4YVOA

Crystal structure of the tpr domain of arabidopsis flu (flu-tpr)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
119
structure length
119
Chain Sequence
b'PKKQELISKLKTGKTFLRNQEPEKAYTEFKIALELAQSLKDPTEEKKAARGLGASLQRQGKYREAIQYHSMVLAISKRESEDSGITEAYGAIADCYTELGDLEKAGKFYDTYIARLETD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein FLUORESCENT IN BLUE LIGHT, chloroplastic
publication title The Non-canonical Tetratricopeptide Repeat (TPR) Domain of Fluorescent (FLU) Mediates Complex Formation with Glutamyl-tRNA Reductase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Fluorescent protein
total genus 57
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4yvoA00
3GZ2A 3LY8A 5LCWJ 5KJMA 2UY1B 5A7DB 3ASFA 2VGXB 2FEZA 5FJYA 4Y6WA 4XIFA 5DIZA 2PZIA 3ZHEB 1KT1A 4EQFA 4CGVA 3S7JA 3Q49B 3R9AB 3CK7A 3KAEA 5BW8C 3FFLA 1Y8MA 3QOUA 3GZ1A 2FF4A 2IF4A 2OOEA 2C0MA 3KD7A 3AS5A 3TGOA 2E2EA 5EX3A 4G1TA 2NC9A 4RG9A 4GZ6A 4CGWA 2LSVA 3N71A 4JA9A 2JLBA 3WXXA 3EDTB 3UQ3A 1WAO1 2VGYA 3NF1A 2KCLA 3HYMB 5C1DA 3CEQA 1NA3A 3ULQA 3Q4AB 3SF4A 2WPVA 4GZ3A 1QZ2A 3BEEA 3AS4A 2KCKA 4I2ZA 3URZA 2PQNA 2VSYA 4I9EA 2DBAA 4BTAA 4N2SA 4WNGA 5JJ6A 5FZSA 2XGSA 3CK9A 2FBNA 4WUYA 3ESKA 1XNFA 1PC2A 2P58C 4GA1A 4J8DA 4GA0A 2XCBA 3QKYA 1HZ4A 4H7YA 2AVPA 2PL2A 1P5QA 4APOA 4KYOB 4Y6CA 3AS8A 3MV3B 4J8FA 4F3VA 4GCNA 3OXGA 3TAXA 3CV0A 2Y4UA 4G25A 5A6CA 4U0ZA 5G05J 4HOSA 3QWPA 4G24A 3JYSA 3PDNA 4N2QA 4JL0A 2ONDA 4UI9C 3MA5A 4B94A 1ZBPA 3LKUA 5KJKA 5FZRA 2VGXA 4AIFA 3VTXA 4IN3B 4I9CA 4UQYA 3PE4A 2Q7FA 4G26A 4U07A 3UUXA 1NZNA 1HXIA 4GYYA 3RKVA 1ELRA 4U04A 2V5FA 5D0QD 5ARGA 2KCVA 3E4BA 4BWRA 4AM9A 1B89A 1TJCA 4UQZA 4CDRA 2XEVA 3LCAA 2VYIA 4BT8A 4UI9K 2XPIA 4N5CA 3CVPA 1IYGA 2L6JA 5HI7A 3RIBA 2LNIA 4U0UA 5JJ7A 3U4TA 2LSUA 3MKRA 2J9QA 4AY5A 2PQRA 2Y4TA 3KS2A 4N39A 1ELWA 4NQ0A 5G04C 4BTBA 3O48A 4RG6A 1YA0A 1NA0A 1W3BA 4I2WA 3FWVA 2HO1A 5JJTA 4A1SA 3FP3A 4XI0A 5BT1A 4HORA 4HOQA 4GCOA 1KLXA 3CKCA 1FCHA 3SZ7A 4GA2A 3LY7A 3QWVA 5AYWD 4JHRA 1QQEA 2GW1A 3MV2B 4N3AA 3CKBA 3U3WA 5M72A 4GYOA 3LYAA 3ZN3A 3GW4A 3ZGQA 3Q47B 5CHEE 4H7XA 5FT9A 2R5SA 4KXKB 3CVLA 2UWJG 4KBQA 5KJLA 2C2LA 5LCWC 3TG5A 2XGMA 2UY1A 4G23A 2I6HA 4N3BA 3LY9A 4UI9J 3ZHEA 2KATA 1ZU2A 5ARFA 4I1AA 3CVNA 4GPKA 4ME2A 3S7FA 3OXLA 4GZ5A 2YHCA 2MHKA 3PE3A 5CCMA 3S7DA 3GYZA 3S7BA 2WQHA 3ZPJA 4U0SA 4HOUA 4JA7A 4XI9A 4ABNA 5EKQD 1HH8A 3ASHA 4GYWA 2VQ2A 4YVOA 2IFUA 1IHGA 3ZFWA 4O6FA 5EX0A 5FTPA 2FI7A 3RO2A 3Q15A 4I17A 5CCLA 5KJNA 4WNFA 3VTYA 3RU0A 1WM5A 2HR2A 2BUGA 2FO7A 3CK8A 4N3CA 3OXFA 3QWWA 4J8EA 3TG4A 4WNDA 5G04J 3CVQA 4NRHB 4G2VA 5HQ8A 1E96B 1KT0A 2XCCA 5D0OD 4J0UA 2YQ8A 3Q5MA 3MEKA 1OUVA 4W9RA 4AY6A 3RJVA 2QFCA 1A17A 4UQXA 2HYZA 5FZQA 2C0LA 3RO3A 5G05C 4LEUA 2VSNA 5BNWA 4YVQC 3IEGA 4HOTA 4WNEA 3K9IA 3ASGA 3UPVA 3ASDA 2XGOA 3QDNA 3LPZA 4BT9A 4YNDA 2KC7A 5DBKA
chains in the Genus database with same CATH superfamily
3EIJA 3DWLG 5A7DB 5KNGA 1MYOA 2FEZA 4GTTA 3FTYA 5FJYA 3JXJA 4I6EA 4XIFA 4K5BA 4HI9A 4JD2G 3DBSA 3ZXPA 1EYHA 2V0PA 3ULYA 1MZCA 1GW6A 4NURA 5BW8C 3UKRG 2IEJA 1D8DA 3QOUA 3T5XA 5E76A 4PS8A 4XEIG 1YCSB 1UW4B 4M3OA 1DCEA 2JEKA 4J7WA 5CERB 3ABKE 2VSXE 2LXLA 5EX3A 1SVXA 3I4RB 1D9SA 1A5EA 1TNYA 3AG2E 3ZIMA 2AJAA 4JA9A 3WXXA 3LEWA 2FULA 5B1AE 5EIDA 2KCLA 3HYMB 3CEQA 3DSXA 3DSVA 3UIOC 5AIJA 5FWQA 3R9MA 4B93B 3PZ2A 3AS4A 4HNAD 5G2NA 4FC8A 1YMPA 3RK6A 4DX5D 4I9EA 3ABME 2WXOA 3SNXA 1DCQA 2WXMA 3I3NA 4N2SA 2WXHA 4HRLA 3NZUA 3CK9A 3ESKA 1XNFA 2V4LA 3CVYA 2Y3AA 5D2MC 5LX8A 4GA1A 3SFYA 2XCBA 3VLDA 3AU5A 3AG1E 4H7YA 4HRNA 1UJKA 4KYOB 4YDEA 5ENRD 4GCNA 3FU5A 4UWLA 2H6FA 2ZISA 4G25A 2IO3C 2V4HC 3MKQA 4J8YA 1WY6A 3JYSA 4IRUA 2ONDA 3FDHA 3MA5A 2H6IA 3L82A 4GPMA 4JC8A 3QARA 2BKKB 1Z3XA 3HVEA 2VGXA 5AN8A 3FUFA 3L22A 2ZGDA 3E32A 3NQPA 2Q7FA 4D10C 3MCXA 4OVUA 5HRYA 3EHRA 3HXEA 1HXIA 4TUMA 3FUMA 3EHNA 3HDXA 4U04A 4ATGA 1L5JA 3FH5A 2KCVA 2X6FA 4RSYA 4BWRA 3BUAA 5CMYA 2VYIA 4CZ2D 2IJGX 4BT8A 2EILE 3DPYA 3V30A 2XPIA 1FPPA 2QYJA 1E8YA 4N5CA 3PREA 3APCA 3V2OA 3P2BA 2LNIA 4HXIA 4I43A 3U4TA 3V31A 4B0ZA 3CVVA 3ISMC 5EYPF 4AY5A 2KZTA 2Y4TA 5EYLA 5BV1A 5G55A 5LOZA 3DXMG 4KZ0A 4HBDA 1ELWA 5G04C 5T3RA 2PM7A 5JA4D 4BY6A 3FEXA 4RG6A 2GRLA 5AQ9A 2JABA 1HE8A 5LFAA 2L9BA 4I2WA 2HO1A 5BUZA 2OVBA 1KLXA 3JUIA 3DEOA 3SZ7A 1V55E 1OCZE 3D9PA 4GMJA 3ONLA 3HG0D 4AJWA 3QWVA 1QQEA 2GW1A 3AU4A 4FU3A 4J6IA 2X6IA 3OTNA 3CQCB 2H6HA 4GYOA 4XX5A 3BG1B 4CRWA 3D9JA 1N4SA 3G2TA 4LNUD 3ZGQA 5CHEE 3FTUA 2LUHA 4H7XA 3ZUVB 2R5SA 3CVLA 4ILGA 3ZRHA 4KBQA 4EBAA 4JPSA 2LAIA 1N52A 3UM2A 3PZDA 2MRIA 3W9GA 3HHMA 4JZYA 1H0AA 4TXRA 3ZXSA 4GB9A 3TWWA 2E0IA 4GPKA 4ME2A 3S7FA 3UXGA 5H7PA 2WXLA 4BSXA 3P1UA 2YHCA 4GTQA 2XHEA 4M7CA 3GYZA 3FY4A 4U8YD 1SA4A 4CCAA 4PH4B 3I4GA 2R59A 5FIOA 4XI9A 3TWQA 3FU6A 1HH8A 3LJ3A 5AAOA 3ASHA 4LERA 3B7RL 4I1MA 2IFUA 1XGWA 4XE0A 1KZPA 1HFAA 1IHGA 3TWXA 3MX3A 2OCCE 1O1SA 5FTPA 2PNNA 4OAVB 3FUEA 1O5MA 1NP7A 3RU0A 1IKND 3PEUB 4FADA 3PNLB 4ACKA 4ACLA 3OXFA 3MGBA 3ZW3A 1Y6IA 4Z68A 3Q73A 2YINA 4B8CB 3DEPA 1KT0A 3SBSA 3B7UX 5D0OD 2DYSE 4J0UA 3D9IA 4A55A 2VGEA 4BFRA 1FT2A 4AY6A 4ILIA 3APDA 3RJVA 4F1SA 4G11A 3GZSA 3PZ3A 1OXJA 5G05C 4PS7A 3UM1A 4URKA 3CSFA 3E37A 3UINC 2I1KA 3DXKG 3FH8A 2CG3A 3G2VA 4I6GA 2IOSA 4JEHA 2XGOA 3QDNA 1PAQA 1N0RA 3FUKA 4BT9A 4TUUA 4U95D 2WXNA 5T4YA 5AARA 3C3QA 3LY8A 1KZOA 4HVBA 5LCWJ 2RD0A 3FTSA 2UY1B 4ANVA 1S64A 3ASFA 3IHVA 2VGXB 1N4RA 1HG5A 4WAFA 4QFVA 4Y6WA 5DIZA 2PZIA 2KM4A 2OEVA 2AXVA 2GRNB 2YHEA 3ZYLA 4CGVA 3S7JA 4GTOA 1EF1C 2IO2C 1TN8A 2AXUA 1TNUA 1Y8MA 1JCQA 4L2LA 2FF4A 4GTPA 2IF4A 3FULA 2OOEA 2R17C 2RKKA 4WWPA 3TGOA 4LNBA 3DSUA 4MKTA 4V3IA 4BSZB 1H19A 3BG0B 3RSEG 5ENQD 4AOFA 3L13A 1H2TC 3UQ3A 3NF1A 4OVVA 2GRQB 5C1DA 1U3CA 1NA3A 2M63A 5KBAA 2MYOA 1HG2A 3Q4AB 2WPVA 5EILA 2QYUA 4U7EB 1QZ2A 4I2ZA 1U3DA 1ELKA 1G3NB 2DIWA 3URZA 5CRUA 5B1BE 2VSYA 2XZDG 4L23A 4HI8A 3MJWA 2DBAA 4K03A 3QC1A 4BTAA 3FUNA 5JJ6A 2XPYA 3AG3E 1PC2A 2P58C 3FUDA 3VLFA 4DX6D 4J8DA 4UWFA 4GA0A 3QKYA 3UX4A 1N94A 3R7RA 2AVPA 2PL2A 4APOA 3EHQA 3MV3B 4ANWA 3NAWA 1JWGA 2P9NG 3JQ1A 3OXGA 3CV0A 2P9KG 3FUJA 1OCCE 2IQCA 1TJFA 5CEAA 4HOSA 1E7UA 4G24A 5KWDA 3B95A 3UM0A 2WMOA 3L54A 1OY3D 5AENA 1N4QA 5BV0A 1ZBPA 4J8SA 3ZU7B 2XQ0A 3C3RA 5CBOA 5KJKA 5FZRA 2EIKE 3RRUA 1TN6A 3HXCA 3CHPA 4RVBA 5D66A 4IN3B 1EPUA 3UTMA 5IY5E 3PE4A 2I2OA 1HO8A 4JHKA 1TNZA 2RG8A 3ML9A 1E7VA 3J5PA 3C72A 4KVOA 4XKBA 3CGHA 3SY2A 3E4BA 3B7BA 3FTXA 4MBGA 4I1OB 1N9AA 3L17A 3Q78A 4B8AA 3E30A 1OWNA 4L7TA 5T8IA 2CHWA 4F7AA 1IYGA 2DCPA 2GGFA 2QZAA 4UWKA 4YDWA 2WXIA 1QYMA 2LSUA 4BESA 4EZLA 2ZIRA 5CEDB 3FU3A 4E85A 3KS2A 3ZYQA 2YNQA 3APFA 3JXIA 3TWRA 1OWMA 3ESLA 4DX1A 1W3BA 2OV8A 4A1SA 4MLPA 2WXJA 3BQOA 4GCOA 3CKCA 1QBQA 1DVPA 2BF0X 4DUIA 4KVMA 2I9CA 1MHQA 4DX2A 2KBXA 1IQRA 1OCOE 4LG6A 1INZA 3LYAA 2VSOE 4FHJA 1Z6TA 1K1AA 4WWOA 1H6OA 2UWJG 3SFXA 2LAHA 2UY1A 3SO8A 5AQBA 2XS1A 2F0YA 3CVXA 3C98A 2I1JA 1QNFA 4DPRA 2X3MA 5ARFA 2R05A 3UT7A 1U2VG 4A63B 1X81A 4EZJA 1FT1A 3CQGB 3PE3A 3PUKA 4AP2A 3S7BA 5BPPA 4MRUA 1H2UA 4O1OA 4U0SA 4HOUA 3IHYA 5KNHD 4ABNA 2DZNA 5EKQD 2EIME 1UOHA 3SBTB 1RZ4A 4FHKA 2VQ2A 3FU0A 4BERA 2ZGGA 1LD7A 4CT0A 3T5VA 1BLXB 2P2CP 2ZXWE 4R7LA 2L6BA 4AVXA 3FEYA 3Q15A 4ZFHA 5CCLA 1DC2A 2J49A 4DX7D 4WNFA 4EHMA 4PDXA 3G2SA 4Q69A 2J4BA 3CK8A 3ENEA 5ANLA 1KPSB 3QJZA 5AJLA 1MJ0A 4WNDA 5G04J 4NRHB 4WWNA 3C3OA 3SQVA 2WB2A 2P9IG 4KZCA 1TNBA 4G8KA 1OT8A 4KMOA 4CDNA 3B7SA 2VSNA 3V79K 3TXNA 4WNEA 2XS8A 4PS3A 3W9FA 2Y1LE 1N4PA 4F53A 2KC7A 1UN9A 3V2XA 5AQ7A 3GZ2A 5KJMA 3PZ4A 4GMLA 1DNPA 1KT1A 1TYQG 3Q79A 1PY1A 1K1BA 3R9AB 3Q75A 2ETCA 3FFLA 3GZ1A 4ZHBA 2IOLA 5FINA 1NFIE 3NOGD 3G2UA 4A3VA 2C0MA 1E8ZA 3KD7A 3L9TA 2E2EA 4FULA 4RG9A 3F6QA 3Q7FA 4CGWA 3MZLB 2LSVA 1OWOA 3N71A 3SI5A 2JLBA 1MQSA 2VGYA 2J4DA 2F37A 3ULQA 2FO1E 5FQ8A 3SF4A 4RLYA 2VJ8A 2KCKA 2PQNA 3IXEA 4NACA 1IQUA 4ANXA 3J5QB 1SZ9A 3ZKJA 4WNGA 2XGSA 4FLBA 3JCKC 2FBNA 4WUYA 3TJPA 4C48B 1HF8A 4JEUA 5CMWA 5ENSD 4GZDA 2XZTG 1JPLA 1Q2ZA 4O60A 4DLQA 4P29A 1P5QA 4Y6CA 3AS8A 3DSSA 4EPZA 3TAXA 4APFA 2Y4UA 5A6CA 5G05J 2OEWA 3QWPA 4GTSA 3T9KA 1SQMA 4F1PA 2X6JA 4N2QA 4UI9C 1H6KA 4B94A 3DSWA 3I5PA 3RRMB 3UKUG 3D9HA 4ATZD 2P9SG 3VTXA 2P9UG 4TXQA 2P9LG 4A1GA 1LD8A 4I9CA 3X2QE 4G26A 3HXBA 4TRQA 5EDSA 4OAUC 1NZNA 4GYYA 3RKVA 3FUHA 2V5FA 5D0QD 5ARGA 3FTVA 3DRAA 4GAAA 1B89A 1TJCA 4ANUA 4CDRA 4L2YA 3LCAA 4O1PA 1BD8A 2DYRE 4UI9K 4L9PA 3ZNGA 2WXRA 2IU1A 3CVPA 2L6JA 3Q7AA 1HS6A 3ZYKA 2AWIA 3ZVVA 2J9QA 5ANRA 4U63A 2PQRA 5ITZF 1LF8A 2DVWA 4PUCA 2B0OE 1YYHA 4NQ0A 3B7TA 4BTBA 3O48A 1AP7A 1YA0A 3S2AA 1NA0A 3TWVA 2J09A 3LXUX 3FWVA 4CEMA 3CHSA 3SHFA 3FP3A 4U8HA 4XI0A 5BT1A 4HORA 4HOQA 4UWGA 5EIBE 1FCHA 2GROB 1E8XA 2WXKA 4LUNU 3LY7A 2VTBB 1K8KG 4JHRA 2GRMA 2H6GA 2CFUA 2J08A 2L0IA 1MX4A 1UJJA 3CHRA 2HM8A 3GW4A 1O1TA 1S70B 2WXPA 3Q47B 3IKOB 3ZYMA 5FT9A 4KXKB 4GZCA 4XKCA 4B89A 4DI3A 5BXOA 1UN8A 5KJLA 1Z5SC 5J08A 3IBEA 4G23A 2I6HA 4GTMA 2AW6A 4X8QA 3Q9UC 4N3BA 1MX6A 3L08A 2IY0C 3HXDA 3FUIA 2KATA 4K0RA 1ZU2A 3FTWA 1NI1A 4GMRA 5B3SE 2XRYA 3OXLA 5FQ7A 4GZ5A 3LVQE 2MHKA 2XEEA 2R02A 2XPZA 4UWHA 3NB2A 3ULEG 2WQHA 3ZPJA 3CVWA 1O1RA 3PEVB 5CBNA 3KSLA 2WQ6A 3ONKA 3VLEA 3EU5A 4JA7A 4TXPA 1BI7B 1X5BA 3DPDA 4EZKA 4DRXE 1D8EA 4GYWA 4YVOA 2BTDA 3U9WA 4MS6A 2F8YA 3PRZA 1TEZA 2FI7A 3RO2A 1N95A 2GRRB 3KSQA 4I17A 1H2VC 2LXMA 5LP0A 1WM5A 5HS0A 2HR2A 3AJIA 2FO7A 2WVIA 1RW2A 3CLJA 3D9LA 3UMVA 4N3CA 3QNKA 4J8EA 3IV0A 2WM9A 2XRZA 2BEDA 1SA5A 3TG4A 3CVQA 4G2VA 2V8SE 1E96B 3HRAA 1S0PA 3Q5MA 3CSTA 4HQDA 4W9RA 2F8XK 4BX8A 2QFCA 1A17A 2C0LA 4ILHB 3EJNA 4YVQC 2J8SD 1HU3A 3ASGA 2WMNA 2DZOA 3ASDA 3CHMA 5ENNA 3O4ZA 5ENTD 5DBKA 1VDYA 5FQ4A 4FJYA 1AWCB 2J07A 3D9OA 4LSZE 5CRVA 3BU8A 2OVFA 4JW1A 1V54E 2X6HA 4UUCA 3ZHEB 4BX9A 4EQFA 3TXMA 5CECB 2EQXA 3Q49B 4L1BA 2Y0BG 3CK7A 3KAEA 1S63A 3UI2A 4YDOA 4Q94A 3LJNA 1JWFA 3PVLA 3U66A 2WQ7A 3CHOA 1NL4A 3E34A 3AS5A 4G1TA 4OYSA 4JB8P 2NC9A 4IYPA 4N5QA 1WDYA 3T8MA 4AXHA 4GZ6A 5FQ6A 2WXFA 1OWLA 3LVRE 3EDTB 2X6KA 3HIZA 1WAO1 3SD5A 5KCMA 2HE0A 1TR4A 4JVSA 1JCRA 1IHBA 2AXZA 4CYMD 4GZ3A 3BEEA 1JUQA 1SZAA 3EIQC 5ENOD 3E33A 3CR3A 1BPOA 2ZU6B 5AJDA 3FTZA 4FJZA 2ETBA 1N11A 5FZSA 3SFZA 3PUJA 2VTBA 1N0QA 2GRPB 3MYVA 1HZ4A 5JHBA 3JQ0A 4GU5A 4QQIA 4J8FA 3KEZA 4F3VA 3HXFA 2MOWA 2P9PG 3LDZA 3TL5A 4U0ZA 3UIPC 3PDNA 4JL0A 3L6AA 4DJAA 1FVFA 4HRMB 4DI4A 2XENA 4AV7A 4FLHA 3LKUA 4AIFA 5JMND 1N54A 3UM3A 4UQYA 3SGHA 3AG4E 4YDYA 3QK0A 3CHQA 2DWZA 4U07A 1SW6A 2CG2A 4K5CA 3UUXA 2WXGA 1ELRA 3EHMA 2A5UA 1H6PA 1EDUA 3D9MA 4AM9A 3G2WA 2PM6A 4UQZA 5C2YA 2BKGA 2XEVA 4C0MA 4GTVA 1MX2A 4EECA 2B6CA 4RQIA 3EU9A 3L16A 1E8WA 4HLLA 4KT6B 2QY7A 5EN5D 4DLOA 5A23A 5HI7A 3RIBA 4U0UA 5JJ7A 2QC9A 3ASOE 2CFZA 3MKRA 2Y69E 3UT4A 4HB5A 4E6HA 2A4ZA 4N39A 2V5QC 2RFMA 4BETA 3CVUA 3D3MA 4Q96A 4TV3A 4F6RD 4I6JA 4FP7A 3QAQA 4HLEA 1OWPA 5JJTA 2CHXA 2ILRA 1IXVA 2NXPA 2R2LA 3CIAA 4GA2A 3TWSA 3QB2A 1OCRE 5AYWD 5HKPA 3MV2B 2RFAA 2EIJE 2NYJA 4NIKA 4N3AA 3CKBA 3U3WA 5M72A 2EINE 3ZN3A 1Z3YA 3Q9NC 4JHJA 3FHEA 1E90A 2C2LA 3MKQB 5LCWC 3TG5A 2XGMA 3D9KA 3LY9A 4K5AB 5J90A 4UI9J 3ZHEA 3R7QA 4LCTA 4I1AA 3WG7E 2ETAA 3CVNA 3FH7A 3HVEB 4IULA 1FVHA 3TWUA 1WG0A 3ML8A 3ZEFA 4LRZA 3OAWA 1LTXA 3PH0C 2KXPC 5CCMA 3TWTA 3S7DA 3RRNB 4BEPA 3ABLE 3B13A 3PS6A 2IONA 3NOCD 3PNTB 1BU9A 3UT8A 2X38A 1ZB1A 3T8KA 4A3TA 4FA6A 2CHZA 3EUVA 1BI8B 5ENPD 4HS2A 3ZFWA 1HX8A 1JCSA 4O6FA 5EX0A 2L0TB 4C9BB 5AQAA 3U64A 5KJNA 3VTYA 3LS8A 4GTRA 2XEHA 2BUGA 3C5RA 3RAUA 4G8LA 2NSZA 3KEAA 2KZTB 3AAAC 3QWWA 3ASNE 4XZ4A 1TN7A 4CDMA 3NZSA 1TNOA 4CT4A 4EBAG 5HQ8A 2XCCA 5JHAA 3PZ1A 2YQ8A 1K3ZD 3MEKA 1OUVA 2A5EA 4UQXA 2HYZA 4C0EA 4JXTA 5FZQA 3NBNB 3RO3A 2WXQA 4LEUA 3D9NA 5E75A 4HFGA 5BNWA 3IEGA 4U8VD 2LO6A 4AEZC 4HOTA 3DSTA 4U96D 3K9IA 3UPVA 3JUEA 4DK5A 3LPZA 1UG3A 4LNGA 4YNDA 5BXUA 2R03A
chains in the Genus database with same CATH topology
3GZ2A 3LY8A 4HVBA 5LCWJ 5KJMA 3EIJA 2RD0A 3FTSA 2UY1B 2J07A 4ANVA 3D9OA 5A7DB 3ASFA 3IHVA 2VGXB 2FEZA 3FTYA 1HG5A 4WAFA 4I6EA 5FJYA 2OVFA 4GMLA 4QFVA 4XIFA 4Y6WA 4JW1A 5DIZA 2X6HA 1DNPA 2PZIA 3ZHEB 4BX9A 2KM4A 1KT1A 2AXVA 3DBSA 4EQFA 3TXMA 2YHEA 1EYHA 3ZYLA 4CGVA 2V0PA 1PY1A 3S7JA 2EQXA 3Q49B 4L1BA 1EF1C 3R9AB 3CK7A 3KAEA 1GW6A 4NURA 5BW8C 3FFLA 2AXUA 1Y8MA 3QOUA 4Q94A 3GZ1A 4L2LA 5E76A 4PS8A 2IOLA 3T5XA 1JWFA 2FF4A 1UW4B 4M3OA 2IF4A 3FULA 3G2UA 3PVLA 2JEKA 4A3VA 3U66A 2WQ7A 3CHOA 2OOEA 2C0MA 2R17C 1E8ZA 3KD7A 2VSXE 3AS5A 4WWPA 3TGOA 2E2EA 5EX3A 4G1TA 4OYSA 3I4RB 2NC9A 4FULA 4RG9A 4MKTA 4V3IA 1H19A 3BG0B 4IYPA 3T8MA 4AXHA 4GZ6A 3ZIMA 5FQ6A 4AOFA 2WXFA 1OWLA 4CGWA 3MZLB 2LSVA 3LVRE 1OWOA 3N71A 3L13A 4JA9A 3SI5A 2JLBA 3LEWA 3WXXA 1H2TC 2FULA 3EDTB 2X6KA 3HIZA 3UQ3A 1WAO1 1MQSA 2VGYA 3SD5A 3NF1A 4OVVA 2KCLA 3HYMB 5KCMA 5C1DA 3CEQA 1U3CA 1NA3A 2M63A 2J4DA 3ULQA 4JVSA 5FQ8A 5AIJA 1HG2A 3Q4AB 2AXZA 2WPVA 3SF4A 5FWQA 4GZ3A 1QZ2A 3BEEA 2VJ8A 3AS4A 5G2NA 2KCKA 1JUQA 1SZAA 4FC8A 4I2ZA 1U3DA 3EIQC 1ELKA 2DIWA 3URZA 2PQNA 3RK6A 3CR3A 1BPOA 2VSYA 2ZU6B 4NACA 5AJDA 3FTZA 4I9EA 1IQUA 4L23A 2WXOA 3SNXA 3MJWA 2WXMA 2DBAA 3I3NA 4ANXA 4K03A 3QC1A 1SZ9A 4BTAA 4N2SA 4WNGA 2WXHA 4FJZA 3FUNA 5JJ6A 2XPYA 5FZSA 2XGSA 3SFZA 3NZUA 4FLBA 3CK9A 3JCKC 2FBNA 3PUJA 3ESKA 4WUYA 3TJPA 2VTBA 1HF8A 1XNFA 2V4LA 1PC2A 2Y3AA 4JEUA 5CMWA 2P58C 3FUDA 3CVYA 4GZDA 5LX8A 3VLFA 4GA1A 4J8DA 3MYVA 4UWFA 4GA0A 2XCBA 1JPLA 3QKYA 3UX4A 3VLDA 3AU5A 3R7RA 4DLQA 1HZ4A 4H7YA 2AVPA 4P29A 2PL2A 1UJKA 5JHBA 1P5QA 3JQ0A 4APOA 4KYOB 4Y6CA 3AS8A 4GU5A 3MV3B 4ANWA 4J8FA 3KEZA 4F3VA 4GCNA 1JWGA 4EPZA 3JQ1A 3OXGA 3FU5A 2MOWA 3TAXA 4UWLA 3CV0A 4APFA 2Y4UA 4G25A 3LDZA 3TL5A 3MKQA 5A6CA 3FUJA 2IQCA 4U0ZA 1TJFA 5G05J 4HOSA 1E7UA 1WY6A 3QWPA 1SQMA 4G24A 2X6JA 3JYSA 3PDNA 4IRUA 4N2QA 4JL0A 3L6AA 2ONDA 3FDHA 4DJAA 1FVFA 2WMOA 3L54A 4DI4A 4UI9C 1H6KA 3MA5A 4B94A 5AENA 4AV7A 3I5PA 3RRMB 5BV0A 1ZBPA 4J8SA 4FLHA 4JC8A 3QARA 2XQ0A 3LKUA 5KJKA 1Z3XA 3HVEA 2VGXA 5FZRA 4AIFA 3RRUA 3VTXA 3CHPA 4RVBA 3FUFA 3L22A 4IN3B 1EPUA 1N54A 4A1GA 3NQPA 4I9CA 4UQYA 3PE4A 3SGHA 2Q7FA 2I2OA 4G26A 1HO8A 4JHKA 3QK0A 4D10C 3MCXA 3CHQA 4TRQA 4OVUA 5EDSA 2RG8A 3ML9A 1E7VA 4U07A 2CG2A 3UUXA 1HXIA 1NZNA 2WXGA 4GYYA 3RKVA 1ELRA 3EHMA 3FUMA 3FUHA 3EHNA 2A5UA 3HDXA 4U04A 4KVOA 2V5FA 4XKBA 3CGHA 1EDUA 3D9MA 4ATGA 5D0QD 5ARGA 1L5JA 3FH5A 3FTVA 2KCVA 2X6FA 4RSYA 3E4BA 4BWRA 3FTXA 4GAAA 5CMYA 3G2WA 1B89A 2PM6A 4I1OB 1TJCA 4AM9A 4UQZA 4ANUA 5C2YA 4CDRA 2XEVA 4L2YA 4C0MA 3LCAA 3L17A 4B8AA 2VYIA 2IJGX 4EECA 1OWNA 4BT8A 4L7TA 5T8IA 4UI9K 3L16A 1E8WA 4KT6B 2CHWA 2QY7A 2WXRA 2IU1A 2XPIA 1E8YA 4N5CA 4F7AA 4DLOA 3PREA 3CVPA 3APCA 1IYGA 2DCPA 2GGFA 2L6JA 5A23A 4UWKA 5HI7A 3P2BA 2LNIA 4HXIA 4U0UA 1HS6A 3RIBA 5JJ7A 4I43A 3U4TA 3ZYKA 2CFZA 2AWIA 2WXIA 2LSUA 3ZVVA 4B0ZA 3CVVA 4EZLA 3MKRA 2J9QA 3FU3A 5ANRA 4AY5A 2KZTA 3UT4A 4E85A 4U63A 2PQRA 2Y4TA 5BV1A 1LF8A 5G55A 4E6HA 5LOZA 3KS2A 4PUCA 3ZYQA 2A4ZA 4N39A 4KZ0A 1ELWA 2YNQA 3APFA 4NQ0A 5G04C 3B7TA 5T3RA 2PM7A 4BY6A 3FEXA 4BTBA 3O48A 1OWMA 4RG6A 1YA0A 3ESLA 2GRLA 3S2AA 1NA0A 3D3MA 3CVUA 4Q96A 4TV3A 1W3BA 1HE8A 5LFAA 2L9BA 2J09A 2OV8A 3LXUX 4I6JA 4FP7A 4I2WA 3QAQA 3FWVA 1OWPA 2HO1A 3CHSA 4CEMA 4HLEA 5JJTA 5BUZA 2OVBA 3SHFA 4MLPA 3FP3A 4A1SA 4U8HA 2WXJA 4XI0A 5BT1A 4HORA 4HOQA 2CHXA 4GCOA 4UWGA 1KLXA 3CKCA 2ILRA 3JUIA 1DVPA 1FCHA 2BF0X 3SZ7A 2NXPA 1E8XA 2WXKA 3CIAA 3D9PA 4GA2A 4GMJA 4LUNU 3ONLA 4KVMA 4AJWA 2I9CA 3QB2A 3LY7A 3QWVA 2VTBB 5AYWD 4JHRA 2GRMA 1MHQA 1QQEA 2GW1A 3AU4A 3MV2B 2CFUA 4FU3A 4N3AA 4J6IA 1IQRA 3CKBA 2J08A 3U3WA 2X6IA 3OTNA 2L0IA 3CQCB 4GYOA 5M72A 1INZA 1UJJA 2VSOE 3BG1B 3CHRA 3LYAA 4XX5A 2HM8A 3D9JA 3ZN3A 3G2TA 3GW4A 4CRWA 2WXPA 3ZGQA 3Q47B 5CHEE 4FHJA 3FTUA 1Z6TA 3IKOB 3ZYMA 1Z3YA 4H7XA 5FT9A 2R5SA 4KXKB 4GZCA 4XKCA 3CVLA 4ILGA 4WWOA 4B89A 4DI3A 3ZRHA 2UWJG 4JHJA 3FHEA 4KBQA 1UN8A 4EBAA 5KJLA 1E90A 2C2LA 3MKQB 5LCWC 3TG5A 2XGMA 2LAHA 2UY1A 4JPSA 5J08A 3IBEA 4G23A 2I6HA 2LAIA 2AW6A 3D9KA 1N52A 4N3BA 3L08A 2MRIA 3LY9A 3C98A 3PZDA 3CVXA 2I1JA 3FUIA 3HHMA 4JZYA 1H0AA 4UI9J 5J90A 3ZHEA 2KATA 3ZXSA 1QNFA 4K0RA 1ZU2A 4GB9A 3FTWA 4DPRA 2X3MA 5ARFA 3R7QA 4LCTA 4I1AA 2E0IA 3CVNA 3FH7A 4GPKA 2XRYA 4ME2A 3S7FA 3HVEB 4IULA 1FVHA 3UT7A 3OXLA 2WXLA 3ML8A 3ZEFA 4BSXA 4LRZA 3OAWA 5FQ7A 3P1UA 3PH0C 4GZ5A 2YHCA 4EZJA 3LVQE 3CQGB 2MHKA 3PE3A 3PUKA 4AP2A 5CCMA 2XPZA 2XHEA 3S7DA 3GYZA 4UWHA 3RRNB 3S7BA 3FY4A 3B13A 2WQHA 3ZPJA 3CVWA 4CCAA 3PS6A 3PEVB 5BPPA 2IONA 4MRUA 1H2UA 4PH4B 4U0SA 3PNTB 4HOUA 2WQ6A 3I4GA 3ONKA 3VLEA 4JA7A 2R59A 3IHYA 4XI9A 4ABNA 3UT8A 3FU6A 5EKQD 2X38A 1X5BA 1HH8A 3DPDA 3LJ3A 4EZKA 3ASHA 3SBTB 4A3TA 4LERA 3B7RL 4FA6A 4GYWA 2CHZA 4FHKA 2VQ2A 3FU0A 4I1MA 4YVOA 2IFUA 4CT0A 1XGWA 3T5VA 4XE0A 2BTDA 1HFAA 1IHGA 4HS2A 3ZFWA 3U9WA 1HX8A 3MX3A 4MS6A 4O6FA 5EX0A 4R7LA 5FTPA 3PRZA 1TEZA 2FI7A 3RO2A 4AVXA 2L0TB 3FEYA 3Q15A 3FUEA 1NP7A 4C9BB 4I17A 5CCLA 3U64A 5KJNA 2J49A 1H2VC 4WNFA 3VTYA 3RU0A 3LS8A 3G2SA 3PEUB 4PDXA 1WM5A 4FADA 5LP0A 4Q69A 2J4BA 2HR2A 3PNLB 4ACKA 2BUGA 2FO7A 3CK8A 2NSZA 3ENEA 2WVIA 5ANLA 3D9LA 2KZTB 3CLJA 3UMVA 4ACLA 4N3CA 3OXFA 3QNKA 3QWWA 4J8EA 3IV0A 2WM9A 3MGBA 4XZ4A 2XRZA 3QJZA 4CDMA 5AJLA 1Y6IA 3ZW3A 3NZSA 3TG4A 4WNDA 5G04J 3CVQA 4NRHB 4G2VA 4WWNA 2YINA 2V8SE 4CT4A 4EBAG 4B8CB 5HQ8A 1E96B 1KT0A 2WB2A 3SBSA 2XCCA 3B7UX 5JHAA 1S0PA 5D0OD 4J0UA 2YQ8A 3D9IA 3Q5MA 4A55A 3MEKA 4BFRA 3CSTA 4KZCA 1OUVA 4KMOA 4W9RA 4AY6A 4ILIA 3APDA 3RJVA 2QFCA 4BX8A 1A17A 4UQXA 2HYZA 4G11A 4JXTA 5FZQA 4C0EA 3GZSA 4F1SA 4CDNA 2C0LA 3B7SA 3RO3A 5G05C 4PS7A 2WXQA 4LEUA 3CSFA 4URKA 2VSNA 4ILHB 3D9NA 3TXNA 5E75A 2I1KA 4HFGA 5BNWA 3EJNA 4YVQC 3FH8A 3IEGA 2LO6A 4AEZC 2CG3A 4HOTA 4WNEA 4PS3A 3K9IA 1HU3A 3ASGA 3G2VA 4I6GA 3UPVA 2WMNA 2IOSA 4JEHA 4F53A 3ASDA 4DK5A 2XGOA 3QDNA 3LPZA 1PAQA 3CHMA 1UG3A 3FUKA 4BT9A 4TUUA 5ENNA 3O4ZA 4YNDA 2KC7A 1UN9A 5DBKA 1VDYA 2WXNA 5T4YA 5FQ4A 4FJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZ2 A;  3LY8 A;  5LCW J;  5KJM A;  2UY1 B;  5A7D B;  3ASF A;  2VGX B;  2FEZ A;  5FJY A;  4Y6W A;  4XIF A;  5DIZ A;  2PZI A;  3ZHE B;  1KT1 A;  4EQF A;  4CGV A;  3S7J A;  3Q49 B;  3R9A B;  3CK7 A;  3KAE A;  5BW8 C;  3FFL A;  1Y8M A;  3QOU A;  3GZ1 A;  2FF4 A;  2IF4 A;  2OOE A;  2C0M A;  3KD7 A;  3AS5 A;  3TGO A;  2E2E A;  5EX3 A;  4G1T A;  2NC9 A;  4RG9 A;  4GZ6 A;  4CGW A;  2LSV A;  3N71 A;  4JA9 A;  2JLB A;  3WXX A;  3EDT B;  3UQ3 A;  1WAO 1;  2VGY A;  3NF1 A;  2KCL A;  3HYM B;  5C1D A;  3CEQ A;  1NA3 A;  3ULQ A;  3Q4A B;  3SF4 A;  2WPV A;  4GZ3 A;  1QZ2 A;  3BEE A;  3AS4 A;  2KCK A;  4I2Z A;  3URZ A;  2PQN A;  2VSY A;  4I9E A;  2DBA A;  4BTA A;  4N2S A;  4WNG A;  5JJ6 A;  5FZS A;  2XGS A;  3CK9 A;  2FBN A;  4WUY A;  3ESK A;  1XNF A;  1PC2 A;  2P58 C;  4GA1 A;  4J8D A;  4GA0 A;  2XCB A;  3QKY A;  1HZ4 A;  4H7Y A;  2AVP A;  2PL2 A;  1P5Q A;  4APO A;  4KYO B;  4Y6C A;  3AS8 A;  3MV3 B;  4J8F A;  4F3V A;  4GCN A;  3OXG A;  3TAX A;  3CV0 A;  2Y4U A;  4G25 A;  5A6C A;  4U0Z A;  5G05 J;  4HOS A;  3QWP A;  4G24 A;  3JYS A;  3PDN A;  4N2Q A;  4JL0 A;  2OND A;  4UI9 C;  3MA5 A;  4B94 A;  1ZBP A;  3LKU A;  5KJK A;  5FZR A;  2VGX A;  4AIF A;  3VTX A;  4IN3 B;  4I9C A;  4UQY A;  3PE4 A;  2Q7F A;  4G26 A;  4U07 A;  3UUX A;  1NZN A;  1HXI A;  4GYY A;  3RKV A;  1ELR A;  4U04 A;  2V5F A;  5D0Q D;  5ARG A;  2KCV A;  3E4B A;  4BWR A;  4AM9 A;  1B89 A;  1TJC A;  4UQZ A;  4CDR A;  2XEV A;  3LCA A;  2VYI A;  4BT8 A;  4UI9 K;  2XPI A;  4N5C A;  3CVP A;  1IYG A;  2L6J A;  5HI7 A;  3RIB A;  2LNI A;  4U0U A;  5JJ7 A;  3U4T A;  2LSU A;  3MKR A;  2J9Q A;  4AY5 A;  2PQR A;  2Y4T A;  3KS2 A;  4N39 A;  1ELW A;  4NQ0 A;  5G04 C;  4BTB A;  3O48 A;  4RG6 A;  1YA0 A;  1NA0 A;  1W3B A;  4I2W A;  3FWV A;  2HO1 A;  5JJT A;  4A1S A;  3FP3 A;  4XI0 A;  5BT1 A;  4HOR A;  4HOQ A;  4GCO A;  1KLX A;  3CKC A;  1FCH A;  3SZ7 A;  4GA2 A;  3LY7 A;  3QWV A;  5AYW D;  4JHR A;  1QQE A;  2GW1 A;  3MV2 B;  4N3A A;  3CKB A;  3U3W A;  5M72 A;  4GYO A;  3LYA A;  3ZN3 A;  3GW4 A;  3ZGQ A;  3Q47 B;  5CHE E;  4H7X A;  5FT9 A;  2R5S A;  4KXK B;  3CVL A;  2UWJ G;  4KBQ A;  5KJL A;  2C2L A;  5LCW C;  3TG5 A;  2XGM A;  2UY1 A;  4G23 A;  2I6H A;  4N3B A;  3LY9 A;  4UI9 J;  3ZHE A;  2KAT A;  1ZU2 A;  5ARF A;  4I1A A;  3CVN A;  4GPK A;  4ME2 A;  3S7F A;  3OXL A;  4GZ5 A;  2YHC A;  2MHK A;  3PE3 A;  5CCM A;  3S7D A;  3GYZ A;  3S7B A;  2WQH A;  3ZPJ A;  4U0S A;  4HOU A;  4JA7 A;  4XI9 A;  4ABN A;  5EKQ D;  1HH8 A;  3ASH A;  4GYW A;  2VQ2 A;  4YVO A;  2IFU A;  1IHG A;  3ZFW A;  4O6F A;  5EX0 A;  5FTP A;  2FI7 A;  3RO2 A;  3Q15 A;  4I17 A;  5CCL A;  5KJN A;  4WNF A;  3VTY A;  3RU0 A;  1WM5 A;  2HR2 A;  2BUG A;  2FO7 A;  3CK8 A;  4N3C A;  3OXF A;  3QWW A;  4J8E A;  3TG4 A;  4WND A;  5G04 J;  3CVQ A;  4NRH B;  4G2V A;  5HQ8 A;  1E96 B;  1KT0 A;  2XCC A;  5D0O D;  4J0U A;  2YQ8 A;  3Q5M A;  3MEK A;  1OUV A;  4W9R A;  4AY6 A;  3RJV A;  2QFC A;  1A17 A;  4UQX A;  2HYZ A;  5FZQ A;  2C0L A;  3RO3 A;  5G05 C;  4LEU A;  2VSN A;  5BNW A;  4YVQ C;  3IEG A;  4HOT A;  4WNE A;  3K9I A;  3ASG A;  3UPV A;  3ASD A;  2XGO A;  3QDN A;  3LPZ A;  4BT9 A;  4YND A;  2KC7 A;  5DBK A; 
#chains in the Genus database with same CATH topology
 3EIJ A;  3DWL G;  5A7D B;  5KNG A;  1MYO A;  2FEZ A;  4GTT A;  3FTY A;  5FJY A;  3JXJ A;  4I6E A;  4XIF A;  4K5B A;  4HI9 A;  4JD2 G;  3DBS A;  3ZXP A;  1EYH A;  2V0P A;  3ULY A;  1MZC A;  1GW6 A;  4NUR A;  5BW8 C;  3UKR G;  2IEJ A;  1D8D A;  3QOU A;  3T5X A;  5E76 A;  4PS8 A;  4XEI G;  1YCS B;  1UW4 B;  4M3O A;  1DCE A;  2JEK A;  4J7W A;  5CER B;  3ABK E;  2VSX E;  2LXL A;  5EX3 A;  1SVX A;  3I4R B;  1D9S A;  1A5E A;  1TNY A;  3AG2 E;  3ZIM A;  2AJA A;  4JA9 A;  3WXX A;  3LEW A;  2FUL A;  5B1A E;  5EID A;  2KCL A;  3HYM B;  3CEQ A;  3DSX A;  3DSV A;  3UIO C;  5AIJ A;  5FWQ A;  3R9M A;  4B93 B;  3PZ2 A;  3AS4 A;  4HNA D;  5G2N A;  4FC8 A;  1YMP A;  3RK6 A;  4DX5 D;  4I9E A;  3ABM E;  2WXO A;  3SNX A;  1DCQ A;  2WXM A;  3I3N A;  4N2S A;  2WXH A;  4HRL A;  3NZU A;  3CK9 A;  3ESK A;  1XNF A;  2V4L A;  3CVY A;  2Y3A A;  5D2M C;  5LX8 A;  4GA1 A;  3SFY A;  2XCB A;  3VLD A;  3AU5 A;  3AG1 E;  4H7Y A;  4HRN A;  1UJK A;  4KYO B;  4YDE A;  5ENR D;  4GCN A;  3FU5 A;  4UWL A;  2H6F A;  2ZIS A;  4G25 A;  2IO3 C;  2V4H C;  3MKQ A;  4J8Y A;  1WY6 A;  3JYS A;  4IRU A;  2OND A;  3FDH A;  3MA5 A;  2H6I A;  3L82 A;  4GPM A;  4JC8 A;  3QAR A;  2BKK B;  1Z3X A;  3HVE A;  2VGX A;  5AN8 A;  3FUF A;  3L22 A;  2ZGD A;  3E32 A;  3NQP A;  2Q7F A;  4D10 C;  3MCX A;  4OVU A;  5HRY A;  3EHR A;  3HXE A;  1HXI A;  4TUM A;  3FUM A;  3EHN A;  3HDX A;  4U04 A;  4ATG A;  1L5J A;  3FH5 A;  2KCV A;  2X6F A;  4RSY A;  4BWR A;  3BUA A;  5CMY A;  2VYI A;  4CZ2 D;  2IJG X;  4BT8 A;  2EIL E;  3DPY A;  3V30 A;  2XPI A;  1FPP A;  2QYJ A;  1E8Y A;  4N5C A;  3PRE A;  3APC A;  3V2O A;  3P2B A;  2LNI A;  4HXI A;  4I43 A;  3U4T A;  3V31 A;  4B0Z A;  3CVV A;  3ISM C;  5EYP F;  4AY5 A;  2KZT A;  2Y4T A;  5EYL A;  5BV1 A;  5G55 A;  5LOZ A;  3DXM G;  4KZ0 A;  4HBD A;  1ELW A;  5G04 C;  5T3R A;  2PM7 A;  5JA4 D;  4BY6 A;  3FEX A;  4RG6 A;  2GRL A;  5AQ9 A;  2JAB A;  1HE8 A;  5LFA A;  2L9B A;  4I2W A;  2HO1 A;  5BUZ A;  2OVB A;  1KLX A;  3JUI A;  3DEO A;  3SZ7 A;  1V55 E;  1OCZ E;  3D9P A;  4GMJ A;  3ONL A;  3HG0 D;  4AJW A;  3QWV A;  1QQE A;  2GW1 A;  3AU4 A;  4FU3 A;  4J6I A;  2X6I A;  3OTN A;  3CQC B;  2H6H A;  4GYO A;  4XX5 A;  3BG1 B;  4CRW A;  3D9J A;  1N4S A;  3G2T A;  4LNU D;  3ZGQ A;  5CHE E;  3FTU A;  2LUH A;  4H7X A;  3ZUV B;  2R5S A;  3CVL A;  4ILG A;  3ZRH A;  4KBQ A;  4EBA A;  4JPS A;  2LAI A;  1N52 A;  3UM2 A;  3PZD A;  2MRI A;  3W9G A;  3HHM A;  4JZY A;  1H0A A;  4TXR A;  3ZXS A;  4GB9 A;  3TWW A;  2E0I A;  4GPK A;  4ME2 A;  3S7F A;  3UXG A;  5H7P A;  2WXL A;  4BSX A;  3P1U A;  2YHC A;  4GTQ A;  2XHE A;  4M7C A;  3GYZ A;  3FY4 A;  4U8Y D;  1SA4 A;  4CCA A;  4PH4 B;  3I4G A;  2R59 A;  5FIO A;  4XI9 A;  3TWQ A;  3FU6 A;  1HH8 A;  3LJ3 A;  5AAO A;  3ASH A;  4LER A;  3B7R L;  4I1M A;  2IFU A;  1XGW A;  4XE0 A;  1KZP A;  1HFA A;  1IHG A;  3TWX A;  3MX3 A;  2OCC E;  1O1S A;  5FTP A;  2PNN A;  4OAV B;  3FUE A;  1O5M A;  1NP7 A;  3RU0 A;  1IKN D;  3PEU B;  4FAD A;  3PNL B;  4ACK A;  4ACL A;  3OXF A;  3MGB A;  3ZW3 A;  1Y6I A;  4Z68 A;  3Q73 A;  2YIN A;  4B8C B;  3DEP A;  1KT0 A;  3SBS A;  3B7U X;  5D0O D;  2DYS E;  4J0U A;  3D9I A;  4A55 A;  2VGE A;  4BFR A;  1FT2 A;  4AY6 A;  4ILI A;  3APD A;  3RJV A;  4F1S A;  4G11 A;  3GZS A;  3PZ3 A;  1OXJ A;  5G05 C;  4PS7 A;  3UM1 A;  4URK A;  3CSF A;  3E37 A;  3UIN C;  2I1K A;  3DXK G;  3FH8 A;  2CG3 A;  3G2V A;  4I6G A;  2IOS A;  4JEH A;  2XGO A;  3QDN A;  1PAQ A;  1N0R A;  3FUK A;  4BT9 A;  4TUU A;  4U95 D;  2WXN A;  5T4Y A;  5AAR A;  3C3Q A;  3LY8 A;  1KZO A;  4HVB A;  5LCW J;  2RD0 A;  3FTS A;  2UY1 B;  4ANV A;  1S64 A;  3ASF A;  3IHV A;  2VGX B;  1N4R A;  1HG5 A;  4WAF A;  4QFV A;  4Y6W A;  5DIZ A;  2PZI A;  2KM4 A;  2OEV A;  2AXV A;  2GRN B;  2YHE A;  3ZYL A;  4CGV A;  3S7J A;  4GTO A;  1EF1 C;  2IO2 C;  1TN8 A;  2AXU A;  1TNU A;  1Y8M A;  1JCQ A;  4L2L A;  2FF4 A;  4GTP A;  2IF4 A;  3FUL A;  2OOE A;  2R17 C;  2RKK A;  4WWP A;  3TGO A;  4LNB A;  3DSU A;  4MKT A;  4V3I A;  4BSZ B;  1H19 A;  3BG0 B;  3RSE G;  5ENQ D;  4AOF A;  3L13 A;  1H2T C;  3UQ3 A;  3NF1 A;  4OVV A;  2GRQ B;  5C1D A;  1U3C A;  1NA3 A;  2M63 A;  5KBA A;  2MYO A;  1HG2 A;  3Q4A B;  2WPV A;  5EIL A;  2QYU A;  4U7E B;  1QZ2 A;  4I2Z A;  1U3D A;  1ELK A;  1G3N B;  2DIW A;  3URZ A;  5CRU A;  5B1B E;  2VSY A;  2XZD G;  4L23 A;  4HI8 A;  3MJW A;  2DBA A;  4K03 A;  3QC1 A;  4BTA A;  3FUN A;  5JJ6 A;  2XPY A;  3AG3 E;  1PC2 A;  2P58 C;  3FUD A;  3VLF A;  4DX6 D;  4J8D A;  4UWF A;  4GA0 A;  3QKY A;  3UX4 A;  1N94 A;  3R7R A;  2AVP A;  2PL2 A;  4APO A;  3EHQ A;  3MV3 B;  4ANW A;  3NAW A;  1JWG A;  2P9N G;  3JQ1 A;  3OXG A;  3CV0 A;  2P9K G;  3FUJ A;  1OCC E;  2IQC A;  1TJF A;  5CEA A;  4HOS A;  1E7U A;  4G24 A;  5KWD A;  3B95 A;  3UM0 A;  2WMO A;  3L54 A;  1OY3 D;  5AEN A;  1N4Q A;  5BV0 A;  1ZBP A;  4J8S A;  3ZU7 B;  2XQ0 A;  3C3R A;  5CBO A;  5KJK A;  5FZR A;  2EIK E;  3RRU A;  1TN6 A;  3HXC A;  3CHP A;  4RVB A;  5D66 A;  4IN3 B;  1EPU A;  3UTM A;  5IY5 E;  3PE4 A;  2I2O A;  1HO8 A;  4JHK A;  1TNZ A;  2RG8 A;  3ML9 A;  1E7V A;  3J5P A;  3C72 A;  4KVO A;  4XKB A;  3CGH A;  3SY2 A;  3E4B A;  3B7B A;  3FTX A;  4MBG A;  4I1O B;  1N9A A;  3L17 A;  3Q78 A;  4B8A A;  3E30 A;  1OWN A;  4L7T A;  5T8I A;  2CHW A;  4F7A A;  1IYG A;  2DCP A;  2GGF A;  2QZA A;  4UWK A;  4YDW A;  2WXI A;  1QYM A;  2LSU A;  4BES A;  4EZL A;  2ZIR A;  5CED B;  3FU3 A;  4E85 A;  3KS2 A;  3ZYQ A;  2YNQ A;  3APF A;  3JXI A;  3TWR A;  1OWM A;  3ESL A;  4DX1 A;  1W3B A;  2OV8 A;  4A1S A;  4MLP A;  2WXJ A;  3BQO A;  4GCO A;  3CKC A;  1QBQ A;  1DVP A;  2BF0 X;  4DUI A;  4KVM A;  2I9C A;  1MHQ A;  4DX2 A;  2KBX A;  1IQR A;  1OCO E;  4LG6 A;  1INZ A;  3LYA A;  2VSO E;  4FHJ A;  1Z6T A;  1K1A A;  4WWO A;  1H6O A;  2UWJ G;  3SFX A;  2LAH A;  2UY1 A;  3SO8 A;  5AQB A;  2XS1 A;  2F0Y A;  3CVX A;  3C98 A;  2I1J A;  1QNF A;  4DPR A;  2X3M A;  5ARF A;  2R05 A;  3UT7 A;  1U2V G;  4A63 B;  1X81 A;  4EZJ A;  1FT1 A;  3CQG B;  3PE3 A;  3PUK A;  4AP2 A;  3S7B A;  5BPP A;  4MRU A;  1H2U A;  4O1O A;  4U0S A;  4HOU A;  3IHY A;  5KNH D;  4ABN A;  2DZN A;  5EKQ D;  2EIM E;  1UOH A;  3SBT B;  1RZ4 A;  4FHK A;  2VQ2 A;  3FU0 A;  4BER A;  2ZGG A;  1LD7 A;  4CT0 A;  3T5V A;  1BLX B;  2P2C P;  2ZXW E;  4R7L A;  2L6B A;  4AVX A;  3FEY A;  3Q15 A;  4ZFH A;  5CCL A;  1DC2 A;  2J49 A;  4DX7 D;  4WNF A;  4EHM A;  4PDX A;  3G2S A;  4Q69 A;  2J4B A;  3CK8 A;  3ENE A;  5ANL A;  1KPS B;  3QJZ A;  5AJL A;  1MJ0 A;  4WND A;  5G04 J;  4NRH B;  4WWN A;  3C3O A;  3SQV A;  2WB2 A;  2P9I G;  4KZC A;  1TNB A;  4G8K A;  1OT8 A;  4KMO A;  4CDN A;  3B7S A;  2VSN A;  3V79 K;  3TXN A;  4WNE A;  2XS8 A;  4PS3 A;  3W9F A;  2Y1L E;  1N4P A;  4F53 A;  2KC7 A;  1UN9 A;  3V2X A;  5AQ7 A;  3GZ2 A;  5KJM A;  3PZ4 A;  4GML A;  1DNP A;  1KT1 A;  1TYQ G;  3Q79 A;  1PY1 A;  1K1B A;  3R9A B;  3Q75 A;  2ETC A;  3FFL A;  3GZ1 A;  4ZHB A;  2IOL A;  5FIN A;  1NFI E;  3NOG D;  3G2U A;  4A3V A;  2C0M A;  1E8Z A;  3KD7 A;  3L9T A;  2E2E A;  4FUL A;  4RG9 A;  3F6Q A;  3Q7F A;  4CGW A;  3MZL B;  2LSV A;  1OWO A;  3N71 A;  3SI5 A;  2JLB A;  1MQS A;  2VGY A;  2J4D A;  2F37 A;  3ULQ A;  2FO1 E;  5FQ8 A;  3SF4 A;  4RLY A;  2VJ8 A;  2KCK A;  2PQN A;  3IXE A;  4NAC A;  1IQU A;  4ANX A;  3J5Q B;  1SZ9 A;  3ZKJ A;  4WNG A;  2XGS A;  4FLB A;  3JCK C;  2FBN A;  4WUY A;  3TJP A;  4C48 B;  1HF8 A;  4JEU A;  5CMW A;  5ENS D;  4GZD A;  2XZT G;  1JPL A;  1Q2Z A;  4O60 A;  4DLQ A;  4P29 A;  1P5Q A;  4Y6C A;  3AS8 A;  3DSS A;  4EPZ A;  3TAX A;  4APF A;  2Y4U A;  5A6C A;  5G05 J;  2OEW A;  3QWP A;  4GTS A;  3T9K A;  1SQM A;  4F1P A;  2X6J A;  4N2Q A;  4UI9 C;  1H6K A;  4B94 A;  3DSW A;  3I5P A;  3RRM B;  3UKU G;  3D9H A;  4ATZ D;  2P9S G;  3VTX A;  2P9U G;  4TXQ A;  2P9L G;  4A1G A;  1LD8 A;  4I9C A;  3X2Q E;  4G26 A;  3HXB A;  4TRQ A;  5EDS A;  4OAU C;  1NZN A;  4GYY A;  3RKV A;  3FUH A;  2V5F A;  5D0Q D;  5ARG A;  3FTV A;  3DRA A;  4GAA A;  1B89 A;  1TJC A;  4ANU A;  4CDR A;  4L2Y A;  3LCA A;  4O1P A;  1BD8 A;  2DYR E;  4UI9 K;  4L9P A;  3ZNG A;  2WXR A;  2IU1 A;  3CVP A;  2L6J A;  3Q7A A;  1HS6 A;  3ZYK A;  2AWI A;  3ZVV A;  2J9Q A;  5ANR A;  4U63 A;  2PQR A;  5ITZ F;  1LF8 A;  2DVW A;  4PUC A;  2B0O E;  1YYH A;  4NQ0 A;  3B7T A;  4BTB A;  3O48 A;  1AP7 A;  1YA0 A;  3S2A A;  1NA0 A;  3TWV A;  2J09 A;  3LXU X;  3FWV A;  4CEM A;  3CHS A;  3SHF A;  3FP3 A;  4U8H A;  4XI0 A;  5BT1 A;  4HOR A;  4HOQ A;  4UWG A;  5EIB E;  1FCH A;  2GRO B;  1E8X A;  2WXK A;  4LUN U;  3LY7 A;  2VTB B;  1K8K G;  4JHR A;  2GRM A;  2H6G A;  2CFU A;  2J08 A;  2L0I A;  1MX4 A;  1UJJ A;  3CHR A;  2HM8 A;  3GW4 A;  1O1T A;  1S70 B;  2WXP A;  3Q47 B;  3IKO B;  3ZYM A;  5FT9 A;  4KXK B;  4GZC A;  4XKC A;  4B89 A;  4DI3 A;  5BXO A;  1UN8 A;  5KJL A;  1Z5S C;  5J08 A;  3IBE A;  4G23 A;  2I6H A;  4GTM A;  2AW6 A;  4X8Q A;  3Q9U C;  4N3B A;  1MX6 A;  3L08 A;  2IY0 C;  3HXD A;  3FUI A;  2KAT A;  4K0R A;  1ZU2 A;  3FTW A;  1NI1 A;  4GMR A;  5B3S E;  2XRY A;  3OXL A;  5FQ7 A;  4GZ5 A;  3LVQ E;  2MHK A;  2XEE A;  2R02 A;  2XPZ A;  4UWH A;  3NB2 A;  3ULE G;  2WQH A;  3ZPJ A;  3CVW A;  1O1R A;  3PEV B;  5CBN A;  3KSL A;  2WQ6 A;  3ONK A;  3VLE A;  3EU5 A;  4JA7 A;  4TXP A;  1BI7 B;  1X5B A;  3DPD A;  4EZK A;  4DRX E;  1D8E A;  4GYW A;  4YVO A;  2BTD A;  3U9W A;  4MS6 A;  2F8Y A;  3PRZ A;  1TEZ A;  2FI7 A;  3RO2 A;  1N95 A;  2GRR B;  3KSQ A;  4I17 A;  1H2V C;  2LXM A;  5LP0 A;  1WM5 A;  5HS0 A;  2HR2 A;  3AJI A;  2FO7 A;  2WVI A;  1RW2 A;  3CLJ A;  3D9L A;  3UMV A;  4N3C A;  3QNK A;  4J8E A;  3IV0 A;  2WM9 A;  2XRZ A;  2BED A;  1SA5 A;  3TG4 A;  3CVQ A;  4G2V A;  2V8S E;  1E96 B;  3HRA A;  1S0P A;  3Q5M A;  3CST A;  4HQD A;  4W9R A;  2F8X K;  4BX8 A;  2QFC A;  1A17 A;  2C0L A;  4ILH B;  3EJN A;  4YVQ C;  2J8S D;  1HU3 A;  3ASG A;  2WMN A;  2DZO A;  3ASD A;  3CHM A;  5ENN A;  3O4Z A;  5ENT D;  5DBK A;  1VDY A;  5FQ4 A;  4FJY A;  1AWC B;  2J07 A;  3D9O A;  4LSZ E;  5CRV A;  3BU8 A;  2OVF A;  4JW1 A;  1V54 E;  2X6H A;  4UUC A;  3ZHE B;  4BX9 A;  4EQF A;  3TXM A;  5CEC B;  2EQX A;  3Q49 B;  4L1B A;  2Y0B G;  3CK7 A;  3KAE A;  1S63 A;  3UI2 A;  4YDO A;  4Q94 A;  3LJN A;  1JWF A;  3PVL A;  3U66 A;  2WQ7 A;  3CHO A;  1NL4 A;  3E34 A;  3AS5 A;  4G1T A;  4OYS A;  4JB8 P;  2NC9 A;  4IYP A;  4N5Q A;  1WDY A;  3T8M A;  4AXH A;  4GZ6 A;  5FQ6 A;  2WXF A;  1OWL A;  3LVR E;  3EDT B;  2X6K A;  3HIZ A;  1WAO 1;  3SD5 A;  5KCM A;  2HE0 A;  1TR4 A;  4JVS A;  1JCR A;  1IHB A;  2AXZ A;  4CYM D;  4GZ3 A;  3BEE A;  1JUQ A;  1SZA A;  3EIQ C;  5ENO D;  3E33 A;  3CR3 A;  1BPO A;  2ZU6 B;  5AJD A;  3FTZ A;  4FJZ A;  2ETB A;  1N11 A;  5FZS A;  3SFZ A;  3PUJ A;  2VTB A;  1N0Q A;  2GRP B;  3MYV A;  1HZ4 A;  5JHB A;  3JQ0 A;  4GU5 A;  4QQI A;  4J8F A;  3KEZ A;  4F3V A;  3HXF A;  2MOW A;  2P9P G;  3LDZ A;  3TL5 A;  4U0Z A;  3UIP C;  3PDN A;  4JL0 A;  3L6A A;  4DJA A;  1FVF A;  4HRM B;  4DI4 A;  2XEN A;  4AV7 A;  4FLH A;  3LKU A;  4AIF A;  5JMN D;  1N54 A;  3UM3 A;  4UQY A;  3SGH A;  3AG4 E;  4YDY A;  3QK0 A;  3CHQ A;  2DWZ A;  4U07 A;  1SW6 A;  2CG2 A;  4K5C A;  3UUX A;  2WXG A;  1ELR A;  3EHM A;  2A5U A;  1H6P A;  1EDU A;  3D9M A;  4AM9 A;  3G2W A;  2PM6 A;  4UQZ A;  5C2Y A;  2BKG A;  2XEV A;  4C0M A;  4GTV A;  1MX2 A;  4EEC A;  2B6C A;  4RQI A;  3EU9 A;  3L16 A;  1E8W A;  4HLL A;  4KT6 B;  2QY7 A;  5EN5 D;  4DLO A;  5A23 A;  5HI7 A;  3RIB A;  4U0U A;  5JJ7 A;  2QC9 A;  3ASO E;  2CFZ A;  3MKR A;  2Y69 E;  3UT4 A;  4HB5 A;  4E6H A;  2A4Z A;  4N39 A;  2V5Q C;  2RFM A;  4BET A;  3CVU A;  3D3M A;  4Q96 A;  4TV3 A;  4F6R D;  4I6J A;  4FP7 A;  3QAQ A;  4HLE A;  1OWP A;  5JJT A;  2CHX A;  2ILR A;  1IXV A;  2NXP A;  2R2L A;  3CIA A;  4GA2 A;  3TWS A;  3QB2 A;  1OCR E;  5AYW D;  5HKP A;  3MV2 B;  2RFA A;  2EIJ E;  2NYJ A;  4NIK A;  4N3A A;  3CKB A;  3U3W A;  5M72 A;  2EIN E;  3ZN3 A;  1Z3Y A;  3Q9N C;  4JHJ A;  3FHE A;  1E90 A;  2C2L A;  3MKQ B;  5LCW C;  3TG5 A;  2XGM A;  3D9K A;  3LY9 A;  4K5A B;  5J90 A;  4UI9 J;  3ZHE A;  3R7Q A;  4LCT A;  4I1A A;  3WG7 E;  2ETA A;  3CVN A;  3FH7 A;  3HVE B;  4IUL A;  1FVH A;  3TWU A;  1WG0 A;  3ML8 A;  3ZEF A;  4LRZ A;  3OAW A;  1LTX A;  3PH0 C;  2KXP C;  5CCM A;  3TWT A;  3S7D A;  3RRN B;  4BEP A;  3ABL E;  3B13 A;  3PS6 A;  2ION A;  3NOC D;  3PNT B;  1BU9 A;  3UT8 A;  2X38 A;  1ZB1 A;  3T8K A;  4A3T A;  4FA6 A;  2CHZ A;  3EUV A;  1BI8 B;  5ENP D;  4HS2 A;  3ZFW A;  1HX8 A;  1JCS A;  4O6F A;  5EX0 A;  2L0T B;  4C9B B;  5AQA A;  3U64 A;  5KJN A;  3VTY A;  3LS8 A;  4GTR A;  2XEH A;  2BUG A;  3C5R A;  3RAU A;  4G8L A;  2NSZ A;  3KEA A;  2KZT B;  3AAA C;  3QWW A;  3ASN E;  4XZ4 A;  1TN7 A;  4CDM A;  3NZS A;  1TNO A;  4CT4 A;  4EBA G;  5HQ8 A;  2XCC A;  5JHA A;  3PZ1 A;  2YQ8 A;  1K3Z D;  3MEK A;  1OUV A;  2A5E A;  4UQX A;  2HYZ A;  4C0E A;  4JXT A;  5FZQ A;  3NBN B;  3RO3 A;  2WXQ A;  4LEU A;  3D9N A;  5E75 A;  4HFG A;  5BNW A;  3IEG A;  4U8V D;  2LO6 A;  4AEZ C;  4HOT A;  3DST A;  4U96 D;  3K9I A;  3UPV A;  3JUE A;  4DK5 A;  3LPZ A;  1UG3 A;  4LNG A;  4YND A;  5BXU A;  2R03 A; 
#chains in the Genus database with same CATH homology
 3GZ2 A;  3LY8 A;  4HVB A;  5LCW J;  5KJM A;  3EIJ A;  2RD0 A;  3FTS A;  2UY1 B;  2J07 A;  4ANV A;  3D9O A;  5A7D B;  3ASF A;  3IHV A;  2VGX B;  2FEZ A;  3FTY A;  1HG5 A;  4WAF A;  4I6E A;  5FJY A;  2OVF A;  4GML A;  4QFV A;  4XIF A;  4Y6W A;  4JW1 A;  5DIZ A;  2X6H A;  1DNP A;  2PZI A;  3ZHE B;  4BX9 A;  2KM4 A;  1KT1 A;  2AXV A;  3DBS A;  4EQF A;  3TXM A;  2YHE A;  1EYH A;  3ZYL A;  4CGV A;  2V0P A;  1PY1 A;  3S7J A;  2EQX A;  3Q49 B;  4L1B A;  1EF1 C;  3R9A B;  3CK7 A;  3KAE A;  1GW6 A;  4NUR A;  5BW8 C;  3FFL A;  2AXU A;  1Y8M A;  3QOU A;  4Q94 A;  3GZ1 A;  4L2L A;  5E76 A;  4PS8 A;  2IOL A;  3T5X A;  1JWF A;  2FF4 A;  1UW4 B;  4M3O A;  2IF4 A;  3FUL A;  3G2U A;  3PVL A;  2JEK A;  4A3V A;  3U66 A;  2WQ7 A;  3CHO A;  2OOE A;  2C0M A;  2R17 C;  1E8Z A;  3KD7 A;  2VSX E;  3AS5 A;  4WWP A;  3TGO A;  2E2E A;  5EX3 A;  4G1T A;  4OYS A;  3I4R B;  2NC9 A;  4FUL A;  4RG9 A;  4MKT A;  4V3I A;  1H19 A;  3BG0 B;  4IYP A;  3T8M A;  4AXH A;  4GZ6 A;  3ZIM A;  5FQ6 A;  4AOF A;  2WXF A;  1OWL A;  4CGW A;  3MZL B;  2LSV A;  3LVR E;  1OWO A;  3N71 A;  3L13 A;  4JA9 A;  3SI5 A;  2JLB A;  3LEW A;  3WXX A;  1H2T C;  2FUL A;  3EDT B;  2X6K A;  3HIZ A;  3UQ3 A;  1WAO 1;  1MQS A;  2VGY A;  3SD5 A;  3NF1 A;  4OVV A;  2KCL A;  3HYM B;  5KCM A;  5C1D A;  3CEQ A;  1U3C A;  1NA3 A;  2M63 A;  2J4D A;  3ULQ A;  4JVS A;  5FQ8 A;  5AIJ A;  1HG2 A;  3Q4A B;  2AXZ A;  2WPV A;  3SF4 A;  5FWQ A;  4GZ3 A;  1QZ2 A;  3BEE A;  2VJ8 A;  3AS4 A;  5G2N A;  2KCK A;  1JUQ A;  1SZA A;  4FC8 A;  4I2Z A;  1U3D A;  3EIQ C;  1ELK A;  2DIW A;  3URZ A;  2PQN A;  3RK6 A;  3CR3 A;  1BPO A;  2VSY A;  2ZU6 B;  4NAC A;  5AJD A;  3FTZ A;  4I9E A;  1IQU A;  4L23 A;  2WXO A;  3SNX A;  3MJW A;  2WXM A;  2DBA A;  3I3N A;  4ANX A;  4K03 A;  3QC1 A;  1SZ9 A;  4BTA A;  4N2S A;  4WNG A;  2WXH A;  4FJZ A;  3FUN A;  5JJ6 A;  2XPY A;  5FZS A;  2XGS A;  3SFZ A;  3NZU A;  4FLB A;  3CK9 A;  3JCK C;  2FBN A;  3PUJ A;  3ESK A;  4WUY A;  3TJP A;  2VTB A;  1HF8 A;  1XNF A;  2V4L A;  1PC2 A;  2Y3A A;  4JEU A;  5CMW A;  2P58 C;  3FUD A;  3CVY A;  4GZD A;  5LX8 A;  3VLF A;  4GA1 A;  4J8D A;  3MYV A;  4UWF A;  4GA0 A;  2XCB A;  1JPL A;  3QKY A;  3UX4 A;  3VLD A;  3AU5 A;  3R7R A;  4DLQ A;  1HZ4 A;  4H7Y A;  2AVP A;  4P29 A;  2PL2 A;  1UJK A;  5JHB A;  1P5Q A;  3JQ0 A;  4APO A;  4KYO B;  4Y6C A;  3AS8 A;  4GU5 A;  3MV3 B;  4ANW A;  4J8F A;  3KEZ A;  4F3V A;  4GCN A;  1JWG A;  4EPZ A;  3JQ1 A;  3OXG A;  3FU5 A;  2MOW A;  3TAX A;  4UWL A;  3CV0 A;  4APF A;  2Y4U A;  4G25 A;  3LDZ A;  3TL5 A;  3MKQ A;  5A6C A;  3FUJ A;  2IQC A;  4U0Z A;  1TJF A;  5G05 J;  4HOS A;  1E7U A;  1WY6 A;  3QWP A;  1SQM A;  4G24 A;  2X6J A;  3JYS A;  3PDN A;  4IRU A;  4N2Q A;  4JL0 A;  3L6A A;  2OND A;  3FDH A;  4DJA A;  1FVF A;  2WMO A;  3L54 A;  4DI4 A;  4UI9 C;  1H6K A;  3MA5 A;  4B94 A;  5AEN A;  4AV7 A;  3I5P A;  3RRM B;  5BV0 A;  1ZBP A;  4J8S A;  4FLH A;  4JC8 A;  3QAR A;  2XQ0 A;  3LKU A;  5KJK A;  1Z3X A;  3HVE A;  2VGX A;  5FZR A;  4AIF A;  3RRU A;  3VTX A;  3CHP A;  4RVB A;  3FUF A;  3L22 A;  4IN3 B;  1EPU A;  1N54 A;  4A1G A;  3NQP A;  4I9C A;  4UQY A;  3PE4 A;  3SGH A;  2Q7F A;  2I2O A;  4G26 A;  1HO8 A;  4JHK A;  3QK0 A;  4D10 C;  3MCX A;  3CHQ A;  4TRQ A;  4OVU A;  5EDS A;  2RG8 A;  3ML9 A;  1E7V A;  4U07 A;  2CG2 A;  3UUX A;  1HXI A;  1NZN A;  2WXG A;  4GYY A;  3RKV A;  1ELR A;  3EHM A;  3FUM A;  3FUH A;  3EHN A;  2A5U A;  3HDX A;  4U04 A;  4KVO A;  2V5F A;  4XKB A;  3CGH A;  1EDU A;  3D9M A;  4ATG A;  5D0Q D;  5ARG A;  1L5J A;  3FH5 A;  3FTV A;  2KCV A;  2X6F A;  4RSY A;  3E4B A;  4BWR A;  3FTX A;  4GAA A;  5CMY A;  3G2W A;  1B89 A;  2PM6 A;  4I1O B;  1TJC A;  4AM9 A;  4UQZ A;  4ANU A;  5C2Y A;  4CDR A;  2XEV A;  4L2Y A;  4C0M A;  3LCA A;  3L17 A;  4B8A A;  2VYI A;  2IJG X;  4EEC A;  1OWN A;  4BT8 A;  4L7T A;  5T8I A;  4UI9 K;  3L16 A;  1E8W A;  4KT6 B;  2CHW A;  2QY7 A;  2WXR A;  2IU1 A;  2XPI A;  1E8Y A;  4N5C A;  4F7A A;  4DLO A;  3PRE A;  3CVP A;  3APC A;  1IYG A;  2DCP A;  2GGF A;  2L6J A;  5A23 A;  4UWK A;  5HI7 A;  3P2B A;  2LNI A;  4HXI A;  4U0U A;  1HS6 A;  3RIB A;  5JJ7 A;  4I43 A;  3U4T A;  3ZYK A;  2CFZ A;  2AWI A;  2WXI A;  2LSU A;  3ZVV A;  4B0Z A;  3CVV A;  4EZL A;  3MKR A;  2J9Q A;  3FU3 A;  5ANR A;  4AY5 A;  2KZT A;  3UT4 A;  4E85 A;  4U63 A;  2PQR A;  2Y4T A;  5BV1 A;  1LF8 A;  5G55 A;  4E6H A;  5LOZ A;  3KS2 A;  4PUC A;  3ZYQ A;  2A4Z A;  4N39 A;  4KZ0 A;  1ELW A;  2YNQ A;  3APF A;  4NQ0 A;  5G04 C;  3B7T A;  5T3R A;  2PM7 A;  4BY6 A;  3FEX A;  4BTB A;  3O48 A;  1OWM A;  4RG6 A;  1YA0 A;  3ESL A;  2GRL A;  3S2A A;  1NA0 A;  3D3M A;  3CVU A;  4Q96 A;  4TV3 A;  1W3B A;  1HE8 A;  5LFA A;  2L9B A;  2J09 A;  2OV8 A;  3LXU X;  4I6J A;  4FP7 A;  4I2W A;  3QAQ A;  3FWV A;  1OWP A;  2HO1 A;  3CHS A;  4CEM A;  4HLE A;  5JJT A;  5BUZ A;  2OVB A;  3SHF A;  4MLP A;  3FP3 A;  4A1S A;  4U8H A;  2WXJ A;  4XI0 A;  5BT1 A;  4HOR A;  4HOQ A;  2CHX A;  4GCO A;  4UWG A;  1KLX A;  3CKC A;  2ILR A;  3JUI A;  1DVP A;  1FCH A;  2BF0 X;  3SZ7 A;  2NXP A;  1E8X A;  2WXK A;  3CIA A;  3D9P A;  4GA2 A;  4GMJ A;  4LUN U;  3ONL A;  4KVM A;  4AJW A;  2I9C A;  3QB2 A;  3LY7 A;  3QWV A;  2VTB B;  5AYW D;  4JHR A;  2GRM A;  1MHQ A;  1QQE A;  2GW1 A;  3AU4 A;  3MV2 B;  2CFU A;  4FU3 A;  4N3A A;  4J6I A;  1IQR A;  3CKB A;  2J08 A;  3U3W A;  2X6I A;  3OTN A;  2L0I A;  3CQC B;  4GYO A;  5M72 A;  1INZ A;  1UJJ A;  2VSO E;  3BG1 B;  3CHR A;  3LYA A;  4XX5 A;  2HM8 A;  3D9J A;  3ZN3 A;  3G2T A;  3GW4 A;  4CRW A;  2WXP A;  3ZGQ A;  3Q47 B;  5CHE E;  4FHJ A;  3FTU A;  1Z6T A;  3IKO B;  3ZYM A;  1Z3Y A;  4H7X A;  5FT9 A;  2R5S A;  4KXK B;  4GZC A;  4XKC A;  3CVL A;  4ILG A;  4WWO A;  4B89 A;  4DI3 A;  3ZRH A;  2UWJ G;  4JHJ A;  3FHE A;  4KBQ A;  1UN8 A;  4EBA A;  5KJL A;  1E90 A;  2C2L A;  3MKQ B;  5LCW C;  3TG5 A;  2XGM A;  2LAH A;  2UY1 A;  4JPS A;  5J08 A;  3IBE A;  4G23 A;  2I6H A;  2LAI A;  2AW6 A;  3D9K A;  1N52 A;  4N3B A;  3L08 A;  2MRI A;  3LY9 A;  3C98 A;  3PZD A;  3CVX A;  2I1J A;  3FUI A;  3HHM A;  4JZY A;  1H0A A;  4UI9 J;  5J90 A;  3ZHE A;  2KAT A;  3ZXS A;  1QNF A;  4K0R A;  1ZU2 A;  4GB9 A;  3FTW A;  4DPR A;  2X3M A;  5ARF A;  3R7Q A;  4LCT A;  4I1A A;  2E0I A;  3CVN A;  3FH7 A;  4GPK A;  2XRY A;  4ME2 A;  3S7F A;  3HVE B;  4IUL A;  1FVH A;  3UT7 A;  3OXL A;  2WXL A;  3ML8 A;  3ZEF A;  4BSX A;  4LRZ A;  3OAW A;  5FQ7 A;  3P1U A;  3PH0 C;  4GZ5 A;  2YHC A;  4EZJ A;  3LVQ E;  3CQG B;  2MHK A;  3PE3 A;  3PUK A;  4AP2 A;  5CCM A;  2XPZ A;  2XHE A;  3S7D A;  3GYZ A;  4UWH A;  3RRN B;  3S7B A;  3FY4 A;  3B13 A;  2WQH A;  3ZPJ A;  3CVW A;  4CCA A;  3PS6 A;  3PEV B;  5BPP A;  2ION A;  4MRU A;  1H2U A;  4PH4 B;  4U0S A;  3PNT B;  4HOU A;  2WQ6 A;  3I4G A;  3ONK A;  3VLE A;  4JA7 A;  2R59 A;  3IHY A;  4XI9 A;  4ABN A;  3UT8 A;  3FU6 A;  5EKQ D;  2X38 A;  1X5B A;  1HH8 A;  3DPD A;  3LJ3 A;  4EZK A;  3ASH A;  3SBT B;  4A3T A;  4LER A;  3B7R L;  4FA6 A;  4GYW A;  2CHZ A;  4FHK A;  2VQ2 A;  3FU0 A;  4I1M A;  4YVO A;  2IFU A;  4CT0 A;  1XGW A;  3T5V A;  4XE0 A;  2BTD A;  1HFA A;  1IHG A;  4HS2 A;  3ZFW A;  3U9W A;  1HX8 A;  3MX3 A;  4MS6 A;  4O6F A;  5EX0 A;  4R7L A;  5FTP A;  3PRZ A;  1TEZ A;  2FI7 A;  3RO2 A;  4AVX A;  2L0T B;  3FEY A;  3Q15 A;  3FUE A;  1NP7 A;  4C9B B;  4I17 A;  5CCL A;  3U64 A;  5KJN A;  2J49 A;  1H2V C;  4WNF A;  3VTY A;  3RU0 A;  3LS8 A;  3G2S A;  3PEU B;  4PDX A;  1WM5 A;  4FAD A;  5LP0 A;  4Q69 A;  2J4B A;  2HR2 A;  3PNL B;  4ACK A;  2BUG A;  2FO7 A;  3CK8 A;  2NSZ A;  3ENE A;  2WVI A;  5ANL A;  3D9L A;  2KZT B;  3CLJ A;  3UMV A;  4ACL A;  4N3C A;  3OXF A;  3QNK A;  3QWW A;  4J8E A;  3IV0 A;  2WM9 A;  3MGB A;  4XZ4 A;  2XRZ A;  3QJZ A;  4CDM A;  5AJL A;  1Y6I A;  3ZW3 A;  3NZS A;  3TG4 A;  4WND A;  5G04 J;  3CVQ A;  4NRH B;  4G2V A;  4WWN A;  2YIN A;  2V8S E;  4CT4 A;  4EBA G;  4B8C B;  5HQ8 A;  1E96 B;  1KT0 A;  2WB2 A;  3SBS A;  2XCC A;  3B7U X;  5JHA A;  1S0P A;  5D0O D;  4J0U A;  2YQ8 A;  3D9I A;  3Q5M A;  4A55 A;  3MEK A;  4BFR A;  3CST A;  4KZC A;  1OUV A;  4KMO A;  4W9R A;  4AY6 A;  4ILI A;  3APD A;  3RJV A;  2QFC A;  4BX8 A;  1A17 A;  4UQX A;  2HYZ A;  4G11 A;  4JXT A;  5FZQ A;  4C0E A;  3GZS A;  4F1S A;  4CDN A;  2C0L A;  3B7S A;  3RO3 A;  5G05 C;  4PS7 A;  2WXQ A;  4LEU A;  3CSF A;  4URK A;  2VSN A;  4ILH B;  3D9N A;  3TXN A;  5E75 A;  2I1K A;  4HFG A;  5BNW A;  3EJN A;  4YVQ C;  3FH8 A;  3IEG A;  2LO6 A;  4AEZ C;  2CG3 A;  4HOT A;  4WNE A;  4PS3 A;  3K9I A;  1HU3 A;  3ASG A;  3G2V A;  4I6G A;  3UPV A;  2WMN A;  2IOS A;  4JEH A;  4F53 A;  3ASD A;  4DK5 A;  2XGO A;  3QDN A;  3LPZ A;  1PAQ A;  3CHM A;  1UG3 A;  3FUK A;  4BT9 A;  4TUU A;  5ENN A;  3O4Z A;  4YND A;  2KC7 A;  1UN9 A;  5DBK A;  1VDY A;  2WXN A;  5T4Y A;  5FQ4 A;  4FJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...