4YVOA

Crystal structure of the tpr domain of arabidopsis flu (flu-tpr)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
119
structure length
119
Chain Sequence
PKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein FLUORESCENT IN BLUE LIGHT, chloroplastic
publication title The Non-canonical Tetratricopeptide Repeat (TPR) Domain of Fluorescent (FLU) Mediates Complex Formation with Glutamyl-tRNA Reductase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Fluorescent protein
total genus 57
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yvoA00
3QDNA 5D0OD 3QWVA 4AY5A 2DBAA 3CEQA 3CK8A 3CV0A 4HOTA 4I2ZA 4GYWA 4CGWA 5M72A 3O48A 3QKYA 4J8EA 2Y4TA 3QWPA 2C2LA 4ME2A 2XCBA 4GYYA 4GA1A 1HZ4A 2VSYA 2WQHA 3Q15A 3Q47B 4XI9A 4WNEA 3LPZA 3CK7A 1B89A 1YA0A 3MV3B 2XEVA 2VYIA 2XGMA 3U3WA 4J8FA 2VGXB 5FZRA 1NZNA 2LSUA 3Q5MA 3CVNA 4UQZA 4YVQC 1P5QA 3NF1A 2JLBA 3R9AB 2P58C 5AYWD 4NQ0A 2YHCA 4I1AA 3UPVA 5KJLA 4U0SA 4AM9A 1IYGA 4AIFA 4WNFA 4ABNA 4B94A 4BWRA 4JA7A 1NA0A 4APOA 4G25A 2HYZA 4GZ6A 5JJ7A 4U07A 4WNDA 4IN3B 2VGXA 5CCLA 4UI9K 3TGOA 3RIBA 4NRHB 2PQRA 3CKCA 3GYZA 3CK9A 2C0MA 3LY9A 4KXKB 3CVPA 2KCKA 4YNDA 3CVQA 5ARGA 4GA2A 3ASHA 4N2QA 3K9IA 3RJVA 4I17A 1WAO1 4UQXA 4U0UA 3GZ2A 4GA0A 2BUGA 4Y6WA 3S7BA 5HQ8A 4XIFA 3SZ7A 4N3BA 5EX0A 5ARFA 3AS5A 2C0LA 3HYMB 3VTYA 4HORA 1ELRA 2PZIA 5CCMA 3MA5A 1KT1A 2VSNA 2I6HA 4YVOA 5FTPA 2Y4UA 1E96B 3PDNA 3ASGA 3LKUA 1ZU2A 4RG9A 1FCHA 3LY8A 2MHKA 2NC9A 4W9RA 5EKQD 3KS2A 3EDTB 4GCOA 3PE4A 4U0ZA 2XGOA 1XNFA 4H7YA 3IEGA 2ONDA 2FF4A 2WPVA 4CGVA 3VTXA 2IFUA 5G05C 5G05J 4I9EA 4A1SA 4GPKA 2YQ8A 4N5CA 4BT8A 5LCWC 3WXXA 3LYAA 4N3AA 3S7DA 5DIZA 3RU0A 1W3BA 1OUVA 3ZHEA 3QWWA 5LCWJ 4Y6CA 2FO7A 4G26A 5BNWA 4O6FA 4CDRA 4EQFA 4HOUA 3LCAA 4HOQA 4UI9C 5G04C 1HH8A 3AS8A 1HXIA 4UI9J 5EX3A 2IF4A 1QZ2A 3KD7A 5G04J 4JHRA 3SF4A 3JYSA 4GZ5A 3ULQA 1A17A 2KCLA 3ZPJA 3LY7A 4N3CA 4G2VA 4N39A 5DBKA 2L6JA 4BTAA 4J0UA 3AS4A 5BW8C 2XCCA 4GCNA 5FZQA 3ZFWA 3Q49B 4KYOB 3GZ1A 3S7FA 2VQ2A 2HR2A 2LNIA 3TG4A 3Q4AB 3QOUA 3MV2B 2UY1A 3ASDA 2VGYA 1WM5A 3RO3A 2FEZA 1KT0A 1KLXA 1PC2A 4J8DA 4BTBA 3N71A 5JJTA 3OXGA 1NA3A 4RG6A 3FFLA 5A7DB 3ZHEB 5FT9A 2AVPA 3TAXA 2XGSA 2LSVA 2Q7FA 2FI7A 4GYOA 4KBQA 2PL2A 2R5SA 3BEEA 4UQYA 4I2WA 3UQ3A 5A6CA 2GW1A 3TG5A 3KAEA 5KJNA 1ELWA 3CVLA 4F3VA 3ZGQA 3UUXA 3GW4A 5CHEE 3OXFA 5JJ6A 4WUYA 3ASFA 4GZ3A 1ZBPA 4I9CA 2UWJG 3OXLA 1QQEA 4JA9A 3MKRA 3RKVA 2XPIA 2V5FA 5HI7A 4HOSA 5C1DA 3FWVA 2QFCA 2J9QA 2UY1B 5KJMA 3U4TA 5D0QD 2FBNA 4AY6A 4LEUA 2PQNA 3E4BA 4U04A 2OOEA 5BT1A 3ZN3A 1TJCA 3FP3A 4JL0A 4G23A 5FZSA 2HO1A 3MEKA 4H7XA 4XI0A 3S7JA 4G24A 2KATA 4BT9A 4G1TA 3ESKA 2E2EA 2KC7A 4WNGA 3RO2A 5KJKA 5FJYA 3PE3A 1IHGA 1Y8MA 2KCVA 3URZA 4N2SA 3CKBA
chains in the Genus database with same CATH superfamily
4HRLA 2CHXA 3NBNB 4UWGA 3AG2E 4MRUA 2P9UG 3AAAC 4TV3A 1BLXB 2WXMA 4K5CA 4O1PA 4J8EA 4UWHA 3LVRE 1MX2A 1TNOA 3QWPA 1Z6TA 2XCBA 1JCSA 3G2TA 4YDYA 2WQHA 3Q15A 2DVWA 3BUAA 4F6RD 1B89A 1YA0A 4I1MA 4HS2A 2OVBA 3ULYA 2XGMA 4LNGA 1NZNA 2IO2C 3CVNA 5AYWD 1KPSB 2YHCA 1OWPA 5EIBE 4GAAA 4JVSA 5FWQA 4B94A 4DX1A 1HO8A 2QYJA 5FQ6A 3FH7A 4U7EB 5G55A 4FHJA 4GZ6A 4WNDA 4IN3B 4UI9K 3TWUA 5KNHD 2ZXWE 4EZKA 1UN8A 2WM9A 2B0OE 3MJWA 1BI8B 2LO6A 3CVPA 2ETAA 5AJLA 2GRMA 4L1BA 5BUZA 4GA2A 4ACLA 4N2QA 2WXPA 3K9IA 3FUFA 2P9SG 4NURA 2R02A 3QAQA 3TWWA 1TNYA 4GA0A 2BUGA 4Y6WA 3ABKE 5HQ8A 4F53A 1SVXA 1UOHA 4NACA 4N3BA 3X2QE 1PY1A 3AS5A 2C0LA 3B7SA 4CYMD 1ELRA 1OCCE 3I5PA 4GTRA 3SQVA 3ONKA 4WWOA 2XPYA 1K1BA 2X3MA 2DYSE 3CHOA 2BTDA 3DBSA 4CT4A 1S70B 3G2UA 3ASGA 2XENA 1EYHA 4E6HA 3EJNA 4L2LA 4A3VA 4J6IA 3ZYMA 1O1SA 3KS2A 4AJWA 3EDTB 3JXIA 1NP7A 1E7VA 1XNFA 4H7YA 4ATZD 4G8LA 4DX7D 3EHNA 3MCXA 3B95A 2IFUA 1S63A 3C98A 1H0AA 3PZ1A 5G05J 4I9EA 3V2OA 4HXIA 3CSFA 3U9WA 2H6FA 3BG0B 2I2OA 3CVYA 4N5CA 4MKTA 2P9NG 4OVVA 4IYPA 2IONA 3ZHEA 1N0RA 4CDNA 4G26A 3EIQC 1A5EA 2B6CA 5ANLA 4B0ZA 4EQFA 4HOUA 5AQ9A 4GB9A 4JPSA 3MYVA 3DSVA 3CSTA 4J7WA 1HH8A 5CBOA 1AWCB 1HXIA 5G04J 5BV0A 5LX8A 4HRNA 3U64A 3ZPJA 3EHQA 2L6JA 3LVQE 4PS7A 4BTAA 4J0UA 3L82A 2L9BA 3AJIA 2OCCE 5FQ4A 4GCNA 5EYPF 4DX6D 4I6JA 1FPPA 4KYOB 3GZ1A 1OWLA 1E7UA 5AIJA 4DI4A 2LNIA 3Q4AB 3QOUA 4B8AA 4KVOA 4TXQA 4B8CB 1AP7A 2ILRA 2QY7A 2VGYA 4DLQA 4HRMB 1KT0A 1KLXA 2FULA 2ZIRA 3CQCB 3RSEG 1PC2A 3N71A 3B7RL 3RAUA 5JJTA 3FEYA 3UKRG 5D66A 3W9GA 4AVXA 4F1SA 2MYOA 2BEDA 2ETBA 2EQXA 2J09A 4GYOA 4KBQA 2X6JA 3Q9NC 4GZCA 4XE0A 3BEEA 3RRUA 5H7PA 2DZOA 2FO1E 4I2WA 1N4PA 1K3ZD 1SW6A 3L13A 5AN8A 2HM8A 5A6CA 3TG5A 5KJNA 1O1TA 3CVLA 3IKOB 4F3VA 3UUXA 2X6KA 1YCSB 2XPZA 2H6GA 2X38A 2AXZA 4JZYA 3OXFA 1LF8A 4WUYA 3DWLG 2XZTG 1HF8A 3ASFA 4GZ3A 4I9CA 2UWJG 5AAOA 2DYRE 4M7CA 3CQGB 1BI7B 2XPIA 4UWFA 3I3NA 4GTTA 5KNGA 3T8KA 3E33A 3ZXPA 4HOSA 2H6HA 3ASOE 1UW4B 5LOZA 1S0PA 1WY6A 2UY1B 3TWXA 1EPUA 4XZ4A 3TXMA 2JABA 2P2CP 4LEUA 1UG3A 5AQBA 3E4BA 1N4QA 2R2LA 5FQ7A 3VLEA 1MX4A 3EHRA 1G3NB 5BT1A 3ZN3A 2J07A 1TJCA 5E75A 1QNFA 4H7XA 2R17C 1JCRA 3FUHA 4G24A 4DX5D 3PZDA 3E30A 5EILA 3ZNGA 4G1TA 2WXNA 4KMOA 2KC7A 3D3MA 3JUIA 2GGFA 1X5BA 3C3OA 2EIJE 4L2YA 3RO2A 3Q7FA 5CMYA 3RRMB 4HVBA 5D0OD 4AY5A 3CEQA 4IULA 3CVUA 2BKGA 3CK8A 1UJJA 4HOTA 4I2ZA 1K1AA 4CGWA 1N52A 5KCMA 4CDMA 2IJGX 1XGWA 3LS8A 3LXUX 4X8QA 4ME2A 1H2UA 5BV1A 3CIAA 3SD5A 4AV7A 4GYYA 1RZ4A 1L5JA 1NI1A 2GRPB 3Q47B 3APCA 4XI9A 3LPZA 4CT0A 2DIWA 5CECB 4U8VD 3D9MA 1TN8A 3TL5A 3Q5MA 4GMLA 3RRNB 5JA4D 2NXPA 3CHPA 1OWOA 4F7AA 1TYQG 5EYLA 3UT4A 1KZPA 2P58C 4P29A 4NQ0A 4I1OB 1ZB1A 3PEVB 1OCRE 3UPVA 4U0SA 4AM9A 4A3TA 4HBDA 3D9PA 3LDZA 4ABNA 4PDXA 3HDXA 2V4LA 1V54E 4JA7A 3C72A 5AARA 1E8XA 3L16A 1X81A 1Z5SC 3T5XA 3G2SA 5JJ7A 1DCQA 3PNLB 2VGXA 5CCLA 2OV8A 3CVVA 3CHSA 3TGOA 3UT8A 3RIBA 3IXEA 4AEZC 1N54A 5EDSA 2OEWA 3CK9A 2C0MA 4KXKB 5FINA 2V5QC 4C0MA 4XKCA 3EHMA 1VDYA 3SFZA 2XHEA 4JEHA 5ARGA 2A5EA 3JUEA 4KZ0A 2WQ6A 3ZUVB 3O4ZA 4LCTA 3S7BA 2WXGA 2I9CA 1N94A 4XIFA 3B7TA 4U8YD 2P9IG 3C3QA 5CCMA 2AWIA 3MA5A 4HLEA 1H2TC 2VSNA 2I6HA 3VLDA 2WQ7A 4YVOA 1OCOE 2P9LG 3ABME 3TWVA 1QYMA 4D10C 4RVBA 3ML8A 3D9NA 1FCHA 3Q73A 2NC9A 5EKQD 5BXOA 3FULA 5B1BE 2F0YA 4YDEA 2NSZA 3PE4A 4RLYA 2WXFA 3IEGA 2AW6A 2J08A 1ELKA 2ONDA 4CGVA 3VTXA 5G05C 3MKQB 3R9MA 4PS8A 1O1RA 2YQ8A 1JWGA 4EBAG 2WXJA 2RFMA 3WXXA 3LYAA 4DJAA 4N3AA 3GZSA 3S7DA 2WMNA 5JHAA 4EHMA 1W3BA 1D8DA 4DLOA 5LCWJ 4EZLA 3CR3A 2A5UA 4Y6CA 1EF1C 2XQ0A 4O6FA 4CDRA 3HXCA 4K03A 5T8IA 3LCAA 4HOQA 2I1KA 3UXGA 3DEOA 4JHKA 5G04C 3TWRA 4UI9J 1QZ2A 1E8WA 4LSZE 4JHRA 5BXUA 3JYSA 4GZ5A 3ULQA 3PZ2A 4Z68A 1A17A 4NIKA 4J8SA 4G2VA 2L0IA 3AS4A 2QC9A 4ANXA 3L54A 5J08A 5CBNA 3Q49B 2WXRA 2RKKA 2VQ2A 4KVMA 1BD8A 4BEPA 3D9OA 1QBQA 5ENOD 3TG4A 3C5RA 2UY1A 3ASDA 1WM5A 2L6BA 1GW6A 3D9LA 2FEZA 2Y69E 1SZ9A 1N4SA 4FHKA 3L9TA 4BTBA 3AU5A 2H6IA 3CLJA 3FH5A 1NA3A 4BX8A 4RG6A 3FFLA 1MYOA 2EILE 3FH8A 2AVPA 3C3RA 4FA6A 3S2AA 2Q7FA 2FI7A 2Y3AA 2ETCA 4BSXA 1E90A 4UQYA 2WB2A 3SFYA 2OVFA 2XEHA 4R7LA 3UINC 4A63B 4LNBA 4C9BB 2GW1A 1ELWA 4PS3A 3DXKG 3ZYQA 3HHMA 3PH0C 4QQIA 3W9FA 5ENQD 4RSYA 2MRIA 2JEKA 2DZNA 3OXLA 2AJAA 1D8EA 1BU9A 3FUKA 3ZU7B 4JA9A 3MKRA 3RKVA 4GMJA 5HKPA 3ABLE 2NYJA 5C1DA 3L22A 5KJMA 4ILGA 1U3CA 5D0QD 2FBNA 4AY6A 5A23A 2PQNA 4U04A 3IHVA 2OOEA 3FP3A 1HU3A 5FZSA 3IV0A 4EBAA 5ENTD 3KEAA 4U95D 4XI0A 3S7JA 2GRQB 3KEZA 4JEUA 3CVXA 4HFGA 4XX5A 3U66A 2J49A 4FULA 2WXLA 3E34A 3FU5A 3D9HA 2VTBB 3CKBA 2LXMA 4JW1A 3QDNA 3TWTA 3QWVA 2DBAA 2MOWA 3PS6A 3UIOC 1DC2A 3FU0A 4OAUC 1TJFA 3CV0A 1DNPA 4TXRA 4G11A 2BKKB 5KWDA 4TUUA 4GYWA 5M72A 3SFXA 3P1UA 3O48A 3G2VA 1E8ZA 2Y4TA 4HNAD 5JMND 1KZOA 4GA1A 4FLHA 4L7TA 2X6IA 3EUVA 4U63A 3CK7A 5CRVA 3TWSA 3MV3B 2XEVA 2VYIA 4F1PA 1S64A 3U3WA 3APDA 4V3IA 4J8FA 4E85A 5FZRA 5ENNA 1EDUA 2XRYA 2AXUA 3JXJA 4UUCA 4YVQC 2JLBA 1N4RA 4BSZB 4I1AA 1NFIE 5KJLA 2OEVA 3VLFA 1IYGA 4AIFA 4ILIA 4GTPA 3B7BA 1OWNA 4APOA 2XRZA 1NL4A 4G25A 3CHRA 4U07A 4ANVA 1IXVA 3IBEA 1HE8A 3I4GA 3J5PA 1HG5A 4NRHB 4BX9A 3GYZA 2I1JA 4C0EA 3HG0D 3V30A 4LERA 4Q96A 1MJ0A 4YNDA 3BQOA 1K8KG 3ASHA 4L23A 3PUKA 5FIOA 1WDYA 4UQXA 4K5AB 3V31A 3GZ2A 3SI5A 3HXDA 1YYHA 4DUIA 4KT6B 3SZ7A 3NB2A 1H6OA 1TR4A 4DK5A 5ARFA 3DSTA 3HYMB 3VTYA 2YHEA 4ILHB 2PZIA 3ISMC 3MX3A 1H19A 3DEPA 3ESLA 5FTPA 1FVHA 2Y4UA 3DPYA 4U8HA 3DSWA 4WWPA 3DSSA 3FUMA 3LKUA 1ZU2A 3FTWA 4CZ2D 2GRNB 3LY8A 4Q94A 2MHKA 1MHQA 3ML9A 5J90A 2V0PA 1OT8A 4JXTA 3FTXA 4HI8A 5ENSD 4DPRA 4K0RA 2XGOA 3EIJA 3L08A 1FVFA 4BERA 3PEUB 2PNNA 3CHQA 1N11A 1SA5A 4ANUA 2WPVA 2FF4A 3AU4A 5B1AE 3TWQA 3FTVA 4A1SA 4GPKA 4O1OA 2WXHA 4FC8A 1Y6IA 5LCWC 1OCZE 3RU0A 3T9KA 1OUVA 4EZJA 1OWMA 4GTQA 4HLLA 2RD0A 5BNWA 2Y0BG 5JHBA 2WXKA 4ACKA 1UJKA 1D9SA 2P9PG 2DCPA 3QK0A 4UI9C 3SBTB 4BETA 3D9JA 3AS8A 4B93B 5EX3A 2IF4A 4XEIG 3B13A 3ZYKA 3PUJA 3WG7E 3MZLB 2F37A 3B7UX 4N3CA 3FEXA 4UWKA 2ZGDA 1LD7A 2VGEA 4AP2A 1JWFA 3QARA 3DSXA 5HS0A 5ENPD 5BPPA 3UTMA 3PREA 4LG6A 3FU6A 5HRYA 1OY3D 4PUCA 5CEAA 3ASNE 4FP7A 5CEDB 1RW2A 2BF0X 4A1GA 1WG0A 1Z3XA 2A4ZA 3NZUA 1H2VC 4U96D 3PZ4A 2ZGGA 5LP0A 4BFRA 5T3RA 2IU1A 4XKBA 3BG1B 4TXPA 1INZA 3KSLA 1Z3YA 4YDWA 3JQ1A 4N5QA 3TAXA 2XGSA 3ZIMA 3ONLA 2R59A 1SA4A 4ZHBA 2VTBA 4GZDA 3ENEA 4TUMA 5AQAA 2LXLA 2CFZA 3UI2A 3SBSA 3ZGQA 3PRZA 3GW4A 5CHEE 4OAVB 3TXNA 3G2WA 3NAWA 3DSUA 3FY4A 1ZBPA 3TJPA 3FHEA 1QQEA 4GU5A 3NOGD 5B3SE 3PVLA 1IKND 2V5FA 1YMPA 5HI7A 3ZRHA 4J8YA 4GTMA 3F6QA 4ATGA 4B89A 3U4TA 2XS8A 4UWLA 3QNKA 3FU3A 1V55E 3ULEG 4G23A 1HS6A 2HO1A 3HVEB 2X6FA 4HB5A 4JC8A 4ANWA 2KATA 2EIME 3D9KA 4PH4B 3CHMA 3ESKA 3Q79A 4WNGA 4O60A 5KJKA 5FJYA 3PE3A 1IHGA 5E76A 1N0QA 3URZA 4GMRA 2GROB 3NZSA 3BU8A 4BESA 1MQSA 2HE0A 5EIDA 3PZ3A 1U2VG 3DPDA 4EECA 2VSOE 2XS1A 3QKYA 3T5VA 2CG3A 2C2LA 2GRLA 1E8YA 2KBXA 1HZ4A 2VSYA 2KZTB 2DWZA 4HI9A 2X6HA 4WNEA 4DRXE 2VGXB 2LSUA 3EU9A 4UQZA 2KXPC 1P5QA 2VSXE 3NF1A 3R9AB 2J4DA 2WVIA 5LFAA 4I6EA 3APFA 5AQ7A 4GTVA 3SO8A 3FTSA 2M63A 2IEJA 4WNFA 5CRUA 4BWRA 1TNBA 1NA0A 2AXVA 3AG4E 3Q7AA 2HYZA 3FTYA 3FUEA 3FTUA 2PM6A 4BY6A 2WXIA 2IQCA 2PQRA 3CKCA 2XZDG 4DX2A 2PM7A 3ZEFA 3LY9A 3Q9UC 1DCEA 4QFVA 2LAIA 2KCKA 4I6GA 2R03A 4C48B 3UKUG 1OXJA 3CVQA 5T4YA 2IO3C 5IY5E 5C2YA 3RJVA 4I17A 1WAO1 1TEZA 4U0UA 1U3DA 1LTXA 3AG3E 5FQ8A 2L0TB 3DXMG 5EX0A 1Q2ZA 3UM2A 3PNTB 4HORA 3ZKJA 3RK6A 4FLBA 3IHYA 4CEMA 3HXEA 3CGHA 3UM3A 3R7RA 1KT1A 5G2NA 1JUQA 4RQIA 1TNZA 5D2MC 3UT7A 1E96B 2LAHA 3PDNA 3ZVVA 3L17A 2WXQA 2WMOA 4RG9A 3QJZA 3UX4A 2ZISA 4W9RA 5ANRA 1H6KA 1TNUA 4GCOA 1FT2A 3L6AA 3HRAA 4U0ZA 2F8YA 2XEEA 3CVWA 1IHBA 2YNQA 3P2BA 2F8XK 4KZCA 2R05A 3HXBA 1IQRA 4LUNU 4K5BA 1PAQA 3KSQA 4BT8A 4ZFHA 4JB8P 5DIZA 4M3OA 3QWWA 3LJNA 2FO7A 3JCKC 1H6PA 4FJYA 3SHFA 1UN9A 2CHZA 3NQPA 2WXOA 1N9AA 4LRZA 2E0IA 1IQUA 4WWNA 2IOSA 3FUDA 3MKQA 4TRQA 2LUHA 3KD7A 3HIZA 3AG1E 3SF4A 2KCLA 3E32A 3LY7A 3UM0A 3LEWA 4N39A 5DBKA 3I4RB 1BPOA 5BW8C 4DI3A 2XCCA 3HXFA 3ZW3A 4JHJA 3D9IA 5EN5D 2VJ8A 3QC1A 1MX6A 4FJZA 4GPMA 3T8MA 5FZQA 3ZFWA 3FUJA 3ZYLA 2KM4A 1MZCA 2J8SD 3S7FA 2IY0C 2HR2A 2V8SE 1LD8A 1DVPA 1SZAA 3MV2B 4APFA 1HX8A 2V4HC 4URKA 4LNUD 2CG2A 3Q75A 3RO3A 1TN6A 4OYSA 4CCAA 3V79K 1JPLA 1O5MA 3SNXA 4L9PA 2CHWA 2EIKE 4J8DA 3MGBA 3OXGA 4A55A 4MLPA 3HVEA 5CERB 4GTSA 3OAWA 3OTNA 5A7DB 3ZHEB 3R7QA 5FT9A 4GTOA 2IOLA 3E37A 2LSVA 2PL2A 4Q69A 2R5SA 4AXHA 2YINA 1N95A 3UM1A 4FU3A 2QYUA 4EPZA 1HG2A 2ZU6B 3FUNA 2QZAA 3UQ3A 1HFAA 3KAEA 3FDHA 3NOCD 3JQ0A 3FTZA 2EINE 5CMWA 2GRRB 3UMVA 5AENA 2RFAA 5JJ6A 2CFUA 3V2XA 3Q78A 3UIPC 4FADA 2KZTA 2J4BA 3QB2A 5ENRD 1FT1A 4CRWA 4JD2G 5KBAA 4YDOA 3J5QB 4MBGA 4IRUA 3ZXSA 3FWVA 2QFCA 4WAFA 2J9QA 2Y1LE 2P9KG 5ITZF 2RG8A 4MS6A 3SGHA 4G8KA 4AOFA 4JL0A 3EU5A 1JCQA 3MEKA 3SY2A 1SQMA 5AJDA 3FUIA 4BT9A 2E2EA 1TN7A 3DRAA 3LJ3A 1Y8MA 2KCVA 4I43A 4N2SA 4OVUA 4HQDA
chains in the Genus database with same CATH topology
4JW1A 3QDNA 2CHXA 4HVBA 5D0OD 3QWVA 3NZSA 4AY5A 2DBAA 2MOWA 3PS6A 4UWGA 3CEQA 1MQSA 3FU0A 4IULA 4MRUA 3CVUA 1TJFA 3CK8A 3CV0A 1DNPA 1UJJA 4G11A 4HOTA 3DPDA 4I2ZA 4EECA 2VSOE 4TV3A 4TUUA 4GYWA 4CGWA 5M72A 1N52A 2WXMA 3P1UA 3O48A 3QKYA 5KCMA 3G2VA 4J8EA 4UWHA 1E8ZA 2IJGX 1XGWA 3LVRE 2Y4TA 3LS8A 3QWPA 2CG3A 3LXUX 4CDMA 2C2LA 4ME2A 1H2UA 1Z6TA 2XCBA 2GRLA 3CIAA 3SD5A 4AV7A 5BV1A 1E8YA 4GYYA 4GA1A 3G2TA 1HZ4A 2VSYA 1L5JA 2KZTB 4FLHA 2WQHA 4L7TA 3Q15A 2X6IA 3Q47B 3APCA 4XI9A 2X6HA 4WNEA 3LPZA 4U63A 3CK7A 1B89A 4CT0A 1YA0A 2DIWA 3MV3B 4I1MA 2XEVA 2VYIA 4HS2A 2OVBA 2XGMA 3U3WA 3APDA 4V3IA 4J8FA 4E85A 2VGXB 3D9MA 5FZRA 1NZNA 2LSUA 3Q5MA 4GMLA 3RRNB 3TL5A 5ENNA 1EDUA 2XRYA 2NXPA 3CHPA 1OWOA 3CVNA 2AXUA 4UQZA 4YVQC 4F7AA 1P5QA 2VSXE 3NF1A 2JLBA 3R9AB 3UT4A 2J4DA 2P58C 4P29A 5AYWD 2WVIA 5LFAA 4I6EA 4NQ0A 4I1OB 2YHCA 1OWPA 3PEVB 4I1AA 3UPVA 5KJLA 3APFA 4U0SA 4AM9A 4GAAA 3VLFA 4A3TA 1IYGA 4JVSA 4AIFA 4ILIA 3FTSA 2M63A 5FWQA 3D9PA 3LDZA 4WNFA 4ABNA 4PDXA 1HO8A 4B94A 4BWRA 3HDXA 5FQ6A 2V4LA 4JA7A 1NA0A 1OWNA 2AXVA 3FH7A 4APOA 1E8XA 2XRZA 3L16A 5G55A 4FHJA 3T5XA 3G2SA 4G25A 2HYZA 3CHRA 4GZ6A 5JJ7A 3PNLB 3FTYA 4U07A 3FUEA 4WNDA 4ANVA 3FTUA 2VGXA 4IN3B 5CCLA 2OV8A 1HE8A 3IBEA 3CHSA 3I4GA 4UI9K 3TGOA 2PM6A 3UT8A 4BY6A 1HG5A 2WXIA 2IQCA 3RIBA 4NRHB 4AEZC 2PQRA 3CKCA 1N54A 4BX9A 3GYZA 5EDSA 3CK9A 4EZKA 1UN8A 2PM7A 2C0MA 2I1JA 2WM9A 3ZEFA 3LY9A 3MJWA 4KXKB 4C0EA 4LERA 2LO6A 4QFVA 3CVPA 4Q96A 4C0MA 5AJLA 2LAIA 4XKCA 2KCKA 4I6GA 3EHMA 4YNDA 2GRMA 1VDYA 3SFZA 2XHEA 3CVQA 4L1BA 5BUZA 4JEHA 5T4YA 5ARGA 4GA2A 4ACLA 3ASHA 4N2QA 2WXPA 4L23A 3K9IA 5C2YA 3FUFA 3PUKA 4KZ0A 3RJVA 2WQ6A 4I17A 1WAO1 4NURA 4UQXA 1TEZA 4U0UA 3O4ZA 4LCTA 3QAQA 1U3DA 3GZ2A 4GA0A 2BUGA 4Y6WA 3S7BA 3SI5A 5HQ8A 5FQ8A 4F53A 2WXGA 2L0TB 4KT6B 2I9CA 4NACA 4XIFA 3B7TA 3SZ7A 4N3BA 5EX0A 4DK5A 1PY1A 5ARFA 3AS5A 2C0LA 3PNTB 3HYMB 3B7SA 3VTYA 4HORA 1ELRA 2YHEA 4ILHB 3RK6A 4FLBA 3IHYA 4CEMA 3I5PA 2PZIA 5CCMA 2AWIA 3MA5A 4HLEA 1H2TC 3MX3A 1H19A 3CGHA 3ONKA 4WWOA 1KT1A 3R7RA 2VSNA 2XPYA 2X3MA 3CHOA 5G2NA 2BTDA 1JUQA 2I6HA 3VLDA 3ESLA 2WQ7A 4YVOA 5FTPA 1FVHA 2Y4UA 3DBSA 3UT7A 4CT4A 1E96B 2LAHA 3G2UA 3PDNA 4U8HA 3ZVVA 3ASGA 3L17A 4WWPA 3FUMA 3T5VA 3LKUA 1ZU2A 3FTWA 2WXQA 4D10C 4RVBA 1EYHA 3ML8A 2WMOA 3D9NA 4RG9A 4E6HA 3EJNA 3QJZA 3UX4A 1FCHA 3LY8A 4L2LA 4Q94A 4A3VA 2MHKA 1MHQA 2NC9A 3ML9A 4J6IA 4W9RA 5ANRA 2V0PA 5J90A 3ZYMA 1H6KA 4JXTA 5EKQD 3FTXA 3KS2A 4AJWA 3EDTB 4GCOA 3FULA 3L6AA 4DPRA 1NP7A 2NSZA 1E7VA 3PE4A 4K0RA 2XGOA 4U0ZA 3EIJA 1XNFA 3CVWA 3L08A 1FVFA 3PEUB 2WXFA 2YNQA 3CHQA 3P2BA 4H7YA 3IEGA 2AW6A 2J08A 4KZCA 1ELKA 2ONDA 2FF4A 2WPVA 3EHNA 1IQRA 3VTXA 4ANUA 4CGVA 3MCXA 3AU4A 2IFUA 4LUNU 5G05C 3C98A 3MKQB 1H0AA 4PS8A 1PAQA 3FTVA 5G05J 4I9EA 4HXIA 3CSFA 3U9WA 4A1SA 4GPKA 3BG0B 2YQ8A 2I2OA 3CVYA 4N5CA 2WXHA 1JWGA 4EBAG 2WXJA 4FC8A 4MKTA 4BT8A 1Y6IA 5LCWC 3WXXA 4OVVA 3LYAA 4DJAA 4IYPA 4N3AA 3GZSA 3S7DA 2WMNA 5DIZA 5JHAA 3RU0A 4M3OA 2IONA 1W3BA 4DLOA 1OUVA 3ZHEA 3QWWA 5LCWJ 4CDNA 4EZJA 1OWMA 3CR3A 4EZLA 2A5UA 4Y6CA 2FO7A 4G26A 2RD0A 5BNWA 1EF1C 2XQ0A 3EIQC 4O6FA 3JCKC 4FJYA 3SHFA 4CDRA 5JHBA 5ANLA 1UN9A 4K03A 2WXKA 4ACKA 1UJKA 2CHZA 4B0ZA 5T8IA 4EQFA 3NQPA 4HOUA 2DCPA 2WXOA 4GB9A 3QK0A 3LCAA 4LRZA 3MYVA 4JPSA 2E0IA 2I1KA 1IQUA 4HOQA 2IOSA 4UI9C 3CSTA 4WWNA 3SBTB 3D9JA 4JHKA 5G04C 1HH8A 3FUDA 3AS8A 3MKQA 1HXIA 4TRQA 4UI9J 2IF4A 1QZ2A 1E8WA 5EX3A 3KD7A 5G04J 5BV0A 3HIZA 4JHRA 3SF4A 3JYSA 4GZ5A 5LX8A 3B13A 3ULQA 3ZYKA 3PUJA 1A17A 2KCLA 3MZLB 3U64A 3B7UX 3ZPJA 3LY7A 4J8SA 4N3CA 3FEXA 4G2VA 3LEWA 4UWKA 4N39A 5DBKA 2L6JA 3LVQE 2L0IA 4PS7A 4BTAA 4J0UA 3I4RB 1BPOA 3AS4A 5BW8C 4ANXA 4AP2A 4DI3A 1JWFA 3L54A 2XCCA 2L9BA 3ZW3A 4JHJA 3D9IA 4OVUA 3QARA 5J08A 2VJ8A 3QC1A 3T8MA 4FJZA 5FQ4A 4GCNA 5FZQA 3ZFWA 3Q49B 5BPPA 2WXRA 4I6JA 3PREA 4KYOB 3FUJA 3GZ1A 1OWLA 1E7UA 3ZYLA 2KM4A 3S7FA 2VQ2A 3FU6A 5AIJA 2HR2A 4KVMA 4DI4A 2V8SE 3D9OA 2LNIA 4PUCA 3TG4A 3Q4AB 1DVPA 3QOUA 4B8AA 1SZAA 4KVOA 3MV2B 4APFA 1HX8A 4B8CB 4URKA 2UY1A 2ILRA 2QY7A 3ASDA 2VGYA 1WM5A 4FP7A 4DLQA 2CG2A 3RO3A 4OYSA 2BF0X 1GW6A 3D9LA 4A1GA 2FEZA 4CCAA 1KT0A 1Z3XA 1JPLA 2A4ZA 3NZUA 1KLXA 1SZ9A 4FHKA 3SNXA 2FULA 1H2VC 2CHWA 3CQCB 1PC2A 4J8DA 4BTBA 3MGBA 3N71A 5LP0A 3B7RL 5JJTA 3OXGA 4BFRA 4A55A 5T3RA 4MLPA 3FEYA 3HVEA 3AU5A 2IU1A 4XKBA 3BG1B 3CLJA 1INZA 4AVXA 4F1SA 3FH5A 3OAWA 1NA3A 3OTNA 4BX8A 1Z3YA 4RG6A 3JQ1A 3FFLA 3FH8A 5A7DB 3ZHEB 3R7QA 5FT9A 2AVPA 3TAXA 2XGSA 2IOLA 2LSVA 4FA6A 2EQXA 3S2AA 3ZIMA 2Q7FA 2J09A 2FI7A 4GYOA 3ONLA 2R59A 2X6JA 4KBQA 2PL2A 2Y3AA 4BSXA 4Q69A 2R5SA 4GZCA 4XE0A 3BEEA 1E90A 2VTBA 4UQYA 4AXHA 2YINA 2WB2A 3RRMB 3RRUA 4GZDA 2OVFA 4I2WA 4FU3A 3ENEA 4R7LA 3L13A 4EPZA 1HG2A 2ZU6B 2CFZA 3FUNA 2HM8A 3UQ3A 5A6CA 4C9BB 2GW1A 3TG5A 1HFAA 3KAEA 3FDHA 3SBSA 5KJNA 1ELWA 3CVLA 3IKOB 3JQ0A 4F3VA 4PS3A 3FTZA 3ZGQA 5CMWA 3CVVA 3UUXA 3ZYQA 2X6KA 3HHMA 3PH0C 2XPZA 2X38A 2AXZA 3GW4A 3PRZA 5CHEE 4JZYA 3UMVA 3TXNA 3G2WA 5AENA 3OXFA 5JJ6A 1LF8A 3FY4A 4WUYA 1HF8A 3ASFA 2CFUA 4RSYA 2MRIA 1ZBPA 2JEKA 4GZ3A 4I9CA 3TJPA 2UWJG 4FADA 2KZTA 3OXLA 3FHEA 1QQEA 4GU5A 2J4BA 3QB2A 4CRWA 3FUKA 3CQGB 3PVLA 3MKRA 4JA9A 3RKVA 2XPIA 4GMJA 4UWFA 3I3NA 2V5FA 5HI7A 4IRUA 4HOSA 3ZXSA 5C1DA 3FWVA 2QFCA 1UW4B 3L22A 3ZRHA 5LOZA 4WAFA 2J9QA 1S0PA 1WY6A 2UY1B 5KJMA 1EPUA 4ATGA 4B89A 3U4TA 4ILGA 1U3CA 4XZ4A 5D0QD 2FBNA 3TXMA 2RG8A 4UWLA 4MS6A 3SGHA 4AY6A 3QNKA 1UG3A 4LEUA 5A23A 2PQNA 3E4BA 4U04A 3IHVA 3FU3A 5FQ7A 4AOFA 3VLEA 2OOEA 5BT1A 3ZN3A 2J07A 1TJCA 3FP3A 5E75A 1HU3A 1QNFA 4JL0A 4G23A 1HS6A 5FZSA 2HO1A 3HVEB 3MEKA 2X6FA 4H7XA 3IV0A 4EBAA 2R17C 4JC8A 4ANWA 4XI0A 3S7JA 3FUHA 4G24A 3KEZA 3PZDA 2KATA 1SQMA 4JEUA 3D9KA 5AJDA 3FUIA 4PH4B 3CVXA 4BT9A 4G1TA 2WXNA 3CHMA 4KMOA 3ESKA 2E2EA 4HFGA 2KC7A 3D3MA 3JUIA 4XX5A 2GGFA 1X5BA 4L2YA 2J49A 4WNGA 3RO2A 5KJKA 3U66A 5FJYA 3LJ3A 3PE3A 1IHGA 4FULA 2WXLA 1Y8MA 2KCVA 3FU5A 4I43A 5E76A 2VTBB 3URZA 4N2SA 5CMYA 3CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDN A;  5D0O D;  3QWV A;  4AY5 A;  2DBA A;  3CEQ A;  3CK8 A;  3CV0 A;  4HOT A;  4I2Z A;  4GYW A;  4CGW A;  5M72 A;  3O48 A;  3QKY A;  4J8E A;  2Y4T A;  3QWP A;  2C2L A;  4ME2 A;  2XCB A;  4GYY A;  4GA1 A;  1HZ4 A;  2VSY A;  2WQH A;  3Q15 A;  3Q47 B;  4XI9 A;  4WNE A;  3LPZ A;  3CK7 A;  1B89 A;  1YA0 A;  3MV3 B;  2XEV A;  2VYI A;  2XGM A;  3U3W A;  4J8F A;  2VGX B;  5FZR A;  1NZN A;  2LSU A;  3Q5M A;  3CVN A;  4UQZ A;  4YVQ C;  1P5Q A;  3NF1 A;  2JLB A;  3R9A B;  2P58 C;  5AYW D;  4NQ0 A;  2YHC A;  4I1A A;  3UPV A;  5KJL A;  4U0S A;  4AM9 A;  1IYG A;  4AIF A;  4WNF A;  4ABN A;  4B94 A;  4BWR A;  4JA7 A;  1NA0 A;  4APO A;  4G25 A;  2HYZ A;  4GZ6 A;  5JJ7 A;  4U07 A;  4WND A;  4IN3 B;  2VGX A;  5CCL A;  4UI9 K;  3TGO A;  3RIB A;  4NRH B;  2PQR A;  3CKC A;  3GYZ A;  3CK9 A;  2C0M A;  3LY9 A;  4KXK B;  3CVP A;  2KCK A;  4YND A;  3CVQ A;  5ARG A;  4GA2 A;  3ASH A;  4N2Q A;  3K9I A;  3RJV A;  4I17 A;  1WAO 1;  4UQX A;  4U0U A;  3GZ2 A;  4GA0 A;  2BUG A;  4Y6W A;  3S7B A;  5HQ8 A;  4XIF A;  3SZ7 A;  4N3B A;  5EX0 A;  5ARF A;  3AS5 A;  2C0L A;  3HYM B;  3VTY A;  4HOR A;  1ELR A;  2PZI A;  5CCM A;  3MA5 A;  1KT1 A;  2VSN A;  2I6H A;  4YVO A;  5FTP A;  2Y4U A;  1E96 B;  3PDN A;  3ASG A;  3LKU A;  1ZU2 A;  4RG9 A;  1FCH A;  3LY8 A;  2MHK A;  2NC9 A;  4W9R A;  5EKQ D;  3KS2 A;  3EDT B;  4GCO A;  3PE4 A;  4U0Z A;  2XGO A;  1XNF A;  4H7Y A;  3IEG A;  2OND A;  2FF4 A;  2WPV A;  4CGV A;  3VTX A;  2IFU A;  5G05 C;  5G05 J;  4I9E A;  4A1S A;  4GPK A;  2YQ8 A;  4N5C A;  4BT8 A;  5LCW C;  3WXX A;  3LYA A;  4N3A A;  3S7D A;  5DIZ A;  3RU0 A;  1W3B A;  1OUV A;  3ZHE A;  3QWW A;  5LCW J;  4Y6C A;  2FO7 A;  4G26 A;  5BNW A;  4O6F A;  4CDR A;  4EQF A;  4HOU A;  3LCA A;  4HOQ A;  4UI9 C;  5G04 C;  1HH8 A;  3AS8 A;  1HXI A;  4UI9 J;  5EX3 A;  2IF4 A;  1QZ2 A;  3KD7 A;  5G04 J;  4JHR A;  3SF4 A;  3JYS A;  4GZ5 A;  3ULQ A;  1A17 A;  2KCL A;  3ZPJ A;  3LY7 A;  4N3C A;  4G2V A;  4N39 A;  5DBK A;  2L6J A;  4BTA A;  4J0U A;  3AS4 A;  5BW8 C;  2XCC A;  4GCN A;  5FZQ A;  3ZFW A;  3Q49 B;  4KYO B;  3GZ1 A;  3S7F A;  2VQ2 A;  2HR2 A;  2LNI A;  3TG4 A;  3Q4A B;  3QOU A;  3MV2 B;  2UY1 A;  3ASD A;  2VGY A;  1WM5 A;  3RO3 A;  2FEZ A;  1KT0 A;  1KLX A;  1PC2 A;  4J8D A;  4BTB A;  3N71 A;  5JJT A;  3OXG A;  1NA3 A;  4RG6 A;  3FFL A;  5A7D B;  3ZHE B;  5FT9 A;  2AVP A;  3TAX A;  2XGS A;  2LSV A;  2Q7F A;  2FI7 A;  4GYO A;  4KBQ A;  2PL2 A;  2R5S A;  3BEE A;  4UQY A;  4I2W A;  3UQ3 A;  5A6C A;  2GW1 A;  3TG5 A;  3KAE A;  5KJN A;  1ELW A;  3CVL A;  4F3V A;  3ZGQ A;  3UUX A;  3GW4 A;  5CHE E;  3OXF A;  5JJ6 A;  4WUY A;  3ASF A;  4GZ3 A;  1ZBP A;  4I9C A;  2UWJ G;  3OXL A;  1QQE A;  4JA9 A;  3MKR A;  3RKV A;  2XPI A;  2V5F A;  5HI7 A;  4HOS A;  5C1D A;  3FWV A;  2QFC A;  2J9Q A;  2UY1 B;  5KJM A;  3U4T A;  5D0Q D;  2FBN A;  4AY6 A;  4LEU A;  2PQN A;  3E4B A;  4U04 A;  2OOE A;  5BT1 A;  3ZN3 A;  1TJC A;  3FP3 A;  4JL0 A;  4G23 A;  5FZS A;  2HO1 A;  3MEK A;  4H7X A;  4XI0 A;  3S7J A;  4G24 A;  2KAT A;  4BT9 A;  4G1T A;  3ESK A;  2E2E A;  2KC7 A;  4WNG A;  3RO2 A;  5KJK A;  5FJY A;  3PE3 A;  1IHG A;  1Y8M A;  2KCV A;  3URZ A;  4N2S A;  3CKB A; 
#chains in the Genus database with same CATH topology
 4HRL A;  2CHX A;  3NBN B;  4UWG A;  3AG2 E;  4MRU A;  2P9U G;  3AAA C;  4TV3 A;  1BLX B;  2WXM A;  4K5C A;  4O1P A;  4J8E A;  4UWH A;  3LVR E;  1MX2 A;  1TNO A;  3QWP A;  1Z6T A;  2XCB A;  1JCS A;  3G2T A;  4YDY A;  2WQH A;  3Q15 A;  2DVW A;  3BUA A;  4F6R D;  1B89 A;  1YA0 A;  4I1M A;  4HS2 A;  2OVB A;  3ULY A;  2XGM A;  4LNG A;  1NZN A;  2IO2 C;  3CVN A;  5AYW D;  1KPS B;  2YHC A;  1OWP A;  5EIB E;  4GAA A;  4JVS A;  5FWQ A;  4B94 A;  4DX1 A;  1HO8 A;  2QYJ A;  5FQ6 A;  3FH7 A;  4U7E B;  5G55 A;  4FHJ A;  4GZ6 A;  4WND A;  4IN3 B;  4UI9 K;  3TWU A;  5KNH D;  2ZXW E;  4EZK A;  1UN8 A;  2WM9 A;  2B0O E;  3MJW A;  1BI8 B;  2LO6 A;  3CVP A;  2ETA A;  5AJL A;  2GRM A;  4L1B A;  5BUZ A;  4GA2 A;  4ACL A;  4N2Q A;  2WXP A;  3K9I A;  3FUF A;  2P9S G;  4NUR A;  2R02 A;  3QAQ A;  3TWW A;  1TNY A;  4GA0 A;  2BUG A;  4Y6W A;  3ABK E;  5HQ8 A;  4F53 A;  1SVX A;  1UOH A;  4NAC A;  4N3B A;  3X2Q E;  1PY1 A;  3AS5 A;  2C0L A;  3B7S A;  4CYM D;  1ELR A;  1OCC E;  3I5P A;  4GTR A;  3SQV A;  3ONK A;  4WWO A;  2XPY A;  1K1B A;  2X3M A;  2DYS E;  3CHO A;  2BTD A;  3DBS A;  4CT4 A;  1S70 B;  3G2U A;  3ASG A;  2XEN A;  1EYH A;  4E6H A;  3EJN A;  4L2L A;  4A3V A;  4J6I A;  3ZYM A;  1O1S A;  3KS2 A;  4AJW A;  3EDT B;  3JXI A;  1NP7 A;  1E7V A;  1XNF A;  4H7Y A;  4ATZ D;  4G8L A;  4DX7 D;  3EHN A;  3MCX A;  3B95 A;  2IFU A;  1S63 A;  3C98 A;  1H0A A;  3PZ1 A;  5G05 J;  4I9E A;  3V2O A;  4HXI A;  3CSF A;  3U9W A;  2H6F A;  3BG0 B;  2I2O A;  3CVY A;  4N5C A;  4MKT A;  2P9N G;  4OVV A;  4IYP A;  2ION A;  3ZHE A;  1N0R A;  4CDN A;  4G26 A;  3EIQ C;  1A5E A;  2B6C A;  5ANL A;  4B0Z A;  4EQF A;  4HOU A;  5AQ9 A;  4GB9 A;  4JPS A;  3MYV A;  3DSV A;  3CST A;  4J7W A;  1HH8 A;  5CBO A;  1AWC B;  1HXI A;  5G04 J;  5BV0 A;  5LX8 A;  4HRN A;  3U64 A;  3ZPJ A;  3EHQ A;  2L6J A;  3LVQ E;  4PS7 A;  4BTA A;  4J0U A;  3L82 A;  2L9B A;  3AJI A;  2OCC E;  5FQ4 A;  4GCN A;  5EYP F;  4DX6 D;  4I6J A;  1FPP A;  4KYO B;  3GZ1 A;  1OWL A;  1E7U A;  5AIJ A;  4DI4 A;  2LNI A;  3Q4A B;  3QOU A;  4B8A A;  4KVO A;  4TXQ A;  4B8C B;  1AP7 A;  2ILR A;  2QY7 A;  2VGY A;  4DLQ A;  4HRM B;  1KT0 A;  1KLX A;  2FUL A;  2ZIR A;  3CQC B;  3RSE G;  1PC2 A;  3N71 A;  3B7R L;  3RAU A;  5JJT A;  3FEY A;  3UKR G;  5D66 A;  3W9G A;  4AVX A;  4F1S A;  2MYO A;  2BED A;  2ETB A;  2EQX A;  2J09 A;  4GYO A;  4KBQ A;  2X6J A;  3Q9N C;  4GZC A;  4XE0 A;  3BEE A;  3RRU A;  5H7P A;  2DZO A;  2FO1 E;  4I2W A;  1N4P A;  1K3Z D;  1SW6 A;  3L13 A;  5AN8 A;  2HM8 A;  5A6C A;  3TG5 A;  5KJN A;  1O1T A;  3CVL A;  3IKO B;  4F3V A;  3UUX A;  2X6K A;  1YCS B;  2XPZ A;  2H6G A;  2X38 A;  2AXZ A;  4JZY A;  3OXF A;  1LF8 A;  4WUY A;  3DWL G;  2XZT G;  1HF8 A;  3ASF A;  4GZ3 A;  4I9C A;  2UWJ G;  5AAO A;  2DYR E;  4M7C A;  3CQG B;  1BI7 B;  2XPI A;  4UWF A;  3I3N A;  4GTT A;  5KNG A;  3T8K A;  3E33 A;  3ZXP A;  4HOS A;  2H6H A;  3ASO E;  1UW4 B;  5LOZ A;  1S0P A;  1WY6 A;  2UY1 B;  3TWX A;  1EPU A;  4XZ4 A;  3TXM A;  2JAB A;  2P2C P;  4LEU A;  1UG3 A;  5AQB A;  3E4B A;  1N4Q A;  2R2L A;  5FQ7 A;  3VLE A;  1MX4 A;  3EHR A;  1G3N B;  5BT1 A;  3ZN3 A;  2J07 A;  1TJC A;  5E75 A;  1QNF A;  4H7X A;  2R17 C;  1JCR A;  3FUH A;  4G24 A;  4DX5 D;  3PZD A;  3E30 A;  5EIL A;  3ZNG A;  4G1T A;  2WXN A;  4KMO A;  2KC7 A;  3D3M A;  3JUI A;  2GGF A;  1X5B A;  3C3O A;  2EIJ E;  4L2Y A;  3RO2 A;  3Q7F A;  5CMY A;  3RRM B;  4HVB A;  5D0O D;  4AY5 A;  3CEQ A;  4IUL A;  3CVU A;  2BKG A;  3CK8 A;  1UJJ A;  4HOT A;  4I2Z A;  1K1A A;  4CGW A;  1N52 A;  5KCM A;  4CDM A;  2IJG X;  1XGW A;  3LS8 A;  3LXU X;  4X8Q A;  4ME2 A;  1H2U A;  5BV1 A;  3CIA A;  3SD5 A;  4AV7 A;  4GYY A;  1RZ4 A;  1L5J A;  1NI1 A;  2GRP B;  3Q47 B;  3APC A;  4XI9 A;  3LPZ A;  4CT0 A;  2DIW A;  5CEC B;  4U8V D;  3D9M A;  1TN8 A;  3TL5 A;  3Q5M A;  4GML A;  3RRN B;  5JA4 D;  2NXP A;  3CHP A;  1OWO A;  4F7A A;  1TYQ G;  5EYL A;  3UT4 A;  1KZP A;  2P58 C;  4P29 A;  4NQ0 A;  4I1O B;  1ZB1 A;  3PEV B;  1OCR E;  3UPV A;  4U0S A;  4AM9 A;  4A3T A;  4HBD A;  3D9P A;  3LDZ A;  4ABN A;  4PDX A;  3HDX A;  2V4L A;  1V54 E;  4JA7 A;  3C72 A;  5AAR A;  1E8X A;  3L16 A;  1X81 A;  1Z5S C;  3T5X A;  3G2S A;  5JJ7 A;  1DCQ A;  3PNL B;  2VGX A;  5CCL A;  2OV8 A;  3CVV A;  3CHS A;  3TGO A;  3UT8 A;  3RIB A;  3IXE A;  4AEZ C;  1N54 A;  5EDS A;  2OEW A;  3CK9 A;  2C0M A;  4KXK B;  5FIN A;  2V5Q C;  4C0M A;  4XKC A;  3EHM A;  1VDY A;  3SFZ A;  2XHE A;  4JEH A;  5ARG A;  2A5E A;  3JUE A;  4KZ0 A;  2WQ6 A;  3ZUV B;  3O4Z A;  4LCT A;  3S7B A;  2WXG A;  2I9C A;  1N94 A;  4XIF A;  3B7T A;  4U8Y D;  2P9I G;  3C3Q A;  5CCM A;  2AWI A;  3MA5 A;  4HLE A;  1H2T C;  2VSN A;  2I6H A;  3VLD A;  2WQ7 A;  4YVO A;  1OCO E;  2P9L G;  3ABM E;  3TWV A;  1QYM A;  4D10 C;  4RVB A;  3ML8 A;  3D9N A;  1FCH A;  3Q73 A;  2NC9 A;  5EKQ D;  5BXO A;  3FUL A;  5B1B E;  2F0Y A;  4YDE A;  2NSZ A;  3PE4 A;  4RLY A;  2WXF A;  3IEG A;  2AW6 A;  2J08 A;  1ELK A;  2OND A;  4CGV A;  3VTX A;  5G05 C;  3MKQ B;  3R9M A;  4PS8 A;  1O1R A;  2YQ8 A;  1JWG A;  4EBA G;  2WXJ A;  2RFM A;  3WXX A;  3LYA A;  4DJA A;  4N3A A;  3GZS A;  3S7D A;  2WMN A;  5JHA A;  4EHM A;  1W3B A;  1D8D A;  4DLO A;  5LCW J;  4EZL A;  3CR3 A;  2A5U A;  4Y6C A;  1EF1 C;  2XQ0 A;  4O6F A;  4CDR A;  3HXC A;  4K03 A;  5T8I A;  3LCA A;  4HOQ A;  2I1K A;  3UXG A;  3DEO A;  4JHK A;  5G04 C;  3TWR A;  4UI9 J;  1QZ2 A;  1E8W A;  4LSZ E;  4JHR A;  5BXU A;  3JYS A;  4GZ5 A;  3ULQ A;  3PZ2 A;  4Z68 A;  1A17 A;  4NIK A;  4J8S A;  4G2V A;  2L0I A;  3AS4 A;  2QC9 A;  4ANX A;  3L54 A;  5J08 A;  5CBN A;  3Q49 B;  2WXR A;  2RKK A;  2VQ2 A;  4KVM A;  1BD8 A;  4BEP A;  3D9O A;  1QBQ A;  5ENO D;  3TG4 A;  3C5R A;  2UY1 A;  3ASD A;  1WM5 A;  2L6B A;  1GW6 A;  3D9L A;  2FEZ A;  2Y69 E;  1SZ9 A;  1N4S A;  4FHK A;  3L9T A;  4BTB A;  3AU5 A;  2H6I A;  3CLJ A;  3FH5 A;  1NA3 A;  4BX8 A;  4RG6 A;  3FFL A;  1MYO A;  2EIL E;  3FH8 A;  2AVP A;  3C3R A;  4FA6 A;  3S2A A;  2Q7F A;  2FI7 A;  2Y3A A;  2ETC A;  4BSX A;  1E90 A;  4UQY A;  2WB2 A;  3SFY A;  2OVF A;  2XEH A;  4R7L A;  3UIN C;  4A63 B;  4LNB A;  4C9B B;  2GW1 A;  1ELW A;  4PS3 A;  3DXK G;  3ZYQ A;  3HHM A;  3PH0 C;  4QQI A;  3W9F A;  5ENQ D;  4RSY A;  2MRI A;  2JEK A;  2DZN A;  3OXL A;  2AJA A;  1D8E A;  1BU9 A;  3FUK A;  3ZU7 B;  4JA9 A;  3MKR A;  3RKV A;  4GMJ A;  5HKP A;  3ABL E;  2NYJ A;  5C1D A;  3L22 A;  5KJM A;  4ILG A;  1U3C A;  5D0Q D;  2FBN A;  4AY6 A;  5A23 A;  2PQN A;  4U04 A;  3IHV A;  2OOE A;  3FP3 A;  1HU3 A;  5FZS A;  3IV0 A;  4EBA A;  5ENT D;  3KEA A;  4U95 D;  4XI0 A;  3S7J A;  2GRQ B;  3KEZ A;  4JEU A;  3CVX A;  4HFG A;  4XX5 A;  3U66 A;  2J49 A;  4FUL A;  2WXL A;  3E34 A;  3FU5 A;  3D9H A;  2VTB B;  3CKB A;  2LXM A;  4JW1 A;  3QDN A;  3TWT A;  3QWV A;  2DBA A;  2MOW A;  3PS6 A;  3UIO C;  1DC2 A;  3FU0 A;  4OAU C;  1TJF A;  3CV0 A;  1DNP A;  4TXR A;  4G11 A;  2BKK B;  5KWD A;  4TUU A;  4GYW A;  5M72 A;  3SFX A;  3P1U A;  3O48 A;  3G2V A;  1E8Z A;  2Y4T A;  4HNA D;  5JMN D;  1KZO A;  4GA1 A;  4FLH A;  4L7T A;  2X6I A;  3EUV A;  4U63 A;  3CK7 A;  5CRV A;  3TWS A;  3MV3 B;  2XEV A;  2VYI A;  4F1P A;  1S64 A;  3U3W A;  3APD A;  4V3I A;  4J8F A;  4E85 A;  5FZR A;  5ENN A;  1EDU A;  2XRY A;  2AXU A;  3JXJ A;  4UUC A;  4YVQ C;  2JLB A;  1N4R A;  4BSZ B;  4I1A A;  1NFI E;  5KJL A;  2OEV A;  3VLF A;  1IYG A;  4AIF A;  4ILI A;  4GTP A;  3B7B A;  1OWN A;  4APO A;  2XRZ A;  1NL4 A;  4G25 A;  3CHR A;  4U07 A;  4ANV A;  1IXV A;  3IBE A;  1HE8 A;  3I4G A;  3J5P A;  1HG5 A;  4NRH B;  4BX9 A;  3GYZ A;  2I1J A;  4C0E A;  3HG0 D;  3V30 A;  4LER A;  4Q96 A;  1MJ0 A;  4YND A;  3BQO A;  1K8K G;  3ASH A;  4L23 A;  3PUK A;  5FIO A;  1WDY A;  4UQX A;  4K5A B;  3V31 A;  3GZ2 A;  3SI5 A;  3HXD A;  1YYH A;  4DUI A;  4KT6 B;  3SZ7 A;  3NB2 A;  1H6O A;  1TR4 A;  4DK5 A;  5ARF A;  3DST A;  3HYM B;  3VTY A;  2YHE A;  4ILH B;  2PZI A;  3ISM C;  3MX3 A;  1H19 A;  3DEP A;  3ESL A;  5FTP A;  1FVH A;  2Y4U A;  3DPY A;  4U8H A;  3DSW A;  4WWP A;  3DSS A;  3FUM A;  3LKU A;  1ZU2 A;  3FTW A;  4CZ2 D;  2GRN B;  3LY8 A;  4Q94 A;  2MHK A;  1MHQ A;  3ML9 A;  5J90 A;  2V0P A;  1OT8 A;  4JXT A;  3FTX A;  4HI8 A;  5ENS D;  4DPR A;  4K0R A;  2XGO A;  3EIJ A;  3L08 A;  1FVF A;  4BER A;  3PEU B;  2PNN A;  3CHQ A;  1N11 A;  1SA5 A;  4ANU A;  2WPV A;  2FF4 A;  3AU4 A;  5B1A E;  3TWQ A;  3FTV A;  4A1S A;  4GPK A;  4O1O A;  2WXH A;  4FC8 A;  1Y6I A;  5LCW C;  1OCZ E;  3RU0 A;  3T9K A;  1OUV A;  4EZJ A;  1OWM A;  4GTQ A;  4HLL A;  2RD0 A;  5BNW A;  2Y0B G;  5JHB A;  2WXK A;  4ACK A;  1UJK A;  1D9S A;  2P9P G;  2DCP A;  3QK0 A;  4UI9 C;  3SBT B;  4BET A;  3D9J A;  3AS8 A;  4B93 B;  5EX3 A;  2IF4 A;  4XEI G;  3B13 A;  3ZYK A;  3PUJ A;  3WG7 E;  3MZL B;  2F37 A;  3B7U X;  4N3C A;  3FEX A;  4UWK A;  2ZGD A;  1LD7 A;  2VGE A;  4AP2 A;  1JWF A;  3QAR A;  3DSX A;  5HS0 A;  5ENP D;  5BPP A;  3UTM A;  3PRE A;  4LG6 A;  3FU6 A;  5HRY A;  1OY3 D;  4PUC A;  5CEA A;  3ASN E;  4FP7 A;  5CED B;  1RW2 A;  2BF0 X;  4A1G A;  1WG0 A;  1Z3X A;  2A4Z A;  3NZU A;  1H2V C;  4U96 D;  3PZ4 A;  2ZGG A;  5LP0 A;  4BFR A;  5T3R A;  2IU1 A;  4XKB A;  3BG1 B;  4TXP A;  1INZ A;  3KSL A;  1Z3Y A;  4YDW A;  3JQ1 A;  4N5Q A;  3TAX A;  2XGS A;  3ZIM A;  3ONL A;  2R59 A;  1SA4 A;  4ZHB A;  2VTB A;  4GZD A;  3ENE A;  4TUM A;  5AQA A;  2LXL A;  2CFZ A;  3UI2 A;  3SBS A;  3ZGQ A;  3PRZ A;  3GW4 A;  5CHE E;  4OAV B;  3TXN A;  3G2W A;  3NAW A;  3DSU A;  3FY4 A;  1ZBP A;  3TJP A;  3FHE A;  1QQE A;  4GU5 A;  3NOG D;  5B3S E;  3PVL A;  1IKN D;  2V5F A;  1YMP A;  5HI7 A;  3ZRH A;  4J8Y A;  4GTM A;  3F6Q A;  4ATG A;  4B89 A;  3U4T A;  2XS8 A;  4UWL A;  3QNK A;  3FU3 A;  1V55 E;  3ULE G;  4G23 A;  1HS6 A;  2HO1 A;  3HVE B;  2X6F A;  4HB5 A;  4JC8 A;  4ANW A;  2KAT A;  2EIM E;  3D9K A;  4PH4 B;  3CHM A;  3ESK A;  3Q79 A;  4WNG A;  4O60 A;  5KJK A;  5FJY A;  3PE3 A;  1IHG A;  5E76 A;  1N0Q A;  3URZ A;  4GMR A;  2GRO B;  3NZS A;  3BU8 A;  4BES A;  1MQS A;  2HE0 A;  5EID A;  3PZ3 A;  1U2V G;  3DPD A;  4EEC A;  2VSO E;  2XS1 A;  3QKY A;  3T5V A;  2CG3 A;  2C2L A;  2GRL A;  1E8Y A;  2KBX A;  1HZ4 A;  2VSY A;  2KZT B;  2DWZ A;  4HI9 A;  2X6H A;  4WNE A;  4DRX E;  2VGX B;  2LSU A;  3EU9 A;  4UQZ A;  2KXP C;  1P5Q A;  2VSX E;  3NF1 A;  3R9A B;  2J4D A;  2WVI A;  5LFA A;  4I6E A;  3APF A;  5AQ7 A;  4GTV A;  3SO8 A;  3FTS A;  2M63 A;  2IEJ A;  4WNF A;  5CRU A;  4BWR A;  1TNB A;  1NA0 A;  2AXV A;  3AG4 E;  3Q7A A;  2HYZ A;  3FTY A;  3FUE A;  3FTU A;  2PM6 A;  4BY6 A;  2WXI A;  2IQC A;  2PQR A;  3CKC A;  2XZD G;  4DX2 A;  2PM7 A;  3ZEF A;  3LY9 A;  3Q9U C;  1DCE A;  4QFV A;  2LAI A;  2KCK A;  4I6G A;  2R03 A;  4C48 B;  3UKU G;  1OXJ A;  3CVQ A;  5T4Y A;  2IO3 C;  5IY5 E;  5C2Y A;  3RJV A;  4I17 A;  1WAO 1;  1TEZ A;  4U0U A;  1U3D A;  1LTX A;  3AG3 E;  5FQ8 A;  2L0T B;  3DXM G;  5EX0 A;  1Q2Z A;  3UM2 A;  3PNT B;  4HOR A;  3ZKJ A;  3RK6 A;  4FLB A;  3IHY A;  4CEM A;  3HXE A;  3CGH A;  3UM3 A;  3R7R A;  1KT1 A;  5G2N A;  1JUQ A;  4RQI A;  1TNZ A;  5D2M C;  3UT7 A;  1E96 B;  2LAH A;  3PDN A;  3ZVV A;  3L17 A;  2WXQ A;  2WMO A;  4RG9 A;  3QJZ A;  3UX4 A;  2ZIS A;  4W9R A;  5ANR A;  1H6K A;  1TNU A;  4GCO A;  1FT2 A;  3L6A A;  3HRA A;  4U0Z A;  2F8Y A;  2XEE A;  3CVW A;  1IHB A;  2YNQ A;  3P2B A;  2F8X K;  4KZC A;  2R05 A;  3HXB A;  1IQR A;  4LUN U;  4K5B A;  1PAQ A;  3KSQ A;  4BT8 A;  4ZFH A;  4JB8 P;  5DIZ A;  4M3O A;  3QWW A;  3LJN A;  2FO7 A;  3JCK C;  1H6P A;  4FJY A;  3SHF A;  1UN9 A;  2CHZ A;  3NQP A;  2WXO A;  1N9A A;  4LRZ A;  2E0I A;  1IQU A;  4WWN A;  2IOS A;  3FUD A;  3MKQ A;  4TRQ A;  2LUH A;  3KD7 A;  3HIZ A;  3AG1 E;  3SF4 A;  2KCL A;  3E32 A;  3LY7 A;  3UM0 A;  3LEW A;  4N39 A;  5DBK A;  3I4R B;  1BPO A;  5BW8 C;  4DI3 A;  2XCC A;  3HXF A;  3ZW3 A;  4JHJ A;  3D9I A;  5EN5 D;  2VJ8 A;  3QC1 A;  1MX6 A;  4FJZ A;  4GPM A;  3T8M A;  5FZQ A;  3ZFW A;  3FUJ A;  3ZYL A;  2KM4 A;  1MZC A;  2J8S D;  3S7F A;  2IY0 C;  2HR2 A;  2V8S E;  1LD8 A;  1DVP A;  1SZA A;  3MV2 B;  4APF A;  1HX8 A;  2V4H C;  4URK A;  4LNU D;  2CG2 A;  3Q75 A;  3RO3 A;  1TN6 A;  4OYS A;  4CCA A;  3V79 K;  1JPL A;  1O5M A;  3SNX A;  4L9P A;  2CHW A;  2EIK E;  4J8D A;  3MGB A;  3OXG A;  4A55 A;  4MLP A;  3HVE A;  5CER B;  4GTS A;  3OAW A;  3OTN A;  5A7D B;  3ZHE B;  3R7Q A;  5FT9 A;  4GTO A;  2IOL A;  3E37 A;  2LSV A;  2PL2 A;  4Q69 A;  2R5S A;  4AXH A;  2YIN A;  1N95 A;  3UM1 A;  4FU3 A;  2QYU A;  4EPZ A;  1HG2 A;  2ZU6 B;  3FUN A;  2QZA A;  3UQ3 A;  1HFA A;  3KAE A;  3FDH A;  3NOC D;  3JQ0 A;  3FTZ A;  2EIN E;  5CMW A;  2GRR B;  3UMV A;  5AEN A;  2RFA A;  5JJ6 A;  2CFU A;  3V2X A;  3Q78 A;  3UIP C;  4FAD A;  2KZT A;  2J4B A;  3QB2 A;  5ENR D;  1FT1 A;  4CRW A;  4JD2 G;  5KBA A;  4YDO A;  3J5Q B;  4MBG A;  4IRU A;  3ZXS A;  3FWV A;  2QFC A;  4WAF A;  2J9Q A;  2Y1L E;  2P9K G;  5ITZ F;  2RG8 A;  4MS6 A;  3SGH A;  4G8K A;  4AOF A;  4JL0 A;  3EU5 A;  1JCQ A;  3MEK A;  3SY2 A;  1SQM A;  5AJD A;  3FUI A;  4BT9 A;  2E2E A;  1TN7 A;  3DRA A;  3LJ3 A;  1Y8M A;  2KCV A;  4I43 A;  4N2S A;  4OVU A;  4HQD A; 
#chains in the Genus database with same CATH homology
 4JW1 A;  3QDN A;  2CHX A;  4HVB A;  5D0O D;  3QWV A;  3NZS A;  4AY5 A;  2DBA A;  2MOW A;  3PS6 A;  4UWG A;  3CEQ A;  1MQS A;  3FU0 A;  4IUL A;  4MRU A;  3CVU A;  1TJF A;  3CK8 A;  3CV0 A;  1DNP A;  1UJJ A;  4G11 A;  4HOT A;  3DPD A;  4I2Z A;  4EEC A;  2VSO E;  4TV3 A;  4TUU A;  4GYW A;  4CGW A;  5M72 A;  1N52 A;  2WXM A;  3P1U A;  3O48 A;  3QKY A;  5KCM A;  3G2V A;  4J8E A;  4UWH A;  1E8Z A;  2IJG X;  1XGW A;  3LVR E;  2Y4T A;  3LS8 A;  3QWP A;  2CG3 A;  3LXU X;  4CDM A;  2C2L A;  4ME2 A;  1H2U A;  1Z6T A;  2XCB A;  2GRL A;  3CIA A;  3SD5 A;  4AV7 A;  5BV1 A;  1E8Y A;  4GYY A;  4GA1 A;  3G2T A;  1HZ4 A;  2VSY A;  1L5J A;  2KZT B;  4FLH A;  2WQH A;  4L7T A;  3Q15 A;  2X6I A;  3Q47 B;  3APC A;  4XI9 A;  2X6H A;  4WNE A;  3LPZ A;  4U63 A;  3CK7 A;  1B89 A;  4CT0 A;  1YA0 A;  2DIW A;  3MV3 B;  4I1M A;  2XEV A;  2VYI A;  4HS2 A;  2OVB A;  2XGM A;  3U3W A;  3APD A;  4V3I A;  4J8F A;  4E85 A;  2VGX B;  3D9M A;  5FZR A;  1NZN A;  2LSU A;  3Q5M A;  4GML A;  3RRN B;  3TL5 A;  5ENN A;  1EDU A;  2XRY A;  2NXP A;  3CHP A;  1OWO A;  3CVN A;  2AXU A;  4UQZ A;  4YVQ C;  4F7A A;  1P5Q A;  2VSX E;  3NF1 A;  2JLB A;  3R9A B;  3UT4 A;  2J4D A;  2P58 C;  4P29 A;  5AYW D;  2WVI A;  5LFA A;  4I6E A;  4NQ0 A;  4I1O B;  2YHC A;  1OWP A;  3PEV B;  4I1A A;  3UPV A;  5KJL A;  3APF A;  4U0S A;  4AM9 A;  4GAA A;  3VLF A;  4A3T A;  1IYG A;  4JVS A;  4AIF A;  4ILI A;  3FTS A;  2M63 A;  5FWQ A;  3D9P A;  3LDZ A;  4WNF A;  4ABN A;  4PDX A;  1HO8 A;  4B94 A;  4BWR A;  3HDX A;  5FQ6 A;  2V4L A;  4JA7 A;  1NA0 A;  1OWN A;  2AXV A;  3FH7 A;  4APO A;  1E8X A;  2XRZ A;  3L16 A;  5G55 A;  4FHJ A;  3T5X A;  3G2S A;  4G25 A;  2HYZ A;  3CHR A;  4GZ6 A;  5JJ7 A;  3PNL B;  3FTY A;  4U07 A;  3FUE A;  4WND A;  4ANV A;  3FTU A;  2VGX A;  4IN3 B;  5CCL A;  2OV8 A;  1HE8 A;  3IBE A;  3CHS A;  3I4G A;  4UI9 K;  3TGO A;  2PM6 A;  3UT8 A;  4BY6 A;  1HG5 A;  2WXI A;  2IQC A;  3RIB A;  4NRH B;  4AEZ C;  2PQR A;  3CKC A;  1N54 A;  4BX9 A;  3GYZ A;  5EDS A;  3CK9 A;  4EZK A;  1UN8 A;  2PM7 A;  2C0M A;  2I1J A;  2WM9 A;  3ZEF A;  3LY9 A;  3MJW A;  4KXK B;  4C0E A;  4LER A;  2LO6 A;  4QFV A;  3CVP A;  4Q96 A;  4C0M A;  5AJL A;  2LAI A;  4XKC A;  2KCK A;  4I6G A;  3EHM A;  4YND A;  2GRM A;  1VDY A;  3SFZ A;  2XHE A;  3CVQ A;  4L1B A;  5BUZ A;  4JEH A;  5T4Y A;  5ARG A;  4GA2 A;  4ACL A;  3ASH A;  4N2Q A;  2WXP A;  4L23 A;  3K9I A;  5C2Y A;  3FUF A;  3PUK A;  4KZ0 A;  3RJV A;  2WQ6 A;  4I17 A;  1WAO 1;  4NUR A;  4UQX A;  1TEZ A;  4U0U A;  3O4Z A;  4LCT A;  3QAQ A;  1U3D A;  3GZ2 A;  4GA0 A;  2BUG A;  4Y6W A;  3S7B A;  3SI5 A;  5HQ8 A;  5FQ8 A;  4F53 A;  2WXG A;  2L0T B;  4KT6 B;  2I9C A;  4NAC A;  4XIF A;  3B7T A;  3SZ7 A;  4N3B A;  5EX0 A;  4DK5 A;  1PY1 A;  5ARF A;  3AS5 A;  2C0L A;  3PNT B;  3HYM B;  3B7S A;  3VTY A;  4HOR A;  1ELR A;  2YHE A;  4ILH B;  3RK6 A;  4FLB A;  3IHY A;  4CEM A;  3I5P A;  2PZI A;  5CCM A;  2AWI A;  3MA5 A;  4HLE A;  1H2T C;  3MX3 A;  1H19 A;  3CGH A;  3ONK A;  4WWO A;  1KT1 A;  3R7R A;  2VSN A;  2XPY A;  2X3M A;  3CHO A;  5G2N A;  2BTD A;  1JUQ A;  2I6H A;  3VLD A;  3ESL A;  2WQ7 A;  4YVO A;  5FTP A;  1FVH A;  2Y4U A;  3DBS A;  3UT7 A;  4CT4 A;  1E96 B;  2LAH A;  3G2U A;  3PDN A;  4U8H A;  3ZVV A;  3ASG A;  3L17 A;  4WWP A;  3FUM A;  3T5V A;  3LKU A;  1ZU2 A;  3FTW A;  2WXQ A;  4D10 C;  4RVB A;  1EYH A;  3ML8 A;  2WMO A;  3D9N A;  4RG9 A;  4E6H A;  3EJN A;  3QJZ A;  3UX4 A;  1FCH A;  3LY8 A;  4L2L A;  4Q94 A;  4A3V A;  2MHK A;  1MHQ A;  2NC9 A;  3ML9 A;  4J6I A;  4W9R A;  5ANR A;  2V0P A;  5J90 A;  3ZYM A;  1H6K A;  4JXT A;  5EKQ D;  3FTX A;  3KS2 A;  4AJW A;  3EDT B;  4GCO A;  3FUL A;  3L6A A;  4DPR A;  1NP7 A;  2NSZ A;  1E7V A;  3PE4 A;  4K0R A;  2XGO A;  4U0Z A;  3EIJ A;  1XNF A;  3CVW A;  3L08 A;  1FVF A;  3PEU B;  2WXF A;  2YNQ A;  3CHQ A;  3P2B A;  4H7Y A;  3IEG A;  2AW6 A;  2J08 A;  4KZC A;  1ELK A;  2OND A;  2FF4 A;  2WPV A;  3EHN A;  1IQR A;  3VTX A;  4ANU A;  4CGV A;  3MCX A;  3AU4 A;  2IFU A;  4LUN U;  5G05 C;  3C98 A;  3MKQ B;  1H0A A;  4PS8 A;  1PAQ A;  3FTV A;  5G05 J;  4I9E A;  4HXI A;  3CSF A;  3U9W A;  4A1S A;  4GPK A;  3BG0 B;  2YQ8 A;  2I2O A;  3CVY A;  4N5C A;  2WXH A;  1JWG A;  4EBA G;  2WXJ A;  4FC8 A;  4MKT A;  4BT8 A;  1Y6I A;  5LCW C;  3WXX A;  4OVV A;  3LYA A;  4DJA A;  4IYP A;  4N3A A;  3GZS A;  3S7D A;  2WMN A;  5DIZ A;  5JHA A;  3RU0 A;  4M3O A;  2ION A;  1W3B A;  4DLO A;  1OUV A;  3ZHE A;  3QWW A;  5LCW J;  4CDN A;  4EZJ A;  1OWM A;  3CR3 A;  4EZL A;  2A5U A;  4Y6C A;  2FO7 A;  4G26 A;  2RD0 A;  5BNW A;  1EF1 C;  2XQ0 A;  3EIQ C;  4O6F A;  3JCK C;  4FJY A;  3SHF A;  4CDR A;  5JHB A;  5ANL A;  1UN9 A;  4K03 A;  2WXK A;  4ACK A;  1UJK A;  2CHZ A;  4B0Z A;  5T8I A;  4EQF A;  3NQP A;  4HOU A;  2DCP A;  2WXO A;  4GB9 A;  3QK0 A;  3LCA A;  4LRZ A;  3MYV A;  4JPS A;  2E0I A;  2I1K A;  1IQU A;  4HOQ A;  2IOS A;  4UI9 C;  3CST A;  4WWN A;  3SBT B;  3D9J A;  4JHK A;  5G04 C;  1HH8 A;  3FUD A;  3AS8 A;  3MKQ A;  1HXI A;  4TRQ A;  4UI9 J;  2IF4 A;  1QZ2 A;  1E8W A;  5EX3 A;  3KD7 A;  5G04 J;  5BV0 A;  3HIZ A;  4JHR A;  3SF4 A;  3JYS A;  4GZ5 A;  5LX8 A;  3B13 A;  3ULQ A;  3ZYK A;  3PUJ A;  1A17 A;  2KCL A;  3MZL B;  3U64 A;  3B7U X;  3ZPJ A;  3LY7 A;  4J8S A;  4N3C A;  3FEX A;  4G2V A;  3LEW A;  4UWK A;  4N39 A;  5DBK A;  2L6J A;  3LVQ E;  2L0I A;  4PS7 A;  4BTA A;  4J0U A;  3I4R B;  1BPO A;  3AS4 A;  5BW8 C;  4ANX A;  4AP2 A;  4DI3 A;  1JWF A;  3L54 A;  2XCC A;  2L9B A;  3ZW3 A;  4JHJ A;  3D9I A;  4OVU A;  3QAR A;  5J08 A;  2VJ8 A;  3QC1 A;  3T8M A;  4FJZ A;  5FQ4 A;  4GCN A;  5FZQ A;  3ZFW A;  3Q49 B;  5BPP A;  2WXR A;  4I6J A;  3PRE A;  4KYO B;  3FUJ A;  3GZ1 A;  1OWL A;  1E7U A;  3ZYL A;  2KM4 A;  3S7F A;  2VQ2 A;  3FU6 A;  5AIJ A;  2HR2 A;  4KVM A;  4DI4 A;  2V8S E;  3D9O A;  2LNI A;  4PUC A;  3TG4 A;  3Q4A B;  1DVP A;  3QOU A;  4B8A A;  1SZA A;  4KVO A;  3MV2 B;  4APF A;  1HX8 A;  4B8C B;  4URK A;  2UY1 A;  2ILR A;  2QY7 A;  3ASD A;  2VGY A;  1WM5 A;  4FP7 A;  4DLQ A;  2CG2 A;  3RO3 A;  4OYS A;  2BF0 X;  1GW6 A;  3D9L A;  4A1G A;  2FEZ A;  4CCA A;  1KT0 A;  1Z3X A;  1JPL A;  2A4Z A;  3NZU A;  1KLX A;  1SZ9 A;  4FHK A;  3SNX A;  2FUL A;  1H2V C;  2CHW A;  3CQC B;  1PC2 A;  4J8D A;  4BTB A;  3MGB A;  3N71 A;  5LP0 A;  3B7R L;  5JJT A;  3OXG A;  4BFR A;  4A55 A;  5T3R A;  4MLP A;  3FEY A;  3HVE A;  3AU5 A;  2IU1 A;  4XKB A;  3BG1 B;  3CLJ A;  1INZ A;  4AVX A;  4F1S A;  3FH5 A;  3OAW A;  1NA3 A;  3OTN A;  4BX8 A;  1Z3Y A;  4RG6 A;  3JQ1 A;  3FFL A;  3FH8 A;  5A7D B;  3ZHE B;  3R7Q A;  5FT9 A;  2AVP A;  3TAX A;  2XGS A;  2IOL A;  2LSV A;  4FA6 A;  2EQX A;  3S2A A;  3ZIM A;  2Q7F A;  2J09 A;  2FI7 A;  4GYO A;  3ONL A;  2R59 A;  2X6J A;  4KBQ A;  2PL2 A;  2Y3A A;  4BSX A;  4Q69 A;  2R5S A;  4GZC A;  4XE0 A;  3BEE A;  1E90 A;  2VTB A;  4UQY A;  4AXH A;  2YIN A;  2WB2 A;  3RRM B;  3RRU A;  4GZD A;  2OVF A;  4I2W A;  4FU3 A;  3ENE A;  4R7L A;  3L13 A;  4EPZ A;  1HG2 A;  2ZU6 B;  2CFZ A;  3FUN A;  2HM8 A;  3UQ3 A;  5A6C A;  4C9B B;  2GW1 A;  3TG5 A;  1HFA A;  3KAE A;  3FDH A;  3SBS A;  5KJN A;  1ELW A;  3CVL A;  3IKO B;  3JQ0 A;  4F3V A;  4PS3 A;  3FTZ A;  3ZGQ A;  5CMW A;  3CVV A;  3UUX A;  3ZYQ A;  2X6K A;  3HHM A;  3PH0 C;  2XPZ A;  2X38 A;  2AXZ A;  3GW4 A;  3PRZ A;  5CHE E;  4JZY A;  3UMV A;  3TXN A;  3G2W A;  5AEN A;  3OXF A;  5JJ6 A;  1LF8 A;  3FY4 A;  4WUY A;  1HF8 A;  3ASF A;  2CFU A;  4RSY A;  2MRI A;  1ZBP A;  2JEK A;  4GZ3 A;  4I9C A;  3TJP A;  2UWJ G;  4FAD A;  2KZT A;  3OXL A;  3FHE A;  1QQE A;  4GU5 A;  2J4B A;  3QB2 A;  4CRW A;  3FUK A;  3CQG B;  3PVL A;  3MKR A;  4JA9 A;  3RKV A;  2XPI A;  4GMJ A;  4UWF A;  3I3N A;  2V5F A;  5HI7 A;  4IRU A;  4HOS A;  3ZXS A;  5C1D A;  3FWV A;  2QFC A;  1UW4 B;  3L22 A;  3ZRH A;  5LOZ A;  4WAF A;  2J9Q A;  1S0P A;  1WY6 A;  2UY1 B;  5KJM A;  1EPU A;  4ATG A;  4B89 A;  3U4T A;  4ILG A;  1U3C A;  4XZ4 A;  5D0Q D;  2FBN A;  3TXM A;  2RG8 A;  4UWL A;  4MS6 A;  3SGH A;  4AY6 A;  3QNK A;  1UG3 A;  4LEU A;  5A23 A;  2PQN A;  3E4B A;  4U04 A;  3IHV A;  3FU3 A;  5FQ7 A;  4AOF A;  3VLE A;  2OOE A;  5BT1 A;  3ZN3 A;  2J07 A;  1TJC A;  3FP3 A;  5E75 A;  1HU3 A;  1QNF A;  4JL0 A;  4G23 A;  1HS6 A;  5FZS A;  2HO1 A;  3HVE B;  3MEK A;  2X6F A;  4H7X A;  3IV0 A;  4EBA A;  2R17 C;  4JC8 A;  4ANW A;  4XI0 A;  3S7J A;  3FUH A;  4G24 A;  3KEZ A;  3PZD A;  2KAT A;  1SQM A;  4JEU A;  3D9K A;  5AJD A;  3FUI A;  4PH4 B;  3CVX A;  4BT9 A;  4G1T A;  2WXN A;  3CHM A;  4KMO A;  3ESK A;  2E2E A;  4HFG A;  2KC7 A;  3D3M A;  3JUI A;  4XX5 A;  2GGF A;  1X5B A;  4L2Y A;  2J49 A;  4WNG A;  3RO2 A;  5KJK A;  3U66 A;  5FJY A;  3LJ3 A;  3PE3 A;  1IHG A;  4FUL A;  2WXL A;  1Y8M A;  2KCV A;  3FU5 A;  4I43 A;  5E76 A;  2VTB B;  3URZ A;  4N2S A;  5CMY A;  3CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...