4YVUA

Crystal structure of cota native enzyme in the acid condition, ph5.6
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
510
structure length
506
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spore coat protein A
publication title Crystal structure of CotA laccase complexed with 2,2-azinobis-(3-ethylbenzothiazoline-6-sulfonate) at a novel binding site
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Oxidoreductase
total genus 152
structure length 506
sequence length 510
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA02
4BWWA 2B3IA 1M9WA 5AKRA 1NWPA 4YSUA 1RZQA 3X2QB 3ZIYA 3H56A 2WSDA 1NICA 2BP8A 1J5CA 3PPSA 4AKPA 2UX7A 2AZUA 2YQBA 2WO2B 3QPKA 2AANA 1V10A 3GYRA 2EIJB 2GIMA 1PNCA 1GR7A 5I6MA 2UXGA 3PCYA 4G71B 2XYBA 2VN3A 3U25A 4Q8BA 1GYCA 5B1JA 1AZNA 1AS7A 1KGYE 1NZRA 1SHWA 2AZAA 4DP6X 2HXAA 3QJRB 4E9VA 3ASOB 1W6WA 1AG6A 4BK5C 1PF3A 1SFDA 5B1JC 2BW4A 3WI9A 1RCYA 2P80D 2HRGA 2PP7A 3FU7A 6PCYA 2PPFA 3V9CA 1QNIA 3T71A 3PAUA 4HAKA 2QPDB 1X9UA 3WKPA 1ET5A 4DP1X 1PLBA 1GS8A 3IEAA 3NSFA 2CUAA 4DP2X 2FQFA 4JKNA 1ASQA 4KO7A 2H3XC 4GP8B 1AANA 5EHFA 1WA0X 2ZWNA 3NP4A 1HFUA 4F2FA 2FQDA 1ID2A 3UAEA 1A3ZA 1AZCA 3EH5B 3HB3B 2TSAA 1BQKA 2W88A 1FWXA 1E5ZA 4WTQA 2XU9A 2UX6A 2H47C 2Q9OA 4HHGA 1JXFA 1N68A 4Q89A 2PP8A 3S3DB 4CSPA 2ZONA 1PLCA 1SDDA 1AG0A 2FT7A 3UADA 3FT0A 1GS7A 3SBRA 4ZK8A 1GY2A 1BXVA 1J9QA 2BP0A 1JXGA 3FYIB 2YAQA 1WA2X 2IDTA 2FT8A 3AG3B 5AZUA 4G70B 4G72B 4AKOA 4EF3A 2J57A 4UAHA 4A67A 4YSDA 4F2EA 7PCYA 3D12B 3TA4D 1ADWA 1JVLA 4X4KA 5B1BB 4YSPA 3QJQB 1NIBA 1F56A 5B1KA 2FTAA 2XV0A 1KV7A 2BW5A 1L9RA 3SQRA 1L9PA 2I7OA 1SF3A 4F7KA 3FQ2A 5E9NA 2YARA 1ZDSA 3NJKA 1AQ8A 2MRYA 2YAHA 4NERA 5B7MA 2UXTA 2XV2A 5I5MA 1HAUA 4A2FA 1MZYA 4A2DA 4YSSA 1T5KA 1R1CA 5PCYA 1NPJA 1SHXA 4AX3A 4UF7C 4YL4A 3QJTB 1TKWA 1J9RA 4JHVA 1JZFA 1ZIAA 3S8GB 2HLEB 2VSKB 2R7EA 1AIZA 1NPNA 1XB3A 4HALA 4BDVA 3S8FB 5I5IA 2H5UA 1MDAA 1WS7A 1UATA 3RYMA 3T6XA 1PZCA 3T6VA 2YAMA 1ZPUA 5B7FA 3WG7B 1TU2A 4NAJA 3FQ1A 5TK2A 2FT6A 3S3BB 3QJVB 3EF4A 2AFNA 4N8UA 1PY0A 4GXFA 4DPCX 4A66A 1FFTB 2IDSA 3NYKA 1SFHA 3TU6A 2XV3A 2X87A 2VM3A 1KDIA 2GHZA 2N0MA 2QDWA 3ABGA 3TBBA 4KNTA 2FQEA 1L9OA 2JXMA 4HHWA 1NWOA 2PPAA 1JZGA 1A4BA 1NTDA 1GS6X 6PAZA 1ET7A 3GXUB 3PAVA 2CCWA 4E9RA 2Y1AA 1N70A 4PAZA 2XVBA 1E30A 2XX1A 2I7SA 1SF5A 4A2HA 4E9SA 4KOBA 3IBOA 2R7EB 2RACA 4TXVB 3OMAB 4BDVB 4HCGA 2VW6A 2YXWA 3ERXA 3CDZB 3OD3A 4G7QB 1RZPA 1BYPA 5I6LA 1PLAA 1E67A 3X1GA 4E9XA 1NIEA 1OOWA 1BXAA 1ILSA 3CVBA 1PCSA 1JZHA 4BWUA 3QJSB 1KYAA 1L9TA 3BQVA 2TSBA 4CSZA 2I85A 2PCFA 3NJHA 3CG8A 1OE1A 3FSVA 3NJIA 3NJLA 4HIPA 1JZEA 1V55B 3OQRA 4DP8X 4E9WA 5D4JA 2IAAC 3FS9A 4P5RA 1OV8A 2P80A 2JKWA 2FJSA 1L9SA 1AACA 1JZJA 4GP5B 4WKXA 1WA1X 1OF0A 3X1FA 1OE3A 1B3IA 3X1EA 2GC7C 1KBWA 2A3TA 1AZRA 5I6NA 3FSAA 2GB2A 3NP3A 2IH9A 3WIAA 2CBPA 3NJJA 2XXGA 1CYXA 4HZ1A 1A65A 1AAJA 1JZIA 3OMNB 1JOIA 1VLXA 1NDTA 1OCZB 3FQYA 1KDJA 2LLNA 1IKOP 2PP9A 3FPYA 4ENZA 1ZV2A 2QDVA 1X9RA 3PAZA 3TBCA 4A2EA 1AZUA 1XB8A 3EHBB 1A4AA 2YAPA 3DTUB 2EIKB 2XLLA 2EINB 3ABLB 3AG2B 4KNUA 3T9WA 3QJUB 4K9JA 1NIAA 3PLYA 2IH8A 5D4HA 1ZDQA 3UAAA 1ETJA 2DY2A 3DKHA 3PXLA 1GY1A 1EHKB 2HX9A 5B1AB 1KCBA 4BXVA 1BEXA 1M56B 1TEGA 1V54B 1SNRA 3C75A 3ABMB 2WO3B 1E5YA 1DYZA 5B7EA 3HEIB 1IBYA 4KO9A 3CDZA 2X88A 3H4FA 1AS6A 1ILUA 3JTBA 1E65A 5AFAA 3CZUB 2IDQA 1YLBB 2CALA 4GYBA 3FU8A 4G7SB 1PZAA 2IWKA 4JHUA 2GC4C 9PCYA 2BHFA 1PAZA 3AG1B 4YSCA 2DWTA 1J9TA 3IE9A 1BQ5A 5I26A 5FC9A 3KW7A 3FYEB 4BWTA 2UXFA 4DP4X 4FA7B 1OE2A 1KCWA 2CAKA 3IN0A 4HCFA 2DWSA 2XUWA 2PPDA 2BO0A 4E9TA 1ASPA 2NRDA 1AS8A 3AG4B 4P5SA 3QQXA 4KO5A 4MFHA 1QLEB 2J55A 1J9SA 2BZCA 4DP7X 4AI7A 2UXVA 3ABKB 4GP4B 2B08A 2HRHA 4QLWA 3SBQA 2OJ1A 1CC3A 2FQGA 3EH3B 1W6LA 2XXFA 3L45A 3NJGA 1ZIBA 3OM3B 1EZLA 4KNSA 4KO6A 3CVCA 2VW7A 2YAEA 4AZUA 3JT2A 1JVOA 4YSEA 3AZUA 3X1BA 2W8CA 1BYOA 2HZHA 3FPXA 2BZ7A 5D4IA 3EH4B 4DP0X 5I6OA 3T6ZA 1WS8A 3NJNA 3KW8A 4UANA 1I53A 3S3CB 3DIVA 4KOCA 1KBVA 1RKRA 3FSWA 1AZBA 1JERA 3UACA 3NSDA 3ZX1A 1M57B 1GW0A 1FA4A 2OV0A 4YSOA 2VM4A 3N55A 3NJMA 4GY4A 1IC0A 3ZBMA 1CYWA 2Q5BA 2VSMB 1A8ZA 2VMJA 1WAEA 2IWEA 1QHQA 5F7AA 2ZXWB 1OCCB 2YAFA 4DP5X 2IWFA 3FSZA 2VW4A 5LDUA 2YAOA 1W8EA 3WKQA 2JFCA 3FU9A 1BXUA 4N4YB 5B3SB 2EILB 4YSAA 1URIA 5F7BA 3NJFA 2BP8B 1MZZA 3V9EA 2BWDA 1TEFA 1MG2C 2IDUA 4L0PB 2GI0A 1PMYA 4M3HA 1NIDA 3UABA 1BAWA 2FWLB 1ET8A 2J56A 3NT0A 2YXVA 5I6PA 1ASOA 4DPBX 2Y69B 4E9YA 3G5WA 1L9QA 5IY5B 4DPAX 3NSCA 4AKQA 3NSYA 1J5DA 3SBPA 4W9ZA 2DV6A 5I5JA 3H4HA 1CUOA 2GSMB 4YSTA 1NINA 3BVDB 3MBWB 4RH4A 3AY2A 3UGEA 1A4CA 8PAZA 2PLTA 3WNJA 1PNDA 3X1NA 2GBAA 3FU7B 4QKTA 1IBZA 2PPEA 4NB7A 2HX7A 3TASA 2DYSB 4YVUA 4E9QA 5I6KA 2XX0A 2OCCB 3N2JA 5PAZA 1BQRA 5I28A 4YSQA 5TK4A 3ZDWA 2DYRB 4DP9X 1CURA 2AVFA 2MTAA 1IUZA 1NIFA 2EIMB 4M4RB 2BWIA 4BXSV 3OMIB 2PCYA 1OCRB 2E86A 4YSRA 4HCIA 4A2GA 1HAWA 4FAAB 1XB6A 1AR1B 7PAZA 1SDDB 2QT6A 3AW5A 4YVNA 5ANHA 1DZ0A 3ASNB 3IN2A 2CJ3A 2HX8A 2QPEB 3WNIA 1MG3C 2BP0B 1SJMA 3MX0B 2IDFA 2PPCA 4G7RB 3T6WA 2XWZA 1XMEB 4W1TA 3GDCA 4A68A 2FNWA 1AOZA 1JXDA 1PZBA 2J5WA 4PCYA 1GSKA 5A7EA 1OCOB 3CVDA 2ZOOA
chains in the Genus database with same CATH superfamily
2NY5C 4JPVH 4FI7A 2EZ0C 4JX0A 3TVMA 4UU9B 2CRZA 5I74C 3VFOA 4U31A 1XSKA 1WDAA 1F3DJ 2WSDA 3C6LC 3UO1L 4J5VA 1Y0LB 5KYWA 1RURL 4LSQL 4RAVB 4PR5B 4YDVB 1W80A 4X7CC 3V5HA 3MUY1 1KYUA 1V10A 2K9FB 4Z3IA 2EIJB 2FR4B 1PY9A 3O3EA 4QWWD 4ABWA 1Z9LA 2KZWA 3P9WB 4UUJB 5GJTL 4NYLB 5F6IC 1JF5A 4DGVL 1YEWA 2G4EA 2NY0B 1IEBB 1JD9A 4NM8H 5E94B 4AYFB 2X9WA 5JQIB 5C0GB 3MC0A 3Q9PA 3QJRB 2NSQA 1LDPL 2Z4QB 4AQAB 5FB8A 2Q76A 1UOKA 2XRAL 2LQRA 5EU6B 5GGRA 4M7LL 5AYUH 4BGDA 1KB9J 1SFDA 2MH4A 5ECJE 5EUOA 4JPWL 4GUCA 3V0WL 1LO3L 2P80D 2PP7A 1OB1A 1B90A 1OKEA 4G1MB 4YGAB 2Y6SD 5JHDB 4E68A 5GGUB 4N86A 1EAPB 2YPLB 4APQD 4YDKH 4ZYKA 4DP1X 2V9TA 1Z0NA 3VGBA 1BCIA 4EDXA 3S98A 5EUKA 5B39A 2W92A 1ASQA 4HFWB 5FK9A 3WDJA 4AEHL 3NIDF 3MR9A 2Z92A 2ZWNA 4MZ3A 2V6HA 1W72A 1KB9K 3OB8A 3WS3A 2R4RL 2IJ0C 3JT0A 1R34A 2NY5L 3SOBL 1AJ7H 1OT2A 5CAYB 2W88A 5C09E 4RESB 3UTTA 2XETA 4Y89A 4FG6D 1N18A 5KSVA 4HKJA 3I75B 4HKBB 1N68A 3UGUA 3C5SB 3V4VL 4H2AA 5DZOA 5KBNC 4M5YL 3Q9QA 5TH2B 2YD0A 5DZPA 3QG7L 5LN8A 3QQ3A 3LH2L 1KIQA 4G2AA 1JXGA 3N43F 1SRDA 1VADB 4EKXA 1JAEA 1S3KH 3K2MC 3ELAT 3VWJA 5H94A 3L7FB 4MD5A 4F2EA 7PCYA 1MCOH 1NGQL 4FOMA 4LHUG 2XZCH 3VMOA 3CFBA 4XOCA 4GMSL 4QAWA 5ILTH 4I77H 4YSPA 4FEMA 5C7XH 4NFBA 3ZHKA 1XCQB 3FOLA 3UTSD 5CILH 4BM7A 1MUJA 1JRHH 4HJ0D 4PJ7B 1NFDB 5IFHH 2YEQA 1HQ4B 2VZ3A 1U21A 2J25A 1A9EA 4NERA 3PS6A 1QSFD 1RHHA 3QCUH 1OHZA 4NJAL 2F9BT 2VAAB 3RBSA 3MXVL 3BJLA 1PEWA 2X1OA 4ZNEE 3ZW3A 1R3LB 3N85H 5DUPL 3SB3A 1HEJC 3ULUF 3BAXA 2ZYSA 3KXFA 4LASL 5HVWA 2IC2A 5TTRA 1QFUH 3GHBL 2LE9A 3SQOL 2O1AA 3KLAB 2VDMH 3ILDA 3MJ6A 4Y8AA 5A7BA 1TJHL 2YPVA 2ITEA 2VSCA 3NIFF 4NN5B 3IPBA 3RGVC 1U8PA 1S7UB 3RB7A 5BQDA 2WW8A 3B8SA 5EZJB 2HLEB 4NRYB 3TTSA 1FNAA 4JPKH 4X5WB 2XG5B 4AG4H 4JLRB 3F00A 2JK5B 4BIKA 1L0PA 1N3NA 1OB0A 1UATA 5FYJH 1KXVA 4XCYB 3GB7B 3RNKA 4FA6A 5IBLD 3L9EA 3S3BB 3QJVB 3DGGB 2BMKA 3TJPA 1FFTB 2FYYA 5F6HJ 3EFOA 5F0JB 2WB1A 4H44C 2H2SD 3REVA 3DOSB 2BS9A 5EEVA 4XNBA 4PRNB 3IM1A 4PPTA 3W0WD 4WSJA 1PIFA 2NY2C 3BP5A 3D34A 4GW4A 5L8LB 1JUFA 2DL9A 1ONQB 1I8IB 2PPAA 1DBBL 1IGJB 3EJZC 3I2CL 4P5MA 1N9PA 3N41F 4YBLB 3Q05A 1XR9A 1P4UA 3EYUL 4F33B 2AMUA 1NEUA 5MI0B 5HHOB 3FQTB 4F8LA 4HUXA 3II2A 3ARXA 4MBOA 4YNYB 2NDFA 4GQQA 4FG2A 5C09B 2K6ZA 4WNQA 1I7UB 4XPHH 5DD6A 2CHWA 4TN9A 2CA3A 4Y5XB 4YDJB 1EBAA 2H45A 1E4KC 5IGXL 4CVXB 5EO9B 1XFPA 3CHOA 4H4NA 5AOJA 2CQVA 5GZNA 1YO4A 5IBTH 3JV5A 4QRRA 2XKUA 2I24N 3FULA 4CVUA 4Z5RB 1A25A 2BIPA 1JP5A 1WGVA 2E0PA 3LKOB 2AJXH 4Y2NA 1FNEA 1U42A 4XPTH 4WF7A 1QHOA 2DOCA 5I1IL 2CG9X 2X6UA 4JZOB 3L2MA 5HHQB 3UTPE 2EDXA 2L7EA 4Q9CA 5I0XA 3QJSB 4BSWB 4PIRF 1ZEAH 5LGYA 3OZ9H 1J5OH 5IQ7H 2J1ZA 5DFAA 3GMRB 4FA8A 5F7LB 4P5TB 3SKJH 4FJYA 3MLTB 3DJRA 2Z3FA 1MVUB 1DN2A 3BP7B 1PQZB 3E3QE 4F8QA 3PL6B 4FX5A 4K3DL 3D3VD 3BIKB 3FTSA 2AXFB 1W72H 4NHCH 4DGIH 4CSSA 4OZHF 2UUDK 5AB1A 4QJ5B 3INUL 4B95C 4WV1B 4K23H 3EJYD 5GGTL 4WTWA 4B5EA 4Y4HA 2OP4H 3PQYA 1MCSA 4OW6A 5AWNH 1Y07A 3G04B 1I8LC 2GB2A 3QB7C 4L5FL 4F58L 5DURB 1QABA 1BGXL 4P2RA 1L3NA 3NJJA 3TYFA 3QCVH 3OWRA 4LSTL 3IJHB 4RFEA 5IVXE 3NN8B 5JUEL 5E23A 2IGFH 3HC0A 4JDEB 1SYSA 1LEIA 2BY2A 2DD8L 3LQZB 1TETL 3FPYA 3ZHNA 3QDHA 3NRQA 3WAKA 2EYRB 3HHSA 2FHFA 4JFUA 4PUBL 3KPTA 2WWMC 4PMEA 1WZ1L 5KAQG 2UZIH 4CAGA 4JQXA 5LHDA 3TJEH 4RMTA 2ICEA 1A3LL 3B37A 1YN6A 3KPQA 3WN5B 1ORQB 2NR6D 2PABA 2CHXA 3QJUB 1F58H 2MCPL 4JAMA 2P8PB 2A9MH 2GBUA 3H0TB 4O2EB 4BYHA 3PXLA 4ATWA 3OHXA 5CMAA 2V8LA 1T1XB 2DH3A 1YEHL 2NXYD 3D9AL 4H8VA 5D6DC 1GH7A 2H1PH 3RVTC 4ZMXA 2AJVL 4U1NA 4XCEA 4R7DB 4AGQA 3KPOB 5G5DB 4CC4C 4UQ2B 3BD5A 4F7TA 2ZOLA 4JGNA 4M9OA 4J3WA 1J10A 3D4YA 2CIKB 1RXLA 1Q1PA 3RL2B 4OCWL 4JRYD 4N0YH 1TTCA 3V6OE 1KGCD 1QFWL 3RY4A 3ZMEA 5ALCH 2VLKE 3SJVB 3IDNB 2AAVA 1H8LA 1PD1A 4S2SB 3K5RA 4NT6A 2TRHA 2AQTA 3ZZ1A 3EXLA 1P2CA 1FYTE 2DJMA 3QYMA 5A2CA 4A7TA 4CKVX 4FA7B 5T3ZE 3VFTB 3DA0A 3C6LA 1TQSA 3CZLA 3LEYH 4YC2C 3V4VA 1ASPA 4FTDA 3S36H 4L37A 4XXWA 4RGNE 4LESA 5BO1H 1JNJA 1P5UA 1MCIA 3X3FH 1CC3A 1ACYH 2XXFA 5A3ID 5K59F 3G5XA 1BD2B 1BW8A 4KNSA 1GXEA 1NJ9A 4H8UA 4B3EA 2CKBL 1YYMH 1TQCC 2E7BA 4CMMB 3FCSB 2HMIC 3RZCA 1KTLA 5IHBA 4HMDA 2E27L 4U49A 1JERA 3UACA 2ENYA 3NSDA 3U1PA 1KBBA 3I6GB 4PWEA 4JCWA 3FHAA 3FZUD 4LKXA 4OUOA 1FNSH 5D7KE 1I1RA 1ANUA 5ADOH 3H3BC 2VMJA 3IGFA 4JO3H 1VFOA 2Y36L 1MFBH 4L8SB 3ISRA 5D1QB 2J44A 4BZ2L 4LSUH 4MLSA 1BXUA 4U1GB 2I07A 1EFQA 5EIIG 4QRUA 3QZWG 3P3YA 3PWPE 2A83B 2V17L 1TTGA 4IGBA 3UC0H 4HSQA 2VO5A 3FN0H 2OMUB 1OHQA 4RNRB 2R56H 4MJ6B 1G7LA 1Q94A 5EEUA 1MEXH 4O5LL 4KKQA 3HBZA 3FO0H 5I6PA 4WHTB 2X4QA 3F7RA 3KPSD 2DLIA 2FJGA 1EXHA 3C5XA 4CVZA 2W1NA 3G5WA 2P5EE 4QOKD 1P9MA 1ZHBB 1RUQL 5ACZB 3IGAB 1IT9H 3P3TA 1LK3L 2NY0D 3U36B 4MCYA 3HRPA 1JVKA 2NSXA 2NZ9D 3DVNB 3GNMH 4MXVF 4B9FA 1H8OA 1II4E 4QIRA 4AM0Q 3PGDA 4X6CA 3K91A 3SCMC 4NC2B 2EICA 4IKLA 2PYEA 1B0RA 4HC1L 3G5ZB 2J88H 4GW1B 3APFA 5EU6D 4KH2A 3S2AA 2XWTA 5HGHA 3KWWB 3GJFA 5I1GL 2OR7A 3DX8A 3JUYA 3QFGA 5DJXA 1BAFH 3FT4B 4N6RB 2Z31C 5DVMA 1NOLA 1Y6NR 1TQTA 2K9UA 1GGIL 2V9RA 3FKUS 4ZOAA 5JHDD 3AU1A 3OR7A 4BZ1L 4FF9A 2YPLD 1NKRA 1G7JA 3DJSA 4K7PL 4OY9A 2AEIT 1QLRA 2WQSA 1NCBL 5IFJA 5L4JA 2O93L 5AVVB 3OG4B 4EOWH 3UZQB 4QYOB 4D0BA 4XODA 2IAMA 25C8L 3LYRA 2DQEL 4BXSV 1E4JA 1N8OE 3B7SA 2OL3H 5GJTH 3ATFA 4FXKC 4H88L 4LVOC 1WBZA 1MI5E 1XF3B 1GZPA 3RIAF 1HNFA 5SWSE 4LB8A 2WUCH 5K9QI 4X50A 1XB6A 2Y06H 3UIZA 3RVUD 2X7LB 1KJ2B 3GRWH 5D96C 1X7TA 5ANHA 1F1DA 1WFIA 1WQVT 2C1PA 3SD2A 4KJYB 2FECI 2BP0B 4GBXC 1RVFL 3VJ6B 1VDGA 4MNQD 4F9PC 5H35A 1FVEA 4Y9BA 2VXTL 5LGJA 4OH2A 1HHHA 4YSUA 3CIQA 1TJMA 4FQIL 1IARB 1NC4B 5JW4Q 2H8PA 4AM0B 2FEDD 4UBDD 3B2DC 2F8OA 3W39B 4HZAA 1FUNA 4N9OB 5C8JA 5HHXH 3T2OA 1H3UA 3IDJA 5KJ7E 1IM3A 3HR5B 1HCZA 5GGTA 1JPFA 3MUGB 2IQAA 5LGHH 2OLDA 3JBG7 4WU5A 4CRPA 3LB6C 2BVUA 1HYSC 1TTAA 4MCNA 4NNXB 1RUAH 2EO7A 3PWPB 4M5SA 2OMNA 1E4KA 2FUTA 1DJYA 3RVXC 2JI2A 4IRJB 3KPRE 1VACB 4IU3B 4Y16B 2WC7A 4BUGA 4N2BA 1DO5A 1IAOA 1KC5L 4HDIA 5HY9B 2BW4A 1HJBC 4NWTL 2C3VA 1ZLDA 3IAPA 1A6WH 3WJLC 6PCYA 2VIRA 4GAYB 2MFNA 4X80H 3VWKD 4HAKA 5CSZA 2O61A 3NDZE 3MLWH 3IAQA 1DEDA 4RGOL 2QHRH 4LLVB 3QNXB 2Z7YA 1OK8A 2A74C 1R6VA 4ONHA 4ZX3A 1XD0A 3ARDC 5GS0C 4AL8C 5FM5O 2JIXA 4Q7DA 2N7AA 3MODL 3UH8A 1EANA 2CJUL 4LBAA 4MB4A 3UFIA 2DLFL 4XBEH 3MHZA 5K33A 1CR9H 5FOJA 1SEBA 4F7PB 2WIIA 5D2NB 5CGMA 3BKCH 2MNUA 2WZ0A 2F08A 1Z9MA 3MTRA 1WCBB 1KMGA 2XZQH 3RDJA 2JXMB 4Q89A 4W6WB 5D7JA 1G9NC 4YO0A 4DEWA 1QW9A 2QKSA 4CSPA 2CLRB 1SDDA 2QVMA 1E0OB 4N2EA 2X3BA 2WXRA 2EABA 3SPVA 1EDQA 5DZLA 3RPBA 3KYAA 3VD5A 5C2BL 2LLGA 3EOTL 1L0YA 5DJAB 1T0MA 1NOAA 2Z8SA 1JZ5A 1N5AA 3PJLA 5HHOD 5DUML 4G7VH 3KWTA 3RWIA 4Y2DD 4M02A 5C09D 2XZAL 3E9UA 2YSSA 3EO0A 5DD1H 4JFOA 4NUGH 2ZE0A 3NCEB 2F19L 2GSIA 4LSRL 3QHZH 2P46B 4JFYB 1BIIB 3PJNA 1FDLL 4ODSH 4AV0A 2FO1A 5FM5M 3VGDA 2R69H 1AQDA 1NANI 4C47A 1DJZA 1PKQA 2J20A 4Y1AB 5E00B 1M7IB 4GKSB 3W9DB 2HT4D 5FEBA 5MEPB 2CKBA 2C9VA 2XV2A 4NZUH 3FRPB 1DVYA 1K8DA 5D6DA 5FO2A 3UAJC 3VDAA 4F7MA 1CGWA 2JKRM 5F1IA 1FFPB 4MBRA 1OY3B 1IC7H 2AQRA 4OM1H 2VZUA 5A43C 2NMSA 2F7OA 1OGSA 4P5TD 1SVZA 3S3JA 3VXSA 1DQQB 5ID0A 3ILQC 3NACL 4MVBC 1XF5A 2AQQA 3QJTB 1J0HA 1SJHA 3QIUB 4GAFB 5DU7A 1TVHB 5MERB 4NZ8A 5KVFE 2DWDB 1KXQE 4N8VG 3E2HB 3PL6D 5BW7C 1N19A 3IKCA 3M1BB 3TV3H 5HHNB 1G9NL 3NZ8A 1H9DA 2HKHL 4DSYA 1DLHB 4S1DC 1AIZA 4HALA 4RSYA 1XX9C 2NZ1A 3DX7A 5D5ME 4AGNA 2BRRL 5I5IA 5ISZB 3VQLA 1MFAH 4BZ2A 4X2UA 1IB5A 1MAKA 3CSFA 3P0VL 1BQSA 2DQTL 4JDTL 3KPRB 3RGHA 5DURD 5J1TC 1J86A 2YD3A 2Z34A 3MO1B 4I85A 1BZQK 3V52L 3FFDB 4KXBA 5C3IA 3L13A 5DD5H 4N90E 3IAGC 1KIRA 4Y19A 3CHPA 4JGJA 2FX9H 2Z8VC 3T0EA 3C87A 3QUXC 5F6HI 2XXMB 1MNUL 1UXWA 1AFVH 4W9KC 2JB6A 4F8OA 1HZHH 4N2DA 1JHTA 1A5FL 1T5WA 3QI9B 1JZGA 4IW4C 4XNUH 3UTOA 1GS6X 3FT2A 5G4OA 3CK0H 4EUPG 1FH2A 4FQCH 1KPUB 4I2XA 1DQML 3AQZA 1WBYA 5CEZE 3DTXA 1OXYA 4LKCB 3WTSA 1IJ9A 5MHSE 1JTOA 3FOMB 1S7TB 4OJEH 1C8PA 1X44A 4E9SA 3IU3B 1M05A 1TVBA 3E1ZA 4TXVB 3SYAA 4K2UH 5DT1L 2XV6B 4MDIB 4KI5C 1IGML 3N40P 3ERXA 5KVDE 2XWJA 3O45B 5L4FA 2K3HA 2CUIA 4XP5L 4BZ1A 2B2XH 2V33A 3QULA 4JKMA 3SE9H 4G8IB 1OP4A 2XJLA 3HPLB 1T6BX 2MPAL 3FAXA 1F6LL 4KVCL 3SJVD 4G3YH 1M4KA 4EI5A 3P02A 1T6VN 4J1UB 5I9QB 5T33L 2DQDL 1E2ZA 3T5WA 1L9TA 1QSEE 1XGZA 4Q6YA 4N1EA 1JF6A 2Y5QA 3MRDB 4NQEA 4YGVB 2Q86B 3P3SA 4U6YB 4EQ3A 4IRZH 4YE0A 1HDMB 4HIPA 3NJLA 4U1LA 5TFSH 2ZCKH 4JVWA 4KY1L 2CK0H 1UZGA 1HE8A 3QH3A 4KI1A 3FS9A 4P5RA 2B59A 3BC9A 1IC4H 1P53A 3NPSC 4UINH 2B1OA 4UB0H 2NY3C 3FRUB 1RPQA 2YEZA 3D0AA 2HWZH 2XVGA 4GO9A 1CE6A 1JHLH 1CN4A 3WNNA 4RZCB 3UTPD 3CMOH 2GAZB 4JDZA 3TC9A 1BD2D 4OF0A 4AJYV 5ABDE 4FFZL 1LEKA 3KBPA 1WK0A 4QGYA 3N50A 2VDRL 3SCMA 4LSPL 4ZTPL 4U2ZA 3N1PC 1MLBB 5F7MC 3S4SA 3TX4A 3WNOA 4BA8A 2HH0L 1A21A 3M86A 2ERJC 5GGSY 3ZO9A 2L4OA 5DWUH 2XI9A 3FT3B 3GSRA 3ARFC 1MXGA 3OPUA 5H2BA 4QR7A 4J3VA 5IFAL 3FFCA 5ALBH 3F7YA 3U6RB 1U8OA 4X7SL 3VTTA 3QYNA 4LVHB 4K3JL 3QWOB 2H6UA 4IBQA 4Q9RL 5F9OL 5D1QD 4YE4H 2OYLA 1KPRA 4TQ8A 4TNWF 4WI0A 1M3JA 3BCDA 5CP7B 1IMHC 5BRZE 1UA6H 3HEIB 3GI9L 3O81A 4RFNB 4Z7QF 3G5YB 5FDYA 2NQCA 3NQIA 5F7HA 4ONGH 1EXGA 1QKZL 4OF8A 4MB5A 4NEHB 5J11C 1CI3M 1YLBB 4Z6AT 3OZKA 1DVFA 1KELL 1U8LB 3FU8A 4LU5L 4NAMA 4WO4B 4ALAC 1S9KC 5EU7E 5GJSL 3ARBA 3ZR5A 1GCFA 2X6AA 3GMLA 3LXAA 2WJ7A 1HC1A 3LIZL 3SGDH 3UERA 5DJZA 2ZCLH 4TQIA 3QEGH 3VFVA 4PJEE 1HINL 3QIBB 3V0JA 4BZ2H 1OSYA 4OTXH 3Q2LA 4L0ZA 4E9TA 2E7CA 2IWGA 3SKNB 3ZTJG 3TNMA 1QLEB 1A14L 5ENWA 4KKAC 4MJIA 4QCIB 1EEQA 1CGVA 4DP7X 2YMXL 1N64L 3OJDB 2V17H 3UX9B 2VSDA 1XBDA 2C3WA 1O5PA 4NQQA 4DO5A 3A67H 4G8FA 4NGHH 4YSEA 1KCUL 2OMTB 1JBJA 1SZNA 4PJCA 4RRPG 3TO4A 4AT6A 4DP0X 5B3NA 2GKIA 3MV7A 4NPKA 4WLCA 4DFHA 2WZAA 3EYQC 3LHPL 5EH1A 1G7QA 5AAMC 5T3ZD 2CH8A 5C0BA 3TURA 1E28B 2D7MA 3AREA 2YD5A 3CFQA 2DMHA 2RHEA 3GM8A 1CXHA 5INCA 5K5YA 5I8CB 4YAQA 2VERN 3AROA 3HE7B 4NQCE 1PKOA 4M3JA 5DQJA 3EDFA 3LS5H 2L7JA 4PRDB 3DOHA 1UD6A 1CD8A 2TRYA 4YZFE 3O4LB 2A74A 1OZTG 2YWZA 4XPFL 3CUPA 4JPQA 1ZT1A 3NCYP 3FONB 3TIDB 3HZYA 3H9HB 4ALAL 3SDAC 1U92B 1V8HA 4IBWA 4N8CL 5E8NA 2YAOA 1BPVA 3U9WA 3EJPA 5AAPA 2VWEC 4NENA 3DX0A 4YLBA 1T21A 1DLFH 1NCBH 3B6SB 3NJFA 3BZ5A 1NC4D 3CX2A 5AB0A 1XGTB 4YFDB 5AZEH 4PJBE 3AAZA 1NBZB 5GSVA 5D7KD 1T66D 2VH5L 2ZOTA 3ZDXF 3AS2A 1KF9B 5FOBA 1QUPA 2BOCB 5DWPA 2B1HL 4HJGB 2Q7YB 4YHPA 3STZB 3I9IA 5CEYA 1RIHL 2BC4A 1KNOA 2ZXEB 4WGKA 1LJMA 3CSTA 3WTXA 1KFAL 2J1YA 1W0VA 4N0RA 2OTUB 1CFQA 3FDWA 3P2DA 1USQA 4G6KL 4AMWA 2K3TA 3HLAB 3PWPD 3TEZA 1MVFA 1IAKB 4LARH 3HTLX 1BM3L 4WKZA 5TDNB 4FQHA 3BFOA 5I71C 1YMME 4IRJD 3QEHB 5GGVH 3QQDA 4RRPA 4A04A 1UM6H 3UJTL 1F2XK 4QXVA 2HX7A 1A6AB 2VKWA 1KN2H 1OAKH 3W56A 1AMXA 3ELQA 3MACL 3P3UA 1LO4H 4AK2A 4RGMC 3QJZA 3CMGA 1SN2A 1FORH 4F5CE 2HJLB 5I6KA 2XG4B 4JFSA 2PTTA 2P5ED 4QRTA 4HU8A 3SDYL 1SXCA 3U30C 4ODBD 5J6GA 2AVFA 4FLSA 4ONOA 2JJWA 2XWDA 4DGUA 3EJTA 5EO1A 4AVHA 3MNVA 4XCFH 3UAJA 5JOEA 1ZV9A 2GT9A 1DJXA 1J1PL 1RUMH 3ZGIA 1V7ML 4MYPA 2E9WA 4NHUB 2KDGA 2AQ2A 4BJLA 2D0HA 4BSVB 4Q9BA 4FZ8L 5HYIA 1XF4A 4XE5B 5DJ0A 4MMXB 4A2GA 2IMMA 5T3XH 1BECA 2VL4A 1X4YA 2ZTBA 1XGRA 3B2VH 1ZA3B 3U0TB 3UTZA 2EC8A 8CGTA 7PAZA 2WY3B 3QPXL 2R0LH 4YVNA 3T09A 3BO8A 3QRGL 5FGBC 3GBDA 3EYSL 5JR1H 1CDUA 4Z7UF 3P73B 4HIIB 4NWTH 5HGDA 1XMEB 3GDCA 1E6JL 2CBTA 3VYOA 3K71B 4N2IA 1RP8A 1I1YB 2BXZA 3K81A 3CC5B 5DJ2A 1GZHC 2K70A 2AVGA 4Q56A 2X12A 1RZ8A 4H26B 4I89A 5JXED 1PJ9A 3X2QB 3WEOA 4ZS6C 1J5CA 2HT2D 1BJMA 3CU7A 1YEIL 5FV2A 4HK3J 2AZUA 2ED7A 2FO4A 3MGTA 2N4IA 2VXUH 2WO2B 3WIFB 5CKGA 3QPKA 4UV4L 2AANA 4N0UB 2R0ZH 4IMLA 5IIEA 4J6IA 1PNCA 1OTTD 1M9SA 1KCLA 1QLFA 2A9CA 4JG5A 5E6SB 4FFZA 1FGNL 1K5NB 4RMBA 2VGLM 3KBEA 4I3GA 1HL5A 4Y1AD 4M93C 2ESVB 3F6IA 2WQXA 2YA1A 3AY4C 3UPAA 1TEYA 2AAAA 5GSRA 3VXUA 2HXAA 4BHUA 1UJ3B 4XP1L 1WAAA 2WZ6A 1KBPA 1KN4H 1T3FA 3TIEB 1T20B 1W6WA 2ORBH 2QFRA 4WI3A 5E9AA 1JS4A 3UP1A 4Z76A 1IZKA 4ZO7A 1PF3A 1ETA1 1E5AA 4QLRA 3QIUD 3POCA 2EDWA 2NCEA 2VR3A 3FU7A 3DPBB 3GMQB 1MCDA 4WEEA 3QDJB 1HOCB 4JM2A 1JGDA 1DQLL 1PLBA 3F62A 3G6AA 1FIGH 2CUAA 4DP2X 1CDGA 3IETA 4I48A 3G5VB 2XN9B 2DQGL 4HGMA 1S7SB 3M7OA 4KZDL 1G9MH 2I32A 1YMMB 5LNEA 3KPRD 3IKKA 2ICES 2IADA 3APDA 4M4RA 2ATKA 2NLJA 4XZUA 2JV6A 3B9AA 3UROR 4M43H 1F4HA 3TO2B 5INDB 2BSRA 2Q9OA 2Z6FA 1O6SA 4HHAB 4RMRA 1JDDA 4D3CH 1A2YB 4QPEA 4N0CD 4Y0GA 5AG9A 1JK8A 4MMYB 2C4FT 1YYLH 3D51A 4AEFA 3QI9D 4RISH 1QTYT 1HYRC 5HD8C 1NSNH 4L29B 4TSBH 2ZX7A 3SBRA 2WLZA 1BXVA 1JNHA 4HMCA 2EDKA 4XN7A 2CHZA 4I4WA 4X4YB 3LIZA 3GXFA 5CFAA 2IDTA 3JWNC 1GHFL 1SDYA 4AKOA 5IB2A 2W95A 3G7TA 4JFXB 2MKLC 3BQUB 4XNMB 4WAFA 4ZUSB 1F42A 3QG6A 4BFEA 4DGYH 2XN2A 4ES8A 2LU5A 2ZX6A 5JW4M 5I8EA 1UM5L 4N2HA 1NIBA 1I9RL 3RJQB 5B1CA 2APXA 3RIFF 3ARWA 1LO0H 2E47A 4GUPB 4GKZA 3PGCA 5HI3C 5DMGC 3BEWB 4S0SD 3K72A 4KY2A 3VGFA 1UA3A 3ILPB 4Y88A 3T6QC 1U58B 2ZXBA 5I73C 3QWRD 5FGCE 2A6JA 5FYLL 4FRWA 5HPOA 2YD8A 3RX9A 1HCFX 4FCAA 1CB4A 1JD7A 4L3AA 3HMWH 1NCJA 1EJOH 1JGVL 4M3KB 4PLJD 1TOXA 3ATBA 1TZAA 1J8SA 2ZAIA 1SHXA 1FSKB 3VI4B 2UVFA 2VC2B 5BVPH 4AYDC 4V11A 3U46A 2JQAA 1OQXA 4PJFB 3IJ8A 5IQOA 4YFLI 2ATAA 4QT5B 4WDIA 1XGUB 5AB9A 1EPFA 1K4DA 4QXGH 5T1KB 3TBSA 1IGMH 2C9AA 2IH1A 5AOIA 4K7PX 4XMKL 2MCMA 3BDBA 4DIXA 5DMKB 3FTXA 2DQUL 2J8UF 1IEAB 2K7PA 1QFOA 3QUZC 3RYMA 2BSTA 1MHCA 3OGCA 4LLAA 1WYJA 1UCBL 4UQBA 5DVLA 4GXVH 4KPHL 3WIIL 1IE4A 5DI8A 2NPLX 3CSYB 3C8HA 5BZWA 5HGBA 1A9BB 2PR4L 1G7HB 2LT9A 1CGXA 1X4ZA 2NTFA 1RERA 3W3BA 4F1SA 1XF2B 3F3HA 2ZJSL 4KNTA 3B43A 3QARA 3VAEA 1H9VA 4MJ5A 5C92A 3HI5H 1JV5A 5AVRB 4G9FE 2VDKB 1FL3B 4X98A 1JDCA 4R6UA 6PAZA 4MCMA 5D1XB 4UTAH 4O4YH 2DQFB 2DB8A 2P5WE 3MRJA 3O41A 4HIHA 3JWDC 3U1SH 3GXUB 5CINL 1N70A 2XVBA 5AOKA 2HN7B 3OX8A 1FO0B 1RK1A 1DVQA 2KZKA 2A38A 5JORB 4HXBH 1BJ8A 1TG8A 2VABB 3MLXL 3EFDL 4ERSH 2CO2A 4FFZH 4BDVB 4YHMH 3LN4B 1A6ZB 3RWGB 5L8JB 1UACH 5DS8A 2HUHA 4M6ML 3K2IA 2JKXA 3OD3A 5TE7L 3DRQA 1KZQA 5I6LA 2VLJA 4IM8A 4G5AA 4OJCA 4AZ8B 2GIYA 3QHFL 3AM8C 3W1ZA 2JKTM 1R3KB 4IOFD 1UT9A 1UOLA 2R0KL 3SDAA 4WK0B 5MHSD 2A6IB 5E5UB 3L6FB 4ZD3L 4XR8C 3VSVA 3FSVA 2BIIA 4QWWC 5FYKE 1JZEA 2YS4A 1FLRH 3IJ7A 1RZFH 2HFFB 4AJVA 1R3JA 5KSBE 4DP8X 2VDNH 4GT7A 5LXGH 1BBDL 4HGKC 3T8XA 3DK0A 3QHTC 2EP6A 2O26U 1SXAA 3QIBD 5E8DL 4OFYA 4NN6B 2R2EA 1Z9NA 3UBXA 2P44B 5HP5A 4K7FA 4DVBB 1U3NA 1UTDA 2BNUA 1P7HL 1UVQA 4OLYH 2GUOB 3BLBA 3MOBH 3WIHL 1OE3A 3KS0H 2J8HA 2VN4A 3A22A 5LWYH 3TFBA 3LH8A 4GQZA 3MGOA 3MJGX 1K72A 3LKSA 4Z78B 5CBAB 3K0WA 2GCYA 3CLEH 3ZTNL 1PDKB 2Y6SC 3GBNL 4QY8A 4X6DF 4E0RB 4YWGH 4OLWL 4KZ0A 4KKLD 5JPMA 4APQC 5DJCA 5I1AA 4ZW8A 1U8QA 4LSSH 1NCDL 1U8CB 4ILDA 5AZ2L 3GMPB 3CQPA 5HHVH 4GG6A 5KN5A 3ZDYE 4ZTEA 1HL4A 3FW6A 4MZIA 4WW1B 1KLFA 1X9RA 1MPAL 3F6LA 3KNBB 4PRIB 3HZMB 3D05A 2YC1A 1IGCH 3DSNB 3MA7A 3RDTB 4DTGL 3AG2B 2J4WL 4FQ1L 3O4LD 5F7DB 1S46A 1TYEB 4NRZB 2YQ3A 1ES0B 1OAYL 3HAEG 1FVDB 1RZIB 3KWVA 3QBTB 1J0YA 5A2AA 3P0YH 4ZPTB 1M56B 5I0WA 1OT1A 3CWGA 1XL4A 1Q9KB 4PRPE 4X4ZA 4DKFH 5CZVL 2WSPA 4NIKB 3L2LA 4UYQA 1EBPA 1NM9A 4FNTA 1WFMA 1U95A 5EUOE 1BFSA 4CVWA 5TDPB 2OZ4H 1RU9L 1I4FA 3JTBA 3PWJA 4ZXBB 3WD5L 1WBXB 1I7TB 2ZWZA 2IWKA 2Q7AA 1QEXA 3ECWA 3V6FA 1MLCA 1XD1A 3PWVA 4HJ0C 3VFWB 3C8KA 4H20L 2J7LA 2DJUA 4PS8A 4ETQA 1AGBA 2UXFA 2YN3A 1KCWA 2YD7A 2Q2EB 3UTTE 3CLFL 4P5SA 3S5LB 3L3JA 3MRNB 2EDRA 3GXNA 2TAAA 3RWJB 2WMPB 1D2PA 3O6LH 2UXVA 4TNFA 1EXUA 4NCC2 2VDMB 2OMWA 4PS3A 4V33A 4PRHB 2MHAA 4OI7A 3G6JF 4X83A 2W8CA 2IPTL 5FV1L 2BZ7A 3PHAA 5D71L 4FI6A 5KSBB 3TA3A 1FZKA 4UANA 1I53A 1SXZA 4MA8L 2APTA 1JMZA 4PJHB 3Q48A 3UG4A 2X2YA 3T0AA 1LE9A 4U1SB 1PFCA 2PYFA 1QI5A 1Z3RA 3B2MA 3MREB 1FCGA 3ZHLA 4G6KH 5IBLC 1A6VH 4OZIB 4ANXA 5I1KL 1AHWC 1Q9LB 1YAZA 2FSEA 1A6UL 3IT8D 3N55A 1NGZA 3BUYB 3M7FB 4A38A 4O02H 1MWAB 1T1ZA 2DMCA 1UOWA 2DQCH 2H2SC 1CJYA 3RILA 2YXMA 2XT1B 2Y7QB 2BIMA 4IDJL 3TVMB 4Q74A 1OPGH 2RMNA 3ZDYB 3AMLA 2NOYA 3RY5A 3W57A 3LD8B 1SEQL 5C3TA 5D70H 2AEPL 1HI6A 3IK2A 3KXFE 1B0IA 5KYWB 2YZ1A 5E9DA 4XP4H 3WY2A 2FATH 2O6CA 1U2YA 3OZLA 3CPUA 5MP6H 2LFEA 1S3RA 2SEBA 3D07A 1I7RA 3K1DA 4RWHA 4TTDC 3FTUA 5IEHA 5EZPA 3O3EB 2OBGA 1JZDC 4XPGH 3A5VA 2Z4TA 4FFTA 1DE4A 5DS2A 2D4FA 4X8GA 4HMEA 2UWEF 1BQLL 1L9QA 2Q2LA 4LCVA 3GSWA 2OI9B 4OIIH 4KVPA 5SWZA 1ZLWH 5HVHC 1F6AA 5HJDA 2ESVD 4LIQL 5FB8B 2Q76B 2FD6H 5GGRB 1WG3A 2ZPKL 5E95B 2GSMB 1ZCRA 2VR8A 3LXCA 2WUBH 3FT1A 1XH3A 3O6ML 4YDZA 1PNDA 4P57A 1OB1B 1X6LA 1YNLH 2Q6WA 4QKTA 3MOAH 4BH8A 3PV6A 4AGLA 1AYRA 3MCG1 4ZYKB 1KJVA 4XVUD 4E9QA 1WIUA 4EDXB 1ZVNA 5EUKB 5B39B 3I6LD 4FCHA 4KBPA 4YSQA 1MQKL 3QDJD 1EVUA 3MR9B 4Z7VA 2Z92B 2C9QA 3EDKA 4UT6L 4LGPB 4NWUH 3WY3A 1W72B 3WS3B 1FC1A 2K78A 5FHBH 3AXIA 3GIZL 5JIIA 3LRSA 1PVHA 2XN9D 8FABA 4IKIA 3UTTB 4LK4A 1YMMD 2P48B 2RQ8A 2W81C 3UBFA 5GGVY 5KSVB 2ZG3A 1DDTA 2IFFL 3MLUH 4AUUA 5T5NF 4JKLA 1XIWC 4PP2B 4AQEB 1EZUA 1CDIA 2WK2A 1AR1B 3V2AR 5TPWH 3VA6A 3VI3F 2FL5B 1H5BC 4ZX5A 3QQ3B 4C56B 3AS0A 4R90L 3DROB 5ITFB 1GSMA 5EA0L 3QAZC 4A68A 3FXIC 4MDJA 4BK4A 4EPSA 4NO5A 4AH2B 3GXPA 3VWJB 2J5WA 4N3TA 4PV8A 5H94B 3DV4A 2EADA 3S37H 1UG9A 2Y1VA 2QSQA 2YR3A 3VFPB 2NR6C 5LNGA 4OBRA 4PVNA 2X0UA 2WXFA 2ENSA 2OKMA 2E9GA 3BQUD 1UXSB 2NXYC 4XP9L 1MUJB 3FUDA 5TF0A 3WLBA 2HLAB 4XP6L 4GO6B 7FABH 5EBMA 4MXQC 1SLVA 3KEDA 1RHHB 3WTWA 3OAWA 3PQYE 2IOIA 2G9KA 4R84A 4RDQF 1L7TL 4W9GC 3BE1L 4Q8BA 4XHJD 1PSKL 1RJLA 3KXFB 3ETBF 2FWOA 3ASOB 3QO1A 4FQXA 4B50A 5AYTA 2CUHA 2J21A 4KK8D 4GLRI 1YNKH 4JJOA 4KDTC 5KTEL 3UYOD 3BKMH 2R0WL 3X11A 4PU2A 2V2XA 1CG9A 5CJBA 1A0QH 4RA0C 3G3LA 4IJ3C 4CADA 5T1KD 1V3JA 5AYQA 5L9DH 1FE8L 3SDXF 4B96A 2G75B 3HAEH 3RNKB 2FGWL 1WA0X 1HFUA 2DTSA 4R8WL 5D7HA 5DD0L 1ZLVH 4DKAA 3NZHL 2YKKA 2HB0A 3LXUX 1MFDL 4H0IA 5DHDA 2IG2L 3L3GB 5A3IC 3EFOB 1FWXA 3REVB 1AXSA 4MB3A 3SGEH 2XTJB 3BUDA 4IU2A 2H47C 3BP5B 4D7PA 4GW4B 5FO8B 1JUFB 4R4FH 2XA8H 4P5MB 1CL7H 4PRAB 1P4BH 1UT2A 1C12B 1FG2A 5E99L 4OZHA 3O6FC 1AYOA 3BPCB 3HNSL 3P1VA 4WNQB 5DD6B 1GGCL 3BDYL 3FZUC 2EH8L 1NM4A 3M6DA 4H8HA 4NZRL 3SZKC 1OT4A 3NEXA 4I18C 4XMKH 4NUQA 3KCPA 3D12B 1ADWA 1K3IA 1LM8V 3UCRA 2PKDA 4QRRB 4I9WE 3QJQB 4POYA 3GRBA 1F56A 4E42A 1FBIL 3TH4T 2BW5A 1FNEB 1JNNH 5EZLA 1MJ7L 4F7KA 1KULA 5CCKL 4PN6A 5DRZB 4XNDA 3GS4A 1ITBB 3S5YA 5B7MA 1D5IL 4MKTA 3HVDA 5I5MA 3EZJB 1YEFL 1F2QA 5G55A 1KIPA 4OGQC 4RIRA 3V4UL 1UURA 2OQJA 1GC1C 1U9KA 4JCMA 4BUQA 3PJSA 2NY0C 3KGTA 1O9WA 2AS5M 4MXWL 4CUCA 5EBWB 1MCJA 2ZXCA 4KQ3L 2E7LC 1AD9A 4E5XG 4Y4HB 4S0TD 2K4AA 3PQYB 3R06B 2EDHA 2Z91A 2O4EA 4TLSA 2IBZX 3UTSA 4X9FA 4P2RB 1QZ1A 3TYFB 3ULUH 3BT2L 1U8MA 3GIVA 4PS7A 1K5WA 3HC0B 4U1MA 1SYSB 4NC0B 2BLFA 3UJJL 2V3EA 2AFNA 4LLMA 4OZ4A 3WTYA 3S8WA 4W9DC 5CJOL 3HHSB 1SFHA 4OCXL 2XV3A 2OL3B 3ZKMD 4Z0XA 3KLLA 1YN6B 2WQ8A 3KPQB 5JIKA 2BH0A 1NDGB 4JAMB 5E8DH 1RZKC 3RDTD 3OHXB 5CMAB 3VXTA 1JWSA 2ZUQB 4GRWF 3RVUC 3WFBL 4UQIM 4UI2A 5I17A 1OAXL 1UKTA 4U1NB 3WO4B 1FAIL 4XCEB 3S97C 4WEBL 1HE7A 4NBZB 3RTQB 4OFQA 2ZOLB 1RUPL 1BZ9A 2Z7WA 4NUMA 2ZUTA 3WE6B 3RPIA 5BJTA 2OAAA 1GC1L 2PYEE 2R7EB 4I5BB 1AHWA 3FBKA 4KXZH 3TT3L 4ODTH 2VXQL 2G3MA 5JQ6H 2Y7SA 3E6HA 4ABUA 2A9AA 4OF6A 1ZMYA 3RVVC 4ZXBD 1P2CB 3IMUA 3N44F 1OAUH 2F15A 3QT2A 4CN4A 2CO7A 4M61B 4ANUA 3IJSB 4YDMA 1I9EA 4MA3B 3GI8L 3MCLH 4OLZH 5D9SA 2H41A 3P54A 2X4TA 1ZHNA 3V4VB 1AVAA 1JRHI 3SYCA 4XOEA 5BOZG 5D4JA 4HX1B 3M8OH 1MJJA 5K9JH 2CGYA 3Q1SH 4PCKA 3IBEA 1P5UB 2G4GA 5AOZA 3T3PE 1CF1A 4AXWA 1NJ9B 2G3ZA 4PRHD 4GQ9L 2WQWA 3BPNB 4NN5C 4LLQA 5SX4H 5FYKD 3CDFA 1EK3A 2O5ZL 2BSDA 2VNCA 1KTLB 3GJFK 3RZCB 1TZGL 3QISA 4FYQA 2ADFL 2H1LM 1ADQH 1JZIA 4FP8L 2ZNWA 4FADA 3N6YA 4PY7A 3RFRA 3BAEL 1K6QL 1UHVA 1VEOA 4HUKB 1GJUA 1YEEL 2JB5H 4LKXB 4W4OC 3LX9A 4HBCL 4FJ6A 5AVTB 3Q06A 3M17B 4OD2A 4X8XA 3H42L 1WFJA 4NPYA 5IB3B 1S7WA 3T9WA 1Q0YL 2KLRA 2MCG1 5FR3A 1KTRL 3AVEA 4GIPD 4L5FE 4XC1H 2X53A 1KBGH 3DKHA 3L2NA 5IJBC 1T04A 1YUKB 1GY1A 5F71A 1EHKB 3LPWA 4QRUB 2CGRH 5CN2A 3TVMD 2BSBA 1JPGB 3LQAH 4IGBB 1FH5L 5B38A 4YBLC 3F7VA 4P04A 5AVYB 1E5YA 1FYHB 1XIWA 2O5NA 4U0RB 4HPOL 5MI0C 1OWRM 5B7EA 3KHQA 1IBYA 2DLHA 1H5BA 3WKNA 3WEAA 2X4QB 5GXBB 4LLUB 1AHKA 5EDXA 4CVZB 3KYOA 2Q3XA 4EI6A 3FAWA 5AFAA 1JYNA 4XMPH 3C2AH 1A4KB 3W2DH 4MCYB 4PJXF 1DVXA 1ZRUA 2B3RA 2JKIS 9PCYA 1KGJA 4ODXA 3PGDB 4X6CB 5KJRL 1R5WB 2X4RB 3BAWA 1R0AL 1WFTA 4IBTA 4JHWL 4OFPA 3BJ91 2HT4C 3GJFB 2VISB 5IG7A 1CCZA 4U2YA 3DX8B 2J73A 2BO0A 4WUKL 2VL5B 3ULVH 2UY7A 1FN4B 3JSSA 4P5TC 4UTBH 1G7JB 1A1OA 3DX6A 2KBGA 1QLRB 4NZFA 1I1FA 4O9HH 4QLWA 2YIHA 4QNPF 3US0A 5IFJB 4KVNL 5EEYA 2CO3A 2WYZA 3OTTA 5A2IH 1ZJAA 2IAMB 4BFIA 4M7KH 5FXCH 5TF1L 5T1LA 2EXWD 4FQJL 5FA3A 4YHOH 4XN2A 3HS0B 4WV1C 1GZPB 1F45A 4LDLB 4N2GA 4TSCL 3UTTD 3L1FA 4U6XA 5I18H 1CBVH 1RKRA 3K5SA 2DQJL 3T3PB 1AZBA 4FKHA 1ZS8B 2C1PB 3GKZA 1AR1D 4UT9L 2EDTA 4GY4A 1E5BA 2GTWA 3WJMA 4KZEL 5H35B 3WEXB 2YZ8A 1N7MH 2KI6A 2Q5BA 4G6AC 1A8ZA 5LGJB 4GAJL 1WAEA 3LEVH 1HHHB 1LNUA 1OCCB 4C59B 1EGJL 3UZVA 2WCPA 3KJ6H 5LDUA 3VWJD 3QPQC 4MZRA 4JZJA 1INEL 2ZSWA 2BY0A 4MQSB 1ITCA 3QA3A 2NX5A 3WN5C 4FFYL 3D1MC 4J6RL 4FG0A 5DK3A 3TCLA 1D2OA 1S5HA 2NY2B 2WB7A 3H7LA 1HSBA 3R1GH 3IDJB 4R7XA 1IM3B 5ACMA 1RZ7L 1JPFB 1P5VA 3F5WB 2IQAB 2ZAGA 4XTRD 2YK1L 3I74A 4YUEL 3LH9A 4U4BA 4ORZC 2E5EA 3O6FA 1GYAA 5DVKA 4FQLL 1WZAA 5IY5B 3TWYA 3SN6N 4IJTA 4KX9A 4Y5VB 4E9LA 2XTLA 4XCCL 1S7VA 5HI5D 2DI7A 4I3RH 4FQ2L 4ODVH 1B0GB 3PNWA 1IQWL 4ORGB 5E08L 3KXFD 3A6BL 4RH4A 3UGEA 1IAOB 3QNFA 4HDIB 1FV1A 3BP6B 2C3VB 3MLSH 4PJ5E 4Y19E 3DNKA 4O58L 2VIRB 3TASA 4FLOA 4AW4A 2WV3A 3T0EE 5CSZB 2O61B 5F72S 4IOSA 5AL0A 2Q8BL 3K6NA 3VGAC 4LVNB 1CK0L 5PAZA 5I28A 3ZDWA 4ONHB 3X14B 1CZ8H 3KEHA 1C08A 1TO4A 1F8TH 4J3OF 4JL1A 4YX2H 4RAVA 4PR5A 4QRQB 3SE3C 4I2XE 2OK0L 1SEBB 2D9QB 2WIIB 5CM1A 4NYLA 4TUJA 3ISWA 2DDQH 4JFWA 4AE0A 4OAWA 4PRBB 5E94A 1MFCL 1QBMH 5D7JB 4Q6IC 1H15A 4LEEA 4YO0B 5SV4A 1MCPL 4RQQB 2E7LA 1UXLA 1SDDB 2XTJD 3AW5A 3QSKB 4U4IA 4AQAA 1YPZB 4F80A 5HHPB 3SPVB 1NEPA 3CZFB 1M7UA 4NAQA 4BFOA 3K74B 3MJ8A 3JV6B 4MKMA 3WNIA 2PPCA 1QYGL 3U4KA 3EGDA 1KT2B 1N5AB 4W1TA 1KJ3L 1TSHA 5GGUA 4BELD 4H8WC 1LHZA 1WGOA 3NFNA 3CVDA 2YSSB 2AGJH 4JFOB 4NQEE 2GSIB 4YOKA 4PV9B 3VSTA 3PHOA 5GZND 4OFVA 3LZRA 3ZIYA 5JIHA 4L8SC 1FGVH 4ONFH 4QMEA 4QRRD 1IGIL 4U7KA 5D1QC 4BCZA 3ZSSA 2YQBA 1OP5H 4ATTA 1PKQB 2EXSA 3WOVA 1Z32X 2EXTA 2D03L 4U1GC 3GYRA 1AC0A 3ZO0A 3C60A 3OMZA 1RZJH 4G71B 4NZTL 1K8DB 2VLRB 3I75A 5KSUB 2AXWA 2BDNH 3BP4A 3OLIA 4HKBA 5F1IB 4F7MB 1ACZA 4J3TA 4OF3A 1WC7A 1GYCA 1URZA 2BOLA 2YA2A 3V0FA 3X13A 2YD6A 3T2NH 1GJIA 5TH2A 4KV5F 5EWIL 2LR4A 1XF5B 2EAEA 5DA0B 2GJJA 1OWWA 1SJHB 3OSKA 5C0JA 1UYWL 3VO0A 3NTCH 4BK5C 1DL7L 2YBGA 4IBSA 2C3XA 1KWKA 1VADA 4HH9A 3IKCB 1DO6A 3NZ8B 2ZKXA 2P42B 4JO4L 4YXHL 4YXLH 1BZEA 3Q8CA 3NESA 3HCVA 3BZ4A 5JW4R 3VH8G 1KCRL 4HS8L 3DX7B 4Y4HD 1ET5A 1XH0A 2VJ0A 3PQYD 4MWFA 3H55A 4JKNA 2H3XC 1FBIH 2O72A 2ZYRA 3FFCE 1KTDA 4P2RD 4H8WL 4PJ7A 1OANA 4F37F 1KIRB 1JYWA 4Y19B 5MENB 2D7QA 2ZKHL 4S1RH 4HV8A 5J5EA 1Q72H 4G7YL 3T0EB 1KGWA 1UXWB 2CO4A 4XN9A 2JB6B 1AXTH 4HU2A 4H25A 1JK9A 1JHTB 1N6VA 4NM4H 1BJ1H 1LO5B 1T5WB 3N04A 1YA5A 1MCRA 2W9DH 2KL6A 2Y2TA 4GIOA 3FT2B 4PJAE 4Q14A 3ROLA 3BD3A 3FH8A 3WFEH 4N2OA 1HJCA 1WZKA 3GZOA 4JFDA 2DJ4A 1WBYB 2X1WL 2AERT 1HIML 3DTXB 4N2NA 1LWJA 4JFZL 4LEXL 5BUPA 1T2JA 4NRYA 1WA2X 3II1A 3MNZB 3ZL4H 1M05B 3ALWA 1TVBB 3AMKA 2A4ZA 2R2BA 3RTQD 3ZKNC 3KYKL 3ATDA 2EIBA 1ZTMA 4KRLB 4LFHG 2XWJB 4W4OA 3IVKA 4LLWA 2IMNA 5E6ZA 2XV0A 2QZ5A 2R1WA 1SF3A 4MJIE 3CZNA 4EI5B 3DX9A 3QORA 4N8VB 3TF4A 1DUZA 2FBOJ 3LPPA 3ZE1E 3MLYL 4X4XB 2WXPA 3HZVA 4LP8A 3SZ6A 3GLZA 1I9IL 1T66C 5AL8A 2WXGA 1CICB 1YEKL 1ONQA 4M7JH 4PJCE 2JJUA 4U1LB 2H26A 35C8L 3ZE0F 2ZWSA 1R17A 1EVTC 2C9PA 1NL0L 2G5RA 4F33A 4HUVB 4I9WD 5HHOA 3HFMH 3FQTA 4A6YL 4UT9A 1I7UA 2YEZB 4WIQA 5KYXA 2MIZA 4AEIL 1YMHA 1CE6B 2R2HB 5CFHA 4CVXA 4UIKH 1NMAL 2HFGL 4JDZB 4B6ZA 1J8HA 4IRJC 5ICXA 1NPNA 4Y16C 4DO4A 3S8FB 4TF4A 1HNGA 2DMGA 3TT3H 1LEKB 3GLEA 4NCDA 1XZWA 1EGJA 4QXTA 4IMKC 3NABH 1IKFL 1KJ2L 2YAMA 3PAYA 1OAJA 4Z5RA 3S4SB 4ZW3A 5B7FA 1BFVH 1FFRA 5CLWA 1EAJA 3RZCD 2W0FA 4FFYA 1E42A 3RTLA 5I8OH 3JV4A 4MJHA 1S8DA 4X5QA 1OTSD 1PX8A 2NYZA 1NPUA 5AEAA 4HUWA 1EZVX 5HJ3A 4F9LA 1YEGL 4B9ZA 3X17A 2ITDA 1XEDA 4P5TA 5A40E 2VDPL 3ABGA 1JFQH 2FQEA 1SOQA 4GI9A 1E6OH 4H5SA 1RK0A 1MVUA 3FFCB 1AD0A 3OC5A 3F7YB 1INDL 1U8OB 4JG0H 3BP7A 4FYTA 5D2NC 3N1MC 3O6KH 2H32A 3PWLA 3BIKA 1J8KA 4HEMA 5B4MD 2Y1AA 1SXNA 1KPRB 5ESAA 4XO4A 1T03L 4LQFL 5DGRA 2DQIL 1I85C 5C0IA 2WQUA 3NFSH 1GPOL 3EUUA 4IGBD 4NKOA 2C7UA 3OLEA 4MQ7A 2X42A 1VGKB 4XPBL 4XMVA 2D3JA 5I82A 4Z0BH 4AC4A 2QL1A 1JPSH 3SGJA 5HGGS 3QC5X 1FFQA 3WLWD 3BRGC 4ZBJA 1S9VA 1NAKH 1JPTH 2HA1A 4MQXD 2GJPA 3BGFB 4JDEA 5CIPH 3TT1L 1DVFB 5JXEC 4I1PA 1JGIA 2YRLA 3LMJL 2OA9A 2HT2C 5CR1A 1CGUA 1N26A 3ARBB 4BWUA 4YHZL 3GMLB 1UENA 3CXDL 3N9GH 1DBAH 4P2AA 4CSTA 2I85A 2LV4A 4XHQA 1XQ4A 4CN1A 4XMTA 4AMKL 3VFVB 1OTTC 3WN5A 1ORQA 4G59C 5J8OA 4YZWA 3QR0A 2AI0L 4JANA 4IS6A 2ZSVA 2IAAC 4IEFA 4MJIB 5ENWB 3WDIA 4GJTB 5ESQA 4A7SA 4OUUB 4LCUA 5G5DA 5FKPB 5ICYA 2D7TH 1KCVH 1DBJH 1F4XH 2LFGA 4JN1H 4F1ZA 1QACA 4PJCB 2A3TA 3QIUC 3TO4B 3QK0A 4AT6B 5I6NA 3MV7B 2AK4E 2WTOA 3PYCA 2FNBA 4WI4A 2ICWA 2AV1B 2PWHA 1MQ8A 2IAMD 1QI3A 3E2HC 3F7QA 3RU8L 3L4ZA 2XQYA 4FL4B 5C0BB 1OGAB 1XAUA 1RJZA 3EYOA 2EEFA 3AREB 1LXMA 3FT9A 2XHNA 5INCB 4XX1E 1KG0A 4YAQB 5KJRH 5JDSA 5HXMA 1N6UA 5DQJB 4IK6A 2J3SA 2YMOA 4L3EA 2EC9U 1GKEA 3J07A 3BWUF 5LGKA 5CGYD 4YH6A 3B2PA 1HWWA 2YAPA 3VFTA 3HBGA 2J5LB 3CUPB 2OULB 4L4TA 3ZE2E 1ZT1B 4PWHA 4F24A 3HZYB 1LWRA 1NIAA 4JGMA 3SE3A 2V5MA 4PGDB 2CR0A 5E8NB 5JA9A 1R19A 4N0CC 3HC4H 4NENB 4AQ1B 1T21B 4GUQA 5AW4B 1EMTH 3K46A 5B1AB 4KVNH 1F4YH 1E8YA 2BY3A 3KE0A 5J1AB 3OKEA 5I0VA 1TEGA 1R75A 1V54B 2GIXA 2F7RA 3C75A 4KTYA 3VXUE 1IM9B 1WAAE 4ZPVB 3AAZB 4B53A 4Q6IA 5TF1H 2NY2D 4ICXA 5GSVB 3MNDA 5BV7L 4PVLA 5IVXF 4KO9A 4L3CA 1IM3D 6CGTA 2CMRL 1E8XA 4OGZA 2K8QA 2CXGA 5LXVA 3CDZA 1DJWA 3K2UL 2MCAA 2EDYA 5CEYB 1F4AA 2BC4B 1KNOB 2ZYHA 3EYVB 4MSWA 4FLHA 3RJOA 2H2PD 4LPYA 1GGTA 1W0VB 1XWVA 1CFQB 4QRBA 1WJ3A 3I6GA 4TQHA 4JG9A 2IO5A 3TBYB 1HX0A 2P26A 3ABZA 4W93A 4WKZB 3V0GA 1EX0A 3LVTA 1SQMA 2M8XA 4GAJH 4OZGF 3QQDB 4GEIA 4BWTA 3GXMA 2AK1H 4ZUUA 3DI3B 3IN0A 4HCFA 3VXSE 2ZX5A 5FM8A 1EGJH 5K1VA 4EQ2A 2WLLB 4XMLH 2ETWA 5I9QC 3L3HA 4PLJC 2Y72A 3VQ2C 4H1LG 2PTTB 2FIKA 2J55A 3RI5K 4K4KA 5J6GB 5T1DL 4FFYH 2AABH 4J6RH 4OCRH 1AE6H 3WV0A 2A83A 5EO1B 2GT9B 2RCSL 3CVCA 3TM6A 1M6UA 4X7EC 3HG4A 1AGDA 4HEPA 1ZVYA 3FPXA 4MJ6A 3HNVH 3D5OF 4NP4H 2EVHA 3NJNA 1PZUB 2V7NA 3D0VA 5IESH 2IANA 3AT9A 4XCNB 1WEJH 3DUHA 4DO6A 3UTZB 4LQ1A 1ECZA 2H32H 3FSWA 4WFGD 5CHNA 4YHYB 2X1QA 3U36A 1G5AA 3BO8B 3DVNA 5EO0A 5DQDL 5D7JD 1M57B 3DHPA 3QRLA 5IWLC 1KXTB 3NCMA 2OV0A 4HJJH 1FA4A 4YBQD 2APBA 1QFWI 4NOFA 1ED3B 4HS6A 1A6TB 1G6RH 4AL8H 3GS7A 5IHUL 1FRGH 2O5XH 3RHWF 2G3NA 4WWPA 4HSAC 3ESVF 5AVSB 2B77A 4BEIA 4R9HA 5DEZA 3I9GL 3AQXA 4MQTB 3RIKA 1RZ8B 2G0KA 4WFHE 1RIVH 1ZLEA 4JS7A 4X4MA 4A6YA 3H53A 1LK2A 4WU7A 2N7SA 1S7QB 2BWDA 4UNVA 4IHOA 4XXDA 1JZ6A 2FO4B 3MGTB 3I3BA 1HWGB 3ZE2B 3K2KA 4HJEA 4IMLB 3T65A 2ARWA 1T7YA 3O0LA 4NO3B 1QLFB 1ZHKA 1MFCH 1ASOA 5D6CB 4DKEH 5IHHA 2EIEA 2VDRB 5IB5A 4JG1H 2B4CC 2X7LA 1KJ2A 2VLRD 4RFNC 5F7FA 4EVNA 3FUKA 3SBPA 5AVWB 3PHQA 3EJUA 1NBCA 1T3FB 4JUSA 3QUHA 4KJYA 2WANA 4HA1A 3MRIA 3VRLF 1I3UA 3VJ6A 3P9MA 3PREA 3I50L 2QQNL 3DO3A 4NRXB 1PG7L 3FU7B 1DBML 4WO4C 2APFA 4N68A 5JW4N 3PIQA 1J1OL 1VESA 3O2DH 1SBSH 4JM2B 4PS4H 4R26L 2V0AA 3QUKA 3KPMA 4AM0A 3IETB 3LPFA 1UZ6E 2VDNB 4D9LL 4YQXH 5IOKA 3W39A 1WO2A 4I48B 1DQTA 4U33A 4M1GH 3QIBC 3CFDB 3SGDI 6TAAA 2CLVA 3D4CA 2IADB 1KTKE 1QRNE 1U8JA 1BSIA 4NKIL 4M4RB 2ATKB 5CLYA 4GI6A 2NLJB 2WKOA 3ZGHA 4XZUB 3D18A 4HCRH 5I8KL 4Y19D 3EBGA 3COOA 5MEND 1JFHA 1MW3A 3JQOB 2BSRB 2JSFA 3E1F1 1O6SB 4HCIA 3T0ED 3U4AA 3VACA 2HKFH 4NNXA 2IPKB 5FGSA 3ECBB 4KKLC 1YC7A 4HWZA 2H1XA 1JK8B 4BQ6A 3MUHL 2DTMH 1OCWL 1W15A 4Y16A 1U6AH 1YCSA 5EEXA 2QPEB 4XAWL 2VLJE 3EFFA 4L1TA 2F7IA 2WINB 1KGIA 4I4WB 2B4CL 2JTDA 2DLEA 1RV6X 3KGUA 1WFUA 4MAUH 2FNWA 1ZLSH 1W91A 2FWSA 2WXOA 3LZLA 2HMID 3HE7C 5A7EA 4LRIA 3D0LB 5IB2B 1DJGA 2EH7H 4KRNA 2VWEE 5CD3B 2VJXA 2J8UA 3QG6B 3FMGL 4GT0A 3QNXA 3MA9H 2ZF8A 3ORJA 1E40A 3U7YH 5J7CC 2QQLH 1A7NH 5I8EB 2FB4L 2AHIA 1P69B 4PGEA 4AKPA 3SBWC 3PGCB 1C5BL 1SM3H 1U2HA 2GY7B 3OLDA 1IAIH 3K72B 3QCTH 4F7PA 3AC0A 3V4PH 3MCYA 1K4CA 3UG5A 3F6JA 2A6JB 1HEZA 2DLTA 5D7SH 1A3QA 1WCBA 2WJ5A 4EI5D 4JY6A 1RIUH 3WL9A 4K71B 4DEUA 3IS1X 4NQED 3NA4A 4LSVH 1I85A 1XGPB 3SHSA 3TH3T 3X3GL 4L3FA 1CICD 2MOGA 1W0YT 5FUZH 3K0YA 2BVTA 1MH5B 3UIYA 1AGFA 1USZA 1AG6A 2V7HA 3U46B 5EORH 1C16B 3U0WH 4GG6E 3W5MA 4WDIB 2YD9A 4WK2B 1XCWA 4GG8B 1SJEA 1FQ9C 3PAUA 1MCHA 3TBSB 2IH1B 4KX8A 2CD0A 3RKPA 4TVPL 1QRKA 3OGCB 1MREL 3UZEA 3MI6A 1NCUA 5LQBL 3SCMD 1PX3A 1A3ZA 4J3UA 1ZLWK 5HGBB 4QTIH 2F58H 5BZWB 3BKYH 4XC3H 2J6WA 3TTYA 1FNFA 1MW2A 1M7IA 1X7QA 5EU7C 3W9DA 5H4ZA 2NTFB 3DRTA 4WTQA 1BIHA 2CDGB 2VDLH 5LBSL 3UYPA 2EUXA 1VIWA 4MJ5B 3WSQH 1CLOL 2VZOA 2HJFB 1JV5B 1TTUA 3N0PB 4X98B 3CFKB 4E2OA 1CYGA 1T5XA 3HC3L 3MRJB 2EDNA 3O41B 4HIHB 3FT0A 3NCYS 4HZLA 3FFCD 2XCMC 4MMXC 4ZK8A 5TE4H 2DWDA 3WNPA 1AOHA 1R5VB 3MX0A 3M1BA 3FTGA 3OX8B 1LQBC 1RK1B 2V9QA 4HKXB 5HHNA 1MKFA 2HFGH 2Q3AA 4M6NH 2D3NA 2CA4A 1T0PB 5FLUA 2NY7H 1DLHA 5AZUA 1J8RA 4FJZA 4X0NA 4NO2B 1E7UA 3TA4D 5ISZA 4X6DA 2DKUA 3HG1A 1A4JB 1MHPH 3UAFA 4H1LH 3DRQB 1E4WL 4PGCA 4OD3L 3B3BA 3CFUA 3RB5A 2YD4A 5AKTA 1KZYA 1JDAA 4LPTA 1L9RA 2W65A 2R8SL 1KXHA 2GFBA 5A2FA 4AYEC 4MRCA 1DVFD 1MF2H 2AJYH 1TZHA 2IBGA 5ABAA 2VE6A 4HUUA 2UXTA 4EI0A 1YEDA 3MDJA 2AEQL 1CE1L 3ARBD 3AS1A 3DURA 2WXJA 1R3JB 3OF6A 3P4OA 2WLMA 1WLHA 3T8XB 3EO9L 4NP9A 5JW3H 3GSNL 1JWUA 2BJML 5D72H 3UBXB 1CXLA 4K7FB 2WAQA 2BS8A 2BNUB 3FOMA 1UVQB 4MJID 3IU3A 4JO8A 5DR5H 1MIEH 1UJ3C 3CVIL 3MGOB 3LKSB 4LE8A 1AHMA 3SDDC 3LB6D 1HYSD 5IR1A 4P9HC 3O45A 5FYLE 3BWAB 3O2WH 5JPMB 3TO4D 5DJCB 3MV7D 4XVUC 4BINA 5HSFA 3MRGB 3NH7L 2VUOA 3KBHE 3WG7B 3FQ1A 2W9EL 4GG6B 2FT6A 4JB9L 5C0BD 4ACTA 4BFKA 5KN5B 4OLXH 3ARED 1M7XA 3NIDE 1KLFB 3KH4A 4HSCX 3UTQA 4W4NA 5E5MA 3MRDA 4YGVA 5E9DE 3U30B 2YC1B 4D7BA 1V05A 4JQIH 5I2IA 5L4IA 1A4BA 2OJZH 5SWZE 1H3TA 3VE0A 3JWNE 2J6EH 5IT2H 4RZCA 4N22A 4OLUL 3G6JA 4PWGA 3VD7A 2GAZA 5D5MF 1SVBA 4R5TA 1ZLVK 1FZJA 3CHXA 1X5JA 3CE1A 3IBOA 3LQMA 3GJEB 4WUUA 1U95B 1X5KA 3WGUB 5I0DA 3VGEA 2COQA 3L5JA 2M1KA 4XOAA 5E4AA 4G7QB 4L1DA 1BDYA 1I4FB 3PWJB 1OARH 3A4DA 5F7EL 1BEYL 4XPAH 4NQUA 3BVNA 1UZ8B 2OSWA 3KDPB 3L9YA 3ARUA 3VSUA 3H3PL 4MJ2A 3V6FB 1K3ZA 1MLCB 4P9HL 4Z7VE 5C6TL 5JPNA 3C8KB 2AQNA 3FT3A 1B4TA 2ZUXA 4LL4A 3QRBA 1J88A 4HK0A 1AGBB 1S78D 2VB5A 2Y1ZA 2RD0A 3MBXH 5T5NG 3U6RA 5C0FA 1KV3A 3QC6X 1ZXQA 3H9YA 3L3JB 3VGGA 1KENL 1U30A 3KMDA 1G7PA 1Q90A 3V7MA 1QHPA 3ZTDC 2PNDA 1KTBA 2OMWB 2MJWA 2MHAB 3LIUA 3QS3A 4JMXA 2ZCHH 1S5IH 4NOBA 2XBZA 2AKRB 2BIOA 2F5BH 1FSKC 2NYKA 4Y5YA 3NIFE 3UAJD 4PB9H 3APCA 1UT1A 2EUWA 3TA3B 4D9RE 3H9SA 4U1HA 4XBGA 1N0XH 2EQDA 4DAGL 3ILQD 4YEEA 5C0RH 2PYFB 3LAFA 1YRKA 4DW2H 5I19H 3F7KA 1LE5A 4WO4A 1N10A 3CBKB 2BVOA 3HAEB 4U3XA 3RUGF 2UZXA 3L5XL 4OCMC 1BP3B 2FSEB 1NCWH 2Z7ZA 4DT2A 4YDLC 1NGZB 4QHUA 4S1DD 4TSAL 4RMSA 2X3CA 1BPLB 1I8MA 2EVJA 2NXZB 3QIWA 1T1ZB 3DTUB 3KLKA 3Q8AA 4M9PA 5F3FA 3ZMNA 4K9JA 2ID5A 3R8BB 2OMYA 5ETUA 4PGZA 4JVPA 3NIDB 5DC0A 1HI6B 5FWQA 1UWXK 4Z23A 3BGAA 1DVZA 4P2QE 5E9DB 3CPLB 2YGVA 3HUJA 1IFHH 5D1XC 1XAKA 2OMTA 4LNVA 5DYFA 5KYUA 3F65A 1MNNA 2SEBB 1I7RB 5IEHB 2BNQE 1FPTH 4DQOH 5A16A 4OCSL 4NDMA 2WQRA 3U4BL 1DE4B 4TM9A 2YKLH 3S96A 2VN7A 2HFEA 2HSIA 4GXUM 1E28A 1N4XL 4O2FB 4A7QA 3NAAL 4F27A 5SWZB 3AADB 1BVNT 3GSWB 2BCMA 1A7PH 1LP9F 1F6AB 3VI3A 3ZYOA 2FJUB 4N1CA 5I8CA 2GC4C 2VC2L 3HE7A 1EERB 5FYKU 1NCAL 1QWUA 1FNLA 2KMWA 3PU7A 1JGLL 5HYQB 1XH3B 3N43B 4JMNA 3O4LA 5IHUH 1ZSHA 2LOEA 4P57B 4AQ8A 1F3RB 2YUWA 4K55A 5CZXC 2Q6WB 5LBSA 4FNQA 4BHUI 3FONA 4BH8B 3PV6B 3IFLL 1KB5L 3B4NA 3I9GH 2BERA 1KJVB 4NS0A 3HBQA 4A63A 2YBRB 3ZZSA 3FQRA 4MFHA 4UQDA 5ITBH 5I76B 5I73B 4GKNA 3B6SA 4UT7H 4JM2D 5LO7A 1J05B 3EH3B 3OM3B 5DJ6A 1DDHA 4KTDH 3LRSB 1GOFA 3QDAA 2ZAHA 3NCJL 1DVUA 3T6ZA 1WS8A 1DSFH 1T89C 3F2LA 4ZNCD 5E2WH 3HMXL 2BOCA 1IZJA 2Q7YA 4NNPL 2VDKL 3O2VL 4URTB 4RRPM 4NFDA 3H9ZA 5I1JL 3ESOA 4DN3H 4B0MB 3HLAA 1GW0A 4LRNH 1IGYA 1FO0L 2W07A 3NIFB 4LEBA 4YSOA 4FABL 1IC0A 4FXGA 4PJEF 4ODHH 3THML 2GJRA 4MDJB 1AQMA 4R97B 4TULL 4M4PA 2QKIC 5IK3B 1A6AA 4RBPH 4LCIH 3DV4B 2JCCF 1Q9OA 5CJQL 3FSZA 4W9HC 1Z0MA 2E46A 2EEBA 3LV3A 4JPVL 4HVBA 2QSCH 3SDXA 5E8OA 3S6CA 3UPRB 3RDTC 3E80A 3GSNA 4K9EH 4DUWA 4ELME 1J87A 2X6BA 3U48A 1NUDA 1M7DB 3WLBB 1J18A 1P0SE 1PMYA 4WWKB 4BSVA 2F8IA 5EBMB 3C6EA 4LLDA 2XBTA 4MMXA 4CW1A 3QDGB 3U0TA 3A4EA 3M1CA 4NM8L 2I60L 2A1WH 1EHNA 3N41B 1MY7A 3BHBB 1RJLB 3UTSE 2WCGA 1HT6A 4UV7H 2FWOB 3FUJA 1TPXB 4FQXB 4YZFF 3K4ZA 2GITA 3L4XA 1UUSA 3BVDB 1A4CA 4ZXBC 4F7EA 5KVEH 5AYUL 1QBAA 4AYGA 1QSFE 5E0QA 1NMCB 1IBZA 2ROXA 2PPEA 2CM6A 2V2XB 4KHTH 4LNRA 5HJGA 1CG9B 3CC5A 15C8H 4PW9A 4YDKL 4UTCA 1G87A 4CADB 3GT6A 4N25A 2H0PA 12E8H 3LKRA 3FTYA 4YDNA 5C0EB 2G60H 1MCKA 1WHOA 4PJBF 4QRAA 3ARZA 3QAQA 4OZFA 3TGXA 1JG9A 1NFIA 2J71A 1CF8H 3VXMA 1HTYA 2EIMB 3WXWL 4LIQE 4O51B 4N0UA 2E6JA 2BWIA 2XYCA 1AJ7L 3BZFA 4JHBA 1T7VA 3ENEA 5K59E 3WFDH 1DJSA 5IHZB 5E7FA 4IU2B 1HXMB 2ESVA 4ADJA 4XNQA 4HK3N 1NCNA 3SE4A 2FLRT 2OW7A 2FZ3A 1FP5A 3P11H 4U6VH 1PZSA 1T20A 3TIEA 3SDDA 3WUWA 5IOPB 4OZHB 2WTPA 5C0AA 1GA2A 4LL9A 3BUQA 2NNCA 3WXVH 1ORSA 3L7EB 1A6PA 1M42A 1PS3A 1S3KL 3O0RH 3QQ9D 2ITCA 4KK5D 3LSOB 1M9WA 1MCOL 1BMZA 2XZCL 1NH6A 5ILTL 1NWPA 4I77L 5CWSA 3BW9B 5C7XL 3G5VA 4E42B 3F84A 2UX7A 3K6DA 5CILL 5EZLB 5DO8A 1NEZG 4MNGA 3L1OL 3CCHA 3SE8H 2KDYA 2X4UB 2Q20A 2VLJD 5IMOA 5IFHL 5EN3A 4ZFGH 1MWOA 4MS8D 4TNEA 3ZUCA 2GIMA 3DK2A 5LBSH 5JW5A 1CLOH 1X3DA 4HHAA 3QCUL 3GWJA 1XGQA 4BFGA 1VPOH 2ENPA 2BVPB 1AZNA 3N85L 2AZAA 5ELIA 4NQVA 4APXA 2OQJB 3TNNA 4AJWA 1QFUL 4HAFA 4AC2A 2P43B 3PJSB 1UCTA 4G42B 4YPJA 2VDML 1U3HB 4JW3A 4IYKA 3Q8FA 1UGKA 4X4YA 4ZZFA 2AV7A 3ATAA 4OFYD 3S3PA 5DHYA 3VYPA 1DN0B 3Q6GH 2PPFA 4E41B 3R4RA 4JPKL 3Q2VA 4AG4L 1OM9A 1TLKA 5E6UB 2Z91B 5DMJB 4R4BA 3UBXI 2R1YA 3H6AA 4MA7H 4KUCF 1UWYA 3E38A 3D3VE 5FYJL 1U8MB 3GIVB 1ACXA 2DYPA 1KACB 1M3IA 3NP4A 1PLGH 2YA0A 2DF3A 5FUOH 4OJYA 4N9GB 3BEWA 4OZ4B 3LKQA 4RCAA 1ACCA 4ZS7H 4EN2A 2CO6B 5F0PB 1U58A 1VA9A 1D6VH 3OBAA 5AG8A 1ID5I 5CP3H 4KDVA 4YLCA 5DUJA 3NRPA 3TYGH 4Z0XB 2DAVA 3WTUA 5BO0D 2EXWC 2NY6B 1CDBA 3S3DB 1OM3H 5IVNA 5FWRA 3UADA 1JWSB 2DM3A 3VXTB 5DVNA 3VI4A 3L3OA 5L6YH 5I17B 1N12A 5IW6A 5EBLB 1C5DA 2APWA 4HJIA 1DQDH 1TJGH 3QQ4B 1E90A 3MUUA 4QT5A 1AR1C 1XGUA 2W5PA 4GEJA 4XPHL 3BSGA 4G6JH 4FQPA 1ZLUH 1BZ9B 1G94A 3QE5A 4W6YB 3RPIB 1BMWA 4EF3A 2D7NA 4A67A 5EOTA 1QO3B 4Y4KA 1KB5A 3B9KB 1AHWB 1ZPLA 2W0LA 4D0DA 5J06A 1CFVH 3B2UD 2F1AA 2DWYA 3CFCH 1JHKH 3VWJC 3EO1A 2JVUA 3E6HB 1CGYA 4L23A 1KV7A 2AJXL 1I1CA 3CSYA 4XPTL 1OAZH 2CO7B 4Z3GA 3V6BR 5BCAA 1ZEAL 2FUQA 3OZ9L 1J5OL 3CQFA 4NI3A 4KMQA 4XTRC 3VB8A 1VHPA 5IQ7L 1FL5A 4RMWA 4GAGH 3SKJL 2JLPA 1WISA 5J4MA 5AB2A 5D9SB 2X4TB 2Y6TE 1ZHNB 1T5KA 3CFEA 5D1XA 2ZNXA 4ZS6D 3RIAK 1A7QH 1U8NA 1VFUA 5DHXB 5F9AC 5JYLA 4OZFH 3ALXA 2WTRB 1PG7X 2HN7A 4DGIL 1W72L 4NHCL 5CSGA 2BIHA 1FO0A 3ZZLA 3K6SA 2F0CA 1S9YA 4K23L 3OAUH 2OMXA 4PJ6A 2OP4L 2Z9TA 5AWNL 1Z7JA 3CD4A 4BDVA 1HKFA 3LN4A 1IIIA 1OP5K 2WWOA 2FX7H 4LLQB 4KX7A 2EDFA 1IRAY 3QCVL 3TA3D 5CU9A 4ZW7A 4NAJA 4OSUH 4PJXA 2IGFL 1T2QH 3M46A 5TK2A 1G6VK 1ZA6B 4PY7B 1S9WB 1P1ZA 2NX5E 4KK6D 2H9GA 4P4KB 3BIBX 1TCRB 4ADIA 2X87A 3B9EA 1Y1UA 3L6FA 4XBMA 4XNZB 5MEQB 2UZIL 4UAOB 3D6GA 4OD2B 3TJEL 3MNWB 4NPYB 4EBQH 5JOFA 4MAYB 3DYMA 1EDHA 1F5WA 1F58L 1HN1A 2NXZD 3L5IA 2A9ML 2FHBA 1P4IH 3VFRA 4I1NB 2XTJC 2BCKA 3D09A 3EJRA 2H1PL 1T89A 3SGEI 1BJ1J 5C2UB 2DQHH 3VNYA 1CTOA 3FF7A 5SWQB 5B38B 1SF5A 3F7VB 4HISA 5F3HA 4BKTC 2A9NH 1CL7I 2EIZA 1DUYA 1VENA 5E9DD 4BRJA 4JCLA 1PDKA 1T4KB 2OW6A 2V9UA 3APNA 5JIPA 4N0YL 2QVFB <