4YVUA

Crystal structure of cota native enzyme in the acid condition, ph5.6
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
510
structure length
506
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of CotA laccase complexed with 2,2-azinobis-(3-ethylbenzothiazoline-6-sulfonate) at a novel binding site
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Oxidoreductase
molecule keywords Spore coat protein A
total genus 152
structure length 506
sequence length 510
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA02
2VSMB 2DYRB 2IWKA 4GY4A 2YAEA 3FU7A 3WIAA 1TU2A 2BP0A 3DIVA 2TSBA 2ZONA 2QDVA 4QLWA 7PCYA 1URIA 4DPCX 3PPSA 1NPNA 4GP5B 1AS7A 1JZIA 4KNTA 1J5CA 3FSVA 1RKRA 2ZOOA 1T5KA 2VMJA 1AG0A 1TEGA 4HCGA 3U25A 2JKWA 3NSFA 4A2FA 4AI7A 1KBVA 1JZJA 3H56A 3T9WA 1SNRA 5EHFA 1CURA 4F7KA 3GXUB 1IKOP 2DWTA 3C75A 1MZZA 4BK5C 4YVNA 2OV0A 1OE3A 4FAAB 2GBAA 3NYKA 4DP8X 3ZIYA 1E65A 4KO7A 1L9QA 1JXGA 4KO5A 2X88A 4NERA 1WA1X 4FA7B 5LDUA 1CYXA 2JXMA 1WA0X 1E5YA 1WS8A 5I6NA 2J56A 2VM3A 3NJJA 1E67A 4DP1X 5F7AA 3UAEA 1W8EA 3TASA 2IWFA 2PP8A 4JHVA 1BYPA 1L9OA 1NICA 1PLBA 2I7OA 4DP9X 3T71A 3IN2A 2DYSB 1PZCA 3KW7A 2IDUA 3NJHA 2VM4A 2IDTA 3DTUB 1XB3A 5I26A 1NIDA 1PLAA 2DY2A 1M57B 2I7SA 2H47C 3T6WA 3CG8A 4GP4B 1AACA 4TXVB 2PPAA 5AFAA 3OMIB 1AIZA 4YSDA 4HAKA 3NJLA 3UACA 1PZBA 4ZK8A 1TKWA 2IH8A 1MZYA 1ID2A 4E9TA 2FQFA 1AANA 4E9QA 3X1NA 1EZLA 1KDJA 4KNSA 2XXGA 3GYRA 2E86A 2AFNA 4WTQA 1F56A 3ASOB 4Q89A 2EILB 1B3IA 2GIMA 2XX0A 3IN0A 2NRDA 4YVUA 1BAWA 2FT8A 3PCYA 3QJUB 4ENZA 2BP8A 1PLCA 2H3XC 2BP0B 1PNCA 2CAKA 2HRGA 3NJNA 5I5IA 5I6KA 2AVFA 1N68A 5ANHA 1JZEA 3BQVA 4YSTA 3D12B 5I6PA 5B3SB 1BQRA 2FWLB 1CUOA 3EF4A 4AX3A 4DP4X 3EH3B 5B7EA 3ZX1A 2BWIA 2YQBA 2XV3A 1E30A 2IH9A 1SFHA 1N70A 4Q8BA 1IBYA 5B7FA 1JOIA 1JVLA 4BDVB 2MTAA 2GI0A 3X2QB 3X1GA 1SHWA 2XV0A 1A3ZA 3CVCA 3FSAA 4UF7C 3CVBA 2CUAA 4GP8B 3AG2B 4L0PB 3SBRA 2YXWA 1NIFA 2YAPA 3NJGA 4JKNA 3QJVB 4DP5X 2XYBA 2XU9A 2CJ3A 1DYZA 4BWWA 1A4AA 3TU6A 5B1BB 1IC0A 2VSKB 1J9SA 1MG2C 2DWSA 4MFHA 3UABA 4E9XA 1X9RA 2GC4C 1QHQA 2BZCA 4CSPA 3EHBB 1A65A 1QNIA 1PZAA 3QPKA 1JVOA 3FSZA 4YSQA 2AZUA 1SFDA 3IE9A 1AG6A 5B1JC 3OMNB 4G7QB 1RZPA 1GS6X 2VW4A 1ASPA 2FT6A 1V54B 3FPXA 1V55B 3S3DB 4X4KA 3X1BA 2CALA 4HHGA 1NWPA 2J55A 3NJMA 4A66A 1SF3A 4BWTA 1X9UA 1ADWA 1KBWA 4HIPA 3FYIB 1JERA 1GW0A 3NSYA 1AS8A 4KOCA 3NSDA 1ZDQA 2GB2A 3FQ2A 4G7SB 1KCWA 1A8ZA 2FTAA 2EIJB 5B1JA 3S3CB 1YLBB 2HXAA 1L9TA 2EINB 3SQRA 4BXVA 1UATA 2BP8B 3NJFA 3RYMA 1OCOB 1NIAA 1AQ8A 3OMAB 3ABLB 1WA2X 2VW7A 1DZ0A 3N2JA 1ZIAA 4W1TA 2P80D 1JZHA 1ZDSA 1W6WA 4KOBA 4N4YB 2XLLA 3FQYA 4DPAX 1KGYE 4BDVA 2WO3B 2BW5A 4E9YA 3FT0A 4A2HA 1HFUA 3GDCA 3FU9A 2FQEA 2P80A 1A4BA 4BWUA 2QT6A 1ZIBA 3S8FB 2UX7A 2GC7C 3OQRA 2PLTA 2QDWA 2J57A 1ZV2A 5TK4A 2UXFA 2FQDA 4DPBX 4EF3A 1ETJA 4A2GA 3NP3A 4GXFA 2B08A 3T6XA 3V9CA 3DKHA 1J5DA 1SDDB 2B3IA 1ILUA 2R7EA 6PCYA 2XUWA 3MX0B 5B1AB 3WG7B 3FU7B 4KO9A 1GR7A 1M9WA 5FC9A 3AY2A 2XV2A 2EIMB 2W88A 1MDAA 2YXVA 3TA4D 2N0MA 2YAHA 4K9JA 3ZBMA 1FFTB 2HLEB 4N8UA 4PCYA 4UAHA 2PPDA 2Q9OA 3ABMB 3X1FA 3T6VA 1NIEA 1NZRA 1GY2A 2YARA 4KNUA 3QJSB 2IDQA 2LLNA 2PCFA 2X87A 1EHKB 2HX8A 1SF5A 3AZUA 3QJRB 1SDDA 1ASOA 2HX7A 3JT2A 3PAVA 1PNDA 3NSCA 1GYCA 3ZDWA 1NINA 1KV7A 1ET8A 1KYAA 1AZNA 1NPJA 1ZPUA 3V9EA 4AKQA 4PAZA 9PCYA 4AKPA 4M3HA 1GY1A 1SHXA 3T6ZA 5IY5B 3UGEA 1RCYA 3QQXA 4YSAA 2YAQA 3SBPA 3H4HA 2BHFA 4AKOA 1M56B 1AZCA 3OD3A 2UXTA 3TBBA 4E9RA 2TSAA 3AW5A 3CDZA 3ABKB 6PAZA 3NJIA 1IBZA 1FA4A 1JXFA 1AZBA 2YAMA 5B1KA 1AOZA 2PPCA 2AANA 3AG1B 4A68A 4YL4A 5E9NA 1OF0A 2WSDA 5D4IA 3NT0A 2OJ1A 4DP2X 3CVDA 2IAAC 2UXVA 3FQ1A 3QJTB 1JXDA 4AZUA 3BVDB 4JHUA 1W6LA 1XB8A 2OCCB 1AZRA 1OOWA 2QPEB 2PCYA 5B7MA 5PAZA 1HAWA 1PMYA 1WS7A 5PCYA 1J9QA 2H5UA 4YSPA 1FWXA 1XMEB 4F2EA 3AG3B 1NIBA 2BZ7A 1NWOA 3FSWA 4YSCA 2HX9A 2VN3A 2UXGA 1PY0A 1JZGA 3CDZB 2R7EB 2YAFA 1IUZA 2CBPA 2UX6A 2PPEA 3HEIB 3IEAA 2GHZA 4W9ZA 4KO6A 1GS7A 3WI9A 4DP7X 5D4HA 3JTBA 1BEXA 3PLYA 3WNIA 2Y69B 2PP9A 3NP4A 2DV6A 1BXVA 1L9PA 2BW4A 4A67A 2W8CA 1AAJA 3MBWB 4F2FA 3QJQB 4G72B 4DP0X 2FNWA 4E9WA 1OCRB 2CCWA 3IBOA 1VLXA 2FQGA 4HCFA 1ET7A 2ZWNA 3EH5B 4UANA 5I6OA 1KCBA 1ET5A 3OM3B 2BO0A 4P5RA 5D4JA 1GSKA 1OCCB 4HCIA 2XWZA 5I6LA 1NDTA 3PXLA 4YSSA 1MG3C 4GYBA 2VW6A 1ASQA 8PAZA 2YAOA 1OV8A 3G5WA 4HHWA 2I85A 3TBCA 2A3TA 2IDFA 2J5WA 3ERXA 1XB6A 4G70B 3WKQA 2XX1A 1V10A 1RZQA 3FYEB 1AS6A 4G71B 5A7EA 4E9VA 2WO2B 4E9SA 4P5SA 4NAJA 1A4CA 1CC3A 3PAUA 1AZUA 2Y1AA 2FT7A 1NTDA 2IDSA 5I6MA 2JFCA 3HB3B 5AZUA 4A2EA 1GS8A 2Q5BA 3N55A 2QPDB 1PCSA 3NJKA 3PAZA 4RH4A 3S8GB 2GSMB 5I28A 1CYWA 1WAEA 4BXSV 2HRHA 1SJMA 3SBQA 2BWDA 3ASNB 1QLEB 3CZUB 7PAZA 4YSUA 1E5ZA 3FU8A 1BQKA 4QKTA 3UADA 3KW8A 5I5JA 3X1EA 2EIKB 2MRYA 4CSZA 3WKPA 1BXAA 1J9TA 4WKXA 4G7RB 4NB7A 4M4RB 5I5MA 3FPYA 1I53A 2XXFA 1R1CA 3L45A 1OCZB 2PPFA 5F7BA 2XVBA 4HZ1A 2HZHA 1OE1A 5AKRA 3FS9A 2ZXWB 4DP6X 4A2DA 3EH4B 1JZFA 3UAAA 2FJSA 1BXUA 2AZAA 2RACA 3ABGA 1PAZA 1J9RA 1L9SA 1TEFA 2PP7A 1PF3A 3WNJA 4YSEA 1OE2A 4HALA 1HAUA 1BYOA 1AR1B 1BQ5A 3AG4B 1L9RA 2IWEA 5TK2A 3S3BB 4YSRA 3H4FA 1KDIA 1ILSA 4YSOA
chains in the Genus database with same CATH superfamily
2GQHA 3BH8B 1ZEAH 2YK1H 5JMOC 4AVKA 3ATDA 3QIUD 1S5HA 3G5ZA 1YMMB 3LRSA 4NNYB 4PW3A 1RMFL 2M83A 3QUGA 4NRXA 2JKTM 3MRGA 1EJ8A 1RZIA 4D9QD 4DPCX 2UY6A 1K3ZA 4LSVH 4M1CC 2X6BA 4JFWA 4A39A 3C5XA 4WWKC 3N1MC 4F7TA 1FI8C 2BNQB 3FT3B 3HZ3A 1ZTXL 2JKWA 2DQDL 3FKUS 4L23A 3BKYH 4XPAH 3B2UC 4KV5F 1UT9A 5EO9B 5C08E 4XXWA 4ZOAA 3S2CA 1LEGA 1V8HA 2Q7AA 1T1YA 3U30C 1F41A 4FKHA 3EFFB 4W9EC 2AHIA 4CVZA 3BUTA 4XX5A 2EVJA 1UD3A 4J3XA 1JGIA 4Y19D 4G83A 1N2RB 1YAZA 1WS8A 1ZLSH 4HU2A 4CJ0A 1XH2A 4JG1L 3IJSB 4JFSA 5FA4A 1A3LL 4KK5D 3K3QA 4PLKD 2XTJD 2UY7A 3FCTB 2I7OA 4IGBC 1IAMA 7FABL 1PZCA 5ANMB 1F4HA 3C09C 3TPKA 2Q86B 1FLRH 1GGYA 3ZDYB 1XB3A 2Q8AL 1SZNA 4HEPA 3WTWA 5FCUH 4JO3H 4YL9A 5HGBB 1WFNA 2ENSA 4BGLA 2FNBA 2I27N 2DQTL 1AACA 2JQZA 5A6LA 1PLGL 4JFTA 2K78A 3F00A 3GSUB 3RX9A 3ZL2A 4X0NA 3RVTD 3D2UB 1SJHB 3OAUH 35C8L 3W39A 3TO4C 2EYTB 1A6ZA 2PYEB 2OQJB 2WQ8A 2Y2YA 3NFSL 5DLLA 5HY9A 3RWFA 2HB0A 4ZPVB 2XXGA 1VESA 1YECL 1OP4A 3ASOB 2HAZA 3E2HC 1CR9H 5BV7C 4ENED 3BI9X 1TZOA 4XHQA 1W72L 3KXFB 3ARZA 5FO7A 3BWUF 2AS5M 3HNSL 2EH7H 2BP8A 3JWDL 4WW1A 3T4YB 5C0RL 5BXFB 2VMEA 3MGOA 4PI2A 4LPTA 1FC2D 2YS4A 5TDNB 2VXTH 2B1HL 4Z7VE 3HAEG 4YAQA 1BAGA 1J48A 3MLTA 1EAOA 3O9WD 4MMZC 4NZRL 5DJ2B 3LS5L 1MLCB 2NYYC 1CS6A 2VJXA 4PJ7A 4HFUL 4KK6C 1RZKC 4CILA 3HB3C 3UBGA 1AHKA 2BNUA 4HV8B 5IV2A 1ORSB 1CUOA 4DP4X 2HUHA 3MV9D 4N0FB 1JHLH 2BWIA 4QNPF 1EJOH 2IH9A 4AEIL 1O6SA 4HEPG 1CTNA 5AVWB 5JLZA 5EIIB 4BDVB 5F96L 4J5VA 3M1BB 4M1DL 4OZHF 3BH9A 1NJ9A 3IMTA 1JMZA 4FTVB 1UYWH 1CFMA 4ODHL 4I87A 3S35X 4A7GA 5KBMA 4OF7A 1QNZL 4QYOA 4RZCA 4NQEA 4GXVH 4MB3A 5CIPA 1NL0H 1GIGH 2NY2B 1FZJB 2CJ3A 3QDMD 5D8JL 2L7QA 4HZLB 1G1KA 3CVIL 3FH8A 3OAZK 4LESA 3VMOA 1W0WB 4IRJB 1MG2C 3UCRA 1ACCA 4R26L 3UGUA 2IGFL 2P5ED 1LEKA 2Z91B 1QNIA 2A0LC 3FSZA 4WK2B 2WN3A 1U8HA 1U8IB 3LNGA 5HJ3A 3VD7A 4QO1A 5HGDA 2XPYA 2HWZL 1JGEB 2VXTL 4P46D 1RAMA 2PMZA 1JNHB 1V55B 3PQYA 4Y88A 3RPIB 3HA0A 3HUJE 1IIIA 2J55A 4H4NA 4KRMB 5E9DB 5ERWA 4KZ0A 4ODBD 1E5BA 1IEAB 3NEOA 1UCBH 1M7DB 4TPRL 4X5QA 5FYJE 1EBAA 4A37A 4CGUB 4WDIB 4JVPA 5C0ND 4DGYH 2RA1A 5DURD 1OZTG 3AMKA 2NXZB 4RFEA 5DO2D 1MCOH 2QSTA 4U6XA 4OBRA 4BCZA 2HUEA 4HIQA 3V7MA 4G59C 2WYZA 5TE4H 4ONOA 5GZNA 3B1UA 4PM1A 3MCKA 1XF3B 3MRCB 3BIAX 4MNGA 4NBYB 1GIGL 5E6RB 4B6ZA 1A8JH 2VDKL 3K2UH 4YDJB 5HHXL 3FK3A 2OFQA 4W1TA 5HPMB 2MCMA 2XLLA 1D2OA 3FQYA 3M07A 4HS8H 1E5AA 1WFIA 2BNQA 3FT3A 2AK4D 1TQCB 3CN1A 2ZWSA 3FCGA 3FQWB 1KFGA 2E7CA 2ZX6A 3C5JA 3NDZE 4NCDA 4LQFH 4R26H 2DB8A 1N3NA 2KT6A 1A9VA 1NCNA 1QKZH 2QT6A 3AC0A 1XGUB 4OIAA 1C1EH 1RJZA 2PYFB 3EZ8A 1MVFA 2J57A 3RILA 3PNWB 4NQSA 4PRIB 3T6XA 3LRGA 4HGWA 3BH8A 1JWUB 3KPRA 3SPJA 1BVNP 1JPTL 2Y06L 5G2NA 1SDDB 5JLZB 2XUWA 3TO2A 5FO9B 5B1AB 1JMXA 4OV5A 2WBJB 5CHNA 4EDXA 4LASL 3PS6A 1IVTA 2VDKB 4NUGL 5DF0A 3SBWA 4CSSA 4F15C 3NGBB 2XV2A 4URTB 2HRPL 43CAA 4WWNA 1UA6L 2H0EA 3PGDB 1NA8A 1SHSA 5FKPB 2APXA 4HPHA 2G2PA 1BBDH 3FHEA 1RZIB 4F57L 4LE8A 3N43B 4HUUB 2Z92A 3LN5B 2GSIA 5CEYA 1NCCH 2DYPD 3FFDA 5DQ9A 3K2UL 4XC3H 5HHXH 1NAKL 4FFWD 3DMMC 1KCRH 4U7KA 5D1QE 3VFGH 1HWWA 2CJSA 3AZUA 4J12A 5B8CC 1RU9H 2X4TB 1RULL 4ILDA 4OFDA 5JHLA 4YO0B 4CU8A 3J2PA 3L3KA 4XMWA 5CF3A 2V9TA 4ZS6D 5HYQB 4MJIA 2CK2A 2WWKO 3S4SG 4O2EA 3HTLX 4QHLB 2FHFA 1KYAA 5E4OA 4NZJA 5BQ7B 2ZKWA 1ZPUA 3G5VB 1TLKA 3O6FD 4JY4B 4I0PB 4PAZA 1AGDB 4LLWA 3U9UA 4Q0XL 5GXBB 4HUVB 3GSWB 3EKCA 4JKPH 4RQQB 4NGHL 1MFEH 4NQCB 2P45B 3SGDH 3C60C 3CTTA 1Y07A 1XCQA 1GOFA 3BPLB 3ZYOA 1PY4A 5HGBA 1G6RB 1M56B 1SYVB 2W65B 3UFIA 4BZ1H 2ALWA 4HMCA 4O51B 1ETA1 2BSSA 2NZ9D 1ETZB 2Q86A 3U7WL 3LXUX 4HXAL 1YYMH 4AGLA 4AYFB 1HEJC 2NX5A 3FCUB 4TSBH 3CC1A 4HKXB 4XGZB 4HOMA 5B39B 1DO5A 4U1SB 4YPJA 1TITA 3FQ1A 5D6DA 3ZMRA 1L7IH 3IJ9A 2CR3A 1SM3H 4K94C 4PVLA 4DGVL 2FJGB 1F6FB 3ARED 3F58H 4Y5XB 1KCRL 3QEHB 3KPMA 3L4UA 1HAWA 3Q3GA 3ENEA 3O45B 3S34L 4M4PA 3ZZQA 4GW5B 5CCGE 3NZHL 1WF5A 2JELL 2X7LB 1E8ZA 2ZUYA 3KGRA 4HDIB 1FGNL 4JCLA 3RIFF 3KVDD 3U9UB 5IB2A 1HWGB 2CDGA 2VN3A 3H7LA 2ZOTA 4WFHD 2FIKB 1VENA 1R3IL 3DOSB 5B4MD 1COBA 1OTUD 4MD4A 4HIIA 4ICWA 4WNQA 5DHDA 3GM0A 1I9RL 3MV7D 3FUHA 4JG9A 4TTGA 4QRUA 1QD0A 4PB9H 1UB6A 2IANA 2P47B 3ULUF 4XP9L 2ZSWB 4KXAA 3M7OA 5AG9A 2F1BA 2EYSA 3OZ9H 3SKJL 4UQAA 4NSKA 5E8EA 1T0OA 5IWLC 5L4MA 4WHTA 4Q7DA 4MVBD 2ATPB 5T1LA 5L88L 5ADOH 3T0BA 4M7ZB 4ABQA 5HGAB 1XBRA 4RMVA 4X6EB 3GT6A 3QRBA 3QH3B 4UANA 2KC0A 5I6OA 4XPTL 3QWOA 3V2AR 1J8SA 1S7SA 1P4LB 2EDJA 4P5RA 3O8XD 1W8NA 3RDTC 5HVWA 4LPUA 4LRNL 4PJ9B 4QTHB 1IGJA 3L5JA 1CD8A 4TQEL 5DS1A 5C09E 4QHMB 3VXMD 4FFZH 3GMOA 2DQFA 1ZGLB 2A99A 2Y24A 1DQDH 2Y7OA 4XN7A 4M6MH 3ARFD 4HPYH 1IBDA 3UZQB 2CDEA 2HTLD 2V4LA 4Q74A 4XMLH 4A7SA 4AYMC 2GIYA 1G9EA 4HS3A 3N42F 1DBMH 2WN2A 2KS0A 1ML0A 2LFEA 3QHFH 1V10A 4RNRB 5LCVA 4HULB 3DX7A 2K45A 1FDLL 1KY7A 4E9VA 4I85A 2CO6A 3RWGB 3RX7A 4G1MA 5TH2B 4WCYL 4URKA 2JMRA 2O5YL 1NLBL 3KJ6L 5F88B 4JVUA 4PJEE 5HGDB 2VSDA 4ZW8A 2Z8WC 1GW6A 1KJ3L 4X9BA 5IHBA 4NO3A 4G42B 3VDCA 3QIWD 2VLME 2Z4TA 2R2EB 32C2A 3P9MA 4U4BA 2AC0A 1BF2A 2FEEI 5HJBA 3VAEA 1FQ9C 1NEPA 1WAEA 2ZCZA 5I1DA 3NVQA 4HJJH 4A55A 3C6LA 3TBTA 1FFNB 3UTSE 3RL1B 5E6SB 3EFOB 5BCAA 1P4LA 3FRPB 2C3XA 2D8KA 5EORL 2D9CA 4OCWH 3ZU8A 4JN1L 4RDQG 3WKPA 3ZE1E 5JHDE 4LEEA 3RBGA 2NY7H 1BG1A 4X5XA 1MCIA 1DVTA 4OLWL 5F7KC 1OL0A 5AVYB 2YKKA 1N5YL 4LRNH 1UJ3C 1AKJA 4TQEH 1QSVA 3L45A 1OCZB 5JXEA 3TYGL 5CEXA 1C5CH 1G7QB 5BZWA 1E3XA 4LKXB 4Q6KA 1L6ZA 2GTWB 5MP6H 2V7HB 2YWZA 1B4TA 1BJMA 5TF1H 4LSTL 1SLWA 3NRQA 3MRPA 1UOLA 3T5WA 1W72B 1PAZA 4OW6A 1ZT4B 4N1EA 1CFNA 5DMGC 3FQUB 5C2BH 4NWTL 3IKCA 4YX2H 4HG4K 5I76A 3MOBL 3MGOB 1U33A 1JWMB 4I9WD 4YSRA 3KYMB 4GG6F 1GGBL 1B0RB 3NEEA 4TTDD 3QPXH 3UC0L 1JXJA 4HS6A 2GJ6A 2NCEA 3V0JA 4GG6B 2BY0A 3IJ7A 4QLWA 4HJJL 1V5JA 4TLTA 2AJYH 2ISDA 2PTVA 5FYJL 1ORQA 4KI5C 3U4EA 3OR7B 1TYJA 3S7GA 3TVMC 1RKRA 1T5KA 4N2KA 4ZO6A 3CVHB 1GMIA 1R75A 5IMMA 1T2QL 3CCHB 1KCVH 3CZKA 3F84A 1IT9L 1F4XL 2PCFB 4NYLA 4OGZA 5EDSA 3EADA 5KYXB 3SDDB 1ZS2A 3S8WA 3TC9A 5SWSE 3U1SH 1LHZA 1KCUH 1OGPA 1C5CL 3R06B 4FQQA 1KG0B 3D6GA 4YGVB 25C8L 5LAXB 2OV0A 3MA9L 1L9QA 3DBXB 4MXQD 1MFBH 4X80L 1I1CA 5EU7E 4WFFD 3UAJD 3ZRSA 5K59F 5TF1L 1HZLA 1IC4H 4WW2A 3NJJA 1UACH 1IKFL 3BESR 3KAAA 5FV1L 1F13A 5L9DL 4J3VA 3LIZL 3KM1A 2Q3ZA 1JXKA 2XZZA 3C8HA 4YHKL 4Y4KC 3VW3L 1JJUA 1M9SA 3RPKA 4RSVA 5GGRA 1MAML 4JPWL 2QHRL 2X09A 4LARH 1LL1A 2DQIH 5I16B 4BE5A 2VH5H 1GGBH 2UZXA 4JY5L 3BGAA 5AYUH 4XOCA 4ACPA 3FTGA 1A6UL 3DXAA 5ABAA 4B60A 3EXJA 2RFXB 4NQCD 5T3ZD 5CS7A 2FUTA 1JN6B 4LVHB 2FE0A 5JIHA 3NACH 2WXQA 4PJXA 1YQVL 5AOLA 2APWA 2IGLA 1PZBA 1R24A 2IH8A 4H1LB 3R19A 2P46B 1BOYA 5E6ZA 5FUOL 4BRVA 1TVBB 2CLVB 3GXIA 2VTFA 5LQBL 1S7VA 5FHBL 3GYRA 5ICXB 2JCCE 5D7LB 3F2LA 5CJ8A 1QLEL 2HJFA 1CT8A 4MTMA 1ZHKB 1NCGA 2OMWA 3GHEH 5BOZG 4TSCH 1T22A 3FZUD 5IR1B 1K3IA 2EXSA 1RJLB 1PS3A 5DD1L 1RURL 5AAWC 3THMH 3EJRA 1QVOB 3CLEL 5AWNH 4FEMA 1J1OH 3BZ5A 3WNPA 1TSHA 2MJWA 3O6FB 3PUCA 1FO0B 2ERJB 4FC3E 4U1MA 3H9ZA 4UTCA 1CFBA 3EBIA 2XVGA 2ZSWA 5JIIA 2E27H 1Y7VA 4R84A 3MRLB 4BFFA 1F0LA 1GPOH 5DUML 1A14H 5C0BD 2WWMC 3L81A 3BO8A 3QUZD 4PN6A 2BS71 3ME0B 4M02A 4AX3A 2OZNA 3VI3E 2VAAA 4ZMXA 1T0MA 2WXJA 1XF2B 3DC0A 1J8HE 4K94H 3S4SA 2GI0A 3RJOA 1WZMA 1FNLA 4UF7C 2VWEE 1QW8A 1UXSA 2EXYC 1MFMA 2OSYA 5FA3A 5INCB 1U8NB 4DP5X 4L8DA 5HVHC 1QFWH 1OTTC 5BOPA 4NKIL 2XN2A 3Q2NA 4XBPA 5FHBH 5GGSA 5F44A 3L08A 4L1HA 1KN2L 4IRSA 4IU3A 5EC1B 3B83A 5FW7A 4P5TB 2ODHA 1YMME 4TSCL 1Z5YD 5C0JB 3MLZL 2DLFL 3IDMA 3OG4B 4FG2A 4TNVK 3V0EA 1D6EB 1PZAA 3D34A 4PJ9D 4PWJA 4YSQA 1SFDA 1IAIM 3WDJA 4GAGL 1VCBC 4S2SB 1IL1A 3N04A 1AHWB 3MNZA 1LO5A 3Q8CA 2B9AA 2CALA 4EN3C 1DEEB 1KJMA 4N9GB 4OR1A 1UM6H 2X4UA 4R4NC 5F2FA 4CADA 1TZIB 5F7HA 2R1XA 2Z34A 3VWKA 4LU5H 2YWYA 2JJTC 4KOCA 4G80B 4PS7A 1ZK5A 4MA1C 1IQDA 4FXTA 3EJYD 5DEZA 3KZ8A 3GSVA 2BJMH 3S3CB 1YLBB 4JJHA 1RZ8B 3JTSA 5ELIA 4Z76B 2ESVD 3OLGA 1VHPA 3ZHLA 1SXAA 3SQRA 4HSQA 2NXYB 2PR9A 1R3HA 2QVTA 1J5OL 4F91B 4FG6D 2FECL 2ZX7A 3N2JA 3IGKA 4Q9QH 1N6QH 5ANME 1G9NH 1DQLH 1ORQB 1JZHA 1ZDSA 1W6WA 1E4XH 3CQFA 4RAVB 5E8NA 1X6LA 1KGYE 5A2JH 3FB7B 3S98A 4H26B 2BNRD 3MROA 4BDVA 3ARFB 3JUZA 5ESQA 5K39A 3G5XB 3FT0A 2OJEA 5KN5A 4OZGF 2NUTA 4PJHE 4TMPA 2DMKA 4B7LA 1JWSB 1ZV2A 4GAGH 4O00A 1Z2KA 2F19H 3QUHA 1N7MH 4JHZA 1RZFL 1IC7L 1XEUA 2XTSA 3V9CA 1EEUA 2B08A 2DWDA 1KLFA 2UYLB 1CFNB 3C5SA 1ZLWH 3EJCA 2X4NB 3DYMA 1DCLA 2VDMB 1DQKA 2OM5A 1XD1A 1GR7A 2YFOA 2NY1B 1E9OB 1SXSA 2L04A 3HRPA 2EIMB 3CH1A 2R2BB 3M17B 3VSUA 1LE5A 3UJIH 1JNNH 2A9AA 3GSWA 1HQRB 1HNYA 4ZUUA 2VL5A 3U0TA 1TETL 2A1WL 3IDNA 3F04A 1ZSDA 1YG9A 1TCRA 4O9HH 4OGAC 4XZ4A 4ADIA 5BS0A 5C9JA 4LB8A 4XC1L 3ULVE 3W39B 2A9NH 2HT2C 1VADB 1J5OH 3FH7A 5JIQA 1BECA 2ESVA 1Z9LA 1ZA3B 4G9FE 5IIEB 1G9NL 3L54A 2NNXA 4P2QA 1HILA 2G75A 2DYPA 3I75B 4PJCA 5T3ZL 5KSVA 4MA8L 4MMYB 4NO0D 4Z7WF 3UPCA 5DD5L 1F90H 2HG5B 4E41E 3H3PL 2BM3A 4FQJH 5IQLA 3ZPDA 2OI9B 1LILA 3PE9A 3C6LD 4U6XB 4G5ZH 4PBVC 1DVZA 1W91A 2TAAA 4XZUA 3S2AA 4JLRA 1NPJA 1MRFH 1PD6A 5E24E 5T1JA 4OM1H 2X1WL 3HC2A 2EABA 4OGXH 5J6HA 4POUB 3EJSA 3QQXA 5E7BA 3ZUCA 3DX7B 4B0MB 1FAIH 2X4QB 3BZ4A 4GMSH 4AM0Q 2AJSL 2FWOB 3SEPA 1SOSA 5C86A 4UYQA 5KJRH 4YWGL 1CFTB 3NJIA 1PKQB 1Q8MA 2YAMA 3NBNA 3QYCA 3C60B 2B59B 4XR8C 1QLRA 3QR2A 1HL8A 1LD9B 4DAGH 1SYSA 5SWZE 3RURA 2JLPA 3FF7A 1FFOB 3BW9B 3QFJB 3Q8AA 3RJQB 4B27A 3BUPA 1ZVSB 4J4PA 4OLZH 4XC1H 3QZOA 3CGTA 2SEBA 4WK0B 4HPOH 3W9EA 4A7UA 3IJ8A 1W6LA 1YC7A 3OXSB 3TJEH 4JUTA 4MZIA 2QPEB 1RD6A 1IBGL 4OZFH 3VG0H 1RK0B 2DJUA 4BHUA 3S96A 4J3OG 4XZUB 1KTLA 5TQ2L 2H3NA 2NPLX 4F2EA 1YYLH 4MJ6B 5BV7B 1ND0B 4PRNB 5JW3H 2IGFH 4U1IA 5E2TL 5AVSB 4ODVL 5IHHA 1MJ7H 1GZHC 2UXGA 1U58A 1ZLWK 5A3IC 4X6DA 3CDZB 3QORC 3P40A 3MRHA 4LMQI 4M6OH 5JNYA 4DQOL 2VLMD 3SYOA 4F9LC 3MRRB 3V4UL 4EIZC 3Q5YA 1S9XA 1TTAA 3TEZA 4I89A 4UDTA 1KZQA 7FABH 2Q0ZX 3QXAA 1PCXA 1KCSL 2ATKA 1FHGA 2DDQH 5CN1A 3UP6A 4M93C 1ZHLA 3RL2B 2FEEL 3WFEL 3SKNB 3OKMA 1NANH 4EZMA 2VKXA 5D7JB 3ARPA 4BA8A 1KELH 3QUZB 4PR5A 1VJSA 1P9MC 2FNWA 4UMGA 3W11D 1BZ7B 3AM8A 1JGDA 5DQDL 1OK8A 3O4LA 1VLXA 4LHUA 5JYMA 5GRWA 2VQ1A 3PREA 4NC1C 1XX9C 5D1XE 2F58L 4KXBA 4W9KC 2WKGA 5D7SH 4Y5VC 4H8QA 3OM3B 4BKSC 1DFBL 4OZHA 1G9HA 4Z76A 1FSKB 1U93A 4ZFFA 1GAFL 1XF4B 4YHNA 1OCCB 1CE1L 4YNYB 1WC7B 1DSWA 1T7XA 1G4MA 1VFUA 3MN8A 4IYKA 1OW0A 4WI0A 4F5CA 3DXAD 3ZRCC 2GJRA 4NPYA 3FUFA 4PJFE 2Q87A 5BRZA 5E2TH 1AD9A 5IWLA 1F2QA 3LKNA 4YZWA 4LVOC 2W65A 1C1EL 2EH7L 3FTSA 2Z0BA 3BQUA 3I6GB 3BSZL 1CE6B 2R23B 3HPJA 3VFOB 4MDJA 2JKNA 3QDJB 2A9MH 2B1HH 3MR9A 2DLEA 4FA6A 3Q6GH 1AO7E 5A6IA 4WTZA 4XT1C 3BD4A 1AHWA 2AV7A 2Y06H 3MNZB 3K81A 2FX9L 4R2GD 2BP5M 4XVTH 3E7JA 5DZJA 3UPRB 1QEXA 4A2EA 1EHXA 3TIEB 1S8DB 1IGFH 3MBXH 1YEHL 5J8OA 5JORB 2BSTB 5E6IA 1I75A 3IJSA 3D4YA 3APMA 4G6FB 4ONHA 4G8FB 2C7FA 3DETC 1RIHL 1QLEB 2R1XB 3OGOE 2DI9A 2H6OA 2WBKA 2D7TL 3Q0HA 1MFAL 4L4VE 4ELME 1F3DJ 1RIUH 5HDBE 5IKCA 3X1EA 3VRIB 5JQHC 2ZUXA 3EJUA 2F53A 1FVEB 2X42A 3EBAA 1NCCL 3AVEA 4WU5A 2R51A 3L5HA 2V17L 2EKJA 1N8OE 4ODWA 4X99A 4EI5A 1I3RA 3VB8A 2B14A 4JX0A 4YDMA 1OGAE 2E74C 3MUZ1 1BYNA 1VGKB 5C6TH 1TUPA 1FNEB 3D85B 5C8JA 2WXKA 1QPKA 1JZFA 4N3UA 2N7BA 3DWTA 2J8UF 2K7PA 2EYTA 1MHCB 1BXUA 4UQ2A 5CCJA 3LKOB 5CEZE 4QR7A 4E5XG 2HWZH 2CJUH 3MLSH 5LUMA 5EEZA 2X4SA 5DR5L 4GW4A 2Q7YB 3RY6A 4PRAA 1GVIA 5DJXB 4KROB 3H4FA 5B38G 1ILSA 1UCBL 1YY9C 2IWKA 1DBBL 1A3RH 3T0WA 1MW2A 2FR4B 1S4IA 3MLXH 2ATAA 3PHQB 3BLPX 3LPFA 3MLVH 4AQZA 1OT2A 1RIHH 3VI4E 5AB0A 5F7WC 3D30A 4G6MH 3MOQA 4FOMA 1KGUA 3KPLA 1RIUL 3WDHA 2R0LL 4UIKL 4UZGA 4EIBA 4FLSA 1KBVA 4YH6A 3QIBD 3TTSA 1MW3A 2D3VA 2HH0H 1E4KA 3EBHA 5D2LA 1V7ML 2E7DA 5AW7B 5E6YA 3V4PB 4AXWA 3ECBA 3GM8A 3RZCD 1UXSB 2DLHA 2SODB 2BNRB 3ETBF 3EYUH 4LLYB 3TNNA 3W3BA 1R0AH 4R7DB 3PUUA 1QR4A 5IIEA 4PG9A 1DLFL 4LQFL 4OGAD 1DVQA 4F92B 2FL5A 2PF6A 3CDFA 4L3AA 2WNKA 3GLZA 3TEXA 3TYFA 3EYSH 4KMQA 2GY5A 5G5DA 1DDHA 1V27A 3PWVA 4P9ML 4Z7NE 3VXSD 4RGMC 3DJSA 4YHMH 1R3IH 1UKSA 1CD1B 2IWFA 1P1VA 5DMJB 4IIQC 1A21A 4DKEL 2XJLA 3LKRB 1CTMA 3QFDA 5BVJA 3WKYA 4NQTA 5C07A 3I3DA 2IDTA 4AG4L 1Z0MA 4R0LB 3CLFH 1A1MB 1LEKB 2E4TA 4B5ZA 1HHIA 4CC1A 3P02A 2C3HA 4J1UB 4OUOA 1NOAA 3C09B 2PW1B 4GBXB 2Z4QA 3MA7B 5CBAB 2KUTA 4DZBB 2FLBT 4FXKB 2BIQA 3O0LA 3O3BA 3QO1B 1F4YH 2Y5QA 2YPKB 5IVNA 3AQZA 3CFJB 1VIWA 3K2IA 4FQCH 4ODXB 1N9PA 3LPGA 3G5YA 3ALWA 5IB3A 1EHNA 4KNSA 2QR0B 3ZHFA 4U49A 2E75C 3HG1D 4NO0B 1AGBB 3T0EE 1U8MB 1MFDH 3DRTA 2YXMA 1W80A 2E7LC 2VABB 2LT9A 3MNMA 2GIMA 1M42A 1K2DA 1BAWA 3EYSL 1P4UA 3IDXH 1MVUB 3EJYC 4FTDA 3MV8D 4MDIA 2P24A 3KPQB 1VAHA 3HZVB 1UD5A 3NJXA 1FDLH 4UOJA 1BQHG 4M5ZH 2CAKA 4DN3H 1BJ1H 1ED3B 3VD4A 1OAYL 3UEQA 4DKEH 2Z6FA 3SKOA 3PL6A 1MFEL 4U6HB 2GAZB 3QZMA 4J1UA 2J6EA 5B3SB 1KJ3H 2BY3A 4EN3D 1T7ZA 4NCC1 1GL4B 4UNVA 3EH3B 5I8CA 3LRHA 3MR9B 4ZAKB 3QCVL 1DUYB 1CLOH 5BO1L 3FT2A 1JVLA 3DROA 5HP5A 5SX4I 2CIIA 2WW8A 2WXIA 2XZAL 4NM8L 1KJ2A 1AGDA 3W57A 4C4KO 4LCWD 3FSAA 2CUAA 3MNWA 4L0PB 4K3JL 3DTXA 3R4RA 4U1JB 3BFQG 4NWUL 4PJHA 3TEYA 3W37A 1V3MA 4W6WB 3HPLB 4HA1A 4M03A 5T5FA 5LBVA 4OLWH 2FEJA 4ZUVB 1OTTD 1NBCA 3RWEB 4FDWA 3DJRA 2FSDA 1DR9A 2DWSA 1CI5A 2Z1PA 4KAQL 4Q6YA 3UABA 1X9RA 4JRYB 3HS8A 5I71B 1FGNH 2P8MA 3N44B 3F01A 4FQ2L 4P4RB 4X4ME 2ZX9A 5ISZA 3QJFA 3WIIH 2QQNL 2YLKA 3HN8A 1YNTB 1TFPA 2NNAA 1BZOA 2ZNWA 3U6XA 2ZWZA 3OR6B 4GG8A 1F42A 5FECA 1FORH 3DA0A 4A66A 3GD1C 4NFDA 4ZODA 1KGJA 5EO0A 2YPLB 3UYPA 3QPXL 4QHUA 2VDLL 5EBGA 3VVVA 1WGVA 1QX1A 3W9DA 3OZ9L 3Q48A 4N68A 2CK0H 2V3DA 2X4OA 4EN3A 3LIZA 1U2CA 5DK2A 3J07A 3FQ2A 4PV9A 4XNZB 5D5MF 2C3VA 4B96A 1RUML 3LPOA 5CMAB 2FUQA 1UB5A 1OXYA 1KEML 1ZMYA 5FYJH 4UB0L 3IAGC 3FZUC 1AQDA 3FN0L 2AXGB 3VE0B 3IS1X 1VZHA 1HEZB 1UATA 1WBZA 5EF2A 2MH4A 2VSCA 3FRUA 4M8QB 3ABLB 4IHOB 3U48A 2QMJA 4L37A 3KBHE 3OKLB 4M6NL 2P80D 2J6EH 4FX5A 4FXLA 3ARBC 3LQMA 4H0GA 5EZJB 1ZVSA 3FTZA 3S9DB 1GC1H 1UM4L 1MUJA 3P0YL 3WY4A 4A2HA 1LD9A 1DJHA 2AV1B 3AITA 4BWUA 1O7SA 1HH9B 5IG7B 3ULUC 2A6IA 3KWWB 2VITA 1U6AL 5D1ZA 2V9QA 1WT5C 4EF3A 3QJHA 4A2GA 1ES0A 1SGKA 4GXFA 2X28A 1T1ZB 2YPLA 1CGUA 4YS4A 4QIRA 4ABWA 3DKHA 1MAMH 2F1AA 3CVHH 4AY0A 5DSCB 1TNNA 2DTMH 2X12A 4PJGA 6FABH 5IVOA 5IOPA 4ZUWB 2JJWA 5AW1B 4P2RB 3AY2A 3LHAA 4JPVH 5FYLL 1MDAA 3BP4B 3P30H 2AITA 5CZRA 4ZMQA 3BP6A 1H3VA 2CMRH 1KXQA 4R7XA 1PQZA 2GSGA 3BE1H 4KROD 3GSOB 5E7FA 4IQHA 2WGNB 5AVZB 3MLRH 3ISRA 2KPWA 4OCWL 1UB6B 2B1AH 4NZDA 5JHLH 2J1KA 5D1QA 4JFHE 5EU5B 1WVZA 1QLFA 4KNUA 1WD9A 3QJSB 5E99H 2A77H 2OMBA 3SZ6A 1WBXB 5DD3H 2XG4A 3TYGH 4PTTB 1TZGL 2R4RH 2V3EA 4FI8A 4QHKI 5F0MB 3OJMB 4HHAB 5C0GA 3GIZH 1CZ8L 1E42A 3BD3A 4GS7B 4Y9GA 3B5HA 3QIBB 2OJEB 3SIKA 4MHHG 1P9MA 3S5LB 4PCTA 5AWNL 1YN6B 2VQ1B 4LSTH 2EYRA 2OTWA 3MBED 3KHQA 4OD2B 5AZ2L 3ZIMA 3FOMB 2OLDA 1X5AA 1JF6A 4FQLL 5ACZA 1DJZA 4N90D 2X9XA 2ROYA 2WWOA 3ILEA 4MCNA 1U95B 1L0QA 4PRHD 1VFOA 3EXLA 1WWCA 3GSQB 4XAWH 4UQCA 2G0LA 3MJ9L 3VXSB 4R6UA 1JPFB 2XIIA 3ESVF 2X2UA 2VUYA 5KSAA 3QI9A 1NDGB 2ZP9A 2V5YA 2UWEF 4I0CC 2R2HB 1HOCB 5DI8B 3MUGA 4I3GA 5IESL 5CXPA 2OMXB 5KAQG 5D1ZI 2BDNL 3CDGA 3BE1L 2MFNA 4X7FC 3DYPA 3L4ZA 3ATEA 4WNSA 2FBJH 4QRRD 1FFQA 4Y2DC 3V5DB 3HZKB 1JGUH 1GA2A 1FL5A 2W9DL 5HHME 1I7UB 3BVDB 3EG9B 3CXHK 3ARGA 2UZPA 3V95A 5L0QB 3SPVB 3GJEA 2V7NA 4XCYA 3GKWH 1UEYA 3WS6C 1TQVA 2F8IA 3GIZL 3E6HA 4MS6A 4PRDA 3MJGX 4GW1B 3Q9QA 2VLJE 2DLFH 4QMEA 4WSGA 3U0WL 3T0XA 2EDKA 3I50H 3GXFA 1IUZA 4PRPA 1IKFH 4G6AC 3LIZH 2IXQB 5KBNC 1OSZA 3UIZA 3PV6B 1ZANH 4KKBC 2MTPA 3H0TA 2GHZA 3O4OB 4TVPH 4Q4IA 5F9OL 3QIWC 5ICYA 4HT1H 1HINL 4Z23A 3FRPG 4LKCB 3QCUL 4PJFF 1A6WH 5DHMC 2IQAA 1UM6L 1SMAA 4RIRA 4WEUD 3BT0A 4XWOD 2DV6A 3P9WB 2X4QA 4HGMA 5DFAA 5H8DA 1WUNT 5C0IB 4AW7A 4BSWB 1IO4C 3Q05A 1AAJA 3MBWB 1J5IA 2NY2D 2BCKB 4RRPG 5CUSH 1EHLH 1MCCA 3MFFA 3WFHA 2I32A 3GMQB 3AS0A 5ABDE 5LWYL 1OCRB 1KN4L 4R83A 1BFOB 4WGKA 1RUQL 1UXWB 4Y5YC 2D9QB 1ET5A 4AEHL 4FZEH 5FGSA 4LIQL 4S1SL 4M7LH 4JB9L 5JW4R 3U9PL 4X7DC 3PXLA 4UM8A 1MG3C 1QASA 2A74A 4C4KT 4QD2E 1Z6JT 2HFFB 4FNUA 3LEYL 4XNXL 5KSUB 4JG5A 3NAAL 1G6VK 2HFGL 3V0HA 2VXSH 1CXHA 3KPNA 4N5ED 2WVUA 5E9DD 4D7BA 3MCLH 1XH3B 1JE6A 1MCJA 4KKCD 2VZSA 2YSSA 2X9WA 2FD6H 4JL2A 4NRYA 4XXCC 5T3XL 4AIZA 5BVPH 5C7XL 1WPCA 2OXGB 2XHNA 4JRYD 3BEWA 2E8ZA 4UAOC 3ZVVA 2VXQL 3KWWA 4XAKD 5JYLA 3NEXA 4H0IA 3WKMH 4EN3B 1Q0YL 1D9KC 3A4FA 3MXWL 4M61A 2HKHH 2WINB 4QRPA 1WG3A 5C07D 5MENA 1EMTL 1PCSA 1RHFA 3MV7E 5KVFH 1MREH 4KHTL 4EXPX 5B4MC 2OAAA 3E1ZA 4UT9H 5E8DL 5SWSA 3GUTB 4N2GA 3K0YA 2X4OB 1CDUA 3H9HB 4OQTA 3K8LA 1T7WA 1Z9PA 4QTIL 3VFRB 1OM3L 5DS8B 1A7QH 4LCWB 4LCVA 1UOVA 3B2DC 4EKJA 2L7EA 2NW2B 4OLUH 1PZ2A 1BXAA 1HEZA 4IMKA 3CFNA 3HRZC 5IBLD 1T3FA 3PV7A 5AAMC 2NY5H 4M8QA 4GRLC 3DIDA 2HZHA 2Y9RT 3UPAA 4JO1L 1DBJH 2H8PB 4IMLB 4LP8A 1TQWA 2ZCHH 3EH4B 2Y07L 4OF3A 3VACA 2VXVH 4IDJL 4NPYB 2FJSA 2RIKA 3HFML 4LEOB 2R2CA 1KIPB 3EHBC 4PJDA 3VXUE 2YUWA 4H5SB 2NX5D 4UIMB 2BMKA 2HLAB 3EH1A 2UUDK 1CF1A 2BSED 2MNJB 3WNJA 1YDPB 4OZHB 2NZ9C 3U79A 1HAUA 3GMMB 3VFSA 5I0ZA 4HJIA 4AE1A 3VGFA 1S7XA 1BZQK 1ZLUH 3CDCA 3ORJA 5E9DE 2YPLD 5FO7B 4JBSA 5EOTA 3TIEA 1EMTH 3Q7JA 4PWKA 3L1FA 3CHRA 3BDYH 1KB5L 2QDVA 5E8DH 1UWGH 4PIBA 4JDVB 5K93A 5B8CA 2GG1A 5F7EL 1GGUA 3QQ4A 4ZAKA 1OM3H 2YD2A 5A2AA 2MCAA 3MUY1 4U0QB 1CTOA 1BAFH 3OSKA 4TRPH 1QO3B 1CICC 5A6MA 2X6UA 3CXHJ 2K8MA 1EFXD 2IC2A 2WWKT 4HCGA 4HFWA 5C9JB 3SZKC 1FV1B 3I85A 4M5YH 1CB4A 1KBKA 2LLGA 4CU6A 1DQLL 1IFHL 1FNGA 1NDMB 4M29A 1XAKA 4H8PA 4DWHA 1FZMA 1MZZA 1FL5B 4QT5B 5ALBL 4DF9A 2YQ2A 2N01B 2R0WH 4PJDB 4P57A 1A1OB 2GBAA 4KKCC 4K73A 2VXQA 2IEPA 1AHMA 1P7QD 2DKSA 2H3NB 5KVGL 1DQQB 3CFJA 5C0RH 1G7HA 1WA0X 4LNRA 5I6NA 1R3HB 2MNUA 5C0FA 1EXGA 1E67A 4DP1X 1EGJA 3LV3A 4ZAKC 3TASA 4GW1A 4M7KH 5CSGA 4MLSA 1OAKH 4UUJA 2WVVA 4O2CA 1HXKA 3GUTA 3KW7A 4P23D 3IXAB 3NJHA 2DDQL 4YC2B 3ZTJG 5I26A 3L7EA 1M57B 4OGQC 4KI1A 1JTOA 3BDYL 4ISVB 3IWUA 5F3HA 3HZKA 2ZUQB 4L5FL 3L6FB 1HCVA 1SXZA 5L8KB 1UYWL 3DIFB 3LH8A 4L4TE 4A6YB 2Z93A 4XWOC 3KPSD 2G3NA 1MCDA 2VLJD 1NPUA 4M5YL 4ZUSA 3N85L 2Y7NA 1EZLA 2VR7A 1CE1H 2AFNA 4NZUL 2NR6A 3OJVC 4WTQA 4G80A 3IT8D 3W38A 4GLRI 5KVDE 3HG5A 3SB3A 3ECBB 4FQXD 3REWB 1B88A 1XFPA 2EDWA 4M56A 4YDKH 1QRNA 1KTDB 3MV7B 1SHMA 2H9GB 4WEBL 3T0EA 2VDOH 3P3YA 4Y2NA 2J6WA 3MGTA 4IOFC 1R19A 1IGJB 2ZT9C 2QFRA 5ECGA 4OGXL 3V7AG 3T1WA 5C97A 2IADA 1OAKL 4FI6A 2WXHA 4IOSA 5DJCA 2YR3A 5IJVB 4ELMF 2VDNH 4G8GA 3LD8B 1NAMB 1LDSA 3HI6L 4NI3A 2ZWKA 2AJSH 2FL5B 4X9FA 1T1ZA 5E4EC 4LL1A 4IBUA 4Y2DD 3CDYA 4XTRD 4C58B 4RIRB 4CU7A 2UZIH 3SYPA 3ILPA 3I2CL 2F7PA 2BC4B 5JO5B 1YNTA 3X2QB 5FYKU 4PJGF 1I4FA 1M3IA 4TNVF 3S88H 3CVCA 3MNDA 3HMWH 3MREB 2O5XH 2RBLA 5TE4L 1G7LB 2YD8A 1A6VL 4F8OA 3D0LA 3D3VD 1V05A 3GMQA 2ED7A 2JNZA 4P2RA 1I7RB 5MEQB 3C8KB 1YHPA 2KPNA 3ARUA 3GSNA 3RA7L 3T3MF 5HXMA 1USZA 2QVFB 4KY1H 4HS8L 2XI9A 3BHBB 4BUHA 1BFVH 5TGBA 1BHGA 4MFHA 1TCRB 1MAKA 4ZSOE 1D5MA 1L0PA 2GC4C 1QHQA 5CFHA 2DQJL 3MLUL 3IRPX 4J4PD 4JDTL 4CN1A 3QC5X 43C9A 5CO1A 3VSVA 4H20H 1M1SA 1V54B 1BREA 1NBVL 4N0CD 2I69A 5H37A 4AW4A 4J3OC 4Z7IA 2EVHA 1RXLA 4GQPH 5F1OB 1JPTH 4KFMA 4X4KA 3SJVE 3MRIA 5IF0B 5DRWB 2J25A 4BBWA 5C6PB 2NYYD 3WLBA 3QULA 1SF3A 2XN0A 3CN0A 2DIJA 1ADWA 2PWHA 2YGQA 1TEYA 3MLXL 4KJPD 1JERA 4P2QE 4ELMB 3NSYA 3SGKC 1MVUA 2VOTA 2X1PA 2J2ZB 1U91B 5AVXB 3CSYA 2YEZA 4G7SB 3WIFA 5I2IB 3PWUA 2BCMA 4E41A 1D5IH 2CKBB 4XPFL 3HMWL 1MF2L 3QARA 2X5PA 3V79C 1IVLA 2VDNB 4GOSA 2R27A 2EVGA 1JTTA 2OTUB 3EYVA 3LXAA 3LJ3A 4L4JA 4OCLC 3U2JA 1XCTA 3P54A 1DFBH 3KMDA 4HCRH 4FMKA 4MBOA 1ESOA 2AAVA 2YOAA 1NMCC 2B7DT 3PP3K 5DT1H 3LPPA 1J8HA 4GKNB 1UT2A 1H3TA 4K5PA 5GSRB 2DBJA 2B5IC 3TM6A 3TV3H 4X6CA 5FYJU 1RULH 2HKAA 1VA9A 3NFPA 4ZI8A 1EEYB 3VNZA 2IALB 2WBXA 1FYTD 1GYVA 1N6VA 4D0DB 3OQRA 1G87A 2AXJA 1BVKB 4KRNA 1VF5C 2ZIDA 2WUCH 1CBJA 3P4NB 4U1NA 1ETJA 2GVYA 1F1AA 4LBAA 4BV1A 4BEIA 1K72A 4MA7H 3TA3C 2QV4A 4BCXA 3ZZSA 1I9EA 3V52L 1G7HB 4GO8A 4WFHE 2V9RA 3H3KA 4PJXF 2ZKMX 3HLAA 1XZWA 5FKAA 4D94A 4XMXA 3VSQA 2WKOA 5BMFH 4LSUL 1O7DC 1UENA 2XXMB 2KERA 3O3AA 5KSBB 2D31B 4OD2A 2W0LA 4DZ8B 2DBLH 4XNMA 2EVIA 4PP2B 1PDKA 1S9XB 1UH2A 2YAHA 4K9JA 4KX8A 2OYMA 3U2SA 4Z7OE 1DVFB 4XPFH 5HJGA 1N59A 5GIRA 3STZB 2X9ZA 3UBHA 4B7IA 5B8CB 4Y9FA 4UDTB 3T6VA 1WWBX 2DLGA 1G6RL 2AI0H 1NC2B 2JE8A 4XMZA 5E1HB 4DGVH 5HYEA 4C8XA 3B2UD 1XSOA 1X5IA 3F58L 4PRIA 3WXWL 5IQ7H 2YGVA 4D9LL 3OKMB 3SCMA 1CGVA 3QG6A 3TV3L 5EZJA 3N42B 2CGYA 1JGDB 2HX7A 5CZXC 5DZAA 1S78C 4RFOH 3ZTCC 4UM9A 3RFZC 5C0EA 1QTPA 1JPSH 1FYHB 3B3BA 1IMHC 2HG0A 1BWWA 4UOW0 3N50A 5HYJB 2WUCL 4ZRGA 1M05A 2B4CH 5T1LB 3BRFA 4AKPA 1OAYH 2X0UA 2D0GA 4OV5B 1C8QA 3TBTB 3NSXA 3BPCB 1E90A 2I9TB 3QFDB 2L8AA 3H4HA 3O4LD 1FZOB 2IAMD 1KEGH 3ARDC 5HD8C 1KB9K 3KDPB 4Z0XA 3AADB 5H35A 3QIUB 5EOQL 4ZG1A 4UV7L 5IT2H 4M62H 2NSXA 1IC5H 1UWYA 4Y1SA 1QHOA 4Z7VF 5CEXB 1QYGH 1OSZB 3G6JE 1MWAA 2AJXL 4KXZI 5ADOL 4S0SD 4W9LC 3N1QC 2P8PA 3V0FA 1WFTA 2WLYA 2UXVA 4NLAA 3AUVA 3ARDB 4EUPA 1JPST 1TYRA 3L8QA 4A6YA 3BUIA 3UTSD 3L3GA 3L1GA 2HH0L 3CFDA 5HHVH 5ALCH 5TTRA 5JW4N 5CILL 4LAQH 4JUSA 5SWSB 4WI7A 1JAEA 1Y1DA 2HFEA 4M6ML 4P5MB 3IDGA 3HMXL 1VZGA 4FZ8H 1X44A 2MSPA 4PJEF 5FCSH 8CGTA 5ID1A 2VC2B 3DPDA 4XMLL 2AQ3A 2BZ7A 4ZXBD 3T3ME 2D4FA 4XH2A 3TT3H 3WEOA 3CZFA 4F8LA 1ULVA 5F0LB 3QR1A 4X4YA 2QQNH 2CA3A 2H1XA 3IDNB 3HEIB 2F5AL 4Z8FL 1FORL 5L7XH 5MERB 2OMVB 1PPIA 1AVAA 1HKLH 2NNRA 1Z0NA 2ZD0A 3J27A 4XP6H 4YEFA 2BK8A 1LO2H 3LKOA 3MBEA 1HWHB 4FADA 2J8OA 2WNGA 2MKWA 5EOTB 3MLPA 3BIKA 1E3FA 3D2UD 4DUVA 2IBGA 5I15L 4HWBA 4Y2DB 4D0CB 4OZGA 1S7XB 4JN1H 3SGEI 1QA9A 4P5TD 5HD8D 3HC3H 2FO1A 3ES6A 2F15A 4HC1L 3V6FA 4M00A 3FQUA 3ZE2F 4M6NH 5JNYB 4GW5A 5E8PB 1BM3L 2QPFA 3QNFA 2Z8RA 1P53A 1ASQA 8PAZA 3P0YH 1OP9A 1QFPA 2BXYA 3QQ4B 4PS8A 1CLYL 3GBLA 1A47A 1QTYT 1BDYA 5F7FA 4XNQA 5DFVC 2XX1A 4YFDB 1EBPA 2ZXCA 1S78D 5DQJB 1NOFA 4MWFB 3IRCA 5DI8A 1TTBA 2WO2B 5CZXD 5DA4A 1C5DB 3BAEH 1TJMA 1FGVL 5GHWL 1N0XL 4F58H 3CDGB 2JFCA 3HB3B 2BY1A 1RUKL 2I5YL 1P6FA 3MRIB 2Q5BA 1W9XA 2EDXA 1A0QL 6FABL 3DTDA 2KQNA 4DOHB 1QBMH 2VABA 2YMOA 3WLBB 3EG9A 4UTAA 2NQDA 4AITA 4ELKA 5EZLA 3LKQA 4K15A 4QRPE 3ZKSD 2YD9A 1KBPA 3HN3A 4IBVA 3D09A 2AJYL 3PABB 1IJ9A 3V6FB 2J1WA 1RPUA 4IW4C 1JZ8A 3CSYB 1YY9D 4NQCE 1A3QA 4K55A 3RNQA 2V5RA 3KPSA 4WIQA 4J3TA 5LB1A 4HC1H 1K9TA 4QCIA 5D7EA 5DD3L 4UNUA 4M1GL 4YUEL 4NP4H 2FSEB 3U1SL 3F65A 4JW3A 3QNZB 3FS9A 4W4NA 2XG4B 2NDFA 3MA9H 4HWZA 5HY9B 4FXKA 2AEQL 3RGVA 4NN6B 1YNKH 2Z7ZA 2PW1A 3SCMB 1BD2A 1SOQA 4EVNB 4KI5F 3S35L 2OBGA 2YC1A 4FQLH 2LQRA 4WSKA 1OE2A 4C4UA 1WQVT 5K5YA 1F1GA 3C5ZB 2OMUA 3IETA 1QEWA 1FYTB 1KB9J 3ZW3A 3HLKA 2ZJSH 3HOGA 5L4IA 3C08L 1I9IH 4AKOA 3U82B 2VDLH 4B9IA 3U2SB 1U8KB 4ZUWA 1KZYA 1SY6A 3H9SD 2ZSVA 3JBG7 2OSLA 2CPUA 5FO9A 4TKWA 3TO2B 4PB0L 1NMBL 4PBXA 4JE0A 2VO5A 1MW1A 3O3AB 3TBSA 5FLVA 4GP5B 3QQ9C 4ZTOL 4KNTA 3FONA 5HHNA 1J5CA 1CLVA 1U8IA 1Z3GL 1JS4A 1YQVH 4WJ5A 3V0IA 4APQC 2DQFB 2NTFA 3WUZA 4O02B 3H56A 4R2GC 1IE5A 2CDEB 2EDOA 4YR6A 1S3KH 1W16A 4HWZB 3SE9H 3GKWL 3OZLA 3MRJB 2D2CC 5KVFE 3WNKA 3ARGC 5M94B 4EUPB 4NIYE 2FHBA 3CFBB 3Q8FA 1B2WH 3GLAA 3QFJA 1KTRL 3QUXC 3MACL 1FZJA 4ICXA 2JKIS 1PG7H 4OU3A 1UB5B 3B9VA 1KCKA 3E6HB 3OKKB 1A1NB 4G9FD 4PJHB 2MQCA 3LY6A 5ENWA 2FJFB 2K3HA 2CNYA 3C5ZA 3P2TA 4LO9A 4OD1L 3WY1A 2IG2H 2WQSA 4LCCC 4G6KL 1RK1B 1CDGA 2XWTB 4X6BB 3BC9A 1ZANL 4TVPL 3ULVH 3V55A 3EJTA 4JCMA 4HLZG 2DYSB 3VRIA 3LKQB 2XG5B 3DPBB 5KW9H 3ZKXC 3H0TB 3T77B 2H9GA 4F8TA 5I6XB 5LNDA 4MD4B 4M9OA 3UG5A 2DY2A 2WM0A 5FAAA 3W11C 5ISZB 4QRUB 1HXMA 5DJ8B 4EOWH 4P4RA 2QVKA 4N0UB 4X5WB 1HOCA 4OJAA 1J9CT 4X7CC 2QFPA 2KDGA 4JGUA 4UTAL 2B2XH 1FNEA 2IO5A 3D85A 1DVFD 3ARVA 5LWYH 1S9VB 3NJLA 1U0QA 3WD5H 1CDCA 5EV7A 4TQIA 3VGAB 5I1KL 2HT3C 3TURA 5DS2A 3RGVC 5KS9E 3VXRA 1OLZA 3KGSA 5JXED 1LO5B 3M46A 5ADPH 3O45A 4LIQH 4S1SH 3VFUA 1KNOA 2NQCA 2E86A 2VLLB 2Y4SA 3RG1C 2BIOA 1QA9B 1N10A 3BX7C 3FAWA 3BP7A 2EILB 2Y72A 1EO7A 5A3ID 4E41B 3WJLC 5BUGA 1EDYA 3VTAA 3VWKC 4KDTA 4HISA 4XOAA 3QXDA 1PD0A 2HFGH 4L29A 4DVBA 4AYBA 4ENZA 3APCA 3NRFA 5B3NA 2V8LA 5AZ2H 3U30B 2AQPA 4I0PD 4ZXBA 3U7YH 1LWJA 2HRGA 4G7YL 3UJJH 2Z4QB 5IQOA 5F93C 3FSOA 3LV3B 5DJ0B 3FOLB 2IXQA 4KJYB 4X5RA 5JDSB 1JF5A 3QIWA 1TF4A 3RTLA 4HJEA 2EP6A 3VD0A 5LHDA 4XB3A 3ULUH 3EF4A 2DEYX 3ET9F 3ZX1A 1HNFA 2HJKB 1JZDC 2XV3A 5KVFL 3IVKA 2R23A 3HPJB 4YC2C 3TH3T 3FUKA 1AYOA 3E1F1 3QZWG 1JOIA 1G7JB 5FOJA 3S5LA 5JIMA 1KT2B 2ZG3A 1T4WA 5KSBF 2BDNH 1SHWA 3QEUB 4XVUC 1A7QL 3AS1A 4JQIH 4NQEB 3AG2B 3UH8A 4PU2A 1VERA 5G5DB 1HYSC 2P49B 3VM5A 4OQ1A 3AREB 5TE7L 2R69L 3ARBA 1KJ2L 4L4TD 5AVRB 2WZ6A 4GQZA 4KJWD 4DVRL 1DVXA 4U6HA 3K6FA 3WENA 4CJ1A 5DQ9B 3GSOA 2VXUH 3F7VA 2VXVL 5I8CB 4CBPA 2X1QA 1CXIA 2C4XA 2OK0L 2XACC 1AG6A 5FS5A 1VDGA 3AM8C 5CLXA 3GNMH 3WSQH 3DYOA 4GQRA 2QADD 3A22A 4JG0H 3ME0A 1MFNA 2P43B 2NYZA 2BMKB 2J8UE 3MRFB 3TBVB 4P04A 4V11A 3QCUH 1AR1C 1T0MB 4P8QA 4K5MA 1L7TH 1GGCL 1QSFA 2EADA 4M43H 2ZXDA 3DLQR 3QIBA 3R8BB 1TTCA 4RFEB 1II4E 4PRIE 1SY6L 1Q1JH 1MIML 5D9SA 1AGBA 2ZP8A 3JWOC 3WJMA 4F9LA 1PZ5A 4GNKB 4NFCA 4PJ7F 4MJ6A 1OP3H 1YUKB 4LSVL 4IM8A 5CIPH 5I24A 2KKQA 3BUYB 2NY3B 4YHZL 2H2PC 4JLRB 3RYMA 2A9NL 2BNQD 3WNOA 5KWYC 1G1OA 5EWIH 2EQDA 5TE7H 3ZDYF 4IS6A 2C9VA 4Y7OC 1LNUB 1RIVL 2P28B 1ZKAA 4K2UH 4Y16A 4NPKA 1OKEA 2EEXA 4Y5YB 2NTFB 5DVMA 1BW8A 2WO3B 1X5FA 4E9YA 4XN1A 1HFUA 1QFUH 1F3JB 5LGJB 4S2SA 4N8CL 5E2WH 4Z18A 2P42B 2UX7A 3BRDA 5T1MB 3RWIB 3SE4C 1FYTA 1QBLL 1X5GA 4AQEB 4WWID 5D71H 3WCYA 1TR7A 3NP3A 3RI5F 1KJ2B 1UADC 3S37L 1RZJL 5C0CE 3VD3A 1TNMA 3TN0D 4GMSL 2Z1KA 1QBAA 4NN5C 3IETB 3MX0B 5EU7C 1JVKA 4PCKA 5C0EB 2FR4A 2X3BA 3KG5A 4AMXA 4OLXL 1LO3H 1HI6A 1PX4A 2WKLA 4K8RL 1SY6H 4NT6A 4K3EL 4AH2B 4S1QH 3PWJB 3SKMB 3WS6A 2X53A 2Y1YA 2N0MA 4PTUA 1NBZA 1PLGH 1KBBA 3TZVC 5BRZD 5D2NE 1BEYH 1HSBB 5A2FA 2PCXA 5G4NA 3G6JF 4R4ND 3ETTA 2JKJA 5D6DC 1IAIL 2N59A 2WV3A 3FBQA 1D9KD 1J8KA 2JLLA 4HUXB 3LNFA 2C9UA 4K2UL 1IM3D 1LDPH 3WFCL 1R24B 1CR9L 4F80A 1YEDB 4ZT1A 4MXWH 1HL4A 1QFUL 3EDFA 4IBSA 3UTTA 1GYCA 5JOFA 1A9BA 3RB7A 1MJ7L 2WYIA 4N5EC 1KV7A 2KQMA 3G08B 4PREB 5GS3A 4LPXA 4WKZA 3MDJA 5EN3A 2IVFC 4M3HA 4TULL 2FECI 4TNWK 3AQYA 3GGWA 5I2IA 3C5ZD 3N40P 1G7IB 4KX7A 4HFUH 1R17A 3F7RA 4XCNA 3TP4A 3ZKMD 4P3DB 3HI6H 1MJUL 2VRAA 4YAQB 1XSJA 1JPEA 1FPTH 2TSAA 5AVVB 4PJ8C 3DPBA 1KOAA 1KB5H 3NPSB 2XA8L 1PG7W 1AZBA 5CN2A 1KIPA 3L4CA 3UZVA 3GXTA 4RX4D 1JUFB 1UZ8B 3GMLA 4FXKC 2V7HA 3KCPB 1DQJB 4W9CC 3ESNA 4GUOA 2R2EA 4X9IA 4K8RD 4I9XA 4M61B 1XGRB 4TRPL 1MCLA 2D3NA 3BQUB 2CXGA 4W9JC 1T83C 1YN6A 1JXDA 1F4AA 5LG1A 2AEPH 4G7VH 5D8JH 2PYEA 3LZFL 4IRZA 1OOWA 3RA7H 3NCYS 3CVIH 4J6IA 1BFSA 3LKSB 1MNUL 3QDMA 3DMMB 3VFRA 5GGVY 2XBZA 1VRSA 2FYYB 1H3XA 1SEBB 4YSCA 4N2IA 3BP4A 3V0VB 4QOKA 2CCVA 4WUUA 5EBMA 3SKOB 4LSPH 4R4FH 1SYVA 1SQ2N 4LLWB 4BD4A 3SDAB 3UTSA 2APTA 4H40A 4KO6A 3WJJA 4MX7A 2FX9H 3ZR6A 2FLMA 1IAOB 2LV4A 3JTBA 5FWRA 3AROA 4NQCA 1XF2A 1QBBA 1BMWA 3REVB 3WELA 1MJUH 2Y69B 4QXVA 5AOKA 5L6YL 1K8IB 5T5NF 3PQYD 3EO9H 3WHE1 2OYPA 5AENA 3VDBA 4WHTB 5IW1B 3NH7L 4AXWB 4AYSA 5KVEL 4JQVC 1D7DA 5E95B 4PSRA 1ZLVH 4AUJA 4PG9B 2QSCL 1MF2H 2WXOA 4RX4A 5CJQH 5DHYB 4UQ2B 1KCBA 2B77A 3HI1B 2P48B 4AVJA 2BVYA 1N0LB 2XZQL 3RWJA 4PRNA 1WIUA 5DT1L 5KYWB 4F7PB 5FR3A 5J6GB 4NZUH 5I6LA 4NQED 4H8VA 3W56A 2YUVA 4KQ4L 3KPLB 3EAKA 4YDKL 3ZMEA 3L3JB 3PG2A 2PR4H 1PZDA 2UY6B 1CDYA 4DO5A 3MBEC 3ZE1B 2VR4A 2J5WA 1E7VA 1QKZL 3OHXA 3BVTA 2YD1A 5BUAA 4OCYL 1UD6A 3U1PA 5MEOB 4G71B 4JFOB 3GMNA 5GGTH 2AJ3B 4OM0H 4PRID 3X3FL 4ZX6A 4KXCA 2FWOA 2KH2B 3PNWA 4PD4J 3QR0A 2CG9X 3T0VA 1AXIB 4P9HL 2YGNA 2ZXEB 5GGVH 3HN5A 1JWUA 1AP2A 2GJ6D 3KPRB 3W9DB 2WBJD 1JIBA 1WV7T 4NJAL 2RCSL 4KNQA 2YN5A 1IB5A 4NKQB 2GSMB 5FYKL 1CT8B 2OR9L 4AL8C 1CGWA 5DZNA 2OCFD 3PP4H 2NY6D 2WLLA 3CZUB 3NZ8B 3FU8A 1PZ5B 4P2OD 4M48L 4NRZA 1NEUA 3A6OA 4TTDC 3ULSA 1EAQA 3TL5A 3TONA 1A6VH 4LGPB 3GMOB 3ZDZE 3BCDA 1ZGLA 3CN3A 4ANKA 5I71C 3PAYA 2G3ZA 4LLVB 2O6CA 3RVXC 1EZSA 3FF8A 4XB8A 2OMYB 5FHAH 1NC2A 3O3EB 4AM0B 2AQNA 3CUPB 2NY3D 3CXDH 4NKOB 1RU9L 2QKIA 2VIRB 2X1XR 1ZTMA 1MI5B 3JV6A 3MLUH 3L2MA 4GRLB 4JPIA 2BOLA 3RWGA 2V2WA 4B9KC 1IGYA 5AUMA 2PW2B 2ENJA 4P9MH 3SOBL 1CQYA 4YHML 3WFZA 3EYOB 3DI2B 4GI9A 1BYOA 3KPOB 4AQ8A 4P46A 5CJOL 1DTUA 1GYWA 3VXOB 3CFTA 1L9RA 1QACA 2Q1EA 5TD4A 4R7VA 2MIZA 3U9WA 3LQZB 2CO2A 3CZJA 2YRPA 5GRZA 3GS0A 5LCVL 1NGXB 3WEBA 8FABB 4TSBL 1NCIA 2AEOA 5E8PA 3HI5H 1D5IL 5D96B 2WKOF 1ZA3A 4QI3A 3ECVA 4ZMOA 3CCHA 3BIBX 4GAYA 2BVOA 2P44B 2GT9A 3EOTL 2EIZA 1GGTA 4MDIB 1XGQB 4K7PX 2O93L 4FQCL 4KMLB 3VXTB 1T5WB 4LPVA 5ESAB 3MKKA 5FYKD 2JIXB 2F5BL 1DJXA 4U6VL 3DARA 5FW8A 4F7KA 1IKOP 5JUEL 1TTFA 4LAQL 1OGSA 3SDAC 4PJ7E 2E9IA 4N5UA 2A6JB 4FAAB 4K8RC 4DP8X 4NO5A 4P5KB 3WMSA 3OXSA 1UM5H 4AV5A 2OPCA 2P7TA 3AWGA 1CYXA 4FL4B 4PI0A 3LN4B 5GSVB 3S96B 2AQSA 4YFLF 2WTOA 3MUHL 3BUQA 4KHXL 5J4MA 1E6OL 5F7AA 5IB2B 4AQ1A 2E4FA 1F8TH 3UYOD 1INEL 3STBA 4GUQA 4ANUA 4GI6A 2LGNA 2Q20A 1VACA 4QOKD 3C5ZC 3ECWA 1CFTA 1HCFX 3KE0A 5KSAC 2R59A 5H37G 1EA9C 1FC1A 1PD1A 1T3FB 2ROXA 2XC8A 3JQOB 1NIDA 1QLRB 4GAJH 5DJZA 2H47C 3WIHL 2JCCF 2DWEB 2XJKA 3QZPA 4PV8B 1BVOA 2RAMA 1KJMB 2IAND 4N9GA 1OVZA 5IB1B 4BH8A 3HNVL 4FJZA 4APXB 1RQ5A 2A9CA 2JB5H 3FO9B 2IOOA 1EIBA 3PWPD 4Z7QE 4HAKA 4OZIA 4O5LH 2D03H 5E9DA 1BZ9A 5FGBA 3TN0A 5GZNC 1EAPB 3A24A 2FQFA 1MI5A 4E9QA 2WANA 3BD5A 2F5BH 3PFQA 2JQAA 5BVJB 1KIQB 5E2VH 4F7EA 1M6OB 3NIFF 3TBWB 1R4XA 3QPQC 2YUXA 4P07A 4OGYL 5CINL 1PZUB 1CXKA 3HG2A 3QHFL 3SPIA 3ZDXE 5E08L 2HLFC 5GS2H 4D9RE 3GSRB 3BWAA 2OSLB 1WFJA 2B4CL 1LMKA 4LVNB 2DMCA 1INEH 1P6WA 3RVWC 5J1TC 2IBBA 1AFVH 4N1HB 2R0ZL 2FWLB 4KZEH 3IFPB 3OF6D 4QWWD 3DO7A 1L6PA 4G1MB 1MY5A 4WRLA 4JFEB 5CGMA 5I16A 2O61A 2A83A 1QLFB 4Q8BA 4O02A 3UTTD 4CN6A 4WU7B 2DQ6A 1MJ8L 2X4NA 5GS1C 3OHMB 2WC7A 3V0WH 3CN4A 3CWGA 2MEJB 5IP4A 4AYID 2JB5L 4CN4A 2ENPA 1KEMH 1KTDA 1UUNA 4GP8B 5J5EA 1ZHBA 2V2TA 1UXWA 1WE5A 1YN7A 4GUCA 5F7UA 1WGOA 1NMAL 4X6EA 4LVHC 4LLQB 1FYTE 3BAWA 1T21B 2YA1A 1S7SB 1ED3A 2CLVA 4QYOB 4RZCB 4AYGA 4ORGB 4M1GH 4YUEH 3WTSA 3K6SB 2DICA 3MJ7B 3WJMB 3TOPA 2VSKB 4Z7UE 2ERJC 2N56A 3JXAA 5IJVA 4X50A 3RWJB 5IK3A 3VXMA 3JV4B 4ZS7H 3MRGB 3L7EB 3BPNB 1CBVL 4POZC 2QTEA 4NQXA 3SDCA 4DFIA 3CV5A 3MUGB 1ASPA 3BAJA 5LGKA 3M88A 4C83A 3S3DB 1ADQA 2VDPB 1ZT1A 5EO1A 3MC0A 3NJMA 4TVPE 5CGYD 3V4VB 1MLCA 4HUCA 5LG6A 3OAWA 1AQKH 3JWDC 3C08H 2J8UA 2QADC 3MMEA 1JWMA 2A6KB 1MHHA 3UPRA 2EDDA 2H6PA 3QG6B 1SVBA 4PB0H 5HDRA 2CMRL 3ZLQC 1U95A 2EIJB 2NR6D 5DMIL 3K6NA 3L7FB 1H15B 1Z3GH 2DD8L 2GK2A 5I15H 1PU0A 1OCOB 2OTWB 5FDYA 5HDQH 1WA2X 3RTQB 1ECYA 3NMEA 1IT9H 3DO4A 1YPZF 3FT4A 1ZIAA 3H54A 2ILLA 4MKTA 1TZGH 2R4RL 4FFTA 2NX5B 2NMSA 5IMMB 2DM7A 2LHAA 2BW5A 2F08A 4OFPA 1U3ZA 2X6AA 3CZNA 3UIYA 3FAXA 3SDDA 5IEHA 1KB3A 2JWYA 4PJAE 3KL3A 2PLTA 1JD7A 2VQTA 2BNRA 2MQ0A 3CFCL 4IOIA 2FGWH 3DX3A 4ZMPA 3KGTA 3AB0C 5AW2B 3VQLA 4ZSOB 3LZOA 1BZ7A 2YD4A 4UQ3B 4KDWA 4LK4A 4H1LG 1QTSA 5D7KD 1TJGH 3ULVL 5SWZA 2V5SA 3NCMA 1AQKL 2DQIL 5F1IA 2WTRA 3E3QE 5K1VA 1OCWL 4KO9A 1U93B 4ZFFB 1CD1A 3MRRA 4XNDA 1B0RA 2ICCA 3QJXA 1AH1A 1KULA 5DO2C 4L1BA 4EOWL 2B0SL 2L3BA 4PY7B 1KIUA 4WW1B 4HKZB 4ZNCD 3WAJA 4XMKL 4QY8A 3VWKD 1AXTH 3DETD 3RUGB 4BFEA 4HWEL 3QDME 2FBJL 5IGXL 1E4KC 4N8UA 4KK8C 1LTXA 4P2QD 3MV8A 5IMKA 1TZHB 3RVUC 3S3SA 4JANB 3I6SA 5HDQL 2Q8BH 2W9DH 3T1FA 4MRCA 1NC4A 3JV4A 1B4RA 4Y19E 5ADPL 2EUZA 2W5PA 3L95B 3RDTA 1S9YB 2IIJA 4MJIE 3RGHA 5IFJB 5ICXA 3ARYA 1DL7L 1SJHA 1MI5D 2JQMA 2XCMC 2XWCA 3AUWB 3GHEL 1OANA 3IF1A 4I77L 4U3SA 1EUTA 4XBGA 5EOCL 4PBWD 3ZDWA 4CVWA 1PTZA 4ZO9A 3FO1A 4NHCL 5I0XA 5DMKA 1ET8A 3K5RA 4HWBH 4L8CB 2XTLA 3S35H 2YZ1A 3SYCA 2LABA 4DJMA 5SX5H 3GJFK 1WEJH 5EBWA 5A1AA 3BZ4B 2E27L 3HR5A 3UGEA 1YNLL 2HVBA 4YSAA 2WXNA 1A6WL 4GSQA 1MWAH 1A14L 1Y0LB 5D1XA 2ZJSL 5CGTA 2P5EA 3OD3A 5JXAH 2UXTA 1E0OB 2UZXB 2IH3A 4JJ5B 4PWHA 4BIKA 1DEDA 2B0SH 3FRUB 3JYCA 4LOVA 4PG2C 1GJWA 1QI4A 1NMBH 3E3QC 4XVSH 2D73A 4F5CE 4XNUH 2CO3A 2EDLA 5C09D 5TH2A 3OKDA 3G7TA 1JGEA 3SE8L 1P84K 4DP2X 4N2NA 1WZ1L 4EE2A 1UXMA 2E6QA 3ARGD 2A4ZA 2VDMH 1CFQB 1EEZB 4HJ1A 1MIEH 4PJXB 2FBRA 5I1HH 5KSVB 3WHXB 1DJSA 3ZL1A 5IQ9B 5IMLB 3K6DA 1GZQA 3SE9L 3G6DH 3O9WC 3MRMA 3RZCB 3AREA 2ED8A 2Z7UA 4S1RL 2WBWB 2ZTBA 1CXEA 4DVRH 5DMKB 4Y5XA 1B2WL 4HIJA 2OR7A 3NAAH 1IEHA 1EV2E 2XQYK 5GS1A 4M3JA 3UTPD 5GGQL 4QXUH 1CF8L 3MRKA 1ZJAA 3MJ6A 3ZDZF 1JZ4A 1QUNB 2CBPA 1IQWL 3NA9H 1Y6MR 2NY4C 4JRYA 1T5XA 4TQHA 4KFZC 3BVWA 3Q8EA 4WUUD 4Z7WA 5F7NC 2XWJB 2F1EA 3NCJL 1HHGA 1YNLH 2VXQH 4OVVA 4XXDA 3WKML 1T0NA 2K4WA 3FHAA 5D2LB 2D2OA 2WB1A 1G6RA 4M43L 1BD2D 4QO1B 1B4JL 4NAQA 3OKOB 4PD4K 4UT9L 1Q38A 4QJ3B 3V6OE 1J8RA 3TWCL 1HN1A 1KIRA 5E4IA 2V0AA 2J43A 4PRDB 3SPVA 5DA0B 5KEZA 5ABZA 2NXYD 5D1QD 1XF4A 5CU5A 1ZVHA 3IFNL 4JEGB 4YHNB 3IGAA 2DL2A 4F37K 2O5ZL 1WP6A 3DV6B 3PWUB 3HG1B 3I3BA 4X4XA 4Q2ZB 2BIPA 3UZVB 1RZKL 1ZLEA 2RFXA 5D7HA 2XPGA 1ACZA 2AW2A 2Y07H 3M6DA 3WGVB 2IDFA 1H9VA 1QI5A 3KL5A 3NZUA 3MFGB 4JFPB 2XZCL 3C6LC 4LPYA 1HX0A 4TN9A 4X0KA 3FUNA 3PHAA 3WLWC 1X5JA 5D71L 3QO1A 5E4EB 3UJJL 1A4CA 5KN5B 2K6ZA 5G4MA 1E4HA 4KKQA 1FF5A 1ZA6A 3DSFH 4RGNE 4ADGA 1S8DA 1JWSA 1P4IL 4JFVA 1RUAH 4NPJA 3N1GC 1JNJA 4LOUD 4P2YA 1DQQA 3GJFA 4WAFA 5F89A 5FDWA 4UQ3A 4NHUA 1D7CA 2YK1L 2WIIA 2NY1D 3VO0A 4CVXA 3UL4A 4E5XA 1UWGL 4EI0A 2MNWA 1O9WA 1NLDH 5IKCB 1QZNA 2CKBA 2XVLA 1RVFL 3O9WA 4MNHB 3H42H 1AMXA 1RJCA 3QAZB 1HHJA 2G9HB 2VLKD 1BPLB 3OJDA 2V6HA 1N2RA 2ZKHL 1C16A 2GTQA 1XH3A 3S3PA 4NB7A 3V8OA 3WEXB 4M4RB 1GJIA 5I66B 4OF5A 1I53A 1KJ2H 1PBYA 4O51A 2E56A 5F7BA 4NN6C 2ZUSA 4HOXA 1AGFA 4JQIA 4BKLB 3TO4B 1T66D 1N64H 1UKQA 4W9DC 4AYFA 5AKRA 1C5BL 4HUUA 1IFRA 4J3UA 4OF0A 2K1MA 2PUQT 3QDJA 1KXHA 2EC9U 4FQ1H 2XTJE 2HN7B 4K0OA 4MMYA 1F6LL 4H88H 5I8OH 1ZLSL 3WFBL 4Q9BA 4O2EB 3U4BL 4PRHA 2CBQA 1QWNA 2N4IA 1ZOXA 4G8AC 1THAA 1D5ZB 1MFUA 1WFMA 3GSNL 4K3DL 3DX8B 1GGCH 4G3YL 4Y8DC 2VMCA 5AAWA 1MHEB 1OAUL 4X6FA 1Q1JL 1HS6A 3VRLE 2V8MA 1NLDL 4WF7A 4UDUB 1HXYA 2AJ3A 4DAGL 4TUKL 2F9BT 4PJEA 3BN9C 4OT1H 35C8H 4AV0A 3AWFA 3P77B 4K3GA 4AEFA 1AG0A 5JQIB 2VUKA 2X4RB 3OHXB 2PCPA 1MCWW 1FFOA 3BW9A 3NFSH 3IB4A 4L48A 1DDTA 3PRZA 3QUXA 4NQDB 1MCPL 1GYAA 3O6KL 4WU5B 4F8NA 1IEBB 5G4OA 1RIVH 4CBZA 3C75A 3S4SB 3HHMA 4MZRA 3RQ3A 4EIGB 1IAKA 5HYJD 2HN7A 2OMUB 3T3PB 1OE3A 5D9SB 3CE1A 1LP9E 1YYLL 1MNUH 3T4AB 3IK2A 3U46A 1AI1L 3GLDA 3VI3A 1L3WA 3LQAH 1PEWA 4G8EA 3HE7A 5J1AA 4QRTA 2J20A 3ZY7A 3J8F7 4WDIA 3U4BH 2GUOB 1NJ9B 4DQOH 1B6UA 3QEGL 1DQML 2C4FU 2FIKA 3DOSA 2ITFA 5DUPL 4MSWB 3T71A 4G8GD 4GRWH 4IHBA 4NM4H 3GSNH 3Q1SL 4K3DH 5IOKA 3KHOA 4YDVB 4PQXA 3NIFB 5KOMC 5C9KA 1BG9A 1DANU 4P2RD 3EO9L 2EXYD 4OI7A 5L2KE 4DTGL 3Q2CA 3ZKXB 1UFGA 1OPOA 1SBBA 2NXZC 2CD0A 1UOWA 4TXVB 5KVEH 5EEYA 3QUYA 3ZTEA 1KFAH 4DN4L 5M7QA 2AJUH 2VZVA 3FDWA 5E1AA 3JVGC 2FJHB 1U8HB 5HJ3B 4ZK8A 5CWSB 2F58H 2EIZB 1IAIH 4FCAA 1X9LA 3P0VL 2WWMD 5CSZA 3G9AB 5FGCB 3QQDB 1FG2A 3BT2L 3DVGB 1YEJH 5EU3B 1GAFH 3VGAC 4FMVA 5ERWB 1PFCA 3ZKNC 3BSZA 1BFVL 2W9LA 4UUJB 3OGCB 3E0GA 3QVAA 3CU1A 4WWPA 4FP8H 5BOJA 3X3GH 4LBEA 4FQIL 3IN0A 4NO5B 4P5KA 3UXFA 5C70A 3HG0A 3WTVA 3T4AC 3LN5A 4H20L 3A67H 1H5BB 3ZK0A 5D5MA 5I6KA 4L8SA 3V4PH 1OY3B 3K8KA 1FUNA 3N5AA 1RJYA 4TULH 2H1PH 5FUCE 3RZWA 3VFOA 3NJVA 4YSTA 4P9HH 1YEKH 4GBXC 4XVTL 2Z92B 4F24A 3TA3D 1CLZL 3FTUA 3L1OH 4WI9A 1U8JB 2A6DA 2VJ0A 2RCSH 1SDYA 4KJQC 1LEIA 4K5OA 3ESUF 4YO0A 2Z31B 2EEAA 5EUKA 4HHAA 5C0GB 2EZ0C 1IFGA 4XVJL 4QHLA 2JTDA 2XBTA 4M5TA 3GC3A 1R9FA 1YCSA 3MNWB 4LPWA 3ZE0E 4K7PL 2XV0A 4Y4KB 1FAKT 1ZT4A 5IB3B 1O6VA 3STLB 1KBGH 1AY1H 1VFAB 2X70A 4P2RE 1U8LA 3NGBC 1NIFA 1ONQA 3HRZA 4PWEA 2PYFA 4NZ8A 1QR1B 1H9DA 5AALA 2ZKXA 3T8XB 1E6JL 3DGGA 3NG5A 1XD0A 4LCWA 1T6WA 3SO3C 3D25A 2DRUA 1U8NA 4HQQL 2DM3A 4GSXA 4NZTL 3VFTA 4FFVD 3CXDL 1ZVYA 5IZ7A 1RH8A 3UTOA 1BQLH 1B2YA 1E28B 1YRKA 4YGAB 3X3GL 4CSPA 3OZKA 3PDGA 5HJDA 4NKMA 2QKIB 2VIRA 3QPKA 1JVOA 3UAJC 3D33A 2LVCA 5B1JC 1I1AD 4MXQC 3VXRE 5CEZL 2CSPA 4MJ4A 3OLIA 1XIWA 3UERA 3FPXA 3MTRA 4JDZA