4YVOA

Crystal structure of the tpr domain of arabidopsis flu (flu-tpr)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
119
structure length
119
Chain Sequence
PKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Non-canonical Tetratricopeptide Repeat (TPR) Domain of Fluorescent (FLU) Mediates Complex Formation with Glutamyl-tRNA Reductase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Fluorescent protein
molecule keywords Protein FLUORESCENT IN BLUE LIGHT, chloroplastic
total genus 57
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yvoA00
5JJTA 1OUVA 3MV2B 4JHRA 3RO3A 2V5FA 5KJNA 5G04C 1WAO1 1E96B 3OXFA 3TG4A 5D0QD 3MEKA 4AIFA 4YVOA 3HYMB 2YQ8A 3ZHEB 3LY9A 2XGOA 4XI0A 5ARFA 3ASDA 3S7BA 4HOTA 3QWVA 2LNIA 3U3WA 4N2SA 5A6CA 1A17A 2VGXA 2XCBA 3MKRA 4G26A 4WUYA 4XIFA 5G04J 2Y4UA 4GCNA 2FEZA 3OXGA 5DIZA 4N3CA 5ARGA 3AS8A 1KT0A 3Q4AB 3KD7A 3NF1A 3KS2A 4U07A 5A7DB 5LCWJ 4XI9A 2JLBA 3ZGQA 3ZHEA 2XCCA 2FI7A 3LPZA 1W3BA 5BNWA 3ASFA 3ASGA 4GYYA 2HO1A 4GZ6A 3QOUA 2XGSA 4O6FA 2KCLA 4N3BA 2VGXB 4UQZA 2PL2A 4YVQC 3EDTB 1HH8A 2ONDA 3FFLA 3RO2A 4GPKA 3GZ2A 3O48A 4IN3B 3R9AB 3LKUA 1NA3A 3JYSA 3VTXA 3GYZA 3KAEA 2AVPA 5EX0A 5C1DA 5FZQA 5KJMA 1KT1A 3FP3A 2FO7A 2I6HA 4I2WA 4KXKB 1TJCA 3SZ7A 2LSVA 3RJVA 3K9IA 4UI9C 3LCAA 1ZU2A 1HZ4A 3CKCA 1P5QA 3CVLA 1Y8MA 3SF4A 4WNDA 5M72A 5EX3A 2L6JA 4BWRA 3PE4A 1NA0A 4U04A 4N3AA 1WM5A 4U0ZA 3VTYA 5KJLA 2MHKA 4N2QA 1FCHA 2IFUA 4N5CA 3CVQA 4W9RA 2VQ2A 4WNFA 4Y6CA 2R5SA 4G23A 4UI9J 2KC7A 2UY1B 4I2ZA 2GW1A 3UPVA 3MV3B 1IHGA 1KLXA 4G1TA 4JA7A 4RG9A 5FZSA 5JJ6A 4BTAA 2C0MA 4H7XA 4LEUA 3QWPA 4GYOA 4RG6A 3E4BA 4HOQA 4NQ0A 5FT9A 3MA5A 2KCKA 3LYAA 4GA2A 4JL0A 4ABNA 1XNFA 3RU0A 3U4TA 3AS4A 5HI7A 3ESKA 4HOSA 4BT8A 2UY1A 1ELRA 2KCVA 3IEGA 3AS5A 2VGYA 4Y6WA 3S7FA 3CKBA 4H7YA 1B89A 4AY6A 2LSUA 2PQNA 4GZ3A 3QWWA 3S7DA 4GA0A 3UQ3A 3PE3A 3CK9A 3Q5MA 3Q49B 3Q15A 5G05C 4AY5A 2C0LA 2FF4A 3WXXA 2PQRA 4YNDA 3ASHA 5D0OD 4F3VA 5BT1A 2QFCA 3BEEA 3URZA 5JJ7A 4CDRA 4GCOA 4BT9A 4ME2A 3S7JA 2E2EA 4I9CA 3TAXA 4CGWA 3QDNA 4J8EA 5EKQD 3TGOA 2Q7FA 3FWVA 4HORA 1QQEA 4AM9A 5CCLA 4WNGA 4G2VA 5FTPA 4UI9K 4I9EA 1HXIA 5LCWC 2WQHA 2YHCA 3CK7A 3GZ1A 4GYWA 4I17A 4J0UA 4UQYA 3RIBA 3LY8A 3CK8A 4A1SA 3CVPA 4EQFA 1PC2A 2XGMA 5HQ8A 4J8FA 4APOA 4UQXA 3CVNA 4G25A 2XPIA 4U0UA 2UWJG 3GW4A 5FJYA 3ZN3A 2J9QA 4GZ5A 4J8DA 4CGVA 4JA9A 3N71A 1QZ2A 2DBAA 2FBNA 4G24A 5CHEE 3ZPJA 1NZNA 2C2LA 2IF4A 2P58C 3CEQA 3Q47B 3UUXA 3ZFWA 2HR2A 5KJKA 2Y4TA 1IYGA 4NRHB 5FZRA 2OOEA 2XEVA 4KYOB 2VSYA 2HYZA 5DBKA 2VSNA 4WNEA 5G05J 5BW8C 3LY7A 4KBQA 2BUGA 2PZIA 5AYWD 4N39A 1ZBPA 3QKYA 4B94A 3ULQA 4U0SA 4HOUA 1ELWA 3PDNA 2WPVA 2KATA 1YA0A 4I1AA 3RKVA 4BTBA 3OXLA 5CCMA 3TG5A 3CV0A 2VYIA 2NC9A 4GA1A
chains in the Genus database with same CATH superfamily
4V3IA 3ZHEB 3LY9A 3AG3E 4EHMA 2ZU6B 4K5BA 2A4ZA 4I6EA 2Y4UA 4LG6A 2LUHA 4BSXA 4XI9A 3LPZA 3NOGD 2XGSA 1KPSB 4WWPA 1ELKA 3HXFA 3B7TA 1JWGA 4ILGA 1HH8A 4BETA 5AQ9A 3JYSA 1D9SA 3CSTA 3SFXA 2LO6A 4GTVA 4U8YD 1KZOA 4N3AA 5FQ6A 3CVQA 4W9RA 2VQ2A 4F1SA 4G1TA 2X6FA 4H7XA 5ENSD 3EJNA 4JL0A 3FUKA 3LYAA 3CQGB 4LNGA 3ZU7B 1ELRA 4GZ3A 3IXEA 3JCKC 1OY3D 5LX8A 4ME2A 4YDWA 3C3OA 3V31A 3TGOA 1UG3A 1QQEA 2P9LG 3ZYKA 1N4SA 4HI9A 4U95D 1E7UA 4GZ5A 3TL5A 3ZFWA 3FUFA 3BQOA 1D8EA 2AXVA 3FH7A 4FP7A 1H2VC 3OTNA 5AYWD 2H6GA 3QKYA 4XEIG 1TN8A 2J07A 3UIPC 4C0MA 1TYQG 3FHEA 3SFYA 3NZSA 4DUIA 4DX2A 1TNBA 3MEKA 4AIFA 3HYMB 3S7BA 4WUYA 5DIZA 3B13A 4N3CA 2QZAA 1FPPA 3C98A 5LOZA 1FVFA 4UQZA 2VTBA 2VSOE 4XKBA 2OCCE 2VJ8A 4LNUD 1NA3A 2V0PA 2YHEA 4KXKB 2RFAA 4ANVA 4GPMA 4B0ZA 4JHKA 4BWRA 4TXPA 4DLQA 2H6HA 4O1OA 3V2OA 2BTDA 2R5SA 2IOLA 2XEEA 4RG9A 3TWQA 2OVBA 2WQ7A 4FLBA 1XNFA 4M3OA 3X2QE 3IEGA 4QFVA 4HFGA 1H19A 4L9PA 5EYLA 3SY2A 1N4PA 3DXKG 2FF4A 4F3VA 2XZTG 4PDXA 2FO1E 4UQYA 4TXRA 2RD0A 2L0TB 1OWMA 5EYPF 2DVWA 1H2TC 1E8ZA 4CDNA 3J5QB 5AJDA 3CQCB 3MGBA 3CHRA 3NB2A 2IU1A 2PZIA 3L6AA 1YA0A 3LVQE 4D10C 4EPZA 5FQ8A 1JWFA 3LVRE 2ZGGA 5D2MC 1E90A 3FTUA 2EIKE 3RK6A 3CHQA 3QWVA 2LNIA 2CG3A 4GCNA 5AJLA 2RFMA 2XCCA 5AQAA 3PZ4A 3PNTB 2WMOA 3FTYA 3FUNA 3ZVVA 1OXJA 2DYRE 3VTXA 1JPLA 4EZJA 4IRUA 5BV1A 3AU4A 2J08A 3CVWA 1O5MA 3K9IA 1ZU2A 5EX3A 1NA0A 1N4RA 4FHKA 4N2QA 3ABME 4I2ZA 2H6FA 4CT0A 4ACKA 4BTAA 1OCZE 2LAIA 3MA5A 1N0QA 3APDA 3L54A 4I43A 4G8LA 3SBTB 4FC8A 1Q2ZA 4OVVA 4AY5A 3Q5MA 1O1RA 2XRYA 2AXUA 3HDXA 2XHEA 1JCSA 1L5JA 4HORA 1TNZA 1OT8A 3ZRHA 4AEZC 1PY1A 3C5RA 2XPIA 5H7PA 2EINE 2X3MA 4G24A 3HIZA 1QYMA 5FZRA 3PRZA 4WNEA 3P2BA 4LCTA 4BEPA 5B3SE 4HXIA 4BESA 3RRUA 3OAWA 1BPOA 1MQSA 3ISMC 3JXJA 4AOFA 3TG4A 2Y69E 2QYJA 2ZGDA 3Q4AB 4HI8A 4GTPA 4L2LA 4JEUA 3PNLB 3ML9A 1EPUA 1SZ9A 3SO8A 4IYPA 2ONDA 4GPKA 5FZQA 4PS3A 3HHMA 1UJJA 4LUNU 5KJLA 5EN5D 5AAOA 2ILRA 4UI9J 3C3RA 1EDUA 3IKOB 3TWXA 3CGHA 4MKTA 2ZIRA 2F0YA 4OVUA 2ETCA 5EDSA 3S7FA 2NSZA 3D9JA 4E6HA 4H7YA 2R05A 4AY6A 3ULEG 4BFRA 1N0RA 3GZSA 3KEZA 4GU5A 3I3NA 4I17A 4J0UA 2J49A 3CVPA 3ASNE 3D9IA 1K3ZD 4UQXA 4G25A 1TR4A 5ENPD 1GW6A 3UT7A 4NURA 5KBAA 3UUXA 3LS8A 1OCCE 3APCA 4YDEA 5DBKA 4KBQA 2KATA 1WY6A 1G3NB 2F8XK 3Q7AA 3PH0C 3SNXA 2F8YA 3ABKE 4E85A 5ENTD 1LD8A 5CRVA 1N94A 2VGEA 3G2TA 3MYVA 4UWKA 1TNOA 5AQ7A 3ESLA 3W9FA 3UIOC 2V5QC 4U07A 2FI7A 4C48B 4CDMA 1TN6A 3FUDA 4O6FA 2P2CP 3HXDA 3ZXPA 1H6PA 3Q78A 3R9AB 5EIBE 3B7SA 1HFAA 5KJMA 4I2WA 3DSTA 3VLFA 3G2VA 4HRMB 1QBQA 2MOWA 2WXQA 4TUMA 2CHXA 4NQ0A 2I1KA 1OCRE 2BKGA 5B1BE 3ZYMA 4EZLA 4YNDA 3TWWA 1E7VA 3TAXA 3C3QA 5CMYA 1IQUA 5JA4D 1S63A 3RIBA 4CT4A 3CVNA 4U0UA 4UWHA 4CGVA 2J9QA 3N71A 5KWDA 2LXLA 5HS0A 1SVXA 4N39A 4B93B 4Z68A 5JJTA 3RO3A 4JXTA 1E96B 2GRLA 3AG1E 1H2UA 3UM3A 2VGXA 4HVBA 1OWNA 3UKUG 3B7BA 4GMLA 5HKPA 5BNWA 2EQXA 1HO8A 2P9UG 4N3BA 4F53A 3TWRA 3RO2A 3L82A 2EIJE 3EUVA 3SZ7A 3CLJA 2F37A 3LCAA 1LTXA 1IHBA 3D9NA 4JC8A 4Y6CA 4HBDA 5JJ6A 3PUKA 4B8AA 3LJNA 3FH5A 3TWVA 4HOSA 2YINA 3BG1B 3EIQC 5J08A 4GA0A 3Q49B 4DK5A 2C0LA 4CYMD 4PS8A 5AQBA 4CDRA 4HNAD 5ENNA 4ZFHA 2WQHA 3GZ1A 1EYHA 3CK8A 4ATZD 2UWJG 4GTTA 5FJYA 3AG2E 5BXUA 3HRAA 4F7AA 2KM4A 4WAFA 2OVFA 3T9KA 2ETBA 1S70B 3RKVA 3ZUVB 3FEXA 4KZCA 3SHFA 4L2YA 5EILA 5G04C 4UWFA 2I1JA 1N9AA 3O4ZA 3U3WA 1A17A 3ONLA 2DWZA 3NF1A 3EHRA 3ASFA 3FUEA 2EIME 5ITZF 4KVMA 3EDTB 2IO2C 2AWIA 3FFLA 4RLYA 1HE8A 4B89A 1X81A 5AENA 1KT1A 3MKQB 4X8QA 3RJVA 3SI5A 1BLXB 1DCQA 3LDZA 4JB8P 3FTVA 4K5CA 2QC9A 4Q94A 1KLXA 1UOHA 2NXPA 1DVPA 3HVEA 4ABNA 4FHJA 3RU0A 3ESKA 4DJAA 3FULA 2XS8A 3AS5A 3RRMB 2OEVA 3WG7E 1UN8A 4AJWA 1IKND 2PM6A 3KSQA 4NIKA 3QDNA 5EKQD 4AM9A 4G2VA 3I5PA 4L23A 3FTZA 2JABA 2XS1A 4RSYA 2WXHA 2R03A 1U3DA 2IF4A 2IEJA 3CEQA 2P58C 2HR2A 4I6JA 3QJZA 1S0PA 4JZYA 5BW8C 4A55A 1OWOA 2XPYA 4OAVB 2WPVA 4I1AA 3U66A 5CCMA 2VYIA 1RZ4A 1K8KG 4XE0A 4XI0A 3V2XA 3W9GA 3QB2A 2X6JA 4YDYA 5A6CA 5JHBA 1INZA 4MLPA 5AARA 2JLBA 3APFA 4DX1A 3BG0B 1U3CA 1YYHA 3F6QA 3ASGA 1OWLA 4GB9A 3VLEA 1JUQA 2R17C 1QNFA 5ANLA 3O48A 4IN3B 4DI3A 3TWSA 3GYZA 3L16A 5BXOA 3IBEA 4HQDA 2WXFA 4GZCA 1Y6IA 2KBXA 1S64A 3UPVA 4XX5A 3ZYQA 3QWPA 4GYOA 4HOQA 4F1PA 1HU3A 2XZDG 2UY1A 5FQ7A 3CK9A 3Q15A 3DWLG 4FU3A 3PS6A 3FEYA 1HG2A 5CCLA 1MX6A 4FULA 3D9LA 1NL4A 4Q96A 2XGMA 4DX6D 3ZXSA 2DBAA 3G2UA 2NYJA 4DPRA 2Y4TA 2OOEA 2HYZA 5G55A 3CVXA 3S2AA 4GTSA 1N52A 3UTMA 2RG8A 4B94A 3T8KA 1HS6A 2WXGA 4O1PA 4AXHA 3TG5A 3PREA 1OCOE 3E34A 5T4YA 1E8WA 1DNPA 1V55E 2EILE 2WXKA 1NFIE 3ASOE 4HOTA 2M63A 5ENOD 3BUAA 1MX4A 2P9IG 2OEWA 1D8DA 2HE0A 2I9CA 5LCWJ 2IO3C 2P9NG 3LEWA 3G2SA 2LXMA 1IXVA 4YVQC 1E8YA 2JEKA 4AV7A 2WXJA 2WMNA 3FU3A 5FWQA 3SF4A 1MYOA 3PE4A 3ZYLA 1WM5A 4U0ZA 4I1OB 4GTRA 1DCEA 2UY1B 2FULA 3FTWA 3MV3B 4JEHA 4ATGA 3EHNA 3ZNGA 3CHSA 3AS4A 2BF0X 3AG4E 3Q7FA 1SZAA 3R7RA 3S7DA 1MJ0A 3FDHA 4NACA 5B1AE 2XQ0A 5BT1A 1PAQA 5JJ7A 4BY6A 3UM0A 2E2EA 2IQCA 1H6OA 3RAUA 3FWVA 4UI9K 4ILIA 3CHMA 5JMND 2DCPA 4MS6A 3IV0A 4A1GA 3D9MA 5G05J 2IONA 3ULQA 4BTBA 2PL2A 3LY8A 3UMVA 1BI7B 1A5EA 3NZUA 4YVOA 5KNHD 3JXIA 1OWPA 3ML8A 4BX8A 3E32A 1W3BA 4AP2A 2YNQA 3DPYA 1BD8A 2KZTB 5EX0A 2AVPA 4OAUC 2WXRA 3CVUA 1FT2A 4N5QA 5ANRA 2MYOA 2V4HC 2BEDA 2QY7A 3IHYA 5FZSA 4J8YA 4I1MA 1XGWA 4LEUA 4A3VA 3Q79A 4QQIA 2X6KA 4GZDA 3DEOA 1YCSB 3PE3A 3D9HA 1HF8A 2CHWA 3FH8A 5CERB 1U2VG 4P29A 1UJKA 3DXMG 2YHCA 5KNGA 1H6KA 2AXZA 4EQFA 2LAHA 3ZN3A 2AW6A 3T5VA 3Q47B 5CRUA 3RSEG 3PUJA 2XEVA 2IY0C 3FTXA 2Y0BG 3IHVA 4L1BA 4XZ4A 4U0SA 4EBAG 2R59A 1HX8A 3CV0A 4XKCA 2NC9A 4KZ0A 4R7LA 3T5XA 4ACLA 2ZXWE 2J8SD 5ARFA 4GMRA 1JCRA 4XIFA 5BUZA 5ARGA 3EU5A 3D9OA 4PS7A 4Q69A 3B7UX 3ZHEA 3ZGQA 3DSWA 3E37A 3EHMA 4GZ6A 2VGXB 5G2NA 3DSUA 3I4RB 3UKRG 2WXIA 3CHPA 1HZ4A 1Y8MA 2H6IA 5M72A 5BV0A 4GTMA 4AVXA 1UW4B 4WNFA 2IFUA 4JA7A 5FQ4A 3R9MA 3U4TA 3LXUX 1WG0A 2J09A 4GAAA 3SD5A 1B89A 3UQ3A 4FADA 3HVEB 5D0OD 4GCOA 1RW2A 4J8EA 3SBSA 3DPDA 4OYSA 3D9KA 5FTPA 3QC1A 3EIJA 5FINA 3Q75A 3CVVA 3CHOA 3FUHA 4LSZE 4DI4A 5CHEE 3HG0D 1IYGA 3HXBA 4NRHB 2L9BA 3Q9NC 2VSNA 3PZ2A 4HRNA 2ZISA 4LRZA 4MRUA 2WXOA 5FIOA 4ZHBA 4BX9A 4U63A 5J90A 3MV2B 1TNUA 1LD7A 3OXFA 5D0QD 3KSLA 1ZB1A 4URKA 3PEUB 4N2SA 3MJWA 4HRLA 3MX3A 4G26A 1SA5A 3FU6A 3V30A 4FJZA 3KS2A 2DZNA 4JW1A 5C2YA 4K5AB 2AJAA 4JD2G 2KCLA 4UUCA 3J5PA 4KT6B 4HB5A 3UX4A 3I4GA 3TWUA 1SW6A 2FO7A 2XPZA 4HS2A 4MBGA 4ILHB 3UM2A 4CRWA 3E33A 2MHKA 2V8SE 1O1SA 3CSFA 2GW1A 1IHGA 4TXQA 3P1UA 5HI7A 2VGYA 3CKBA 3FTSA 4A63B 3D9PA 4FJYA 4B8CB 2QFCA 4KMOA 4G8KA 2A5EA 3PZ1A 2GGFA 4LNBA 4WNGA 3CR3A 3L17A 5LCWC 3CK7A 4GTQA 2WQ6A 4K03A 3PZDA 3U9WA 4JA9A 2VSXE 1NZNA 2GROB 3MCXA 1LF8A 3RRNB 3UM1A 1FVHA 4HOUA 3AAAC 3TXNA 1NP7A 2DIWA 3NAWA 4A3TA 2CG2A 1H0AA 1X5BA 2FEZA 2A5UA 3FUMA 5CEAA 1Z5SC 3KD7A 1MHQA 5A7DB 4GYYA 5AN8A 4LERA 1AP7A 5E76A 1TJCA 3SQVA 4BSZB 3CKCA 1P5QA 4WNDA 2L6JA 1TNYA 2HM8A 4O60A 3VTYA 1K1AA 2DZOA 4J6IA 4DLOA 1BI8B 3NOCD 3UT4A 2KC7A 3EHQA 3ABLE 3C72A 2CFUA 4F6RD 2C0MA 5CMWA 1EF1C 4UWGA 3E4BA 3DSSA 4GA2A 2L6BA 5E75A 2B6CA 2XRZA 3EU9A 2P9KG 3UINC 4I9CA 4CGWA 2IJGX 1TN7A 4I9EA 4PH4B 3DSXA 2XEHA 4IULA 3ZIMA 3SFZA 3L9TA 3FUIA 5ENRD 5T3RA 3ZPJA 4GMJA 2X6HA 3MZLB 5EIDA 1V54E 4PUCA 3LY7A 2BUGA 1K1BA 4ANXA 2V4LA 4KVOA 4YDOA 2V5FA 1N54A 5T8IA 4HLLA 2XGOA 1SA4A 5A23A 2B0OE 3OXGA 4U8VD 3AS8A 4U96D 5CBNA 5HRYA 5IY5E 2GRQB 2HO1A 4FLHA 5JHAA 3UI2A 3NBNB 3GZ2A 3LKUA 3QARA 2VTBB 2RKKA 2KZTA 4RVBA 3PVLA 4M7CA 3L08A 3MKQA 2WM9A 3TXMA 2WXPA 5ENQD 2CFZA 3Q73A 2WXNA 2J4BA 5LFAA 1YMPA 1Z3YA 3QWWA 1N95A 3G2WA 3CIAA 3BEEA 4TV3A 2WXMA 4BT9A 3U64A 2MRIA 2GRPB 4A1SA 1PC2A 5HQ8A 4U7EB 4FA6A 3E30A 2C2LA 2P9PG 3UT8A 3FU0A 1ZBPA 3TWTA 1ELWA 3KEAA 3OXLA 4G11A 5LP0A 2ETAA 1OUVA 3FUJA 2X38A 1WAO1 3ZKJA 4J8SA 1Z3XA 1HG5A 4I6GA 3ZW3A 1WDYA 2CHZA 2XCBA 3TJPA 1KZPA 4CEMA 5CBOA 3SGHA 1KT0A 3VLDA 2DYSE 4TUUA 3QOUA 3QAQA 1E8XA 3JUIA 4DRXE 5C1DA 2P9SG 4CCAA 2I6HA 2LSVA 4UI9C 4CZ2D 3PZ3A 4ANWA 1FCHA 4N5CA 3B95A 3QK0A 1DC2A 4WWOA 2KCKA 2GRRB 4JVSA 3ONKA 4EECA 3V79K 3ASHA 1UN9A 3S7JA 3JUEA 3HXEA 4RQIA 4L7TA 2E0IA 2Y3AA 2Q7FA 3L13A 1HXIA 4C0EA 4JHJA 3ENEA 2GRNB 4J8FA 3BU8A 4TRQA 5CECB 1QZ2A 2FBNA 4GTOA 2WB2A 1O1TA 2VSYA 2KXPC 1MX2A 3PDNA 2OV8A 1TJFA 2L0IA 3HXCA 2QYUA 1N11A 5KJNA 4JHRA 4HLEA 1N4QA 1MZCA 2YQ8A 2J4DA 3PEVB 3ASDA 3D3MA 1BU9A 3MKRA 5G04J 3ZEFA 5D66A 4WWNA 4EBAA 5BPPA 2XENA 3JQ1A 4APFA 2I2OA 3L22A 4J7WA 1Z6TA 4DX7D 1AWCB 1JCQA 1IQRA 1FT1A 3LJ3A 3KAEA 3DRAA 3AU5A 4BERA 4EZKA 2GRMA 1SQMA 3FP3A 4UWLA 3CVLA 3Q9UC 1VDYA 3DBSA 4U04A 4G23A 4K0RA 2R02A 3QNKA 2R2LA 4RG6A 5FT9A 2IOSA 4BT8A 2KCVA 4Y6WA 2PM7A 5CEDB 2LSUA 2PQNA 5G05C 5AIJA 3DEPA 3WXXA 2PQRA 3URZA 4C9BB 1NI1A 3B7RL 1TEZA 3ULYA 3AJIA 3FY4A 4GYWA 2BKKB 2WXLA 3UXGA 4JPSA 4APOA 3GW4A 3JQ0A 4J8DA 3DSVA 2PNNA 4DX5D 5KCMA 3NQPA 3R7QA 2Y1LE 2X6IA 5KJKA 4KYOB 4U8HA 3T8MA 2WVIA 3CVYA 3FU5A 4ANUA 4GA1A
chains in the Genus database with same CATH topology
5T4YA 1E8WA 4A3TA 4E85A 1DNPA 2CG2A 4V3IA 2WXKA 3ZHEB 1H0AA 3LY9A 2ZU6B 4HOTA 2M63A 2A4ZA 3G2TA 1X5BA 4I6EA 2Y4UA 2FEZA 2A5UA 3MYVA 4UWKA 3FUMA 3ESLA 3KD7A 4BSXA 1MHQA 2I9CA 4U07A 5A7DB 4XI9A 5LCWJ 2FI7A 3LPZA 4CDMA 3FUDA 4GYYA 3LEWA 3G2SA 2XGSA 4O6FA 4WWPA 1ELKA 3B7TA 1JWGA 4ILGA 4YVQC 1HH8A 3R9AB 1E8YA 4LERA 2JEKA 3B7SA 3JYSA 4AV7A 2WXJA 3CSTA 2WMNA 1HFAA 5KJMA 5E76A 3FU3A 4I2WA 3VLFA 1TJCA 2LO6A 3G2VA 5FWQA 3CKCA 1P5QA 3SF4A 4WNDA 2MOWA 2L6JA 3PE4A 3ZYLA 2HM8A 1WM5A 4N3AA 4U0ZA 3VTYA 2WXQA 4I1OB 5FQ6A 4J6IA 3CVQA 4W9RA 2VQ2A 4DLOA 3UT4A 2KC7A 2UY1B 2CHXA 2FULA 4F1SA 3FTWA 3MV3B 4G1TA 4JEHA 2CFUA 2X6FA 2C0MA 4H7XA 5CMWA 1EF1C 4UWGA 3E4BA 4NQ0A 4ATGA 3EJNA 3FUKA 3EHNA 3LYAA 2I1KA 3CQGB 4GA2A 3CHSA 4JL0A 3AS4A 2BF0X 5E75A 1ELRA 1SZAA 2XRZA 3R7RA 4GZ3A 3S7DA 3ZYMA 4EZLA 3FDHA 4NACA 2XQ0A 5BT1A 3JCKC 4YNDA 1PAQA 5JJ7A 4BY6A 1E7VA 4ME2A 2E2EA 4I9CA 3TAXA 4CGWA 2IQCA 5LX8A 3TGOA 2IJGX 1UG3A 3FWVA 1QQEA 5CMYA 4UI9K 4I9EA 3ZYKA 1IQUA 4PH4B 4ILIA 4IULA 3RIBA 3ZIMA 3CHMA 3SFZA 4CT4A 3CVNA 1E7UA 4U0UA 4UWHA 4CGVA 2J9QA 4GZ5A 3FUIA 3N71A 5T3RA 2DCPA 3ZPJA 4GMJA 3TL5A 4MS6A 2X6HA 3IV0A 3ZFWA 3FUFA 3MZLB 4A1GA 2AXVA 3FH7A 4FP7A 4PUCA 1H2VC 3D9MA 5G05J 3LY7A 3OTNA 2BUGA 5AYWD 4N39A 2IONA 3QKYA 3ULQA 2J07A 4ANXA 2V4LA 4C0MA 4KVOA 4BTBA 3FHEA 3NZSA 2PL2A 3LY8A 5JJTA 3RO3A 3UMVA 2V5FA 4JXTA 1N54A 1E96B 3MEKA 3NZUA 5T8IA 4AIFA 4YVOA 3HYMB 2GRLA 2XGOA 1H2UA 1OWPA 3S7BA 3ML8A 2VGXA 4WUYA 4BX8A 5A23A 3OXGA 5DIZA 3B13A 4N3CA 4HVBA 1OWNA 3AS8A 4GMLA 3C98A 5LOZA 1FVFA 1W3BA 5BNWA 2HO1A 2EQXA 1HO8A 4N3BA 4UQZA 2VSOE 4FLHA 4AP2A 4F53A 2VTBA 5JHAA 4XKBA 2YNQA 2VJ8A 3RO2A 3GZ2A 3LKUA 2KZTB 1NA3A 5EX0A 2AVPA 2V0PA 2WXRA 2YHEA 3CVUA 5ANRA 4KXKB 3SZ7A 3QARA 2VTBB 3CLJA 3LCAA 4ANVA 2QY7A 4B0ZA 4JHKA 4BWRA 4DLQA 3D9NA 2KZTA 4JC8A 2BTDA 4Y6CA 2R5SA 4RVBA 3PVLA 3L08A 3IHYA 2IOLA 3MKQA 2WM9A 4RG9A 5FZSA 5JJ6A 3TXMA 3PUKA 2WXPA 4B8AA 4I1MA 1XGWA 4LEUA 4A3VA 2OVBA 3FH5A 2WQ7A 4FLBA 1XNFA 2CFZA 4M3OA 4HOSA 2X6KA 2YINA 3BG1B 3EIQC 2WXNA 3IEGA 4GZDA 2J4BA 5LFAA 4QFVA 4HFGA 1H19A 1Z3YA 3QWWA 5J08A 4GA0A 3PE3A 3G2WA 3Q49B 4DK5A 2C0LA 2FF4A 4F3VA 4PS8A 3CIAA 3BEEA 4PDXA 1HF8A 4TV3A 2WXMA 4BT9A 4CDRA 2CHWA 3FH8A 3U64A 5ENNA 2MRIA 4P29A 1UJKA 2WQHA 2YHCA 1H6KA 1EYHA 2AXZA 3GZ1A 4UQYA 3CK8A 4A1SA 4EQFA 1PC2A 5HQ8A 2LAHA 2L0TB 2RD0A 1OWMA 4FA6A 2UWJG 5FJYA 1H2TC 3ZN3A 4F7AA 2KM4A 1E8ZA 2AW6A 2C2LA 3T5VA 4CDNA 3Q47B 3PUJA 3UT8A 5AJDA 3CQCB 3MGBA 2XEVA 3CHRA 4WAFA 3FTXA 3IHVA 2IU1A 2PZIA 4L1BA 3FU0A 3L6AA 1ZBPA 4XZ4A 4U0SA 1ELWA 2OVFA 4EBAG 1YA0A 3LVQE 3RKVA 4D10C 3OXLA 4G11A 2R59A 1HX8A 3FEXA 4EPZA 5LP0A 3CV0A 4GA1A 4XKCA 4KZCA 5FQ8A 2NC9A 4KZ0A 1JWFA 3LVRE 3SHFA 4R7LA 1OUVA 3FUJA 1E90A 2X38A 4L2YA 5G04C 1WAO1 3FTUA 4UWFA 3T5XA 2I1JA 4J8SA 3RK6A 4ACLA 1Z3XA 1HG5A 3CHQA 4I6GA 5ARFA 3ZW3A 3O4ZA 2CHZA 2LNIA 3QWVA 3U3WA 1A17A 2XCBA 3TJPA 4XIFA 4CEMA 5BUZA 2CG3A 4GCNA 3ONLA 3SGHA 5ARGA 5AJLA 1KT0A 3D9OA 3NF1A 4PS7A 4Q69A 3B7UX 3ZHEA 2XCCA 3ZGQA 3VLDA 4TUUA 3ASFA 3EHMA 3QOUA 3FUEA 4GZ6A 2VGXB 5G2NA 4KVMA 3EDTB 3QAQA 3PNTB 2WMOA 3FTYA 2AWIA 3FUNA 3FFLA 1E8XA 3ZVVA 3JUIA 5C1DA 3VTXA 1JPLA 4EZJA 1HE8A 3I4RB 4IRUA 4B89A 5BV1A 3AU4A 2J08A 5AENA 1KT1A 4CCAA 3CVWA 2I6HA 3MKQB 2LSVA 3RJVA 3K9IA 4UI9C 3SI5A 2WXIA 3CHPA 1ZU2A 1HZ4A 1Y8MA 5M72A 5EX3A 5BV0A 1NA0A 4AVXA 1UW4B 3LDZA 4FHKA 4ANWA 4N2QA 1FCHA 2IFUA 4N5CA 4WNFA 3FTVA 3QK0A 4I2ZA 4Q94A 4JA7A 1KLXA 4WWOA 5FQ4A 4CT0A 4ACKA 4BTAA 2NXPA 1DVPA 3HVEA 2LAIA 2KCKA 3MA5A 4FHJA 4ABNA 3RU0A 3U4TA 3ESKA 3APDA 3LXUX 2J09A 3L54A 3FULA 4GAAA 3AS5A 4DJAA 4I43A 3SD5A 3SBTB 3RRMB 1B89A 4FC8A 3UQ3A 4OVVA 4JVSA 4AY5A 1UN8A 3Q5MA 3ONKA 4AJWA 2XRYA 4EECA 4FADA 3HVEB 3ASHA 5D0OD 2AXUA 1UN9A 4GCOA 2PM6A 3S7JA 3HDXA 3QDNA 4J8EA 2E0IA 2Y3AA 4L7TA 2XHEA 5EKQD 3DPDA 1L5JA 2Q7FA 3SBSA 4OYSA 4AM9A 4HORA 3D9KA 4G2VA 3L13A 5FTPA 3QC1A 1HXIA 3I5PA 4C0EA 4L23A 3EIJA 3ZRHA 4JHJA 3ENEA 3FTZA 4AEZC 1PY1A 3CVVA 4RSYA 4J8FA 3CHOA 2XPIA 2WXHA 3FUHA 4TRQA 4DI4A 2X3MA 1QZ2A 4G24A 2FBNA 1U3DA 5CHEE 2IF4A 3CEQA 2P58C 2HR2A 3HIZA 1IYGA 4NRHB 2L9BA 2WB2A 5FZRA 4I6JA 3PRZA 3QJZA 1S0PA 2VSYA 4JZYA 5BW8C 2VSNA 4WNEA 4A55A 1OWOA 2XPYA 3P2BA 4LCTA 3PDNA 2WPVA 4HXIA 4LRZA 4MRUA 3RRUA 2OV8A 2WXOA 4I1AA 3OAWA 3U66A 4BX9A 1TJFA 5CCMA 2L0IA 1BPOA 4U63A 2VYIA 1MQSA 5J90A 5KJNA 3MV2B 4JHRA 4AOFA 4HLEA 3OXFA 4XE0A 5D0QD 3TG4A 2YQ8A 4XI0A 2J4DA 3PEVB 3ASDA 3D3MA 4URKA 3PEUB 3QB2A 2X6JA 4N2SA 3MJWA 5A6CA 3MX3A 4G26A 3MKRA 5G04J 3FU6A 3ZEFA 5JHBA 1INZA 4FJZA 4MLPA 3Q4AB 4WWNA 3KS2A 2JLBA 3APFA 3BG0B 1U3CA 4JW1A 4EBAA 4L2LA 5BPPA 3ASGA 1OWLA 5C2YA 3JQ1A 4JEUA 4GB9A 2KCLA 2I2OA 3L22A 3ML9A 3PNLB 4APFA 1SZ9A 1EPUA 1Z6TA 3VLEA 1JUQA 4IYPA 2ONDA 2R17C 4KT6B 1QNFA 4GPKA 1IQRA 3O48A 4IN3B 5ANLA 4DI3A 3UX4A 3LJ3A 3GYZA 3KAEA 3AU5A 3I4GA 4EZKA 3L16A 5FZQA 2GRMA 1SQMA 3FP3A 2FO7A 4UWLA 2XPZA 3IBEA 4HS2A 4PS3A 3HHMA 4ILHB 4CRWA 3CVLA 2WXFA 4GZCA 1UJJA 1VDYA 3DBSA 4LUNU 4U04A 1Y6IA 5KJLA 2MHKA 2V8SE 2ILRA 4G23A 4UI9J 3CSFA 2GW1A 3UPVA 1EDUA 4K0RA 4XX5A 1IHGA 3QNKA 3IKOB 3CGHA 4MKTA 3QWPA 4GYOA 4RG6A 3ZYQA 4HOQA 5FT9A 2IOSA 4OVUA 3P1UA 5EDSA 5HI7A 1HU3A 4BT8A 2UY1A 2KCVA 4Y6WA 2PM7A 3S7FA 2NSZA 2VGYA 3D9JA 3CKBA 4E6HA 4H7YA 4AY6A 5FQ7A 2LSUA 2PQNA 3FTSA 3CK9A 5G05C 3Q15A 5AIJA 3WXXA 2PQRA 3D9PA 4FU3A 4FJYA 4B8CB 2QFCA 3PS6A 3URZA 4BFRA 4C9BB 4KMOA 3FEYA 2GGFA 1HG2A 5CCLA 3B7RL 4WNGA 3CR3A 1TEZA 3GZSA 3L17A 3KEZA 5LCWC 4GU5A 3I3NA 4FULA 3CK7A 4I17A 3D9LA 3FY4A 4GYWA 4J0UA 2J49A 2WXLA 3CVPA 4Q96A 2WQ6A 2XGMA 4JPSA 4K03A 3D9IA 3PZDA 4APOA 4UQXA 4G25A 3GW4A 3U9WA 3JQ0A 1GW6A 4J8DA 3UT7A 3ZXSA 4JA9A 2DBAA 2VSXE 3G2UA 5KCMA 3NQPA 4NURA 1NZNA 3R7QA 3MCXA 3UUXA 4DPRA 2X6IA 3LS8A 5KJKA 2Y4TA 3APCA 2OOEA 4KYOB 5DBKA 2HYZA 5G55A 1LF8A 3CVXA 3S2AA 4KBQA 4U8HA 3RRNB 1N52A 1FVHA 2RG8A 4B94A 1HS6A 2WXGA 4HOUA 3TXNA 1NP7A 2KATA 2DIWA 3T8MA 1WY6A 2WVIA 3CVYA 4AXHA 3TG5A 3FU5A 3PREA 4ANUA 3PH0C 3SNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJT A;  1OUV A;  3MV2 B;  4JHR A;  3RO3 A;  2V5F A;  5KJN A;  5G04 C;  1WAO 1;  1E96 B;  3OXF A;  3TG4 A;  5D0Q D;  3MEK A;  4AIF A;  4YVO A;  3HYM B;  2YQ8 A;  3ZHE B;  3LY9 A;  2XGO A;  4XI0 A;  5ARF A;  3ASD A;  3S7B A;  4HOT A;  3QWV A;  2LNI A;  3U3W A;  4N2S A;  5A6C A;  1A17 A;  2VGX A;  2XCB A;  3MKR A;  4G26 A;  4WUY A;  4XIF A;  5G04 J;  2Y4U A;  4GCN A;  2FEZ A;  3OXG A;  5DIZ A;  4N3C A;  5ARG A;  3AS8 A;  1KT0 A;  3Q4A B;  3KD7 A;  3NF1 A;  3KS2 A;  4U07 A;  5A7D B;  5LCW J;  4XI9 A;  2JLB A;  3ZGQ A;  3ZHE A;  2XCC A;  2FI7 A;  3LPZ A;  1W3B A;  5BNW A;  3ASF A;  3ASG A;  4GYY A;  2HO1 A;  4GZ6 A;  3QOU A;  2XGS A;  4O6F A;  2KCL A;  4N3B A;  2VGX B;  4UQZ A;  2PL2 A;  4YVQ C;  3EDT B;  1HH8 A;  2OND A;  3FFL A;  3RO2 A;  4GPK A;  3GZ2 A;  3O48 A;  4IN3 B;  3R9A B;  3LKU A;  1NA3 A;  3JYS A;  3VTX A;  3GYZ A;  3KAE A;  2AVP A;  5EX0 A;  5C1D A;  5FZQ A;  5KJM A;  1KT1 A;  3FP3 A;  2FO7 A;  2I6H A;  4I2W A;  4KXK B;  1TJC A;  3SZ7 A;  2LSV A;  3RJV A;  3K9I A;  4UI9 C;  3LCA A;  1ZU2 A;  1HZ4 A;  3CKC A;  1P5Q A;  3CVL A;  1Y8M A;  3SF4 A;  4WND A;  5M72 A;  5EX3 A;  2L6J A;  4BWR A;  3PE4 A;  1NA0 A;  4U04 A;  4N3A A;  1WM5 A;  4U0Z A;  3VTY A;  5KJL A;  2MHK A;  4N2Q A;  1FCH A;  2IFU A;  4N5C A;  3CVQ A;  4W9R A;  2VQ2 A;  4WNF A;  4Y6C A;  2R5S A;  4G23 A;  4UI9 J;  2KC7 A;  2UY1 B;  4I2Z A;  2GW1 A;  3UPV A;  3MV3 B;  1IHG A;  1KLX A;  4G1T A;  4JA7 A;  4RG9 A;  5FZS A;  5JJ6 A;  4BTA A;  2C0M A;  4H7X A;  4LEU A;  3QWP A;  4GYO A;  4RG6 A;  3E4B A;  4HOQ A;  4NQ0 A;  5FT9 A;  3MA5 A;  2KCK A;  3LYA A;  4GA2 A;  4JL0 A;  4ABN A;  1XNF A;  3RU0 A;  3U4T A;  3AS4 A;  5HI7 A;  3ESK A;  4HOS A;  4BT8 A;  2UY1 A;  1ELR A;  2KCV A;  3IEG A;  3AS5 A;  2VGY A;  4Y6W A;  3S7F A;  3CKB A;  4H7Y A;  1B89 A;  4AY6 A;  2LSU A;  2PQN A;  4GZ3 A;  3QWW A;  3S7D A;  4GA0 A;  3UQ3 A;  3PE3 A;  3CK9 A;  3Q5M A;  3Q49 B;  3Q15 A;  5G05 C;  4AY5 A;  2C0L A;  2FF4 A;  3WXX A;  2PQR A;  4YND A;  3ASH A;  5D0O D;  4F3V A;  5BT1 A;  2QFC A;  3BEE A;  3URZ A;  5JJ7 A;  4CDR A;  4GCO A;  4BT9 A;  4ME2 A;  3S7J A;  2E2E A;  4I9C A;  3TAX A;  4CGW A;  3QDN A;  4J8E A;  5EKQ D;  3TGO A;  2Q7F A;  3FWV A;  4HOR A;  1QQE A;  4AM9 A;  5CCL A;  4WNG A;  4G2V A;  5FTP A;  4UI9 K;  4I9E A;  1HXI A;  5LCW C;  2WQH A;  2YHC A;  3CK7 A;  3GZ1 A;  4GYW A;  4I17 A;  4J0U A;  4UQY A;  3RIB A;  3LY8 A;  3CK8 A;  4A1S A;  3CVP A;  4EQF A;  1PC2 A;  2XGM A;  5HQ8 A;  4J8F A;  4APO A;  4UQX A;  3CVN A;  4G25 A;  2XPI A;  4U0U A;  2UWJ G;  3GW4 A;  5FJY A;  3ZN3 A;  2J9Q A;  4GZ5 A;  4J8D A;  4CGV A;  4JA9 A;  3N71 A;  1QZ2 A;  2DBA A;  2FBN A;  4G24 A;  5CHE E;  3ZPJ A;  1NZN A;  2C2L A;  2IF4 A;  2P58 C;  3CEQ A;  3Q47 B;  3UUX A;  3ZFW A;  2HR2 A;  5KJK A;  2Y4T A;  1IYG A;  4NRH B;  5FZR A;  2OOE A;  2XEV A;  4KYO B;  2VSY A;  2HYZ A;  5DBK A;  2VSN A;  4WNE A;  5G05 J;  5BW8 C;  3LY7 A;  4KBQ A;  2BUG A;  2PZI A;  5AYW D;  4N39 A;  1ZBP A;  3QKY A;  4B94 A;  3ULQ A;  4U0S A;  4HOU A;  1ELW A;  3PDN A;  2WPV A;  2KAT A;  1YA0 A;  4I1A A;  3RKV A;  4BTB A;  3OXL A;  5CCM A;  3TG5 A;  3CV0 A;  2VYI A;  2NC9 A;  4GA1 A; 
#chains in the Genus database with same CATH topology
 4V3I A;  3ZHE B;  3LY9 A;  3AG3 E;  4EHM A;  2ZU6 B;  4K5B A;  2A4Z A;  4I6E A;  2Y4U A;  4LG6 A;  2LUH A;  4BSX A;  4XI9 A;  3LPZ A;  3NOG D;  2XGS A;  1KPS B;  4WWP A;  1ELK A;  3HXF A;  3B7T A;  1JWG A;  4ILG A;  1HH8 A;  4BET A;  5AQ9 A;  3JYS A;  1D9S A;  3CST A;  3SFX A;  2LO6 A;  4GTV A;  4U8Y D;  1KZO A;  4N3A A;  5FQ6 A;  3CVQ A;  4W9R A;  2VQ2 A;  4F1S A;  4G1T A;  2X6F A;  4H7X A;  5ENS D;  3EJN A;  4JL0 A;  3FUK A;  3LYA A;  3CQG B;  4LNG A;  3ZU7 B;  1ELR A;  4GZ3 A;  3IXE A;  3JCK C;  1OY3 D;  5LX8 A;  4ME2 A;  4YDW A;  3C3O A;  3V31 A;  3TGO A;  1UG3 A;  1QQE A;  2P9L G;  3ZYK A;  1N4S A;  4HI9 A;  4U95 D;  1E7U A;  4GZ5 A;  3TL5 A;  3ZFW A;  3FUF A;  3BQO A;  1D8E A;  2AXV A;  3FH7 A;  4FP7 A;  1H2V C;  3OTN A;  5AYW D;  2H6G A;  3QKY A;  4XEI G;  1TN8 A;  2J07 A;  3UIP C;  4C0M A;  1TYQ G;  3FHE A;  3SFY A;  3NZS A;  4DUI A;  4DX2 A;  1TNB A;  3MEK A;  4AIF A;  3HYM B;  3S7B A;  4WUY A;  5DIZ A;  3B13 A;  4N3C A;  2QZA A;  1FPP A;  3C98 A;  5LOZ A;  1FVF A;  4UQZ A;  2VTB A;  2VSO E;  4XKB A;  2OCC E;  2VJ8 A;  4LNU D;  1NA3 A;  2V0P A;  2YHE A;  4KXK B;  2RFA A;  4ANV A;  4GPM A;  4B0Z A;  4JHK A;  4BWR A;  4TXP A;  4DLQ A;  2H6H A;  4O1O A;  3V2O A;  2BTD A;  2R5S A;  2IOL A;  2XEE A;  4RG9 A;  3TWQ A;  2OVB A;  2WQ7 A;  4FLB A;  1XNF A;  4M3O A;  3X2Q E;  3IEG A;  4QFV A;  4HFG A;  1H19 A;  4L9P A;  5EYL A;  3SY2 A;  1N4P A;  3DXK G;  2FF4 A;  4F3V A;  2XZT G;  4PDX A;  2FO1 E;  4UQY A;  4TXR A;  2RD0 A;  2L0T B;  1OWM A;  5EYP F;  2DVW A;  1H2T C;  1E8Z A;  4CDN A;  3J5Q B;  5AJD A;  3CQC B;  3MGB A;  3CHR A;  3NB2 A;  2IU1 A;  2PZI A;  3L6A A;  1YA0 A;  3LVQ E;  4D10 C;  4EPZ A;  5FQ8 A;  1JWF A;  3LVR E;  2ZGG A;  5D2M C;  1E90 A;  3FTU A;  2EIK E;  3RK6 A;  3CHQ A;  3QWV A;  2LNI A;  2CG3 A;  4GCN A;  5AJL A;  2RFM A;  2XCC A;  5AQA A;  3PZ4 A;  3PNT B;  2WMO A;  3FTY A;  3FUN A;  3ZVV A;  1OXJ A;  2DYR E;  3VTX A;  1JPL A;  4EZJ A;  4IRU A;  5BV1 A;  3AU4 A;  2J08 A;  3CVW A;  1O5M A;  3K9I A;  1ZU2 A;  5EX3 A;  1NA0 A;  1N4R A;  4FHK A;  4N2Q A;  3ABM E;  4I2Z A;  2H6F A;  4CT0 A;  4ACK A;  4BTA A;  1OCZ E;  2LAI A;  3MA5 A;  1N0Q A;  3APD A;  3L54 A;  4I43 A;  4G8L A;  3SBT B;  4FC8 A;  1Q2Z A;  4OVV A;  4AY5 A;  3Q5M A;  1O1R A;  2XRY A;  2AXU A;  3HDX A;  2XHE A;  1JCS A;  1L5J A;  4HOR A;  1TNZ A;  1OT8 A;  3ZRH A;  4AEZ C;  1PY1 A;  3C5R A;  2XPI A;  5H7P A;  2EIN E;  2X3M A;  4G24 A;  3HIZ A;  1QYM A;  5FZR A;  3PRZ A;  4WNE A;  3P2B A;  4LCT A;  4BEP A;  5B3S E;  4HXI A;  4BES A;  3RRU A;  3OAW A;  1BPO A;  1MQS A;  3ISM C;  3JXJ A;  4AOF A;  3TG4 A;  2Y69 E;  2QYJ A;  2ZGD A;  3Q4A B;  4HI8 A;  4GTP A;  4L2L A;  4JEU A;  3PNL B;  3ML9 A;  1EPU A;  1SZ9 A;  3SO8 A;  4IYP A;  2OND A;  4GPK A;  5FZQ A;  4PS3 A;  3HHM A;  1UJJ A;  4LUN U;  5KJL A;  5EN5 D;  5AAO A;  2ILR A;  4UI9 J;  3C3R A;  1EDU A;  3IKO B;  3TWX A;  3CGH A;  4MKT A;  2ZIR A;  2F0Y A;  4OVU A;  2ETC A;  5EDS A;  3S7F A;  2NSZ A;  3D9J A;  4E6H A;  4H7Y A;  2R05 A;  4AY6 A;  3ULE G;  4BFR A;  1N0R A;  3GZS A;  3KEZ A;  4GU5 A;  3I3N A;  4I17 A;  4J0U A;  2J49 A;  3CVP A;  3ASN E;  3D9I A;  1K3Z D;  4UQX A;  4G25 A;  1TR4 A;  5ENP D;  1GW6 A;  3UT7 A;  4NUR A;  5KBA A;  3UUX A;  3LS8 A;  1OCC E;  3APC A;  4YDE A;  5DBK A;  4KBQ A;  2KAT A;  1WY6 A;  1G3N B;  2F8X K;  3Q7A A;  3PH0 C;  3SNX A;  2F8Y A;  3ABK E;  4E85 A;  5ENT D;  1LD8 A;  5CRV A;  1N94 A;  2VGE A;  3G2T A;  3MYV A;  4UWK A;  1TNO A;  5AQ7 A;  3ESL A;  3W9F A;  3UIO C;  2V5Q C;  4U07 A;  2FI7 A;  4C48 B;  4CDM A;  1TN6 A;  3FUD A;  4O6F A;  2P2C P;  3HXD A;  3ZXP A;  1H6P A;  3Q78 A;  3R9A B;  5EIB E;  3B7S A;  1HFA A;  5KJM A;  4I2W A;  3DST A;  3VLF A;  3G2V A;  4HRM B;  1QBQ A;  2MOW A;  2WXQ A;  4TUM A;  2CHX A;  4NQ0 A;  2I1K A;  1OCR E;  2BKG A;  5B1B E;  3ZYM A;  4EZL A;  4YND A;  3TWW A;  1E7V A;  3TAX A;  3C3Q A;  5CMY A;  1IQU A;  5JA4 D;  1S63 A;  3RIB A;  4CT4 A;  3CVN A;  4U0U A;  4UWH A;  4CGV A;  2J9Q A;  3N71 A;  5KWD A;  2LXL A;  5HS0 A;  1SVX A;  4N39 A;  4B93 B;  4Z68 A;  5JJT A;  3RO3 A;  4JXT A;  1E96 B;  2GRL A;  3AG1 E;  1H2U A;  3UM3 A;  2VGX A;  4HVB A;  1OWN A;  3UKU G;  3B7B A;  4GML A;  5HKP A;  5BNW A;  2EQX A;  1HO8 A;  2P9U G;  4N3B A;  4F53 A;  3TWR A;  3RO2 A;  3L82 A;  2EIJ E;  3EUV A;  3SZ7 A;  3CLJ A;  2F37 A;  3LCA A;  1LTX A;  1IHB A;  3D9N A;  4JC8 A;  4Y6C A;  4HBD A;  5JJ6 A;  3PUK A;  4B8A A;  3LJN A;  3FH5 A;  3TWV A;  4HOS A;  2YIN A;  3BG1 B;  3EIQ C;  5J08 A;  4GA0 A;  3Q49 B;  4DK5 A;  2C0L A;  4CYM D;  4PS8 A;  5AQB A;  4CDR A;  4HNA D;  5ENN A;  4ZFH A;  2WQH A;  3GZ1 A;  1EYH A;  3CK8 A;  4ATZ D;  2UWJ G;  4GTT A;  5FJY A;  3AG2 E;  5BXU A;  3HRA A;  4F7A A;  2KM4 A;  4WAF A;  2OVF A;  3T9K A;  2ETB A;  1S70 B;  3RKV A;  3ZUV B;  3FEX A;  4KZC A;  3SHF A;  4L2Y A;  5EIL A;  5G04 C;  4UWF A;  2I1J A;  1N9A A;  3O4Z A;  3U3W A;  1A17 A;  3ONL A;  2DWZ A;  3NF1 A;  3EHR A;  3ASF A;  3FUE A;  2EIM E;  5ITZ F;  4KVM A;  3EDT B;  2IO2 C;  2AWI A;  3FFL A;  4RLY A;  1HE8 A;  4B89 A;  1X81 A;  5AEN A;  1KT1 A;  3MKQ B;  4X8Q A;  3RJV A;  3SI5 A;  1BLX B;  1DCQ A;  3LDZ A;  4JB8 P;  3FTV A;  4K5C A;  2QC9 A;  4Q94 A;  1KLX A;  1UOH A;  2NXP A;  1DVP A;  3HVE A;  4ABN A;  4FHJ A;  3RU0 A;  3ESK A;  4DJA A;  3FUL A;  2XS8 A;  3AS5 A;  3RRM B;  2OEV A;  3WG7 E;  1UN8 A;  4AJW A;  1IKN D;  2PM6 A;  3KSQ A;  4NIK A;  3QDN A;  5EKQ D;  4AM9 A;  4G2V A;  3I5P A;  4L23 A;  3FTZ A;  2JAB A;  2XS1 A;  4RSY A;  2WXH A;  2R03 A;  1U3D A;  2IF4 A;  2IEJ A;  3CEQ A;  2P58 C;  2HR2 A;  4I6J A;  3QJZ A;  1S0P A;  4JZY A;  5BW8 C;  4A55 A;  1OWO A;  2XPY A;  4OAV B;  2WPV A;  4I1A A;  3U66 A;  5CCM A;  2VYI A;  1RZ4 A;  1K8K G;  4XE0 A;  4XI0 A;  3V2X A;  3W9G A;  3QB2 A;  2X6J A;  4YDY A;  5A6C A;  5JHB A;  1INZ A;  4MLP A;  5AAR A;  2JLB A;  3APF A;  4DX1 A;  3BG0 B;  1U3C A;  1YYH A;  3F6Q A;  3ASG A;  1OWL A;  4GB9 A;  3VLE A;  1JUQ A;  2R17 C;  1QNF A;  5ANL A;  3O48 A;  4IN3 B;  4DI3 A;  3TWS A;  3GYZ A;  3L16 A;  5BXO A;  3IBE A;  4HQD A;  2WXF A;  4GZC A;  1Y6I A;  2KBX A;  1S64 A;  3UPV A;  4XX5 A;  3ZYQ A;  3QWP A;  4GYO A;  4HOQ A;  4F1P A;  1HU3 A;  2XZD G;  2UY1 A;  5FQ7 A;  3CK9 A;  3Q15 A;  3DWL G;  4FU3 A;  3PS6 A;  3FEY A;  1HG2 A;  5CCL A;  1MX6 A;  4FUL A;  3D9L A;  1NL4 A;  4Q96 A;  2XGM A;  4DX6 D;  3ZXS A;  2DBA A;  3G2U A;  2NYJ A;  4DPR A;  2Y4T A;  2OOE A;  2HYZ A;  5G55 A;  3CVX A;  3S2A A;  4GTS A;  1N52 A;  3UTM A;  2RG8 A;  4B94 A;  3T8K A;  1HS6 A;  2WXG A;  4O1P A;  4AXH A;  3TG5 A;  3PRE A;  1OCO E;  3E34 A;  5T4Y A;  1E8W A;  1DNP A;  1V55 E;  2EIL E;  2WXK A;  1NFI E;  3ASO E;  4HOT A;  2M63 A;  5ENO D;  3BUA A;  1MX4 A;  2P9I G;  2OEW A;  1D8D A;  2HE0 A;  2I9C A;  5LCW J;  2IO3 C;  2P9N G;  3LEW A;  3G2S A;  2LXM A;  1IXV A;  4YVQ C;  1E8Y A;  2JEK A;  4AV7 A;  2WXJ A;  2WMN A;  3FU3 A;  5FWQ A;  3SF4 A;  1MYO A;  3PE4 A;  3ZYL A;  1WM5 A;  4U0Z A;  4I1O B;  4GTR A;  1DCE A;  2UY1 B;  2FUL A;  3FTW A;  3MV3 B;  4JEH A;  4ATG A;  3EHN A;  3ZNG A;  3CHS A;  3AS4 A;  2BF0 X;  3AG4 E;  3Q7F A;  1SZA A;  3R7R A;  3S7D A;  1MJ0 A;  3FDH A;  4NAC A;  5B1A E;  2XQ0 A;  5BT1 A;  1PAQ A;  5JJ7 A;  4BY6 A;  3UM0 A;  2E2E A;  2IQC A;  1H6O A;  3RAU A;  3FWV A;  4UI9 K;  4ILI A;  3CHM A;  5JMN D;  2DCP A;  4MS6 A;  3IV0 A;  4A1G A;  3D9M A;  5G05 J;  2ION A;  3ULQ A;  4BTB A;  2PL2 A;  3LY8 A;  3UMV A;  1BI7 B;  1A5E A;  3NZU A;  4YVO A;  5KNH D;  3JXI A;  1OWP A;  3ML8 A;  4BX8 A;  3E32 A;  1W3B A;  4AP2 A;  2YNQ A;  3DPY A;  1BD8 A;  2KZT B;  5EX0 A;  2AVP A;  4OAU C;  2WXR A;  3CVU A;  1FT2 A;  4N5Q A;  5ANR A;  2MYO A;  2V4H C;  2BED A;  2QY7 A;  3IHY A;  5FZS A;  4J8Y A;  4I1M A;  1XGW A;  4LEU A;  4A3V A;  3Q79 A;  4QQI A;  2X6K A;  4GZD A;  3DEO A;  1YCS B;  3PE3 A;  3D9H A;  1HF8 A;  2CHW A;  3FH8 A;  5CER B;  1U2V G;  4P29 A;  1UJK A;  3DXM G;  2YHC A;  5KNG A;  1H6K A;  2AXZ A;  4EQF A;  2LAH A;  3ZN3 A;  2AW6 A;  3T5V A;  3Q47 B;  5CRU A;  3RSE G;  3PUJ A;  2XEV A;  2IY0 C;  3FTX A;  2Y0B G;  3IHV A;  4L1B A;  4XZ4 A;  4U0S A;  4EBA G;  2R59 A;  1HX8 A;  3CV0 A;  4XKC A;  2NC9 A;  4KZ0 A;  4R7L A;  3T5X A;  4ACL A;  2ZXW E;  2J8S D;  5ARF A;  4GMR A;  1JCR A;  4XIF A;  5BUZ A;  5ARG A;  3EU5 A;  3D9O A;  4PS7 A;  4Q69 A;  3B7U X;  3ZHE A;  3ZGQ A;  3DSW A;  3E37 A;  3EHM A;  4GZ6 A;  2VGX B;  5G2N A;  3DSU A;  3I4R B;  3UKR G;  2WXI A;  3CHP A;  1HZ4 A;  1Y8M A;  2H6I A;  5M72 A;  5BV0 A;  4GTM A;  4AVX A;  1UW4 B;  4WNF A;  2IFU A;  4JA7 A;  5FQ4 A;  3R9M A;  3U4T A;  3LXU X;  1WG0 A;  2J09 A;  4GAA A;  3SD5 A;  1B89 A;  3UQ3 A;  4FAD A;  3HVE B;  5D0O D;  4GCO A;  1RW2 A;  4J8E A;  3SBS A;  3DPD A;  4OYS A;  3D9K A;  5FTP A;  3QC1 A;  3EIJ A;  5FIN A;  3Q75 A;  3CVV A;  3CHO A;  3FUH A;  4LSZ E;  4DI4 A;  5CHE E;  3HG0 D;  1IYG A;  3HXB A;  4NRH B;  2L9B A;  3Q9N C;  2VSN A;  3PZ2 A;  4HRN A;  2ZIS A;  4LRZ A;  4MRU A;  2WXO A;  5FIO A;  4ZHB A;  4BX9 A;  4U63 A;  5J90 A;  3MV2 B;  1TNU A;  1LD7 A;  3OXF A;  5D0Q D;  3KSL A;  1ZB1 A;  4URK A;  3PEU B;  4N2S A;  3MJW A;  4HRL A;  3MX3 A;  4G26 A;  1SA5 A;  3FU6 A;  3V30 A;  4FJZ A;  3KS2 A;  2DZN A;  4JW1 A;  5C2Y A;  4K5A B;  2AJA A;  4JD2 G;  2KCL A;  4UUC A;  3J5P A;  4KT6 B;  4HB5 A;  3UX4 A;  3I4G A;  3TWU A;  1SW6 A;  2FO7 A;  2XPZ A;  4HS2 A;  4MBG A;  4ILH B;  3UM2 A;  4CRW A;  3E33 A;  2MHK A;  2V8S E;  1O1S A;  3CSF A;  2GW1 A;  1IHG A;  4TXQ A;  3P1U A;  5HI7 A;  2VGY A;  3CKB A;  3FTS A;  4A63 B;  3D9P A;  4FJY A;  4B8C B;  2QFC A;  4KMO A;  4G8K A;  2A5E A;  3PZ1 A;  2GGF A;  4LNB A;  4WNG A;  3CR3 A;  3L17 A;  5LCW C;  3CK7 A;  4GTQ A;  2WQ6 A;  4K03 A;  3PZD A;  3U9W A;  4JA9 A;  2VSX E;  1NZN A;  2GRO B;  3MCX A;  1LF8 A;  3RRN B;  3UM1 A;  1FVH A;  4HOU A;  3AAA C;  3TXN A;  1NP7 A;  2DIW A;  3NAW A;  4A3T A;  2CG2 A;  1H0A A;  1X5B A;  2FEZ A;  2A5U A;  3FUM A;  5CEA A;  1Z5S C;  3KD7 A;  1MHQ A;  5A7D B;  4GYY A;  5AN8 A;  4LER A;  1AP7 A;  5E76 A;  1TJC A;  3SQV A;  4BSZ B;  3CKC A;  1P5Q A;  4WND A;  2L6J A;  1TNY A;  2HM8 A;  4O60 A;  3VTY A;  1K1A A;  2DZO A;  4J6I A;  4DLO A;  1BI8 B;  3NOC D;  3UT4 A;  2KC7 A;  3EHQ A;  3ABL E;  3C72 A;  2CFU A;  4F6R D;  2C0M A;  5CMW A;  1EF1 C;  4UWG A;  3E4B A;  3DSS A;  4GA2 A;  2L6B A;  5E75 A;  2B6C A;  2XRZ A;  3EU9 A;  2P9K G;  3UIN C;  4I9C A;  4CGW A;  2IJG X;  1TN7 A;  4I9E A;  4PH4 B;  3DSX A;  2XEH A;  4IUL A;  3ZIM A;  3SFZ A;  3L9T A;  3FUI A;  5ENR D;  5T3R A;  3ZPJ A;  4GMJ A;  2X6H A;  3MZL B;  5EID A;  1V54 E;  4PUC A;  3LY7 A;  2BUG A;  1K1B A;  4ANX A;  2V4L A;  4KVO A;  4YDO A;  2V5F A;  1N54 A;  5T8I A;  4HLL A;  2XGO A;  1SA4 A;  5A23 A;  2B0O E;  3OXG A;  4U8V D;  3AS8 A;  4U96 D;  5CBN A;  5HRY A;  5IY5 E;  2GRQ B;  2HO1 A;  4FLH A;  5JHA A;  3UI2 A;  3NBN B;  3GZ2 A;  3LKU A;  3QAR A;  2VTB B;  2RKK A;  2KZT A;  4RVB A;  3PVL A;  4M7C A;  3L08 A;  3MKQ A;  2WM9 A;  3TXM A;  2WXP A;  5ENQ D;  2CFZ A;  3Q73 A;  2WXN A;  2J4B A;  5LFA A;  1YMP A;  1Z3Y A;  3QWW A;  1N95 A;  3G2W A;  3CIA A;  3BEE A;  4TV3 A;  2WXM A;  4BT9 A;  3U64 A;  2MRI A;  2GRP B;  4A1S A;  1PC2 A;  5HQ8 A;  4U7E B;  4FA6 A;  3E30 A;  2C2L A;  2P9P G;  3UT8 A;  3FU0 A;  1ZBP A;  3TWT A;  1ELW A;  3KEA A;  3OXL A;  4G11 A;  5LP0 A;  2ETA A;  1OUV A;  3FUJ A;  2X38 A;  1WAO 1;  3ZKJ A;  4J8S A;  1Z3X A;  1HG5 A;  4I6G A;  3ZW3 A;  1WDY A;  2CHZ A;  2XCB A;  3TJP A;  1KZP A;  4CEM A;  5CBO A;  3SGH A;  1KT0 A;  3VLD A;  2DYS E;  4TUU A;  3QOU A;  3QAQ A;  1E8X A;  3JUI A;  4DRX E;  5C1D A;  2P9S G;  4CCA A;  2I6H A;  2LSV A;  4UI9 C;  4CZ2 D;  3PZ3 A;  4ANW A;  1FCH A;  4N5C A;  3B95 A;  3QK0 A;  1DC2 A;  4WWO A;  2KCK A;  2GRR B;  4JVS A;  3ONK A;  4EEC A;  3V79 K;  3ASH A;  1UN9 A;  3S7J A;  3JUE A;  3HXE A;  4RQI A;  4L7T A;  2E0I A;  2Y3A A;  2Q7F A;  3L13 A;  1HXI A;  4C0E A;  4JHJ A;  3ENE A;  2GRN B;  4J8F A;  3BU8 A;  4TRQ A;  5CEC B;  1QZ2 A;  2FBN A;  4GTO A;  2WB2 A;  1O1T A;  2VSY A;  2KXP C;  1MX2 A;  3PDN A;  2OV8 A;  1TJF A;  2L0I A;  3HXC A;  2QYU A;  1N11 A;  5KJN A;  4JHR A;  4HLE A;  1N4Q A;  1MZC A;  2YQ8 A;  2J4D A;  3PEV B;  3ASD A;  3D3M A;  1BU9 A;  3MKR A;  5G04 J;  3ZEF A;  5D66 A;  4WWN A;  4EBA A;  5BPP A;  2XEN A;  3JQ1 A;  4APF A;  2I2O A;  3L22 A;  4J7W A;  1Z6T A;  4DX7 D;  1AWC B;  1JCQ A;  1IQR A;  1FT1 A;  3LJ3 A;  3KAE A;  3DRA A;  3AU5 A;  4BER A;  4EZK A;  2GRM A;  1SQM A;  3FP3 A;  4UWL A;  3CVL A;  3Q9U C;  1VDY A;  3DBS A;  4U04 A;  4G23 A;  4K0R A;  2R02 A;  3QNK A;  2R2L A;  4RG6 A;  5FT9 A;  2IOS A;  4BT8 A;  2KCV A;  4Y6W A;  2PM7 A;  5CED B;  2LSU A;  2PQN A;  5G05 C;  5AIJ A;  3DEP A;  3WXX A;  2PQR A;  3URZ A;  4C9B B;  1NI1 A;  3B7R L;  1TEZ A;  3ULY A;  3AJI A;  3FY4 A;  4GYW A;  2BKK B;  2WXL A;  3UXG A;  4JPS A;  4APO A;  3GW4 A;  3JQ0 A;  4J8D A;  3DSV A;  2PNN A;  4DX5 D;  5KCM A;  3NQP A;  3R7Q A;  2Y1L E;  2X6I A;  5KJK A;  4KYO B;  4U8H A;  3T8M A;  2WVI A;  3CVY A;  3FU5 A;  4ANU A;  4GA1 A; 
#chains in the Genus database with same CATH homology
 5T4Y A;  1E8W A;  4A3T A;  4E85 A;  1DNP A;  2CG2 A;  4V3I A;  2WXK A;  3ZHE B;  1H0A A;  3LY9 A;  2ZU6 B;  4HOT A;  2M63 A;  2A4Z A;  3G2T A;  1X5B A;  4I6E A;  2Y4U A;  2FEZ A;  2A5U A;  3MYV A;  4UWK A;  3FUM A;  3ESL A;  3KD7 A;  4BSX A;  1MHQ A;  2I9C A;  4U07 A;  5A7D B;  4XI9 A;  5LCW J;  2FI7 A;  3LPZ A;  4CDM A;  3FUD A;  4GYY A;  3LEW A;  3G2S A;  2XGS A;  4O6F A;  4WWP A;  1ELK A;  3B7T A;  1JWG A;  4ILG A;  4YVQ C;  1HH8 A;  3R9A B;  1E8Y A;  4LER A;  2JEK A;  3B7S A;  3JYS A;  4AV7 A;  2WXJ A;  3CST A;  2WMN A;  1HFA A;  5KJM A;  5E76 A;  3FU3 A;  4I2W A;  3VLF A;  1TJC A;  2LO6 A;  3G2V A;  5FWQ A;  3CKC A;  1P5Q A;  3SF4 A;  4WND A;  2MOW A;  2L6J A;  3PE4 A;  3ZYL A;  2HM8 A;  1WM5 A;  4N3A A;  4U0Z A;  3VTY A;  2WXQ A;  4I1O B;  5FQ6 A;  4J6I A;  3CVQ A;  4W9R A;  2VQ2 A;  4DLO A;  3UT4 A;  2KC7 A;  2UY1 B;  2CHX A;  2FUL A;  4F1S A;  3FTW A;  3MV3 B;  4G1T A;  4JEH A;  2CFU A;  2X6F A;  2C0M A;  4H7X A;  5CMW A;  1EF1 C;  4UWG A;  3E4B A;  4NQ0 A;  4ATG A;  3EJN A;  3FUK A;  3EHN A;  3LYA A;  2I1K A;  3CQG B;  4GA2 A;  3CHS A;  4JL0 A;  3AS4 A;  2BF0 X;  5E75 A;  1ELR A;  1SZA A;  2XRZ A;  3R7R A;  4GZ3 A;  3S7D A;  3ZYM A;  4EZL A;  3FDH A;  4NAC A;  2XQ0 A;  5BT1 A;  3JCK C;  4YND A;  1PAQ A;  5JJ7 A;  4BY6 A;  1E7V A;  4ME2 A;  2E2E A;  4I9C A;  3TAX A;  4CGW A;  2IQC A;  5LX8 A;  3TGO A;  2IJG X;  1UG3 A;  3FWV A;  1QQE A;  5CMY A;  4UI9 K;  4I9E A;  3ZYK A;  1IQU A;  4PH4 B;  4ILI A;  4IUL A;  3RIB A;  3ZIM A;  3CHM A;  3SFZ A;  4CT4 A;  3CVN A;  1E7U A;  4U0U A;  4UWH A;  4CGV A;  2J9Q A;  4GZ5 A;  3FUI A;  3N71 A;  5T3R A;  2DCP A;  3ZPJ A;  4GMJ A;  3TL5 A;  4MS6 A;  2X6H A;  3IV0 A;  3ZFW A;  3FUF A;  3MZL B;  4A1G A;  2AXV A;  3FH7 A;  4FP7 A;  4PUC A;  1H2V C;  3D9M A;  5G05 J;  3LY7 A;  3OTN A;  2BUG A;  5AYW D;  4N39 A;  2ION A;  3QKY A;  3ULQ A;  2J07 A;  4ANX A;  2V4L A;  4C0M A;  4KVO A;  4BTB A;  3FHE A;  3NZS A;  2PL2 A;  3LY8 A;  5JJT A;  3RO3 A;  3UMV A;  2V5F A;  4JXT A;  1N54 A;  1E96 B;  3MEK A;  3NZU A;  5T8I A;  4AIF A;  4YVO A;  3HYM B;  2GRL A;  2XGO A;  1H2U A;  1OWP A;  3S7B A;  3ML8 A;  2VGX A;  4WUY A;  4BX8 A;  5A23 A;  3OXG A;  5DIZ A;  3B13 A;  4N3C A;  4HVB A;  1OWN A;  3AS8 A;  4GML A;  3C98 A;  5LOZ A;  1FVF A;  1W3B A;  5BNW A;  2HO1 A;  2EQX A;  1HO8 A;  4N3B A;  4UQZ A;  2VSO E;  4FLH A;  4AP2 A;  4F53 A;  2VTB A;  5JHA A;  4XKB A;  2YNQ A;  2VJ8 A;  3RO2 A;  3GZ2 A;  3LKU A;  2KZT B;  1NA3 A;  5EX0 A;  2AVP A;  2V0P A;  2WXR A;  2YHE A;  3CVU A;  5ANR A;  4KXK B;  3SZ7 A;  3QAR A;  2VTB B;  3CLJ A;  3LCA A;  4ANV A;  2QY7 A;  4B0Z A;  4JHK A;  4BWR A;  4DLQ A;  3D9N A;  2KZT A;  4JC8 A;  2BTD A;  4Y6C A;  2R5S A;  4RVB A;  3PVL A;  3L08 A;  3IHY A;  2IOL A;  3MKQ A;  2WM9 A;  4RG9 A;  5FZS A;  5JJ6 A;  3TXM A;  3PUK A;  2WXP A;  4B8A A;  4I1M A;  1XGW A;  4LEU A;  4A3V A;  2OVB A;  3FH5 A;  2WQ7 A;  4FLB A;  1XNF A;  2CFZ A;  4M3O A;  4HOS A;  2X6K A;  2YIN A;  3BG1 B;  3EIQ C;  2WXN A;  3IEG A;  4GZD A;  2J4B A;  5LFA A;  4QFV A;  4HFG A;  1H19 A;  1Z3Y A;  3QWW A;  5J08 A;  4GA0 A;  3PE3 A;  3G2W A;  3Q49 B;  4DK5 A;  2C0L A;  2FF4 A;  4F3V A;  4PS8 A;  3CIA A;  3BEE A;  4PDX A;  1HF8 A;  4TV3 A;  2WXM A;  4BT9 A;  4CDR A;  2CHW A;  3FH8 A;  3U64 A;  5ENN A;  2MRI A;  4P29 A;  1UJK A;  2WQH A;  2YHC A;  1H6K A;  1EYH A;  2AXZ A;  3GZ1 A;  4UQY A;  3CK8 A;  4A1S A;  4EQF A;  1PC2 A;  5HQ8 A;  2LAH A;  2L0T B;  2RD0 A;  1OWM A;  4FA6 A;  2UWJ G;  5FJY A;  1H2T C;  3ZN3 A;  4F7A A;  2KM4 A;  1E8Z A;  2AW6 A;  2C2L A;  3T5V A;  4CDN A;  3Q47 B;  3PUJ A;  3UT8 A;  5AJD A;  3CQC B;  3MGB A;  2XEV A;  3CHR A;  4WAF A;  3FTX A;  3IHV A;  2IU1 A;  2PZI A;  4L1B A;  3FU0 A;  3L6A A;  1ZBP A;  4XZ4 A;  4U0S A;  1ELW A;  2OVF A;  4EBA G;  1YA0 A;  3LVQ E;  3RKV A;  4D10 C;  3OXL A;  4G11 A;  2R59 A;  1HX8 A;  3FEX A;  4EPZ A;  5LP0 A;  3CV0 A;  4GA1 A;  4XKC A;  4KZC A;  5FQ8 A;  2NC9 A;  4KZ0 A;  1JWF A;  3LVR E;  3SHF A;  4R7L A;  1OUV A;  3FUJ A;  1E90 A;  2X38 A;  4L2Y A;  5G04 C;  1WAO 1;  3FTU A;  4UWF A;  3T5X A;  2I1J A;  4J8S A;  3RK6 A;  4ACL A;  1Z3X A;  1HG5 A;  3CHQ A;  4I6G A;  5ARF A;  3ZW3 A;  3O4Z A;  2CHZ A;  2LNI A;  3QWV A;  3U3W A;  1A17 A;  2XCB A;  3TJP A;  4XIF A;  4CEM A;  5BUZ A;  2CG3 A;  4GCN A;  3ONL A;  3SGH A;  5ARG A;  5AJL A;  1KT0 A;  3D9O A;  3NF1 A;  4PS7 A;  4Q69 A;  3B7U X;  3ZHE A;  2XCC A;  3ZGQ A;  3VLD A;  4TUU A;  3ASF A;  3EHM A;  3QOU A;  3FUE A;  4GZ6 A;  2VGX B;  5G2N A;  4KVM A;  3EDT B;  3QAQ A;  3PNT B;  2WMO A;  3FTY A;  2AWI A;  3FUN A;  3FFL A;  1E8X A;  3ZVV A;  3JUI A;  5C1D A;  3VTX A;  1JPL A;  4EZJ A;  1HE8 A;  3I4R B;  4IRU A;  4B89 A;  5BV1 A;  3AU4 A;  2J08 A;  5AEN A;  1KT1 A;  4CCA A;  3CVW A;  2I6H A;  3MKQ B;  2LSV A;  3RJV A;  3K9I A;  4UI9 C;  3SI5 A;  2WXI A;  3CHP A;  1ZU2 A;  1HZ4 A;  1Y8M A;  5M72 A;  5EX3 A;  5BV0 A;  1NA0 A;  4AVX A;  1UW4 B;  3LDZ A;  4FHK A;  4ANW A;  4N2Q A;  1FCH A;  2IFU A;  4N5C A;  4WNF A;  3FTV A;  3QK0 A;  4I2Z A;  4Q94 A;  4JA7 A;  1KLX A;  4WWO A;  5FQ4 A;  4CT0 A;  4ACK A;  4BTA A;  2NXP A;  1DVP A;  3HVE A;  2LAI A;  2KCK A;  3MA5 A;  4FHJ A;  4ABN A;  3RU0 A;  3U4T A;  3ESK A;  3APD A;  3LXU X;  2J09 A;  3L54 A;  3FUL A;  4GAA A;  3AS5 A;  4DJA A;  4I43 A;  3SD5 A;  3SBT B;  3RRM B;  1B89 A;  4FC8 A;  3UQ3 A;  4OVV A;  4JVS A;  4AY5 A;  1UN8 A;  3Q5M A;  3ONK A;  4AJW A;  2XRY A;  4EEC A;  4FAD A;  3HVE B;  3ASH A;  5D0O D;  2AXU A;  1UN9 A;  4GCO A;  2PM6 A;  3S7J A;  3HDX A;  3QDN A;  4J8E A;  2E0I A;  2Y3A A;  4L7T A;  2XHE A;  5EKQ D;  3DPD A;  1L5J A;  2Q7F A;  3SBS A;  4OYS A;  4AM9 A;  4HOR A;  3D9K A;  4G2V A;  3L13 A;  5FTP A;  3QC1 A;  1HXI A;  3I5P A;  4C0E A;  4L23 A;  3EIJ A;  3ZRH A;  4JHJ A;  3ENE A;  3FTZ A;  4AEZ C;  1PY1 A;  3CVV A;  4RSY A;  4J8F A;  3CHO A;  2XPI A;  2WXH A;  3FUH A;  4TRQ A;  4DI4 A;  2X3M A;  1QZ2 A;  4G24 A;  2FBN A;  1U3D A;  5CHE E;  2IF4 A;  3CEQ A;  2P58 C;  2HR2 A;  3HIZ A;  1IYG A;  4NRH B;  2L9B A;  2WB2 A;  5FZR A;  4I6J A;  3PRZ A;  3QJZ A;  1S0P A;  2VSY A;  4JZY A;  5BW8 C;  2VSN A;  4WNE A;  4A55 A;  1OWO A;  2XPY A;  3P2B A;  4LCT A;  3PDN A;  2WPV A;  4HXI A;  4LRZ A;  4MRU A;  3RRU A;  2OV8 A;  2WXO A;  4I1A A;  3OAW A;  3U66 A;  4BX9 A;  1TJF A;  5CCM A;  2L0I A;  1BPO A;  4U63 A;  2VYI A;  1MQS A;  5J90 A;  5KJN A;  3MV2 B;  4JHR A;  4AOF A;  4HLE A;  3OXF A;  4XE0 A;  5D0Q D;  3TG4 A;  2YQ8 A;  4XI0 A;  2J4D A;  3PEV B;  3ASD A;  3D3M A;  4URK A;  3PEU B;  3QB2 A;  2X6J A;  4N2S A;  3MJW A;  5A6C A;  3MX3 A;  4G26 A;  3MKR A;  5G04 J;  3FU6 A;  3ZEF A;  5JHB A;  1INZ A;  4FJZ A;  4MLP A;  3Q4A B;  4WWN A;  3KS2 A;  2JLB A;  3APF A;  3BG0 B;  1U3C A;  4JW1 A;  4EBA A;  4L2L A;  5BPP A;  3ASG A;  1OWL A;  5C2Y A;  3JQ1 A;  4JEU A;  4GB9 A;  2KCL A;  2I2O A;  3L22 A;  3ML9 A;  3PNL B;  4APF A;  1SZ9 A;  1EPU A;  1Z6T A;  3VLE A;  1JUQ A;  4IYP A;  2OND A;  2R17 C;  4KT6 B;  1QNF A;  4GPK A;  1IQR A;  3O48 A;  4IN3 B;  5ANL A;  4DI3 A;  3UX4 A;  3LJ3 A;  3GYZ A;  3KAE A;  3AU5 A;  3I4G A;  4EZK A;  3L16 A;  5FZQ A;  2GRM A;  1SQM A;  3FP3 A;  2FO7 A;  4UWL A;  2XPZ A;  3IBE A;  4HS2 A;  4PS3 A;  3HHM A;  4ILH B;  4CRW A;  3CVL A;  2WXF A;  4GZC A;  1UJJ A;  1VDY A;  3DBS A;  4LUN U;  4U04 A;  1Y6I A;  5KJL A;  2MHK A;  2V8S E;  2ILR A;  4G23 A;  4UI9 J;  3CSF A;  2GW1 A;  3UPV A;  1EDU A;  4K0R A;  4XX5 A;  1IHG A;  3QNK A;  3IKO B;  3CGH A;  4MKT A;  3QWP A;  4GYO A;  4RG6 A;  3ZYQ A;  4HOQ A;  5FT9 A;  2IOS A;  4OVU A;  3P1U A;  5EDS A;  5HI7 A;  1HU3 A;  4BT8 A;  2UY1 A;  2KCV A;  4Y6W A;  2PM7 A;  3S7F A;  2NSZ A;  2VGY A;  3D9J A;  3CKB A;  4E6H A;  4H7Y A;  4AY6 A;  5FQ7 A;  2LSU A;  2PQN A;  3FTS A;  3CK9 A;  5G05 C;  3Q15 A;  5AIJ A;  3WXX A;  2PQR A;  3D9P A;  4FU3 A;  4FJY A;  4B8C B;  2QFC A;  3PS6 A;  3URZ A;  4BFR A;  4C9B B;  4KMO A;  3FEY A;  2GGF A;  1HG2 A;  5CCL A;  3B7R L;  4WNG A;  3CR3 A;  1TEZ A;  3GZS A;  3L17 A;  3KEZ A;  5LCW C;  4GU5 A;  3I3N A;  4FUL A;  3CK7 A;  4I17 A;  3D9L A;  3FY4 A;  4GYW A;  4J0U A;  2J49 A;  2WXL A;  3CVP A;  4Q96 A;  2WQ6 A;  2XGM A;  4JPS A;  4K03 A;  3D9I A;  3PZD A;  4APO A;  4UQX A;  4G25 A;  3GW4 A;  3U9W A;  3JQ0 A;  1GW6 A;  4J8D A;  3UT7 A;  3ZXS A;  4JA9 A;  2DBA A;  2VSX E;  3G2U A;  5KCM A;  3NQP A;  4NUR A;  1NZN A;  3R7Q A;  3MCX A;  3UUX A;  4DPR A;  2X6I A;  3LS8 A;  5KJK A;  2Y4T A;  3APC A;  2OOE A;  4KYO B;  5DBK A;  2HYZ A;  5G55 A;  1LF8 A;  3CVX A;  3S2A A;  4KBQ A;  4U8H A;  3RRN B;  1N52 A;  1FVH A;  2RG8 A;  4B94 A;  1HS6 A;  2WXG A;  4HOU A;  3TXN A;  1NP7 A;  2KAT A;  2DIW A;  3T8M A;  1WY6 A;  2WVI A;  3CVY A;  4AXH A;  3TG5 A;  3FU5 A;  3PRE A;  4ANU A;  3PH0 C;  3SNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...