ROFA 1NUAA 2GR9A 2PRSA 4Q5IA 2Q5EA 2DOKA 3RFTA 4B6FA 2Y66A 4BNGA 3SE7A 4A82A 2Z3ZA 3AB8A 4M60A 3R3UA 4MUHA 4PTLA 4H7JA 2XMDA 4KWIA 4MCIA 5FV4A 1Z0FA 3OZGA 2IP2A 1UK9A 2VNKA 4UUPA 1EX7A 2I2XB 3DDSA 3VR4D 4YRKA 3I9MA 4DHEA 2CLSA 2I6FA 4JBIA 3NANA 4JASB 1Q3KA 5DLEA 2QUHA 3ZDYB 4EA7A 2DCUA 1NC3A 3CUEF 4NOJA 1ZWLA 3QEJA 1JQAA 1TPYA 3AHJA 4LZJA 3UT5A 3QEKA 4EGAA 5IF3A 2DEUA 5CYFA 1L3BA 4CKEA 3QVTA 4Y18A 1R27A 5HKAA 4K26A 4M9UA 4MS4B 3NHFA 4RAOA 4DA0A 2AR0A 4MUIA 4R2XA 2XB4A 4L3OA 1JBKA 2MSKA 2QV7A 2ZW9A 4EATA 3KZCA 4LJLA 3MINA 1MVOA 3U3KA 2M2IA 1W2HA 1Y3BE 4YMWA 4C3UA 3CBQA 3BCHA 2Z6VA 1E18A 1CU1A 1ZEMA 5FORA 4B9EA 1Y63A 3VKVA 2FJUA 2GK3A 4ZVRA 2BYTA 2R6JA 4C20A 4CNQA 2XPCA 4KJZA 3ICQB 2P4HX 2NP7A 2NSDA 2IC5A 2OWDA 5FWNA 5CA0A 2ZSAA 4B6RA 5AO9A 5CB4F 1LTHR 1RRGA 3LX5A 2Z6QA 4Z4IA 3LCJA 3G2KA 4Z1OA 3E7PA 4IP0A 4B80A 1R66A 2ZRQA 2HCBA 4OQQA 1VIMA 1GNLA 1VKHA 2J9ZB 2XOXA 3W3AA 1DJPA 1QRRA 2H9AA 3GD5A 2VK2A 2FUCA 3LKBA 1LH0A 1PUXA 5FTLA 5AKGA 3RVDA 5JALA 4JZKA 4OFWA 1J2YA 2ZRIA 4R71A 1J5EB 4BIIA 1DSSG 1D8TA 1U8TA 2Q5OA 2H3HA 5LXTA 1Y4DE 3W6ZA 1B0UA 3LV8A 1JALA 4UUBA 5F73A 4LWOA 1MOQA 4JC0A 2FRDC 2VVTA 3UJ3X 2NXCA 1VPVA 1PI3A 2KLHA 1GXSB 5JPDA 5J2TF 1Q92A 2V5UA 1KMHB 1AG9A 1RWQA 4XFDA 1MRSA 2P9TA 5B1DA 1R0CA 4FYVA 4EVSA 3BGIA 1HNXB 3ZYCA 1D1TA 1H6CA 2KPOA 2PZAA 2XD9A 1FFWA 2H8GA 2A4KA 3AHEA 4L0MA 4LBWA 4F6RB 2G1UA 1P7ZA 1GCUA 2ZJ0A 3DT6A 3KAJA 5CVJA 4V02A 5FWYA 2AW5A 1I4LD 1J8YF 3EVTA 1E6MA 2XMGA 1G41A 1O97D 2EATA 1N5DA 4HS9A 1E59A 5F2OA 1C8VB 1TIKA 3WZ2A 2V7GA 5LLDA 3DB1A 1RKXA 1FDUA 1ZD9A 3KHUA 1IXZA 4MKFA 4TUYA 1DELA 1XEXB 2Y0EA 2PUJA 4L4YA 5FNVA 4EHLA 1JL3A 5KTYA 2IH5A 2X58A 3ELWA 2ZSKA 4LJSA 4NBNA 4PZUA 2CDNA 5A03A 3ROPA 2ZJ7A 4IJWA 2ZJ8A 2BZ1A 2L17A 1R9MA 1QKJA 1SRQA 2RBKA 3L49A 1NOJA 4CTOA 4GRDA 4N3NA 4IXMA 1F06A 1F48A 1VJ0A 5E7MA 1XXHB 3E2MA 4LBVA 4XLZA 4EEKA 1QK4A 1FQOA 1S4MA 2YJNA 3O4JA 4ARZA 5DLYA 4U7FA 3I39X 5LLSA 1M7HA 5EIHA 4DM7A 3TW6A 4QREA 2GFIA 4RC9A 1HR0B 2I2BA 4UNSA 3ZY4A 2GAIA 2JAOA 4NOKA 3O8OB 4RSHA 4HAUA 3CWCA 5CITA 2GD0A 1HT2E 2N1MA 1NF9A 5K0BA 3CRNA 3N07A 1K7SN 2KS6A 1MX5A 3QFCA 1KBQA 3HCFA 3RUCA 2XUIA 3HBAA 3PC3A 5JJLA 4HMPA 1H94A 1Q7GA 3PNKA 4ZAVA 4Z3DA 5FOTA 1CUYA 3EFOB 4ZO6A 3W2HA 1W4ZA 4C43A 2PX5A 1JF8A 4V0ME 3SR3A 3M9XA 4UEOA 1BE8A 3RNOA 3SJCA 3GGCA 4AL4A 4PGHA 2FUG6 3L1KA 2Z2YA 4R2JA 3GR6A 3PEEA 4RADA 4EP1A 4N0DA 4AMYA 3ILXA 4OA8A 4ZVPA 2ZJAA 1E9EA 3I2YX 3O9VA 3SXUA 4QRIA 3T0FA 1JPNA 3NOOA 1U6JA 3K20A 4QARA 2YXPX 5EQDA 3G8CA 3NR2A 5JHHB 1YDMA 1GL6A 3K1AB 3A9RA 3JRXA 3P20A 4TWAA 1E1KA 1FYVA 2SECE 2VNSA 1K88A 3AL3A 5EP4A 1PSWA 5EG5A 2PZ8A 1Z8DA 2QUJA 4UNIA 5EMNA 5AM2A 3W2TA 2QMQA 1T5SA 4YRZA 2PE5A 3ZVKA 5EJMA 4URUR 2JCYA 3CZ4A 3GAFA 1FU4A 1PFGA 1IZ8A 1HETA 3TFQA 3NM6B 3K72B 3HCNA 1YQEA 3HDQA 3JYHA 5LWQA 1TMKA 4WKBA 4ZHSA 5LB2A 4KIGA 3Q3CA 5EE5B 2XXBA 5I7AA 5CIYA 1AKWA 2V6MA 3C1UA 4GKJB 1CV2A 4H7FA 1ODTC 5FCDA 1JG4A 4Y0NA 1FPQA 2PZGA 2VDOB 2VPQA 3HXMA 4U39A 3EA5A 5GOTA 2JGIA 4F8YA 3QYPA 4YRTA 3OY7A 4JN6B 5BWCA 2YMLA 2YHIA 1QRSA 2H18A 3MWEA 3OUUA 1SKQA 3UJHA 4CM9A 1AK1A 1Y8RB 2DQ4A 1FLNA 1O97C 1ORIA 3TR0A 1QORA 1XQ1A 3KEFA 3HNRA 4OXYA 1BHSA 4DLSA 3KG2A 3PTLA 2JIZA 3RIMA 1GPWB 4UBKA 4LQ4A 4MV1A 4OI1A 4EEXA 1Q16A 5E9QA 1F4LA 5AVOA 1NKSA 3QEMA 1Q6YA 2Z5LA 1EWVA 4MW9A 3ZU2A 5KNCA 3LQFA 2DPGA 3HJAA 5TLSA 1HGXA 3S2YA 4Y6PA 5AJYA 4RJKA 3AXSA 5KDDA 1YACA 4MUKA 1DX6A 1EVKA 3OA0A 4B4UA 2OYCA 4FB4A 1YIOA 3D7NA 5CLIA 2XGOA 1WVIA 1RP7A 3AFNA 3E22B 1JKMA 4HRAA 2F8SA 2OBMA 2WTEA 3I32A 2ACKA 2AJDA 3ZTWA 1JG7A 5CPFA 5TX7A 2D0OB 1NJSA 1QYRA 4K3VA 2DTXA 3QKUA 3VR2A 1NVVR 4KDEA 2VHYA 1QWOA 4D80A 4P93A 4H6VA 3P4YA 2DUMA 1GZ4A 3GFOA 2X15A 5ISMA 1A2OA 3DWEX 2LTAA 2OXEA 2V7PA 1WMDA 1OROA 5K3FA 2C1EA 4IJKA 4MVJP 4FQ8A 2FN4A 4QGBA 3BMQA 3M4NA 2IYZA 4ZPXA 5BNFA 1JDPA 3TOVA 5CAEA 5BQ5A 3BEOA 1NGSA 4N0PA 5LN1A 1QIHA 4RXTA 3RRFA 3BDVA 3K9NA 1JHPA 1OFVA 2KWIA 5ALGA 3S1AB 1OAOA 1Y42X 2B9EA 2DT8A 1R9JA 4I08A 1Z4QA 2WUEA 1Y5RA 1PN3A 1E2BA 5CCBA 4AG5A 1FFCA 1OGJA 2FPPA 1XA3A 1Y8CA 2B36A 2FPRA 3JATA 3IAM1 5K0JA 5A3RA 5KPJA 2VUUA 3OWXA 2F1JA 3FDIA 1KMMA 1KYWA 3KKPA 3LVRE 4EW3A 1QP7A 1KK3A 4BBJA 3OQIB 2VBGA 3QLUA 2C3PA 1G59A 3VMFA 3C8DA 4L2IB 4CMJA 3W9UA 4EF4A 4PZAA 4FK8A 4NV3A 1V7CA 1YUBA 1LW7A 4JJAA 2ERCA 2VXOA 3GL9A 4BEWA 3B53X 4PGAA 3VNBA 1H23A 4RBNA 5JVDF 3DL7A 3L05A 4W4TA 5FR2A 3TE7A 2VNAA 1N8TA 3UKJA 1E3QA 1DBWA 1IN5A 5ERYA 1V1RB 1XEAA 2ZJ4A 3ZTYA 2VK8A 3MYYA 4K9RA 3R44A 2JFUA 1L5RA 2AB0A 1ZJWA 1L6IA 1USUA 5F5XA 2ZU6A 4NU5A 2DULA 1QVAA 1NR5A 3DO5A 4V3CA 1J0EA 2GHQA 3R9XA 3OECA 2I8CA 1OXMA 4ARSA 4QULA 4BGUA 4DMUB 4NMWA 1YRBA 4LE2A 5AD1A 1WV1A 3B5EA 3KKQA 4BNKA 5CCXA 2H48A 4CCYB 4BAUA 4F6RA 1LEHA 4DQUA 5LNK1 4ZMRA 5HPYB 1GNSA 3FKSA 4Z8YA 2PZMA 2OGWA 3AL2A 4X6UA 4XVUA 4AJ1A 2DBQA 4PQYA 4TMZA 1RWWA 3B51X 4W99A 1CVRA 3VV2A 3NEYA 3AZPA 3S44A 3ZV3A 2EP7A 4R69A 5B6PA 5KMGA 1IZ9A 5T8KA 2Q3DA 1KAHA 4G6ZA 1P5JA 3DE4X 1JFTA 2WE7A 4OQPA 3U7IA 2KLBA 4RZIA 1SQ5A 2R6FA 3WLHA 4BPRA 3C3YA 2G70A 1OD6A 5EHQA 2NQ8A 4WWHA 3EWAA 1YJ5A 4ALNA 2Z8YA 1RMQA 1YHZA 2YRFA 3NBAA 4ENUA 2IZ5A 2XT0A 1Z18A 4TRJA 3VR6A 3WLSA 2NACA 3ZJTA 4OHUA 3FVRA 4OX9B 2C3UA 2XUKA 3AKDA 3FCSB 3QXSA 3ZV5A 4KB5A 4Y2XA 1W4LA 1D1PA 3LDFA 4BRSA 4CV0A 1KKLA 3EXFB 3GARA 1DAGA 3EOAI 3ESRA 3O1IC 4KQJA 4QBFA 3TEFA 3TW4A 2EP8A 1Z07A 4MI3A 2RGYA 2PGLA 1DU4A 2NXJA 2ZCVA 1U81A 3QGMA 5E8JA 4CBVA 5FA5A 1WXEA 1DKQA 4RF2A 1V11A 1PGJA 1E92A 2KB0A 4BNZA 2AEMA 1T3ZA 3D8UA 2HX1A 5F1PA 4DR5B 1JU3A 5IUKC 2DQSA 5GWXA 3ZIAA 4NDNE 4CIBA 2ZM6B 4HBZA 4U6SA 1KDTA 3E5MA 3G8BA 3EFOA 4ZU1X 2C61A 2G9RA 4UM5A 4IUCS 7AT1A 3V4RA 4B4DA 2VR1A 5COBA 2FZKA 3NIBA 1AS3A 4HAIA 1XCPA 4UPVA 5A0FA 5KEIA 4FDMA 1K2WA 5JBIA 3N2IA 1H9AA 2QIPA 3DWIA 3LZCA 3RB8A 5EQFA 3A1NA 4BX8A 2R00A 1AZTA 4B7AA 4JJGA 5FI0B 2ISSD 3N86A 3ZE0B 1OLSA 1TTPB 1NSYA 2QQ5A 3BGDA 5BQOA 3NMUF 1M83A 3PDHA 1HTWA 4Z7NB 2ONKA 4MRNA 1K2VN 4RKEA 1NX9A 2DHRA 4QFCA 1FFXA 5TQJA 4U9IS 1PZXA 4EYEA 3T3OA 1A8QA 1JQLB 5HP4A 4B3XA 4Q3KA 1N2SA 4C01A 4E5NA 4ZDJA 4GX0A 4J0JA 1C1XB 3D4IA 3WMRA 4UC0A 4N82A 4PRLA 1PJAA 3LP8A 1XZGA 4JB3A 4MW6A 1X87A 3UWKA 2WHEA 2BFEA 2E4VA 3L1VA 1AVTA 4DEVA 3IJRA 2QTCA 5D3QA 2Y4OA 4QO8A 5GGXA 2IPNA 4HGNA 3WMEA 1N5IA 2C20A 1OIVA 4WACA 1GQSA 1ORTA 4KR6A 1KP3A 1SM4A 2HMSA 2VDKB 4CXMA 1ES9A 4YHHB 1W6RA 2GJKA 4FGLA 4MQ4A 3QKWA 1GZ6A 1M2HA 3M3DA 3U0VA 2JGKA 4DWOA 4URWR 2PKRA 2AMJA 3V1TC 2D6FA 4C7OA 3WGKA 3O47A 1QX3A 3U5TA 4XYMA 1F8UA 1Y37A 1WVGA 3VXKA 3P0JA 3NT5A 4NHOA 4RCYA 4FMDB 2QTLA 2ZIFA 2B4YA 2BHLA 5CA1A 3H9UA 4OXRA 4HYYA 4LA4A 5IEBA 4ZT7A 1XXHE 2DECA 1LBSA 2I2AA 1T5TA 1J24A 1W34A 2R4UA 4P3PA 1E3SA 5ICFA 1I7SB 3HUEA 3R7NA 4EAQA 2EIXA 1R6VA 2H7YA 3ER6A 2VRCA 3JYLA 3L40A 3WKEA 1MQAA 5I7FA 1Q0TA 3VV3A 3KQWA 3KLNA 1T91A 4KPGA 5E1BA 3W5JA 4H17A 2GEFA 3RSOA 1HYEA 1TCBA 1PTKA 4N49A 1UANA 5FH9A 2PWPA 3HXQA 4L8GA 4F0JA 2ZJYA 1X80A 1SU8A 2NQ2C 1KXJA 2PA3A 1T9CA 5C1BA 2H4YA 4MUJA 3KYBA 1I3KA 3U1BA 4YUAA 1GDTA 1ZCZA 1RQ7A 2PXXA 4BATA 3T0GA 1R8JA 1NXQA 1YR1A 1RXUA 3BWCA 1OZHA 3L7KA 4PLVA 1W5FA 2HT6A 2ZWVA 4UULA 4BB9A 3DYVA 4FFDA 3WAJA 2C54A 4G37A 4S12A 4HQKA 1TQHA 1Z7YA 5ER6A 1OHHD 1TPZA 2BE7A 2HU2A 3BYZA 4ONEA 3SC4A 4O4HA 4F2PA 2HA6A 4Q4AA 4XUGB 4KL8S 3CH6A 4M22A 1EFCA 5ALYA 3TE6A 4EA6A 2FFAA 3NBYC 1USKA 5DFAA 4TKVA 4RHXA 2J5RA 3LUPA 4FCVA 1Z6GA 2R8PA 4NCHA 1BFUA 3UJ8A 4ZGBA 1W4AA 4TMKA 5B3KA 4UUNA 5HTKA 5FL3A 4YHBA 1WRBA 1IMJA 3QNWA 4C4YA 4Z7OB 3AUSA 5CLHA 3O21A 2C96A 2PH5A 5DW0A 1LZKA 1RD4A 4N39A 1PL6A 4S1OA 1P5HA 2EP5A 2I7TA 4KXMA 3NDIA 3V6MA 3GUZA 3V7WA 3X2SA 4BMPB 1LJ8A 2HHHB 2REQB 5EGNA 4QUBA 2CFCA 5JZMA 3I53A 4CQJA 1EM8B 4JYPA 3OD5A 5EIFA 5T6BA 2OV1A 5BSWA 1BQ3A 1MA3A 3CPJB 4KI7A 2PX0A 4H3KB 3KPYA 2O1EA 1C50A 3MJ4A 2GJSA 3D6MA 1XTPA 3ADCA 4PAWA 4EIWA 4JLKA 4Z9XA 4HAZA 3AFOA 4YROA 4MRMB 4E6EA 2JJYA 3A6KA 4U5QA 3ZC3A 3GVPA 3H8WA 1UC9A 2JFFA 3OQ6A 5IMBA 1KVTA 5BPHA 1KI6A 5KCZA 1GYQA 5K6AA 1T8WA 4H6WA 2BZ0A 1LLQA 3KQTA 4FC7A 1MENA 2NTVA 4G0ZA 3SHTA 3JPWA 4G5SA 4YPVA 3AVVA 1CHDA 2VKQA 4DKJA 3GUUA 2D2FA 4WZBA 1G16A 2IHTA 4I8DA 5DBEX 7MHTA 3A4LA 3QUTA 3W8EA 2IA5A 3GDOA 3SQXA 1CUFA 1FS5A 1XLTA 1NNEA 4YMLA 5IUJC 2GARA 4RH0A 4WLOA 4LV8B 1IBSA 2HHJA 3BDIA 2PO5A 3HGTA 1SXJA 4BJ6A 2EW2A 5IKMA 3GI1A 5FUBA 4TLCA 1P77A 3RABA 2WR8A 1L5HB 1NW4A 1NQOA 3IUMA 3PQ2A 4HYTA 1TJYA 4LYFA 3HV2A 1IWOA 3IT3A 1Y9DA 3D1LA 4ILKA 3I2IA 4YJFA 3UV3A 3AETB 4EY7A 2VPPA 2EKLA 2GVNA 1H66A 4GBJA 4HXGA 4OF4A 4X6XA 5LNK6 1ZVJA 1WP4A 2XA9A 5EXSA 4F12A 3MLBA 4IIGA 2BGKA 3PVCA 5B7QA 2G0TA 1NJFA 1SBTA 1BX1A 1NNI1 4OBXA 1T2FA 3W79A 1BS2A 3OT5A 3TZCA 1POXA 1TIPA 1KKUA 5BSEA 2IXEA 3AV0B 4U7HA 3SEFA 2JCVA 3R7SA 5GVSA 3C15C 5JY6A 2XVAA 2WHRA 4M8LA 2M1XA 3H8SA 3C43A 2WLTA 4R3WA 2X40A 3A06A 3PGXA 3VZCA 4BRWA 4F2HA 1FLVA 2J46A 3D8BA 1MAVA 1QQ6A 3JCZA 3NHKA 4QUJA 5DTJA 4K9PA 3M6UA 1NLYA 2TS1A 4JL5A 1GP2A 4YA6A 2QTBA 3ZIDA 1S3IA 3T7CA 1F20A 4CM5A 1DJLA 2VAVA 7REQA 5CDFE 1GR1A 4WN9B 3STWA 3INGA 1U4NA 1DDOA 3E8XA 3EMDA 3OVMA 3U7RA 1B3BA 2BKLA 3HFSA 3RHTA 4AMUA 4Z4GA 1P1RA 1YIDA 1H8HA 1X1BA 2ODTX 1JHVA 3IMGA 4HDSA 1TYEB 3BMNA 3IBSA 4PRKA 4QELA 1L5LA 4F60A 1G0OA 4YV2A 4DV0B 1NTOA 2RHBA 4GMXA 2NO7A 3AGPA 1M6VB 3PHLA 2PD4A 4KR9A 4A03A 4FD3A 3VH4A 2JH9A 4K9LA 1F8FA 1F8GA 2VHVA 3TKLA 2GFHA 3M49A 4JIMA 2IV3A 1HT3A 1JDVA 3H1BA 1KF0A 1YCFA 1GILA 5EKXA 3CTPA 4RCVA 1MORA 4C87A 2EX1A 3ZQJA 4RPHA 2OBFA 4D97A 2QG4A 1VKNA 5JS7A 3GJXC 3K71B 2R47A 4ZD6A 1B16A 2XLBA 3L7BA 2NYAA 3T7EA 3GP8A 1WEKA 2JAQA 5DHUA 5BN4A 2HA7A 2CVFA 4PLPA 5EKSA 3THSA 4Q4DA 1GPH1 2ATEA 3SLGA 3T95A 3OJ0A 1TNDA 4XSHA 5T4EA 3PWKA 4YXWA 4K6MA 5A2GA 4KSYA 1E1QD 2OHGA 4M49A 4AC9A 3OTGA 4EJ2A 2YL2A 2C4UA 1NFFA 3FWKA 1TRHA 2VG8A 2Y99A 3COSA 5DB4A 1N77A 4LSZA 3LZ6A 1J2EA 2QLMA 2EJTA 2WHYA 3R3JA 4Q9HA 4M9CA 4E14A 1DJQA 1NT4A 3EUFA 2C03A 3KOZA 4MS4A 1KJ8A 2GASA 3UT0A 1BVUA 4CKYA 2ZE7A 1P1FA 1U04A 5G1OA 3L2OB 2APJA 3A7DA 5EXTA 3C6KA 5K01A 4J9UE 4JCCA 1OBOA 3CH5A 4ND4A 2OG2A 3Q41A 2A3RA 1WXQA 4GRIA 2Q5QA 5AICA 4R83A 1E2FA 2RGBA 3A2NA 3BA1A 3MRVA 4ZPJA 1LXCA 1K5HA 4YP1A 4OHBA 3IUEA 3R3ZA 1QF6A 5G3YA 3VR2D 3AR9A 2RI0A 2PUAA 5IYZF 1AF4A 1VC2A 1K5DA 3IEUA 3KR0A 2WILA 1ANKA 3WK4A 2GZRA 5D5PA 3V8QA 2J85A 4C7BA 3RVBA 2BL4A 1II8A 5J2UA 1YASA 2XR1A 3KJIA 4Q7JB 4UHDA 4GRAA 3JARA 3Q5GA 4AWBA 4DTIA 1XCOA 4OYLA 4S1WA 2PWBA 4FOPA 4AN1A 4YCSA 4DQXA 5K8UA 2XJ4A 4ZZ3A 4UEWA 3ZHYA 4B7CA 2MCFA 4QOFA 3R7LA 5LXTB 4G56A 1ZGCA 4EA8A 2V0GA 4NABA 2WF7A 4D4GA 4HAOA 2K7FA 1GXSA 5JD3A 1LFAA 1ZK0A 4K1LA 3RG2A 5A9RA 5L7WA 3UJDA 4OM8A 5L95A 1WB5A 2Q2QA 4PAOA 4QHTA 1UWCA 3BMXA 4KKVA 2QJFA 2GRAA 4FFWA 1E9BA 3HP7A 1Z7EA 4EM6A 4E4RA 1Y81A 5CU7A 3RVOA 1NBHA 3FLEA 5CM8B 2XZLA 2IIVA 4D9CA 3R09A 2H7CA 4HSGA 1LWOA 3HG7A 2VHXA 3T9CA 3FTQA 4XGIA 1ISPA 3E9YA 3K5HA 2BSAA 3P9KA 4M99A 5BSMA 3ZU3A 2ZUFA 3UBTA 3O73A 3J81A 2XUPA 3D3WA 4BFLA 3HXPA 3LOPA 3IP6A 3ESBA 4G5HA 1HFKA 1UC8A 3AF6A 5EJ9A 2O1WA 2P9ZA 4IFTA 1PZGA 2W4MA 1PSDA 3MIIA 2H1HA 3TR5A 5JFGA 1WLYA 3C45A 4UFPA 2FW9A 4GM0A 5A1TA 4B44A 3VDQA 1WHSB 1UFOA 4DDTA 4Q7LA 1E6UA 1H6BA 4RHYA 4KPUA 5L3RA 3DCYA 5JXGA 1KEWA 3ZDAA 4LF8B 1BKDR 3AESA 4FDVA 2FPLA 3U4GA 3ZCTA 3O75A 4UMDA 1BE6A 3P9YA 5ARCA 2P11A 4X97A 3JYQA 4I1YA 3DD5A 5BR4A 1RHQA 3TOZA 4B31A 2WMDA 3CV3A 4FYMA 5CNKA 3WK7A 4MAFA 2XKJE 3B5JA 5HZMA 1X86B 4IO0A 3V2GA 5JXIA 4HQLA 1SY7A 2C58A 2B61A 3NRJA 3GJQA 4N03A 3R4VA 1H65A 3PUYA 4MYSA 2WG0A 4JUIA 5FQOA 3IP3A 2VJOA 1R6BX 4BZZA 1UFRA 1QGZA 5DSXA 1YB4A 3ZGNA 3AUTA 2VTEA 1VXOA 5BQFA 5FOWA 1QVZA 1I0IA 2AH5A 1IJEA 2R7LA 1V8FA 1EDOA 3HBNA 4LRYA 3ZCRA 4LFAB 4FI3F 1XQXA 4C06A 3QFHA 2PD6A 4O1HA 5DBGA 3A25A 4XJVA 2AZ4A 3QNUA 4A8JA 1RHUA 3T5GA 1DAHA 3QSGA 1T36B 2AG1A 3V2IA 1SHTX 3BGSA 2FGKA 1CDOA 4R3UC 2C4HA 4JWTA 1N78A 2GAOA 3JVUA 3OM8A 2TMDA 1FXWA 1AK9A 1YZNA 3EODA 3PQ7A 5FPQA 1QVWA 3FCEA 4LHSA 1GUYA 3SDZA 3T35A 3VPFA 4Z4QA 2IP1A 1GG5A 4YP6A 1O6BA 5IH3A 2ZAMA 5JJIA 4MLZA 3GRCA 5C9ZA 3HXKA 2R85A 5CX1B 3ZHRA 1JKJB 1B41A 1TRKA 1EFRD 2IHBA 2AZDA 5CP8A 2CJWB 1SUSA 3QPVA 3SJZA 4CM7A 4KN5A 1W35A 1ZLXA 2AOTA 2Y1KA 4E5DA 4XB6B 1SCUA 2PVSA 3SY8A 3DS8A 3JTMA 3K70C 4OHWA 1JX6A 3HVIA 4ZI7F 5A1JA 5CDTA 3I9KA 1JFFA 2IE0A 2BY4A 2AG5A 5CFQA 4JU9A 1Q11A 3ND7A 4MVJM 2PSDA 3I01A 1IEWA 2BKAA 2NYVA 2P9CA 1YQUA 4QLAA 1N5RA 3ZGVA 1KZYC 3NC4A 4FFNA 1T8RA 4KQCA 2PUGA 1J8QA 1Q0RA 2JZOA 3A1DA 3STUA 1X7ZB 2O8DB 1Q20A 3COVA 1SO8A 4ACBA 4D02A 4IHQA 3QU4A 3PXDA 3TAHA 1B76A 3BD6A 3AW8A 3PWSA 4JVMA 4AO6A 1PTJA 2WKWA 2OXCA 2X0IA 2JCGA 1M73E 1U3WA 1DNPA 2CXPA 2YXDA 3QMPA 3IE0A 3BE6A 1U02A 1OWMA 1SVUA 4TTAA 3EA0A 3KB1A 4QXOA 3H87A 2DC1A 3IDAA 3AB3A 3ZHUA 4OHCA 2O2DA 3DO6A 4J16C 2R68A 3D81A 2QAGB 3C6BA 3FYUC 2SHKA 3SIRA 1RLJA 1Q19A 2OHFA 3C6XA 4HPXB 1EFVA 4ZOQI 3Q8KA 2D4AA 1Y1KE 3EVFA 4NU8X 4RQBA 1F5SA 3HO6A 3N70A 2AFIE 1DEHA 2YOFA 5AVJA 3RC2A 3S6JA 2D62A 3FTEA 2VJYA 1BC5A 1KFKB 1H2WA 5G1PA 3S2GA 4F5EA 4FFOA 1WCIA 1U9IA 4NFSA 4XIJA 3NWBA 3V00A 4RESA 2QBYA 1YGYA 1PW7A 2F9LA 1T0UA 3KUCA 4LOJA 4Y2VA 4YI3A 2P2GA 1TUBA 5JI2E 4RAQA 5LQSA 1KSFX 2XKBA 3B48A 4R1UA 2VHWA 5LYYA 3DH0A 1Z45A 5C8YA 3SKVA 3CGGA 3FE2A 3L0IB 3MMSA 1IVSA 1JEOA 3FY4A 1YUNA 3FYCA 4KHZA 4JBYA 1LF0A 2V0NA 1TI7A 4JC8A 1R2QA 1SH7A 1MW9X 3AEZA 3NLLA 4OQMA 1BRMA 4FWIB 2ESRA 3EYWA 4Y2TA 4HUJA 4NCXA 4W9NC 3ZDFA 4A73A 4CIAA 4G0NA 1ZXXA 2YJ3A 5EVJA 4UASA 4KQGA 4N5NA 5L3ZA 1NR1A 2LVBA 3GRPA 3HN2A 1A8PA 4HTAA 1XU7A 4M6WB 4IZOA 4NY1A 1NJGA 4BDSA 2G4VA 4KKXB 3FPAA 1XDUA 3ZN2A 2IBSA 2QX4A 3VGPA 2I8LA 5JMTA 4K28A 1O95D 1RM4A 3JQGA 4DQ0A 1VL6A 4UCFA 1P3Y1 5AK3A 2PBZA 3GEEA 4J8PA 2JD1A 3I1IA 2EYQA 4QASA 4GXRA 1YQTA 1JTFA 4C7KA 1NJ1A 1A82A 1JIKA 3ANLA 4D9NA 1DCTA 1J9ZA 1DL5A 4TTTS 2OKCA 3R5TA 5SY6A 5LIRA 4DV5B 1FSSA 3WTCA 4TV9F 1EHCA 4M1OA 1OLXA 3UHFA 1NU6A 1JBEA 2MSDB 1A7KA 4LMPA 4OHMA 3LQ1A 5KDLA 3KNZA