4YVOA

Crystal structure of the tpr domain of arabidopsis flu (flu-tpr)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
119
structure length
119
Chain Sequence
PKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLETD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Non-canonical Tetratricopeptide Repeat (TPR) Domain of Fluorescent (FLU) Mediates Complex Formation with Glutamyl-tRNA Reductase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Fluorescent protein
molecule keywords Protein FLUORESCENT IN BLUE LIGHT, chloroplastic
total genus 57
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yvoA00
3CVPA 2IFUA 2UWJG 3MV3B 3JYSA 4GPKA 2LNIA 2UY1B 2VYIA 4G24A 4U07A 5AYWD 3Q15A 2FF4A 3MA5A 2C0LA 3KD7A 4RG6A 2FI7A 4UI9J 4WNGA 5FJYA 3UPVA 3RO3A 2QFCA 5ARFA 4APOA 3CK7A 2YHCA 4HOTA 4HOQA 2HYZA 3QWPA 2WQHA 3ASFA 4HOUA 5FZSA 3S7JA 1ELWA 4J0UA 1TJCA 3N71A 3LPZA 4I9CA 3HYMB 3K9IA 4XI9A 2V5FA 3RO2A 4GYYA 2YQ8A 4BT8A 3FP3A 1HZ4A 1YA0A 2UY1A 3LY9A 5FT9A 1NA0A 3QWVA 4I9EA 3S7DA 4JA9A 2XEVA 3ZHEA 1QQEA 4G1TA 5CHEE 3MV2B 4AY5A 1E96B 2AVPA 2HR2A 5G04C 3ZGQA 1Y8MA 1FCHA 1QZ2A 3ASHA 3ZN3A 5LCWC 3BEEA 3GW4A 2LSVA 4H7YA 4G26A 4GZ3A 3CEQA 4I1AA 4WUYA 4I2ZA 4YNDA 3TAXA 2FBNA 5FZRA 2IF4A 2XPIA 2Y4UA 3FWVA 4U0ZA 3LCAA 4BTBA 2J9QA 4J8EA 2PQNA 2VGYA 3KS2A 2VGXA 5HI7A 5G04J 4RG9A 4F3VA 1W3BA 2ONDA 4JHRA 3UQ3A 3LY8A 3RIBA 1HH8A 5DBKA 2I6HA 2KCKA 4ME2A 3RJVA 3SF4A 3AS4A 2L6JA 4HOSA 3QWWA 3EDTB 3U4TA 4A1SA 2XGSA 2Q7FA 3ASDA 3MEKA 2PQRA 2PL2A 5G05J 5JJ7A 4BTAA 4CGVA 1NA3A 4U0UA 4UQYA 3QOUA 4YVOA 5EX3A 5FTPA 3R9AB 3RU0A 2HO1A 4KXKB 1ZBPA 4N3AA 4CGWA 4N2SA 4GCNA 4GYWA 4NRHB 3CK8A 4XI0A 3PE3A 5M72A 4KBQA 3FFLA 3Q49B 5KJNA 5ARGA 5D0OD 3ZPJA 5BT1A 4U04A 3GYZA 3Q5MA 3VTYA 4ABNA 4AIFA 2MHKA 4LEUA 4U0SA 2C0MA 3ASGA 4H7XA 4WNFA 5FZQA 3KAEA 3S7FA 1ZU2A 4JL0A 4WNDA 5BW8C 4I2WA 1ELRA 4IN3B 3MKRA 3U3WA 2VGXB 3IEGA 4N2QA 4GYOA 3TG5A 1IYGA 4GCOA 2KCLA 3QKYA 5CCMA 4UQXA 4GA2A 2GW1A 4GA0A 2XGMA 3AS5A 4G23A 5G05C 4BT9A 4BWRA 3TGOA 1A17A 4UI9K 4EQFA 5KJMA 4N3CA 4GA1A 5EKQD 2VSYA 4N5CA 4XIFA 4Y6WA 3ZHEB 5JJTA 4W9RA 4UQZA 5A6CA 5CCLA 1WM5A 2VQ2A 1WAO1 2FEZA 2FO7A 2E2EA 2WPVA 2VSNA 3ESKA 3Q4AB 3ZFWA 5BNWA 1IHGA 1KT0A 3PE4A 4GZ5A 2DBAA 1OUVA 4NQ0A 2P58C 2XGOA 3RKVA 2KCVA 4J8FA 2Y4TA 3CKBA 3CVQA 3LKUA 3OXGA 3CVNA 3CV0A 2KATA 1KT1A 2LSUA 4GZ6A 3TG4A 4CDRA 3Q47B 4WNEA 3SZ7A 3OXFA 4O6FA 1B89A 2BUGA 4JA7A 5C1DA 5KJKA 3GZ2A 3ULQA 2PZIA 1KLXA 1XNFA 4G25A 4UI9C 3PDNA 3GZ1A 3UUXA 4Y6CA 5D0QD 5HQ8A 5EX0A 5LCWJ 3S7BA 4AM9A 1PC2A 4AY6A 2NC9A 4G2VA 5KJLA 3LY7A 3VTXA 1NZNA 4N3BA 3WXXA 3O48A 3CVLA 2XCCA 4YVQC 4I17A 5DIZA 5A7DB 3QDNA 2OOEA 3URZA 3CK9A 2XCBA 4N39A 3NF1A 5JJ6A 3LYAA 4B94A 4KYOB 2R5SA 3E4BA 1HXIA 3OXLA 3AS8A 4HORA 1P5QA 3CKCA 2JLBA 2KC7A 2C2LA 4J8DA
chains in the Genus database with same CATH superfamily
2YINA 3MV3B 4GPKA 2LNIA 1TN7A 3NAWA 1MX2A 4P29A 4EZLA 3UPVA 2XPYA 2QFCA 3BQOA 4APOA 1K3ZD 2IJGX 3LVQE 1UJJA 3ABLE 4J0UA 4EBAA 1HZ4A 4IULA 1OT8A 1QQEA 3ZN3A 2DWZA 2J4DA 3G2TA 4EPZA 4GPMA 1TEZA 3HHMA 1JUQA 3DXMG 4L23A 5IY5E 4RQIA 2V4HC 3F6QA 5G04J 2ONDA 2A5UA 3L17A 1OWMA 4TRQA 1HH8A 1Z5SC 4LRZA 4NACA 2BF0X 3SBTB 3NQPA 3L08A 1S70B 4KXKB 2XEEA 3TWRA 4XI0A 4L2YA 5BT1A 2WXLA 4JL0A 3MKRA 4KT6B 3FDHA 3AS5A 3FUEA 1NFIE 4FULA 2J09A 2FO7A 5BNWA 4F1SA 2GRMA 2XS1A 5BV1A 4D10C 1QNFA 5C1DA 4M7CA 3AG4E 4I6EA 4AV7A 3PNTB 3SI5A 3JQ1A 2FULA 4ILGA 2R5SA 3CVVA 3CKCA 3FTVA 2IFUA 5ENTD 4YDOA 4AOFA 4GTRA 4HNAD 2M63A 1YYHA 1HE8A 4JXTA 3QWPA 1IXVA 4C9BB 1X81A 3ZKJA 5JHAA 3FUKA 3MZLB 3PREA 3V31A 3ZYLA 4G26A 4E85A 4JHJA 1WY6A 2XPIA 3FWVA 4LCTA 3VLDA 1N4RA 5ENSD 1MQSA 1W3BA 2NYJA 3LY8A 3SF4A 2ZGDA 5JHBA 5LOZA 3D9HA 2PQRA 5JJ7A 1UW4B 3FU0A 3UKRG 3HXDA 3FH7A 2EIJE 3DWLG 1DCQA 1D8DA 2MHKA 4GMJA 4F53A 4K5BA 3DXKG 4Q94A 1BI7B 5CERB 4KZCA 4BWRA 1TYQG 4N3CA 5BUZA 2XGOA 3C5RA 3ZU7B 1B89A 2X6JA 3V2OA 3EHQA 1JWFA 5G55A 1NZNA 5BXUA 4KYOB 5CBOA 3HXCA 3AS8A 3MGBA 3RAUA 2KC7A 3EHRA 3D3MA 2QC9A 5KCMA 2P9SG 4G24A 4WNGA 2C0LA 4O1PA 3DBSA 2WQHA 3HVEB 1Q2ZA 4XI9A 2CHWA 3L6AA 3B95A 1H2UA 3ABKE 1JCSA 1PY1A 2CHXA 5FQ7A 2L0TB 4I2ZA 3TAXA 5EYPF 3V30A 5H7PA 4TV3A 3SNXA 3PZDA 3AU4A 5LP0A 3EJNA 3EDTB 3QWWA 4YDWA 4K03A 4N3AA 1K1AA 5ARGA 5D0OD 4QFVA 5BXOA 3ZXPA 2EIME 4MKTA 1QBQA 4MRUA 2WXJA 1MJ0A 4I2WA 2WXNA 1IYGA 5KNGA 4GCOA 3EU5A 5CCMA 2WPVA 4DRXE 3OXGA 3FUDA 5EDSA 2EQXA 4F6RD 3MKQA 3B7UX 5KJKA 1DC2A 3V79K 3R9MA 4FP7A 4Y6CA 1HO8A 1OWPA 3HXEA 4I17A 3QDNA 2OOEA 3DSUA 4HLLA 4HQDA 4DK5A 4JPSA 3CVPA 3C3RA 2V8SE 3JYSA 1MYOA 1KZOA 3MA5A 4UI9J 1H2TC 1U3CA 2XQ0A 1E7VA 1YCSB 4XKBA 4HOTA 2VSOE 5D2MC 4UUCA 1DVPA 1TJCA 4I43A 4I9CA 3CHRA 4J7WA 4GYYA 1UOHA 2UY1A 3Q79A 4B8CB 1KPSB 3E32A 4BFRA 2EINE 4AY5A 2HR2A 1Y8MA 3ULEG 3NZUA 5CEDB 4U0ZA 3L82A 3T8KA 4DUIA 3TL5A 2LXMA 4F3VA 3JXIA 3RIBA 3DPYA 2F8YA 2MRIA 3MEKA 3UT8A 3E33A 3Q78A 4BTAA 3ASOE 4UQYA 2RKKA 3UX4A 5AQ7A 1H6KA 1NL4A 3TWWA 3EHMA 3EU9A 2C0MA 3ASGA 2GRRB 3Q9UC 4WNDA 1TR4A 4CDNA 4U8VD 2J08A 3FUFA 1EYHA 1SVXA 3TWQA 3W9GA 3TWVA 1IQRA 3SQVA 4LERA 4EQFA 4L7TA 1OY3D 5KJMA 2L6BA 2OEVA 3PZ3A 2KCVA 5CRVA 1TNZA 2VTBA 1OCCE 3ML9A 4XX5A 3NOGD 2PZIA 3JCKC 3UUXA 4AY6A 5KJLA 1FT2A 3TWXA 2YNQA 1H19A 5JA4D 1HG5A 3DSXA 2OCCE 1U3DA 2R17C 1N11A 2DYSE 4C0EA 2V5QC 5FZSA 3LPZA 4JVSA 3RO2A 3FTUA 3FP3A 3LY9A 4TUUA 4E6HA 1NA0A 2Y69E 3FTWA 3DEPA 1HX8A 5AQ9A 3IV0A 3APDA 4J8EA 3C3QA 4RG9A 5ENNA 3UQ3A 3UT7A 4TXQA 4XEIG 4V3IA 1EDUA 3GZSA 3TWTA 4NRHB 4WWPA 4KBQA 4ATZD 3GYZA 3L9TA 4GA2A 5G05C 3SHFA 1S63A 2QYUA 1RW2A 2LO6A 4OVVA 1NI1A 2I2OA 3ESKA 3C72A 3AU5A 4ANXA 2H6IA 2GRNB 4GMLA 4URKA 1VDYA 4G11A 2ETCA 1N0RA 4YVQC 1OWOA 4JB8P 3D9MA 4HORA 4AXHA 4CT0A 5AYWD 2BEDA 3HVEA 3QAQA 2ZGGA 3S7JA 2WVIA 4MS6A 2V5FA 5A23A 4XZ4A 3LJNA 3S7DA 4EECA 3BU8A 4K0RA 1FCHA 3I4RB 4N5QA 2FBNA 5D66A 4BETA 5HI7A 2J8SD 2LAHA 4EZKA 5AQBA 5ENOD 2I6HA 5G2NA 2P9UG 3ABME 4QQIA 4U0UA 2VTBB 1RZ4A 2HO1A 2J07A 2CFZA 3EHNA 4CRWA 4YDYA 2WXGA 4OYSA 3U64A 3CLJA 1IKND 3S7FA 4N2QA 2KBXA 4BEPA 4DX7D 3FU5A 2XGMA 4EBAG 4RLYA 4UQZA 2WXIA 3ZFWA 2WQ6A 3QARA 3CV0A 4B89A 1TN6A 3Q73A 4FC8A 2GRPB 3PDNA 5D0QD 1PC2A 4ZHBA 3WXXA 4APFA 3FHEA 2V4LA 3LXUX 4G8LA 2BKGA 4IYPA 4XE0A 5A7DB 3I3NA 4MLPA 1HXIA 1N95A 3HXBA 3KSQA 3SFXA 1JWGA 3B7SA 2YHEA 4HI9A 3DSTA 3LVRE 2HYZA 3CR3A 3MYVA 1ELWA 3L54A 2B0OE 2XZDG 3HYMB 3UM0A 3X2QE 5FT9A 2DYRE 2ILRA 2XEVA 5CHEE 4C48B 1SW6A 5FQ4A 4PUCA 4H7YA 4B8AA 4I1AA 3CEQA 3WG7E 4UWKA 1E8XA 1AP7A 4BERA 4BTBA 4G8KA 1N0QA 2PNNA 3IBEA 4JW1A 4F1PA 4O60A 2R03A 2OV8A 4ANUA 5G05J 2PM6A 1SQMA 2GRQB 1NA3A 3FTYA 3PRZA 3B13A 3QK0A 3UINC 2DZNA 2KZTB 2GRLA 4UWGA 4UI9K 2P9KG 4W9RA 5ITZF 1WAO1 3SFYA 3FULA 1IHGA 3P1UA 3CKBA 1KT1A 4GZ6A 2WXFA 3UKUG 1MX6A 1TNBA 3GZ1A 2CFUA 2IY0C 2NC9A 3FUMA 3ZXSA 1UJKA 4I1MA 4A3VA 2FO1E 5ENPD 4ANVA 3AG1E 1WDYA 4U07A 3C98A 4RG6A 4ILHB 4DX1A 4HOUA 5HS0A 4DX6D 1YA0A 4GTVA 4AVXA 4I9EA 2R2LA 3LEWA 5LCWC 4CEMA 3GW4A 4GZ3A 1H6PA 3LCAA 2XEHA 1N9AA 1IHBA 2WXOA 1Z6TA 3D9IA 1MZCA 4ME2A 2IONA 3HIZA 1LD8A 3S2AA 3FUHA 4GCNA 3I5PA 2Y3AA 1K1BA 3CK8A 4GZCA 4AIFA 3Q5MA 4U0SA 3RRMB 2J4BA 3DSVA 3L16A 4BSXA 4ILIA 1UG3A 3FUIA 4UQXA 4AJWA 4BT9A 1A17A 3KEZA 4XIFA 4GTPA 4K5CA 1OCZE 2ZXWE 2VQ2A 3PH0C 4PH4B 3BG0B 2Y4TA 2KATA 3JXJA 1E90A 3B7TA 1PAQA 4ATGA 1XNFA 2WXQA 4A55A 3S7BA 3ULYA 3RRUA 2GGFA 4GB9A 3J5QB 2J49A 3PEUB 2CHZA 5KNHD 3V2XA 4J6IA 3JQ0A 2UY1B 2VYIA 2KZTA 3D9JA 2FI7A 1D9SA 2HM8A 3CVXA 3FY4A 2DVWA 1FVHA 2X3MA 4DX2A 2P9LG 1E8ZA 2LSVA 1FPPA 3J5PA 5ANRA 3FU6A 2IU1A 1D8EA 4CCAA 4I6GA 2ZU6B 2WXMA 2A5EA 1WG0A 1JCQA 4UWFA 4OVUA 1SZ9A 5KJNA 3RK6A 5E75A 1ZBPA 4DLOA 2LXLA 5M72A 2R59A 3NBNB 4GTTA 5CEAA 3OAWA 5FZQA 3KAEA 5BW8C 4LNBA 4IN3B 4GYOA 3ML8A 2GW1A 3FU3A 4GA0A 4G23A 1TNUA 4Y6WA 3QC1A 3L22A 1Y6IA 2NSZA 2WMOA 3T9KA 4J8FA 1H0AA 2BTDA 2RFAA 5LCWJ 3MCXA 4G2VA 2H6GA 3MKQB 4L9PA 1MHQA 2DZOA 1TNOA 1N4PA 2WXHA 4JZYA 3FH5A 5ANLA 4LSZE 3T5VA 4OAUC 3ONKA 1AWCB 2MOWA 3FH8A 1E8YA 4CZ2D 3Q7FA 4LNUD 3UIOC 3AJIA 1DNPA 3NZSA 3SO8A 2Y4UA 2X6HA 2J9QA 3KS2A 5E76A 3VLFA 3ZEFA 4TXPA 3TXNA 3D9PA 2L6JA 1H6OA 1N4QA 4CGVA 5EX3A 4K5AB 4CDMA 3Q49B 4IRUA 3PUJA 4KMOA 4LEUA 5AIJA 1ELRA 2VGXB 4R7LA 1V55E 4I6JA 4WWNA 1FT1A 3PS6A 4HRMB 3HG0D 2AXZA 1WM5A 5HKPA 1ELKA 3CIAA 2E2EA 5FWQA 1LTXA 4DI4A 4DX5D 4ACKA 3CVNA 2BUGA 5J08A 1EF1C 4G25A 4A3TA 2EILE 4GZDA 1N54A 3Q7AA 2AW6A 2JABA 1QYMA 5JJ6A 5KWDA 3FTSA 3E4BA 5AENA 1S0PA 4PS3A 2KM4A 4HB5A 3CQGB 5EYLA 5FJYA 3RO3A 5FQ8A 3LJ3A 3ASFA 3N71A 2XS8A 2ETBA 4BT8A 3EUVA 3ZHEA 2IO3C 1E96B 4B0ZA 3ZGQA 4KVMA 3QNKA 5FQ6A 1NP7A 3ZIMA 5T8IA 3UM1A 4PS7A 2XRYA 3OTNA 1HFAA 3PVLA 2XZTG 4FHKA 4HOSA 1DCEA 4EHMA 3BUAA 3QOUA 2XENA 2V0PA 5B1AE 3KEAA 1TNYA 2XRZA 4HBDA 4LUNU 1OCRE 3AG2E 2KXPC 4ACLA 4U63A 1OWNA 4LNGA 3MX3A 2FEZA 3Q4AB 3CVYA 1JPLA 2F37A 3LKUA 3RSEG 3SZ7A 4TXRA 4JA7A 4GTOA 3ZNGA 1ZB1A 4HRNA 5FINA 3VTXA 3FTZA 2MYOA 2P9PG 3SGHA 5CRUA 3LYAA 3CQCB 3UIPC 4UWLA 3ONLA 3Q9NC 2I9CA 3FEYA 2FF4A 3CHQA 2X38A 1O1SA 4JD2G 3IHYA 5B1BE 3T8MA 2A4ZA 1QZ2A 3BEEA 3O4ZA 3UTMA 4Q96A 2IOSA 4HS2A 4U8YD 4HXIA 4JHRA 5EN5D 2AXUA 1O1TA 3E34A 1OCOE 4A1SA 2XGSA 5FTPA 4N2SA 3RU0A 3UT4A 3FEXA 4U04A 4OAVB 2QYJA 4WNFA 2QY7A 4KVOA 4FADA 2Y0BG 2OEWA 3DSSA 2XHEA 2HE0A 1A5EA 4DLQA 4PDXA 3ZHEB 3ZYQA 4O1OA 2H6FA 2VSNA 1KT0A 4GZ5A 3CVQA 3Q47B 4GTQA 2VGEA 3RRNB 1O1RA 1UN8A 4LG6A 4N3BA 4N39A 2WXPA 4B94A 3OXLA 5T3RA 4KZ0A 4A63B 3HXFA 3SD5A 4HVBA 3IKOB 2WQ7A 1TJFA 2IOLA 4HOQA 5ENRD 3K9IA 5AJLA 4L1BA 2VSXE 4B93B 3MV2B 2Y1LE 3CSTA 1INZA 5KBAA 3HRAA 3JUIA 5AN8A 3UM2A 3FUNA 5BPPA 4FU3A 2VGXA 2RG8A 3UM3A 2F0YA 3D9NA 4L2LA 5DBKA 3E30A 2LUHA 3D9OA 2KCKA 3RJVA 3CHPA 4GMRA 3U4TA 2RFMA 4A1GA 3JUEA 4YDEA 3SFZA 3CVUA 2XPZA 1LD7A 3ZPJA 2P9IG 4AP2A 3R7RA 3VTYA 4H7XA 1ZU2A 2F8XK 3CHSA 3PUKA 4FLBA 3QKYA 1N94A 5CMYA 3TGOA 1K8KG 2P2CP 4N5CA 5JJTA 1SA4A 2OVBA 3DPDA 3PNLB 4M3OA 5CECB 4U8HA 3PE4A 2DBAA 3ZRHA 3VLEA 4GAAA 3PEVB 2EIKE 3EIJA 3CVWA 3UXGA 1BI8B 4UI9C 1EPUA 2R02A 4AM9A 2XCCA 5HRYA 5AJDA 3EIQC 3D9LA 4FJZA 4NIKA 1JCRA 2XCBA 3ZYMA 1GW6A 2AJAA 5C2YA 4UWHA 2P9NG 2L0IA 3HDXA 3ASNE 3G2SA 3I4GA 1BD8A 3B7BA 1L5JA 2YQ8A 3G2VA 1O5MA 3QWVA 5BV0A 4JA9A 3PZ4A 2AVPA 2WMNA 4GU5A 5G04C 2QZAA 4FLHA 3DEOA 1G3NB 4YNDA 1LF8A 4BY6A 1SA5A 1MX4A 3W9FA 3AS4A 3CGHA 2Q7FA 5EIDA 4YVOA 1UN9A 2H6HA 3PE3A 3E37A 1XGWA 2LAIA 3DSWA 4C0MA 1Z3XA 3PZ1A 4HI8A 3TG5A 4JC8A 3ZYKA 5J90A 2AXVA 2KCLA 5FIOA 4RVBA 5EKQD 4GA1A 2WM9A 5JMND 1S64A 2DIWA 1E7UA 1OUVA 3NOCD 4O6FA 3GZ2A 3ULQA 3NB2A 4JEUA 3CSFA 5CBNA 5EX0A 1YMPA 4GTSA 3O48A 3CVLA 3URZA 3NF1A 4BX9A 4RSYA 1P5QA 2JLBA 4PS8A 4CT4A 2UWJG 3CHMA 4J8SA 3KD7A 4I1OB 5ARFA 2YHCA 3TWSA 1BU9A 4G1TA 2ZIRA 3SY2A 3D9KA 3ASHA 3BG1B 5B3SE 4TUMA 1N4SA 5AARA 1FVFA 2AWIA 3LS8A 3KSLA 4HRLA 2WXRA 1SZAA 4BX8A 2JEKA 3R7QA 3ASDA 3IXEA 2PL2A 2ZISA 5CCLA 2X6FA 4ANWA 4F7AA 2OVFA 3FFLA 4DJAA 2NXPA 1TN8A 4ABNA 1HU3A 2CG3A 4XKCA 3IEGA 3G2UA 4FA6A 2E0IA 3PZ2A 2PM7A 4FHJA 2VSYA 1H2VC 4BSZB 5A6CA 2B6CA 3UMVA 3L13A 3RKVA 4CDRA 1E8WA 3OXFA 5HQ8A 3DRAA 1N52A 3APFA 3FUJA 4Z68A 2WB2A 3MJWA 3TXMA 3SBSA 3CK9A 4CYMD 1OXJA 2ETAA 3QJZA 2WXKA 4J8DA 4CGWA 4JEHA 4WWOA 1OWLA 3B7RL 1Z3YA 3Q15A 5EIBE 3ZUVB 3CK7A 4J8YA 1V54E 2GROB 3UI2A 4ZFHA 1U2VG 2RD0A 3LDZA 1X5BA 2VJ8A 4JHKA 3TJPA 2DCPA 3ESLA 2R05A 2X6IA 5AQAA 3U9WA 4GTMA 4WUYA 5FZRA 4BESA 5ENQD 2IF4A 2PQNA 2VGYA 5CMWA 2BKKB 2CG2A 1KZPA 5LFAA 2IEJA 3ZVVA 3R9AB 1BPOA 3ZW3A 4MBGA 4GYWA 5T4YA 2L9BA 4HFGA 1HG2A 2IO2C 3ENEA 4AEZC 5AAOA 1HS6A 4X8QA 4EZJA 4DPRA 3AAAC 3U66A 3C3OA 3U3WA 3T5XA 4FJYA 3CHOA 2X6KA 2I1JA 4DI3A 4U95D 4U96D 4NURA 3TWUA 3G2WA 4WAFA 4NQ0A 1BLXB 2P58C 4HLEA 2I1KA 2LSUA 3TG4A 4WNEA 5LX8A 3APCA 3IHVA 1KLXA 4Q69A 1HF8A 5EILA 3LY7A 5DIZA 3QB2A 3FTXA 3Q75A 1IQUA 2IQCA 3ISMC 4U7EB 3AG3E 3P2BA 2C2LA
chains in the Genus database with same CATH topology
2R17C 2YINA 3MV3B 4J6IA 5T3RA 4GPKA 3JQ0A 2LNIA 4C0EA 2UY1B 2VYIA 4KZ0A 2KZTA 3SD5A 3D9JA 2FI7A 4P29A 4EZLA 3IKOB 4HVBA 3UPVA 2XPYA 2QFCA 4APOA 2WQ7A 1TJFA 2IOLA 4HOQA 2IJGX 3LVQE 5FZSA 1UJJA 4J0UA 2HM8A 3LPZA 4EBAA 3FY4A 3K9IA 3CVXA 4JVSA 3RO2A 3FTUA 3FP3A 1HZ4A 3LY9A 4IULA 4TUUA 5AJLA 4E6HA 1NA0A 4L1BA 2VSXE 1FVHA 1QQEA 2X3MA 3MV2B 3CSTA 3FTWA 1INZA 3ZN3A 2J4DA 3G2TA 1E8ZA 3JUIA 2LSVA 4EPZA 1HX8A 1TEZA 5ANRA 3HHMA 1JUQA 3FUNA 3IV0A 4L23A 5BPPA 3FU6A 3APDA 2IU1A 4FU3A 4J8EA 4CCAA 2VGXA 2RG8A 5G04J 4I6GA 2ZU6B 4RG9A 3D9NA 2WXMA 5ENNA 2A5UA 2ONDA 4L2LA 3UQ3A 3L17A 1OWMA 3UT7A 4TRQA 1HH8A 5DBKA 3D9OA 2KCKA 3RJVA 4V3IA 3CHPA 4UWFA 3U4TA 4LRZA 4NACA 2BF0X 3SBTB 1EDUA 3NQPA 3L08A 4A1GA 4OVUA 1SZ9A 3GZSA 5KJNA 3SFZA 3RK6A 2XPZA 4KXKB 5E75A 1ZBPA 3CVUA 4NRHB 4XI0A 4WWPA 4DLOA 5M72A 4KBQA 3ZPJA 4L2YA 5BT1A 2R59A 3GYZA 4AP2A 2WXLA 3R7RA 3VTYA 3OAWA 4H7XA 5FZQA 3KAEA 1ZU2A 4JL0A 5BW8C 4IN3B 3CHSA 3MKRA 4KT6B 3FDHA 4GYOA 3PUKA 4FLBA 3ML8A 3QKYA 4GA2A 2GW1A 3FU3A 3AS5A 3FUEA 4G23A 4GA0A 5CMYA 5G05C 3TGOA 3SHFA 2LO6A 4OVVA 4N5CA 4Y6WA 3QC1A 3L22A 5JJTA 1Y6IA 2OVBA 3DPDA 2NSZA 4FULA 2J09A 2FO7A 3PNLB 2WMOA 4M3OA 5BNWA 2I2OA 3ESKA 4U8HA 4F1SA 3PE4A 2DBAA 3ZRHA 2GRMA 3AU5A 4J8FA 5BV1A 4D10C 4ANXA 1QNFA 1H0AA 3VLEA 4GAAA 2BTDA 3PEVB 4GMLA 3EIJA 5C1DA 3CVWA 4URKA 4I6EA 4UI9C 5LCWJ 1VDYA 1EPUA 4G11A 3MCXA 4AV7A 4AM9A 4G2VA 3MKQB 3PNTB 3SI5A 1MHQA 2XCCA 4YVQC 5AJDA 3EIQC 3D9LA 4FJZA 1OWOA 3JQ1A 2FULA 2XCBA 3D9MA 4ILGA 2R5SA 3ZYMA 3CVVA 1GW6A 4HORA 2WXHA 5C2YA 3CKCA 4JZYA 3FTVA 4UWHA 4AXHA 2IFUA 4CT0A 2L0IA 3HDXA 5AYWD 4AOFA 3FH5A 5ANLA 2M63A 3G2SA 3HVEA 3I4GA 3QAQA 3T5VA 1HE8A 3ONKA 3QWPA 4JXTA 3S7JA 4C9BB 2MOWA 2WVIA 4MS6A 2V5FA 3FH8A 1L5JA 5JHAA 2YQ8A 1E8YA 5A23A 4XZ4A 3G2VA 3QWVA 3S7DA 5BV0A 4JA9A 3FUKA 4EECA 2AVPA 2WMNA 4GU5A 3MZLB 3PREA 5G04C 4K0RA 1FCHA 1DNPA 3I4RB 3ZYLA 4FLHA 4G26A 4E85A 4YNDA 1LF8A 2FBNA 4JHJA 4BY6A 3NZSA 1WY6A 2XPIA 2Y4UA 2X6HA 3FWVA 4LCTA 3VLDA 2J9QA 3KS2A 5HI7A 1MQSA 2LAHA 1W3BA 5E76A 4EZKA 3VLFA 3LY8A 3ZEFA 2I6HA 3SF4A 5G2NA 3TXNA 3D9PA 3AS4A 2L6JA 5JHBA 3CGHA 5LOZA 2Q7FA 2PQRA 5JJ7A 1UW4B 4CGVA 4U0UA 4YVOA 2VTBB 5EX3A 2HO1A 2J07A 2CFZA 3EHNA 3FU0A 1UN9A 4CRWA 4CDMA 2WXGA 3PE3A 3Q49B 4OYSA 3U64A 3CLJA 3FH7A 4IRUA 3PUJA 4KMOA 2MHKA 4GMJA 4LEUA 4F53A 1XGWA 2LAIA 3S7FA 5AIJA 4C0MA 1ELRA 1Z3XA 4N2QA 2VGXB 4Q94A 4R7LA 4JC8A 3TG5A 3ZYKA 4I6JA 2AXVA 5J90A 2KCLA 4WWNA 3FU5A 4KZCA 2XGMA 4RVBA 4BWRA 3PS6A 4N3CA 4GA1A 5EKQD 4EBAG 2WM9A 2DIWA 4UQZA 2AXZA 1WM5A 5BUZA 1ELKA 3CIAA 2WXIA 2E2EA 3ZFWA 2WQ6A 5FWQA 1E7UA 3QARA 1OUVA 2XGOA 4DI4A 4ACKA 3CVNA 3CV0A 4B89A 4O6FA 1B89A 2BUGA 4FC8A 2X6JA 3GZ2A 3ULQA 5J08A 4JEUA 1EF1C 4G25A 3CSFA 3PDNA 4A3TA 5D0QD 5EX0A 1PC2A 4GZDA 1JWFA 1N54A 5G55A 1NZNA 3WXXA 2AW6A 4APFA 3O48A 3CVLA 3FHEA 2V4LA 3LXUX 4IYPA 4XE0A 5A7DB 3URZA 5JJ6A 3NF1A 4BX9A 3I3NA 4RSYA 4MLPA 4KYOB 3FTSA 3E4BA 1HXIA 5AENA 3AS8A 1P5QA 3MGBA 2JLBA 4PS8A 2KC7A 1S0PA 4CT4A 4PS3A 3D3MA 5KCMA 2UWJG 1JWGA 3B7SA 4G24A 2KM4A 3CHMA 4J8SA 3CQGB 4WNGA 2C0LA 3KD7A 4I1OB 5FJYA 2YHEA 3RO3A 5ARFA 5FQ8A 3LVRE 2YHCA 3DBSA 3LJ3A 2HYZA 3CR3A 2WQHA 3ASFA 3MYVA 1ELWA 3HVEB 3N71A 3L54A 3HYMB 4XI9A 2CHWA 3L6AA 4BT8A 5FT9A 1H2UA 2ILRA 2XEVA 3ZHEA 4G1TA 5CHEE 1PY1A 1E96B 4B0ZA 2CHXA 3ZGQA 3D9KA 4KVMA 3ASHA 5FQ4A 5FQ7A 2L0TB 3QNKA 4PUCA 3BG1B 4H7YA 1NP7A 5FQ6A 4B8AA 4I1AA 3CEQA 3ZIMA 4I2ZA 3TAXA 4UWKA 5T8IA 1E8XA 1FVFA 2AWIA 4BTBA 3LS8A 4PS7A 4TV3A 3SNXA 2WXRA 3PZDA 3IBEA 4JW1A 2XRYA 3OTNA 1SZAA 1HFAA 3AU4A 4BX8A 5LP0A 3PVLA 4FHKA 2JEKA 2OV8A 3R7QA 4HOSA 3EJNA 3EDTB 3QWWA 4ANUA 5G05J 2PM6A 2PL2A 1SQMA 1NA3A 5CCLA 2X6FA 3QOUA 4K03A 4ANWA 4N3AA 4F7AA 2V0PA 2OVFA 3FTYA 3PRZA 3FFLA 3B13A 3QK0A 5D0OD 4QFVA 5ARGA 4DJAA 2XRZA 2NXPA 4ABNA 4MKTA 4LUNU 2KZTB 4MRUA 2GRLA 2WXJA 1HU3A 2CG3A 4I2WA 2WXNA 4XKCA 3IEGA 1IYGA 4GCOA 4ACLA 4UWGA 5CCMA 3G2UA 4FA6A 2E0IA 4U63A 1OWNA 2PM7A 4FHJA 4UI9K 2VSYA 1H2VC 3MX3A 4W9RA 5A6CA 2FEZA 1WAO1 3UMVA 2WPVA 3Q4AB 3CVYA 1JPLA 3FULA 1IHGA 3L13A 3RKVA 3P1UA 3CKBA 3LKUA 3OXGA 3FUDA 5EDSA 2EQXA 1KT1A 1E8WA 3MKQA 4GZ6A 2WXFA 3SZ7A 4CDRA 3OXFA 3B7UX 4JA7A 5KJKA 3GZ1A 2CFUA 4FP7A 4Y6CA 5HQ8A 1HO8A 1N52A 2NC9A 3FUMA 3ZXSA 1OWPA 3APFA 3FUJA 3VTXA 3FTZA 3SGHA 2WB2A 4I17A 3MJWA 3QDNA 2OOEA 3TXMA 3SBSA 3CK9A 1UJKA 3LYAA 3CQCB 3QJZA 4UWLA 2WXKA 3ONLA 4I1MA 4A3VA 4DK5A 4J8DA 4JPSA 4CGWA 4JEHA 3CVPA 2I9CA 3FEYA 2V8SE 4WWOA 3JYSA 4ANVA 1OWLA 4U07A 3B7RL 1Z3YA 3C98A 2FF4A 3Q15A 3MA5A 4RG6A 4UI9J 1H2TC 1U3CA 2XQ0A 1E7VA 4ILHB 4XKBA 3CK7A 3CHQA 4HOTA 2X38A 4HOUA 2VSOE 2RD0A 1DVPA 1TJCA 4I43A 4I9CA 3CHRA 1X5BA 2VJ8A 3LDZA 4GYYA 4JHKA 3TJPA 2UY1A 1YA0A 4B8CB 4I9EA 2DCPA 3IHYA 4AVXA 4BFRA 3ESLA 3T8MA 4AY5A 2X6IA 2A4ZA 2HR2A 3LEWA 1Y8MA 1QZ2A 5LCWC 4CEMA 3BEEA 3GW4A 3U9WA 3O4ZA 4GZ3A 3NZUA 4WUYA 5FZRA 2IF4A 4U0ZA 3LCAA 2PQNA 2VGYA 4Q96A 2IOSA 2WXOA 4HS2A 5CMWA 3TL5A 1Z6TA 4F3VA 4HXIA 2CG2A 4JHRA 3D9IA 3RIBA 5LFAA 4ME2A 2AXUA 3ZVVA 4A1SA 2MRIA 2XGSA 3MEKA 3UT8A 2IONA 4BTAA 3HIZA 3R9AB 4UQYA 3S2AA 5FTPA 4N2SA 1BPOA 3RU0A 3FUHA 3UT4A 3UX4A 3ZW3A 4GCNA 3I5PA 2Y3AA 4GYWA 3CK8A 3FEXA 5T4YA 2L9BA 1H6KA 4U04A 4HFGA 1HG2A 4GZCA 3ENEA 3Q5MA 4AEZC 4AIFA 3EHMA 4WNFA 1HS6A 3ASGA 2C0MA 2J4BA 2QY7A 4U0SA 3RRMB 4KVOA 4EZJA 4WNDA 3L16A 4CDNA 4DPRA 3U66A 4FADA 3U3WA 2J08A 3FUFA 4BSXA 1EYHA 4ILIA 1UG3A 3FUIA 2XHEA 4UQXA 3T5XA 4FJYA 4AJWA 4BT9A 1IQRA 3CHOA 1A17A 4LERA 4DLQA 4PDXA 3KEZA 4EQFA 3ZHEB 3ZYQA 4L7TA 2X6KA 4XIFA 2I1JA 4DI3A 2VQ2A 3PH0C 5KJMA 4NURA 2VSNA 3G2WA 4PH4B 1KT0A 3BG0B 4GZ5A 4WAFA 4NQ0A 2P58C 4HLEA 2KCVA 2Y4TA 3CVQA 2I1KA 2KATA 2LSUA 3TG4A 3Q47B 4WNEA 5LX8A 3APCA 2VTBA 3ML9A 1E90A 3B7TA 4XX5A 1PAQA 2PZIA 3IHVA 1UN8A 1KLXA 1XNFA 3JCKC 3RRNB 3UUXA 4ATGA 4Q69A 1HF8A 4AY6A 2WXQA 4A55A 3S7BA 5KJLA 3LY7A 3RRUA 4N3BA 2GGFA 5DIZA 3QB2A 4GB9A 3FTXA 3P2BA 1IQUA 2IQCA 2YNQA 4N39A 2J49A 2WXPA 3PEUB 4B94A 2CHZA 1H19A 3OXLA 1HG5A 3ASDA 2C2LA 1U3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVP A;  2IFU A;  2UWJ G;  3MV3 B;  3JYS A;  4GPK A;  2LNI A;  2UY1 B;  2VYI A;  4G24 A;  4U07 A;  5AYW D;  3Q15 A;  2FF4 A;  3MA5 A;  2C0L A;  3KD7 A;  4RG6 A;  2FI7 A;  4UI9 J;  4WNG A;  5FJY A;  3UPV A;  3RO3 A;  2QFC A;  5ARF A;  4APO A;  3CK7 A;  2YHC A;  4HOT A;  4HOQ A;  2HYZ A;  3QWP A;  2WQH A;  3ASF A;  4HOU A;  5FZS A;  3S7J A;  1ELW A;  4J0U A;  1TJC A;  3N71 A;  3LPZ A;  4I9C A;  3HYM B;  3K9I A;  4XI9 A;  2V5F A;  3RO2 A;  4GYY A;  2YQ8 A;  4BT8 A;  3FP3 A;  1HZ4 A;  1YA0 A;  2UY1 A;  3LY9 A;  5FT9 A;  1NA0 A;  3QWV A;  4I9E A;  3S7D A;  4JA9 A;  2XEV A;  3ZHE A;  1QQE A;  4G1T A;  5CHE E;  3MV2 B;  4AY5 A;  1E96 B;  2AVP A;  2HR2 A;  5G04 C;  3ZGQ A;  1Y8M A;  1FCH A;  1QZ2 A;  3ASH A;  3ZN3 A;  5LCW C;  3BEE A;  3GW4 A;  2LSV A;  4H7Y A;  4G26 A;  4GZ3 A;  3CEQ A;  4I1A A;  4WUY A;  4I2Z A;  4YND A;  3TAX A;  2FBN A;  5FZR A;  2IF4 A;  2XPI A;  2Y4U A;  3FWV A;  4U0Z A;  3LCA A;  4BTB A;  2J9Q A;  4J8E A;  2PQN A;  2VGY A;  3KS2 A;  2VGX A;  5HI7 A;  5G04 J;  4RG9 A;  4F3V A;  1W3B A;  2OND A;  4JHR A;  3UQ3 A;  3LY8 A;  3RIB A;  1HH8 A;  5DBK A;  2I6H A;  2KCK A;  4ME2 A;  3RJV A;  3SF4 A;  3AS4 A;  2L6J A;  4HOS A;  3QWW A;  3EDT B;  3U4T A;  4A1S A;  2XGS A;  2Q7F A;  3ASD A;  3MEK A;  2PQR A;  2PL2 A;  5G05 J;  5JJ7 A;  4BTA A;  4CGV A;  1NA3 A;  4U0U A;  4UQY A;  3QOU A;  4YVO A;  5EX3 A;  5FTP A;  3R9A B;  3RU0 A;  2HO1 A;  4KXK B;  1ZBP A;  4N3A A;  4CGW A;  4N2S A;  4GCN A;  4GYW A;  4NRH B;  3CK8 A;  4XI0 A;  3PE3 A;  5M72 A;  4KBQ A;  3FFL A;  3Q49 B;  5KJN A;  5ARG A;  5D0O D;  3ZPJ A;  5BT1 A;  4U04 A;  3GYZ A;  3Q5M A;  3VTY A;  4ABN A;  4AIF A;  2MHK A;  4LEU A;  4U0S A;  2C0M A;  3ASG A;  4H7X A;  4WNF A;  5FZQ A;  3KAE A;  3S7F A;  1ZU2 A;  4JL0 A;  4WND A;  5BW8 C;  4I2W A;  1ELR A;  4IN3 B;  3MKR A;  3U3W A;  2VGX B;  3IEG A;  4N2Q A;  4GYO A;  3TG5 A;  1IYG A;  4GCO A;  2KCL A;  3QKY A;  5CCM A;  4UQX A;  4GA2 A;  2GW1 A;  4GA0 A;  2XGM A;  3AS5 A;  4G23 A;  5G05 C;  4BT9 A;  4BWR A;  3TGO A;  1A17 A;  4UI9 K;  4EQF A;  5KJM A;  4N3C A;  4GA1 A;  5EKQ D;  2VSY A;  4N5C A;  4XIF A;  4Y6W A;  3ZHE B;  5JJT A;  4W9R A;  4UQZ A;  5A6C A;  5CCL A;  1WM5 A;  2VQ2 A;  1WAO 1;  2FEZ A;  2FO7 A;  2E2E A;  2WPV A;  2VSN A;  3ESK A;  3Q4A B;  3ZFW A;  5BNW A;  1IHG A;  1KT0 A;  3PE4 A;  4GZ5 A;  2DBA A;  1OUV A;  4NQ0 A;  2P58 C;  2XGO A;  3RKV A;  2KCV A;  4J8F A;  2Y4T A;  3CKB A;  3CVQ A;  3LKU A;  3OXG A;  3CVN A;  3CV0 A;  2KAT A;  1KT1 A;  2LSU A;  4GZ6 A;  3TG4 A;  4CDR A;  3Q47 B;  4WNE A;  3SZ7 A;  3OXF A;  4O6F A;  1B89 A;  2BUG A;  4JA7 A;  5C1D A;  5KJK A;  3GZ2 A;  3ULQ A;  2PZI A;  1KLX A;  1XNF A;  4G25 A;  4UI9 C;  3PDN A;  3GZ1 A;  3UUX A;  4Y6C A;  5D0Q D;  5HQ8 A;  5EX0 A;  5LCW J;  3S7B A;  4AM9 A;  1PC2 A;  4AY6 A;  2NC9 A;  4G2V A;  5KJL A;  3LY7 A;  3VTX A;  1NZN A;  4N3B A;  3WXX A;  3O48 A;  3CVL A;  2XCC A;  4YVQ C;  4I17 A;  5DIZ A;  5A7D B;  3QDN A;  2OOE A;  3URZ A;  3CK9 A;  2XCB A;  4N39 A;  3NF1 A;  5JJ6 A;  3LYA A;  4B94 A;  4KYO B;  2R5S A;  3E4B A;  1HXI A;  3OXL A;  3AS8 A;  4HOR A;  1P5Q A;  3CKC A;  2JLB A;  2KC7 A;  2C2L A;  4J8D A; 
#chains in the Genus database with same CATH topology
 2YIN A;  3MV3 B;  4GPK A;  2LNI A;  1TN7 A;  3NAW A;  1MX2 A;  4P29 A;  4EZL A;  3UPV A;  2XPY A;  2QFC A;  3BQO A;  4APO A;  1K3Z D;  2IJG X;  3LVQ E;  1UJJ A;  3ABL E;  4J0U A;  4EBA A;  1HZ4 A;  4IUL A;  1OT8 A;  1QQE A;  3ZN3 A;  2DWZ A;  2J4D A;  3G2T A;  4EPZ A;  4GPM A;  1TEZ A;  3HHM A;  1JUQ A;  3DXM G;  4L23 A;  5IY5 E;  4RQI A;  2V4H C;  3F6Q A;  5G04 J;  2OND A;  2A5U A;  3L17 A;  1OWM A;  4TRQ A;  1HH8 A;  1Z5S C;  4LRZ A;  4NAC A;  2BF0 X;  3SBT B;  3NQP A;  3L08 A;  1S70 B;  4KXK B;  2XEE A;  3TWR A;  4XI0 A;  4L2Y A;  5BT1 A;  2WXL A;  4JL0 A;  3MKR A;  4KT6 B;  3FDH A;  3AS5 A;  3FUE A;  1NFI E;  4FUL A;  2J09 A;  2FO7 A;  5BNW A;  4F1S A;  2GRM A;  2XS1 A;  5BV1 A;  4D10 C;  1QNF A;  5C1D A;  4M7C A;  3AG4 E;  4I6E A;  4AV7 A;  3PNT B;  3SI5 A;  3JQ1 A;  2FUL A;  4ILG A;  2R5S A;  3CVV A;  3CKC A;  3FTV A;  2IFU A;  5ENT D;  4YDO A;  4AOF A;  4GTR A;  4HNA D;  2M63 A;  1YYH A;  1HE8 A;  4JXT A;  3QWP A;  1IXV A;  4C9B B;  1X81 A;  3ZKJ A;  5JHA A;  3FUK A;  3MZL B;  3PRE A;  3V31 A;  3ZYL A;  4G26 A;  4E85 A;  4JHJ A;  1WY6 A;  2XPI A;  3FWV A;  4LCT A;  3VLD A;  1N4R A;  5ENS D;  1MQS A;  1W3B A;  2NYJ A;  3LY8 A;  3SF4 A;  2ZGD A;  5JHB A;  5LOZ A;  3D9H A;  2PQR A;  5JJ7 A;  1UW4 B;  3FU0 A;  3UKR G;  3HXD A;  3FH7 A;  2EIJ E;  3DWL G;  1DCQ A;  1D8D A;  2MHK A;  4GMJ A;  4F53 A;  4K5B A;  3DXK G;  4Q94 A;  1BI7 B;  5CER B;  4KZC A;  4BWR A;  1TYQ G;  4N3C A;  5BUZ A;  2XGO A;  3C5R A;  3ZU7 B;  1B89 A;  2X6J A;  3V2O A;  3EHQ A;  1JWF A;  5G55 A;  1NZN A;  5BXU A;  4KYO B;  5CBO A;  3HXC A;  3AS8 A;  3MGB A;  3RAU A;  2KC7 A;  3EHR A;  3D3M A;  2QC9 A;  5KCM A;  2P9S G;  4G24 A;  4WNG A;  2C0L A;  4O1P A;  3DBS A;  2WQH A;  3HVE B;  1Q2Z A;  4XI9 A;  2CHW A;  3L6A A;  3B95 A;  1H2U A;  3ABK E;  1JCS A;  1PY1 A;  2CHX A;  5FQ7 A;  2L0T B;  4I2Z A;  3TAX A;  5EYP F;  3V30 A;  5H7P A;  4TV3 A;  3SNX A;  3PZD A;  3AU4 A;  5LP0 A;  3EJN A;  3EDT B;  3QWW A;  4YDW A;  4K03 A;  4N3A A;  1K1A A;  5ARG A;  5D0O D;  4QFV A;  5BXO A;  3ZXP A;  2EIM E;  4MKT A;  1QBQ A;  4MRU A;  2WXJ A;  1MJ0 A;  4I2W A;  2WXN A;  1IYG A;  5KNG A;  4GCO A;  3EU5 A;  5CCM A;  2WPV A;  4DRX E;  3OXG A;  3FUD A;  5EDS A;  2EQX A;  4F6R D;  3MKQ A;  3B7U X;  5KJK A;  1DC2 A;  3V79 K;  3R9M A;  4FP7 A;  4Y6C A;  1HO8 A;  1OWP A;  3HXE A;  4I17 A;  3QDN A;  2OOE A;  3DSU A;  4HLL A;  4HQD A;  4DK5 A;  4JPS A;  3CVP A;  3C3R A;  2V8S E;  3JYS A;  1MYO A;  1KZO A;  3MA5 A;  4UI9 J;  1H2T C;  1U3C A;  2XQ0 A;  1E7V A;  1YCS B;  4XKB A;  4HOT A;  2VSO E;  5D2M C;  4UUC A;  1DVP A;  1TJC A;  4I43 A;  4I9C A;  3CHR A;  4J7W A;  4GYY A;  1UOH A;  2UY1 A;  3Q79 A;  4B8C B;  1KPS B;  3E32 A;  4BFR A;  2EIN E;  4AY5 A;  2HR2 A;  1Y8M A;  3ULE G;  3NZU A;  5CED B;  4U0Z A;  3L82 A;  3T8K A;  4DUI A;  3TL5 A;  2LXM A;  4F3V A;  3JXI A;  3RIB A;  3DPY A;  2F8Y A;  2MRI A;  3MEK A;  3UT8 A;  3E33 A;  3Q78 A;  4BTA A;  3ASO E;  4UQY A;  2RKK A;  3UX4 A;  5AQ7 A;  1H6K A;  1NL4 A;  3TWW A;  3EHM A;  3EU9 A;  2C0M A;  3ASG A;  2GRR B;  3Q9U C;  4WND A;  1TR4 A;  4CDN A;  4U8V D;  2J08 A;  3FUF A;  1EYH A;  1SVX A;  3TWQ A;  3W9G A;  3TWV A;  1IQR A;  3SQV A;  4LER A;  4EQF A;  4L7T A;  1OY3 D;  5KJM A;  2L6B A;  2OEV A;  3PZ3 A;  2KCV A;  5CRV A;  1TNZ A;  2VTB A;  1OCC E;  3ML9 A;  4XX5 A;  3NOG D;  2PZI A;  3JCK C;  3UUX A;  4AY6 A;  5KJL A;  1FT2 A;  3TWX A;  2YNQ A;  1H19 A;  5JA4 D;  1HG5 A;  3DSX A;  2OCC E;  1U3D A;  2R17 C;  1N11 A;  2DYS E;  4C0E A;  2V5Q C;  5FZS A;  3LPZ A;  4JVS A;  3RO2 A;  3FTU A;  3FP3 A;  3LY9 A;  4TUU A;  4E6H A;  1NA0 A;  2Y69 E;  3FTW A;  3DEP A;  1HX8 A;  5AQ9 A;  3IV0 A;  3APD A;  4J8E A;  3C3Q A;  4RG9 A;  5ENN A;  3UQ3 A;  3UT7 A;  4TXQ A;  4XEI G;  4V3I A;  1EDU A;  3GZS A;  3TWT A;  4NRH B;  4WWP A;  4KBQ A;  4ATZ D;  3GYZ A;  3L9T A;  4GA2 A;  5G05 C;  3SHF A;  1S63 A;  2QYU A;  1RW2 A;  2LO6 A;  4OVV A;  1NI1 A;  2I2O A;  3ESK A;  3C72 A;  3AU5 A;  4ANX A;  2H6I A;  2GRN B;  4GML A;  4URK A;  1VDY A;  4G11 A;  2ETC A;  1N0R A;  4YVQ C;  1OWO A;  4JB8 P;  3D9M A;  4HOR A;  4AXH A;  4CT0 A;  5AYW D;  2BED A;  3HVE A;  3QAQ A;  2ZGG A;  3S7J A;  2WVI A;  4MS6 A;  2V5F A;  5A23 A;  4XZ4 A;  3LJN A;  3S7D A;  4EEC A;  3BU8 A;  4K0R A;  1FCH A;  3I4R B;  4N5Q A;  2FBN A;  5D66 A;  4BET A;  5HI7 A;  2J8S D;  2LAH A;  4EZK A;  5AQB A;  5ENO D;  2I6H A;  5G2N A;  2P9U G;  3ABM E;  4QQI A;  4U0U A;  2VTB B;  1RZ4 A;  2HO1 A;  2J07 A;  2CFZ A;  3EHN A;  4CRW A;  4YDY A;  2WXG A;  4OYS A;  3U64 A;  3CLJ A;  1IKN D;  3S7F A;  4N2Q A;  2KBX A;  4BEP A;  4DX7 D;  3FU5 A;  2XGM A;  4EBA G;  4RLY A;  4UQZ A;  2WXI A;  3ZFW A;  2WQ6 A;  3QAR A;  3CV0 A;  4B89 A;  1TN6 A;  3Q73 A;  4FC8 A;  2GRP B;  3PDN A;  5D0Q D;  1PC2 A;  4ZHB A;  3WXX A;  4APF A;  3FHE A;  2V4L A;  3LXU X;  4G8L A;  2BKG A;  4IYP A;  4XE0 A;  5A7D B;  3I3N A;  4MLP A;  1HXI A;  1N95 A;  3HXB A;  3KSQ A;  3SFX A;  1JWG A;  3B7S A;  2YHE A;  4HI9 A;  3DST A;  3LVR E;  2HYZ A;  3CR3 A;  3MYV A;  1ELW A;  3L54 A;  2B0O E;  2XZD G;  3HYM B;  3UM0 A;  3X2Q E;  5FT9 A;  2DYR E;  2ILR A;  2XEV A;  5CHE E;  4C48 B;  1SW6 A;  5FQ4 A;  4PUC A;  4H7Y A;  4B8A A;  4I1A A;  3CEQ A;  3WG7 E;  4UWK A;  1E8X A;  1AP7 A;  4BER A;  4BTB A;  4G8K A;  1N0Q A;  2PNN A;  3IBE A;  4JW1 A;  4F1P A;  4O60 A;  2R03 A;  2OV8 A;  4ANU A;  5G05 J;  2PM6 A;  1SQM A;  2GRQ B;  1NA3 A;  3FTY A;  3PRZ A;  3B13 A;  3QK0 A;  3UIN C;  2DZN A;  2KZT B;  2GRL A;  4UWG A;  4UI9 K;  2P9K G;  4W9R A;  5ITZ F;  1WAO 1;  3SFY A;  3FUL A;  1IHG A;  3P1U A;  3CKB A;  1KT1 A;  4GZ6 A;  2WXF A;  3UKU G;  1MX6 A;  1TNB A;  3GZ1 A;  2CFU A;  2IY0 C;  2NC9 A;  3FUM A;  3ZXS A;  1UJK A;  4I1M A;  4A3V A;  2FO1 E;  5ENP D;  4ANV A;  3AG1 E;  1WDY A;  4U07 A;  3C98 A;  4RG6 A;  4ILH B;  4DX1 A;  4HOU A;  5HS0 A;  4DX6 D;  1YA0 A;  4GTV A;  4AVX A;  4I9E A;  2R2L A;  3LEW A;  5LCW C;  4CEM A;  3GW4 A;  4GZ3 A;  1H6P A;  3LCA A;  2XEH A;  1N9A A;  1IHB A;  2WXO A;  1Z6T A;  3D9I A;  1MZC A;  4ME2 A;  2ION A;  3HIZ A;  1LD8 A;  3S2A A;  3FUH A;  4GCN A;  3I5P A;  2Y3A A;  1K1B A;  3CK8 A;  4GZC A;  4AIF A;  3Q5M A;  4U0S A;  3RRM B;  2J4B A;  3DSV A;  3L16 A;  4BSX A;  4ILI A;  1UG3 A;  3FUI A;  4UQX A;  4AJW A;  4BT9 A;  1A17 A;  3KEZ A;  4XIF A;  4GTP A;  4K5C A;  1OCZ E;  2ZXW E;  2VQ2 A;  3PH0 C;  4PH4 B;  3BG0 B;  2Y4T A;  2KAT A;  3JXJ A;  1E90 A;  3B7T A;  1PAQ A;  4ATG A;  1XNF A;  2WXQ A;  4A55 A;  3S7B A;  3ULY A;  3RRU A;  2GGF A;  4GB9 A;  3J5Q B;  2J49 A;  3PEU B;  2CHZ A;  5KNH D;  3V2X A;  4J6I A;  3JQ0 A;  2UY1 B;  2VYI A;  2KZT A;  3D9J A;  2FI7 A;  1D9S A;  2HM8 A;  3CVX A;  3FY4 A;  2DVW A;  1FVH A;  2X3M A;  4DX2 A;  2P9L G;  1E8Z A;  2LSV A;  1FPP A;  3J5P A;  5ANR A;  3FU6 A;  2IU1 A;  1D8E A;  4CCA A;  4I6G A;  2ZU6 B;  2WXM A;  2A5E A;  1WG0 A;  1JCQ A;  4UWF A;  4OVU A;  1SZ9 A;  5KJN A;  3RK6 A;  5E75 A;  1ZBP A;  4DLO A;  2LXL A;  5M72 A;  2R59 A;  3NBN B;  4GTT A;  5CEA A;  3OAW A;  5FZQ A;  3KAE A;  5BW8 C;  4LNB A;  4IN3 B;  4GYO A;  3ML8 A;  2GW1 A;  3FU3 A;  4GA0 A;  4G23 A;  1TNU A;  4Y6W A;  3QC1 A;  3L22 A;  1Y6I A;  2NSZ A;  2WMO A;  3T9K A;  4J8F A;  1H0A A;  2BTD A;  2RFA A;  5LCW J;  3MCX A;  4G2V A;  2H6G A;  3MKQ B;  4L9P A;  1MHQ A;  2DZO A;  1TNO A;  1N4P A;  2WXH A;  4JZY A;  3FH5 A;  5ANL A;  4LSZ E;  3T5V A;  4OAU C;  3ONK A;  1AWC B;  2MOW A;  3FH8 A;  1E8Y A;  4CZ2 D;  3Q7F A;  4LNU D;  3UIO C;  3AJI A;  1DNP A;  3NZS A;  3SO8 A;  2Y4U A;  2X6H A;  2J9Q A;  3KS2 A;  5E76 A;  3VLF A;  3ZEF A;  4TXP A;  3TXN A;  3D9P A;  2L6J A;  1H6O A;  1N4Q A;  4CGV A;  5EX3 A;  4K5A B;  4CDM A;  3Q49 B;  4IRU A;  3PUJ A;  4KMO A;  4LEU A;  5AIJ A;  1ELR A;  2VGX B;  4R7L A;  1V55 E;  4I6J A;  4WWN A;  1FT1 A;  3PS6 A;  4HRM B;  3HG0 D;  2AXZ A;  1WM5 A;  5HKP A;  1ELK A;  3CIA A;  2E2E A;  5FWQ A;  1LTX A;  4DI4 A;  4DX5 D;  4ACK A;  3CVN A;  2BUG A;  5J08 A;  1EF1 C;  4G25 A;  4A3T A;  2EIL E;  4GZD A;  1N54 A;  3Q7A A;  2AW6 A;  2JAB A;  1QYM A;  5JJ6 A;  5KWD A;  3FTS A;  3E4B A;  5AEN A;  1S0P A;  4PS3 A;  2KM4 A;  4HB5 A;  3CQG B;  5EYL A;  5FJY A;  3RO3 A;  5FQ8 A;  3LJ3 A;  3ASF A;  3N71 A;  2XS8 A;  2ETB A;  4BT8 A;  3EUV A;  3ZHE A;  2IO3 C;  1E96 B;  4B0Z A;  3ZGQ A;  4KVM A;  3QNK A;  5FQ6 A;  1NP7 A;  3ZIM A;  5T8I A;  3UM1 A;  4PS7 A;  2XRY A;  3OTN A;  1HFA A;  3PVL A;  2XZT G;  4FHK A;  4HOS A;  1DCE A;  4EHM A;  3BUA A;  3QOU A;  2XEN A;  2V0P A;  5B1A E;  3KEA A;  1TNY A;  2XRZ A;  4HBD A;  4LUN U;  1OCR E;  3AG2 E;  2KXP C;  4ACL A;  4U63 A;  1OWN A;  4LNG A;  3MX3 A;  2FEZ A;  3Q4A B;  3CVY A;  1JPL A;  2F37 A;  3LKU A;  3RSE G;  3SZ7 A;  4TXR A;  4JA7 A;  4GTO A;  3ZNG A;  1ZB1 A;  4HRN A;  5FIN A;  3VTX A;  3FTZ A;  2MYO A;  2P9P G;  3SGH A;  5CRU A;  3LYA A;  3CQC B;  3UIP C;  4UWL A;  3ONL A;  3Q9N C;  2I9C A;  3FEY A;  2FF4 A;  3CHQ A;  2X38 A;  1O1S A;  4JD2 G;  3IHY A;  5B1B E;  3T8M A;  2A4Z A;  1QZ2 A;  3BEE A;  3O4Z A;  3UTM A;  4Q96 A;  2IOS A;  4HS2 A;  4U8Y D;  4HXI A;  4JHR A;  5EN5 D;  2AXU A;  1O1T A;  3E34 A;  1OCO E;  4A1S A;  2XGS A;  5FTP A;  4N2S A;  3RU0 A;  3UT4 A;  3FEX A;  4U04 A;  4OAV B;  2QYJ A;  4WNF A;  2QY7 A;  4KVO A;  4FAD A;  2Y0B G;  2OEW A;  3DSS A;  2XHE A;  2HE0 A;  1A5E A;  4DLQ A;  4PDX A;  3ZHE B;  3ZYQ A;  4O1O A;  2H6F A;  2VSN A;  1KT0 A;  4GZ5 A;  3CVQ A;  3Q47 B;  4GTQ A;  2VGE A;  3RRN B;  1O1R A;  1UN8 A;  4LG6 A;  4N3B A;  4N39 A;  2WXP A;  4B94 A;  3OXL A;  5T3R A;  4KZ0 A;  4A63 B;  3HXF A;  3SD5 A;  4HVB A;  3IKO B;  2WQ7 A;  1TJF A;  2IOL A;  4HOQ A;  5ENR D;  3K9I A;  5AJL A;  4L1B A;  2VSX E;  4B93 B;  3MV2 B;  2Y1L E;  3CST A;  1INZ A;  5KBA A;  3HRA A;  3JUI A;  5AN8 A;  3UM2 A;  3FUN A;  5BPP A;  4FU3 A;  2VGX A;  2RG8 A;  3UM3 A;  2F0Y A;  3D9N A;  4L2L A;  5DBK A;  3E30 A;  2LUH A;  3D9O A;  2KCK A;  3RJV A;  3CHP A;  4GMR A;  3U4T A;  2RFM A;  4A1G A;  3JUE A;  4YDE A;  3SFZ A;  3CVU A;  2XPZ A;  1LD7 A;  3ZPJ A;  2P9I G;  4AP2 A;  3R7R A;  3VTY A;  4H7X A;  1ZU2 A;  2F8X K;  3CHS A;  3PUK A;  4FLB A;  3QKY A;  1N94 A;  5CMY A;  3TGO A;  1K8K G;  2P2C P;  4N5C A;  5JJT A;  1SA4 A;  2OVB A;  3DPD A;  3PNL B;  4M3O A;  5CEC B;  4U8H A;  3PE4 A;  2DBA A;  3ZRH A;  3VLE A;  4GAA A;  3PEV B;  2EIK E;  3EIJ A;  3CVW A;  3UXG A;  1BI8 B;  4UI9 C;  1EPU A;  2R02 A;  4AM9 A;  2XCC A;  5HRY A;  5AJD A;  3EIQ C;  3D9L A;  4FJZ A;  4NIK A;  1JCR A;  2XCB A;  3ZYM A;  1GW6 A;  2AJA A;  5C2Y A;  4UWH A;  2P9N G;  2L0I A;  3HDX A;  3ASN E;  3G2S A;  3I4G A;  1BD8 A;  3B7B A;  1L5J A;  2YQ8 A;  3G2V A;  1O5M A;  3QWV A;  5BV0 A;  4JA9 A;  3PZ4 A;  2AVP A;  2WMN A;  4GU5 A;  5G04 C;  2QZA A;  4FLH A;  3DEO A;  1G3N B;  4YND A;  1LF8 A;  4BY6 A;  1SA5 A;  1MX4 A;  3W9F A;  3AS4 A;  3CGH A;  2Q7F A;  5EID A;  4YVO A;  1UN9 A;  2H6H A;  3PE3 A;  3E37 A;  1XGW A;  2LAI A;  3DSW A;  4C0M A;  1Z3X A;  3PZ1 A;  4HI8 A;  3TG5 A;  4JC8 A;  3ZYK A;  5J90 A;  2AXV A;  2KCL A;  5FIO A;  4RVB A;  5EKQ D;  4GA1 A;  2WM9 A;  5JMN D;  1S64 A;  2DIW A;  1E7U A;  1OUV A;  3NOC D;  4O6F A;  3GZ2 A;  3ULQ A;  3NB2 A;  4JEU A;  3CSF A;  5CBN A;  5EX0 A;  1YMP A;  4GTS A;  3O48 A;  3CVL A;  3URZ A;  3NF1 A;  4BX9 A;  4RSY A;  1P5Q A;  2JLB A;  4PS8 A;  4CT4 A;  2UWJ G;  3CHM A;  4J8S A;  3KD7 A;  4I1O B;  5ARF A;  2YHC A;  3TWS A;  1BU9 A;  4G1T A;  2ZIR A;  3SY2 A;  3D9K A;  3ASH A;  3BG1 B;  5B3S E;  4TUM A;  1N4S A;  5AAR A;  1FVF A;  2AWI A;  3LS8 A;  3KSL A;  4HRL A;  2WXR A;  1SZA A;  4BX8 A;  2JEK A;  3R7Q A;  3ASD A;  3IXE A;  2PL2 A;  2ZIS A;  5CCL A;  2X6F A;  4ANW A;  4F7A A;  2OVF A;  3FFL A;  4DJA A;  2NXP A;  1TN8 A;  4ABN A;  1HU3 A;  2CG3 A;  4XKC A;  3IEG A;  3G2U A;  4FA6 A;  2E0I A;  3PZ2 A;  2PM7 A;  4FHJ A;  2VSY A;  1H2V C;  4BSZ B;  5A6C A;  2B6C A;  3UMV A;  3L13 A;  3RKV A;  4CDR A;  1E8W A;  3OXF A;  5HQ8 A;  3DRA A;  1N52 A;  3APF A;  3FUJ A;  4Z68 A;  2WB2 A;  3MJW A;  3TXM A;  3SBS A;  3CK9 A;  4CYM D;  1OXJ A;  2ETA A;  3QJZ A;  2WXK A;  4J8D A;  4CGW A;  4JEH A;  4WWO A;  1OWL A;  3B7R L;  1Z3Y A;  3Q15 A;  5EIB E;  3ZUV B;  3CK7 A;  4J8Y A;  1V54 E;  2GRO B;  3UI2 A;  4ZFH A;  1U2V G;  2RD0 A;  3LDZ A;  1X5B A;  2VJ8 A;  4JHK A;  3TJP A;  2DCP A;  3ESL A;  2R05 A;  2X6I A;  5AQA A;  3U9W A;  4GTM A;  4WUY A;  5FZR A;  4BES A;  5ENQ D;  2IF4 A;  2PQN A;  2VGY A;  5CMW A;  2BKK B;  2CG2 A;  1KZP A;  5LFA A;  2IEJ A;  3ZVV A;  3R9A B;  1BPO A;  3ZW3 A;  4MBG A;  4GYW A;  5T4Y A;  2L9B A;  4HFG A;  1HG2 A;  2IO2 C;  3ENE A;  4AEZ C;  5AAO A;  1HS6 A;  4X8Q A;  4EZJ A;  4DPR A;  3AAA C;  3U66 A;  3C3O A;  3U3W A;  3T5X A;  4FJY A;  3CHO A;  2X6K A;  2I1J A;  4DI3 A;  4U95 D;  4U96 D;  4NUR A;  3TWU A;  3G2W A;  4WAF A;  4NQ0 A;  1BLX B;  2P58 C;  4HLE A;  2I1K A;  2LSU A;  3TG4 A;  4WNE A;  5LX8 A;  3APC A;  3IHV A;  1KLX A;  4Q69 A;  1HF8 A;  5EIL A;  3LY7 A;  5DIZ A;  3QB2 A;  3FTX A;  3Q75 A;  1IQU A;  2IQC A;  3ISM C;  4U7E B;  3AG3 E;  3P2B A;  2C2L A; 
#chains in the Genus database with same CATH homology
 2R17 C;  2YIN A;  3MV3 B;  4J6I A;  5T3R A;  4GPK A;  3JQ0 A;  2LNI A;  4C0E A;  2UY1 B;  2VYI A;  4KZ0 A;  2KZT A;  3SD5 A;  3D9J A;  2FI7 A;  4P29 A;  4EZL A;  3IKO B;  4HVB A;  3UPV A;  2XPY A;  2QFC A;  4APO A;  2WQ7 A;  1TJF A;  2IOL A;  4HOQ A;  2IJG X;  3LVQ E;  5FZS A;  1UJJ A;  4J0U A;  2HM8 A;  3LPZ A;  4EBA A;  3FY4 A;  3K9I A;  3CVX A;  4JVS A;  3RO2 A;  3FTU A;  3FP3 A;  1HZ4 A;  3LY9 A;  4IUL A;  4TUU A;  5AJL A;  4E6H A;  1NA0 A;  4L1B A;  2VSX E;  1FVH A;  1QQE A;  2X3M A;  3MV2 B;  3CST A;  3FTW A;  1INZ A;  3ZN3 A;  2J4D A;  3G2T A;  1E8Z A;  3JUI A;  2LSV A;  4EPZ A;  1HX8 A;  1TEZ A;  5ANR A;  3HHM A;  1JUQ A;  3FUN A;  3IV0 A;  4L23 A;  5BPP A;  3FU6 A;  3APD A;  2IU1 A;  4FU3 A;  4J8E A;  4CCA A;  2VGX A;  2RG8 A;  5G04 J;  4I6G A;  2ZU6 B;  4RG9 A;  3D9N A;  2WXM A;  5ENN A;  2A5U A;  2OND A;  4L2L A;  3UQ3 A;  3L17 A;  1OWM A;  3UT7 A;  4TRQ A;  1HH8 A;  5DBK A;  3D9O A;  2KCK A;  3RJV A;  4V3I A;  3CHP A;  4UWF A;  3U4T A;  4LRZ A;  4NAC A;  2BF0 X;  3SBT B;  1EDU A;  3NQP A;  3L08 A;  4A1G A;  4OVU A;  1SZ9 A;  3GZS A;  5KJN A;  3SFZ A;  3RK6 A;  2XPZ A;  4KXK B;  5E75 A;  1ZBP A;  3CVU A;  4NRH B;  4XI0 A;  4WWP A;  4DLO A;  5M72 A;  4KBQ A;  3ZPJ A;  4L2Y A;  5BT1 A;  2R59 A;  3GYZ A;  4AP2 A;  2WXL A;  3R7R A;  3VTY A;  3OAW A;  4H7X A;  5FZQ A;  3KAE A;  1ZU2 A;  4JL0 A;  5BW8 C;  4IN3 B;  3CHS A;  3MKR A;  4KT6 B;  3FDH A;  4GYO A;  3PUK A;  4FLB A;  3ML8 A;  3QKY A;  4GA2 A;  2GW1 A;  3FU3 A;  3AS5 A;  3FUE A;  4G23 A;  4GA0 A;  5CMY A;  5G05 C;  3TGO A;  3SHF A;  2LO6 A;  4OVV A;  4N5C A;  4Y6W A;  3QC1 A;  3L22 A;  5JJT A;  1Y6I A;  2OVB A;  3DPD A;  2NSZ A;  4FUL A;  2J09 A;  2FO7 A;  3PNL B;  2WMO A;  4M3O A;  5BNW A;  2I2O A;  3ESK A;  4U8H A;  4F1S A;  3PE4 A;  2DBA A;  3ZRH A;  2GRM A;  3AU5 A;  4J8F A;  5BV1 A;  4D10 C;  4ANX A;  1QNF A;  1H0A A;  3VLE A;  4GAA A;  2BTD A;  3PEV B;  4GML A;  3EIJ A;  5C1D A;  3CVW A;  4URK A;  4I6E A;  4UI9 C;  5LCW J;  1VDY A;  1EPU A;  4G11 A;  3MCX A;  4AV7 A;  4AM9 A;  4G2V A;  3MKQ B;  3PNT B;  3SI5 A;  1MHQ A;  2XCC A;  4YVQ C;  5AJD A;  3EIQ C;  3D9L A;  4FJZ A;  1OWO A;  3JQ1 A;  2FUL A;  2XCB A;  3D9M A;  4ILG A;  2R5S A;  3ZYM A;  3CVV A;  1GW6 A;  4HOR A;  2WXH A;  5C2Y A;  3CKC A;  4JZY A;  3FTV A;  4UWH A;  4AXH A;  2IFU A;  4CT0 A;  2L0I A;  3HDX A;  5AYW D;  4AOF A;  3FH5 A;  5ANL A;  2M63 A;  3G2S A;  3HVE A;  3I4G A;  3QAQ A;  3T5V A;  1HE8 A;  3ONK A;  3QWP A;  4JXT A;  3S7J A;  4C9B B;  2MOW A;  2WVI A;  4MS6 A;  2V5F A;  3FH8 A;  1L5J A;  5JHA A;  2YQ8 A;  1E8Y A;  5A23 A;  4XZ4 A;  3G2V A;  3QWV A;  3S7D A;  5BV0 A;  4JA9 A;  3FUK A;  4EEC A;  2AVP A;  2WMN A;  4GU5 A;  3MZL B;  3PRE A;  5G04 C;  4K0R A;  1FCH A;  1DNP A;  3I4R B;  3ZYL A;  4FLH A;  4G26 A;  4E85 A;  4YND A;  1LF8 A;  2FBN A;  4JHJ A;  4BY6 A;  3NZS A;  1WY6 A;  2XPI A;  2Y4U A;  2X6H A;  3FWV A;  4LCT A;  3VLD A;  2J9Q A;  3KS2 A;  5HI7 A;  1MQS A;  2LAH A;  1W3B A;  5E76 A;  4EZK A;  3VLF A;  3LY8 A;  3ZEF A;  2I6H A;  3SF4 A;  5G2N A;  3TXN A;  3D9P A;  3AS4 A;  2L6J A;  5JHB A;  3CGH A;  5LOZ A;  2Q7F A;  2PQR A;  5JJ7 A;  1UW4 B;  4CGV A;  4U0U A;  4YVO A;  2VTB B;  5EX3 A;  2HO1 A;  2J07 A;  2CFZ A;  3EHN A;  3FU0 A;  1UN9 A;  4CRW A;  4CDM A;  2WXG A;  3PE3 A;  3Q49 B;  4OYS A;  3U64 A;  3CLJ A;  3FH7 A;  4IRU A;  3PUJ A;  4KMO A;  2MHK A;  4GMJ A;  4LEU A;  4F53 A;  1XGW A;  2LAI A;  3S7F A;  5AIJ A;  4C0M A;  1ELR A;  1Z3X A;  4N2Q A;  2VGX B;  4Q94 A;  4R7L A;  4JC8 A;  3TG5 A;  3ZYK A;  4I6J A;  2AXV A;  5J90 A;  2KCL A;  4WWN A;  3FU5 A;  4KZC A;  2XGM A;  4RVB A;  4BWR A;  3PS6 A;  4N3C A;  4GA1 A;  5EKQ D;  4EBA G;  2WM9 A;  2DIW A;  4UQZ A;  2AXZ A;  1WM5 A;  5BUZ A;  1ELK A;  3CIA A;  2WXI A;  2E2E A;  3ZFW A;  2WQ6 A;  5FWQ A;  1E7U A;  3QAR A;  1OUV A;  2XGO A;  4DI4 A;  4ACK A;  3CVN A;  3CV0 A;  4B89 A;  4O6F A;  1B89 A;  2BUG A;  4FC8 A;  2X6J A;  3GZ2 A;  3ULQ A;  5J08 A;  4JEU A;  1EF1 C;  4G25 A;  3CSF A;  3PDN A;  4A3T A;  5D0Q D;  5EX0 A;  1PC2 A;  4GZD A;  1JWF A;  1N54 A;  5G55 A;  1NZN A;  3WXX A;  2AW6 A;  4APF A;  3O48 A;  3CVL A;  3FHE A;  2V4L A;  3LXU X;  4IYP A;  4XE0 A;  5A7D B;  3URZ A;  5JJ6 A;  3NF1 A;  4BX9 A;  3I3N A;  4RSY A;  4MLP A;  4KYO B;  3FTS A;  3E4B A;  1HXI A;  5AEN A;  3AS8 A;  1P5Q A;  3MGB A;  2JLB A;  4PS8 A;  2KC7 A;  1S0P A;  4CT4 A;  4PS3 A;  3D3M A;  5KCM A;  2UWJ G;  1JWG A;  3B7S A;  4G24 A;  2KM4 A;  3CHM A;  4J8S A;  3CQG B;  4WNG A;  2C0L A;  3KD7 A;  4I1O B;  5FJY A;  2YHE A;  3RO3 A;  5ARF A;  5FQ8 A;  3LVR E;  2YHC A;  3DBS A;  3LJ3 A;  2HYZ A;  3CR3 A;  2WQH A;  3ASF A;  3MYV A;  1ELW A;  3HVE B;  3N71 A;  3L54 A;  3HYM B;  4XI9 A;  2CHW A;  3L6A A;  4BT8 A;  5FT9 A;  1H2U A;  2ILR A;  2XEV A;  3ZHE A;  4G1T A;  5CHE E;  1PY1 A;  1E96 B;  4B0Z A;  2CHX A;  3ZGQ A;  3D9K A;  4KVM A;  3ASH A;  5FQ4 A;  5FQ7 A;  2L0T B;  3QNK A;  4PUC A;  3BG1 B;  4H7Y A;  1NP7 A;  5FQ6 A;  4B8A A;  4I1A A;  3CEQ A;  3ZIM A;  4I2Z A;  3TAX A;  4UWK A;  5T8I A;  1E8X A;  1FVF A;  2AWI A;  4BTB A;  3LS8 A;  4PS7 A;  4TV3 A;  3SNX A;  2WXR A;  3PZD A;  3IBE A;  4JW1 A;  2XRY A;  3OTN A;  1SZA A;  1HFA A;  3AU4 A;  4BX8 A;  5LP0 A;  3PVL A;  4FHK A;  2JEK A;  2OV8 A;  3R7Q A;  4HOS A;  3EJN A;  3EDT B;  3QWW A;  4ANU A;  5G05 J;  2PM6 A;  2PL2 A;  1SQM A;  1NA3 A;  5CCL A;  2X6F A;  3QOU A;  4K03 A;  4ANW A;  4N3A A;  4F7A A;  2V0P A;  2OVF A;  3FTY A;  3PRZ A;  3FFL A;  3B13 A;  3QK0 A;  5D0O D;  4QFV A;  5ARG A;  4DJA A;  2XRZ A;  2NXP A;  4ABN A;  4MKT A;  4LUN U;  2KZT B;  4MRU A;  2GRL A;  2WXJ A;  1HU3 A;  2CG3 A;  4I2W A;  2WXN A;  4XKC A;  3IEG A;  1IYG A;  4GCO A;  4ACL A;  4UWG A;  5CCM A;  3G2U A;  4FA6 A;  2E0I A;  4U63 A;  1OWN A;  2PM7 A;  4FHJ A;  4UI9 K;  2VSY A;  1H2V C;  3MX3 A;  4W9R A;  5A6C A;  2FEZ A;  1WAO 1;  3UMV A;  2WPV A;  3Q4A B;  3CVY A;  1JPL A;  3FUL A;  1IHG A;  3L13 A;  3RKV A;  3P1U A;  3CKB A;  3LKU A;  3OXG A;  3FUD A;  5EDS A;  2EQX A;  1KT1 A;  1E8W A;  3MKQ A;  4GZ6 A;  2WXF A;  3SZ7 A;  4CDR A;  3OXF A;  3B7U X;  4JA7 A;  5KJK A;  3GZ1 A;  2CFU A;  4FP7 A;  4Y6C A;  5HQ8 A;  1HO8 A;  1N52 A;  2NC9 A;  3FUM A;  3ZXS A;  1OWP A;  3APF A;  3FUJ A;  3VTX A;  3FTZ A;  3SGH A;  2WB2 A;  4I17 A;  3MJW A;  3QDN A;  2OOE A;  3TXM A;  3SBS A;  3CK9 A;  1UJK A;  3LYA A;  3CQC B;  3QJZ A;  4UWL A;  2WXK A;  3ONL A;  4I1M A;  4A3V A;  4DK5 A;  4J8D A;  4JPS A;  4CGW A;  4JEH A;  3CVP A;  2I9C A;  3FEY A;  2V8S E;  4WWO A;  3JYS A;  4ANV A;  1OWL A;  4U07 A;  3B7R L;  1Z3Y A;  3C98 A;  2FF4 A;  3Q15 A;  3MA5 A;  4RG6 A;  4UI9 J;  1H2T C;  1U3C A;  2XQ0 A;  1E7V A;  4ILH B;  4XKB A;  3CK7 A;  3CHQ A;  4HOT A;  2X38 A;  4HOU A;  2VSO E;  2RD0 A;  1DVP A;  1TJC A;  4I43 A;  4I9C A;  3CHR A;  1X5B A;  2VJ8 A;  3LDZ A;  4GYY A;  4JHK A;  3TJP A;  2UY1 A;  1YA0 A;  4B8C B;  4I9E A;  2DCP A;  3IHY A;  4AVX A;  4BFR A;  3ESL A;  3T8M A;  4AY5 A;  2X6I A;  2A4Z A;  2HR2 A;  3LEW A;  1Y8M A;  1QZ2 A;  5LCW C;  4CEM A;  3BEE A;  3GW4 A;  3U9W A;  3O4Z A;  4GZ3 A;  3NZU A;  4WUY A;  5FZR A;  2IF4 A;  4U0Z A;  3LCA A;  2PQN A;  2VGY A;  4Q96 A;  2IOS A;  2WXO A;  4HS2 A;  5CMW A;  3TL5 A;  1Z6T A;  4F3V A;  4HXI A;  2CG2 A;  4JHR A;  3D9I A;  3RIB A;  5LFA A;  4ME2 A;  2AXU A;  3ZVV A;  4A1S A;  2MRI A;  2XGS A;  3MEK A;  3UT8 A;  2ION A;  4BTA A;  3HIZ A;  3R9A B;  4UQY A;  3S2A A;  5FTP A;  4N2S A;  1BPO A;  3RU0 A;  3FUH A;  3UT4 A;  3UX4 A;  3ZW3 A;  4GCN A;  3I5P A;  2Y3A A;  4GYW A;  3CK8 A;  3FEX A;  5T4Y A;  2L9B A;  1H6K A;  4U04 A;  4HFG A;  1HG2 A;  4GZC A;  3ENE A;  3Q5M A;  4AEZ C;  4AIF A;  3EHM A;  4WNF A;  1HS6 A;  3ASG A;  2C0M A;  2J4B A;  2QY7 A;  4U0S A;  3RRM B;  4KVO A;  4EZJ A;  4WND A;  3L16 A;  4CDN A;  4DPR A;  3U66 A;  4FAD A;  3U3W A;  2J08 A;  3FUF A;  4BSX A;  1EYH A;  4ILI A;  1UG3 A;  3FUI A;  2XHE A;  4UQX A;  3T5X A;  4FJY A;  4AJW A;  4BT9 A;  1IQR A;  3CHO A;  1A17 A;  4LER A;  4DLQ A;  4PDX A;  3KEZ A;  4EQF A;  3ZHE B;  3ZYQ A;  4L7T A;  2X6K A;  4XIF A;  2I1J A;  4DI3 A;  2VQ2 A;  3PH0 C;  5KJM A;  4NUR A;  2VSN A;  3G2W A;  4PH4 B;  1KT0 A;  3BG0 B;  4GZ5 A;  4WAF A;  4NQ0 A;  2P58 C;  4HLE A;  2KCV A;  2Y4T A;  3CVQ A;  2I1K A;  2KAT A;  2LSU A;  3TG4 A;  3Q47 B;  4WNE A;  5LX8 A;  3APC A;  2VTB A;  3ML9 A;  1E90 A;  3B7T A;  4XX5 A;  1PAQ A;  2PZI A;  3IHV A;  1UN8 A;  1KLX A;  1XNF A;  3JCK C;  3RRN B;  3UUX A;  4ATG A;  4Q69 A;  1HF8 A;  4AY6 A;  2WXQ A;  4A55 A;  3S7B A;  5KJL A;  3LY7 A;  3RRU A;  4N3B A;  2GGF A;  5DIZ A;  3QB2 A;  4GB9 A;  3FTX A;  3P2B A;  1IQU A;  2IQC A;  2YNQ A;  4N39 A;  2J49 A;  2WXP A;  3PEU B;  4B94 A;  2CHZ A;  1H19 A;  3OXL A;  1HG5 A;  3ASD A;  2C2L A;  1U3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...