4YVUA

Crystal structure of cota native enzyme in the acid condition, ph5.6
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
510
structure length
506
Chain Sequence
b'TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spore coat protein A
publication title Crystal structure of CotA laccase complexed with 2,2-azinobis-(3-ethylbenzothiazoline-6-sulfonate) at a novel binding site
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Oxidoreductase
total genus 152
structure length 506
sequence length 510
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA02
1MG2C 1BXVA 2GHZA 4BWWA 3X1FA 2AVFA 3SBPA 2YAOA 1SDDA 2J56A 2BP0A 1J9TA 4ZK8A 3NJMA 5B1AB 1BYPA 1PZBA 1CURA 4HCIA 4K9JA 1MG3C 1E65A 3FQ1A 3U25A 1YLBB 2PPAA 3QQXA 3S3DB 2W8CA 2DY2A 2FQGA 1AZCA 2CAKA 3NJKA 2CCWA 4BDVA 4BK5C 4KOCA 2XLLA 4DP2X 5I6NA 3KW8A 4BXVA 1EZLA 1J9SA 2DWSA 3AG3B 3ASOB 1MDAA 4WKXA 1PLBA 1NIBA 3EF4A 4L0PB 3AG2B 3TBBA 1QNIA 2ZXWB 3NT0A 2IDUA 1WAEA 1FA4A 2XWZA 2H3XC 1M57B 3KW7A 4QKTA 2IH9A 1JZEA 4HALA 3ABKB 4BWTA 1OCRB 4BXSV 2PP9A 1ASQA 4E9WA 5AKRA 1IBZA 3OMAB 2FT7A 4DP6X 1ZDQA 2BZ7A 2CBPA 3FPXA 1V54B 4P5RA 1GR7A 4RH4A 4AKQA 3IE9A 1L9OA 2MTAA 1BAWA 2ZWNA 3CDZB 1ILUA 1V10A 4YSDA 1ZIAA 4Q89A 2XV3A 3H56A 3NJGA 1AIZA 5I6MA 1JXGA 3CVDA 4GYBA 4N4YB 2GC7C 3SBRA 4YSCA 4YSPA 1J5CA 5D4JA 3UAEA 1A65A 2Q9OA 2BWIA 2I7SA 1N68A 2EIMB 1BQ5A 3HEIB 2J55A 3ZX1A 2YAQA 3MX0B 1I53A 4YSEA 1TU2A 1A4BA 4YVUA 1KYAA 3NSYA 3CG8A 2R7EA 4PCYA 4W1TA 2VMJA 1CUOA 4UF7C 8PAZA 1GW0A 1GYCA 1A4CA 1NPJA 4YSRA 3UADA 1HAWA 4KO7A 2PP8A 1E67A 2YAFA 2E86A 4PAZA 1AG0A 2FQDA 1QLEB 2Q5BA 4DP1X 2XV0A 1NICA 1OCOB 3GXUB 4KO9A 1ETJA 4P5SA 4EF3A 3IEAA 3AZUA 3PAVA 4G7RB 1IKOP 1EHKB 2QPEB 1B3IA 3ABGA 1NINA 2VN3A 5B7EA 3UACA 4JHUA 2IDQA 4CSZA 3L45A 1GY2A 4AKOA 1JZFA 3ABMB 5F7BA 2HZHA 1XB3A 1M9WA 3OQRA 1JZHA 2B3IA 2R7EB 5LDUA 3ZBMA 2TSBA 2AFNA 2PLTA 3X2QB 2XX0A 1AG6A 2DV6A 2X88A 4E9XA 2VW4A 2H47C 2HXAA 4GP4B 4E9TA 4NAJA 3GYRA 4E9SA 3WI9A 2XUWA 5PAZA 3FSVA 3WG7B 1E5YA 1FFTB 1V55B 3PAZA 1X9RA 3FSAA 1OE3A 2CUAA 1HFUA 3WNJA 3QPKA 1ASPA 2XU9A 1WS7A 3T6ZA 3ZDWA 2HX7A 1AANA 1L9RA 1W6LA 2GIMA 1KCWA 4F2FA 1JZGA 1AZRA 2DYSB 1KDIA 1JXDA 1PZCA 2W88A 1W8EA 2PCYA 2HRGA 4WTQA 3EH3B 4KNTA 4CSPA 4DP8X 4W9ZA 2OCCB 3UGEA 3QJRB 3ZIYA 1L9QA 3RYMA 1TEGA 1URIA 3PCYA 3PAUA 4A2FA 1WS8A 4G71B 4KNUA 1ZDSA 2BWDA 1ZIBA 3OM3B 2CJ3A 2IAAC 2XX1A 4UANA 3X1EA 4G72B 2BW4A 2YAPA 1JZIA 5F7AA 3FU9A 2QT6A 2DWTA 5EHFA 1SDDB 4Q8BA 2IWFA 3X1GA 2BP0B 1WA0X 2IDTA 2RACA 1PLAA 4E9RA 1UATA 2YQBA 2P80D 3T9WA 2OJ1A 3WKPA 2HLEB 2IDFA 1BQRA 4M4RB 1AS8A 2BP8A 3UABA 1ET8A 3QJSB 4GP8B 2PCFA 1MZZA 1L9SA 2LLNA 2YARA 4BDVB 1DZ0A 2FJSA 2XVBA 2J57A 1W6WA 1JOIA 4NB7A 3NJIA 2J5WA 4KO5A 3JTBA 2FQFA 1DYZA 4YSSA 3GDCA 3NSCA 1SF3A 3QJVB 4HCGA 4DPAX 6PAZA 3T71A 2FWLB 3TASA 1AZBA 3OD3A 3T6XA 3V9EA 2VSKB 2Y1AA 4HCFA 3FT0A 4E9QA 3S8GB 2HX9A 1PLCA 4A67A 1OE2A 1XB8A 1IBYA 2UX7A 5I6LA 4MFHA 3FPYA 2JXMA 1JVLA 1OOWA 1JERA 3FU7A 4AI7A 1NWPA 4DP0X 5I6PA 4NERA 3S8FB 3QJQB 5I5MA 4YSOA 3ASNB 5B1BB 3NSFA 1AS6A 2YXWA 5I5IA 5I28A 2MRYA 1RZPA 4KNSA 1GS7A 1HAUA 5B1JC 1ZPUA 2PPEA 3S3BB 5FC9A 1BQKA 2XYBA 1SFDA 1IUZA 1OE1A 2VM4A 1KDJA 3FYIB 3S3CB 3WNIA 4DP5X 3SBQA 4UAHA 1XMEB 2GBAA 2DYRB 1OV8A 1XB6A 1OCCB 2GC4C 2Y69B 3OMNB 2BHFA 3X1NA 1TEFA 3BVDB 3CVCA 3FU7B 3EH5B 1X9UA 2X87A 1NWOA 3DTUB 5E9NA 1E5ZA 2CALA 1GS6X 4A68A 2N0MA 3SQRA 2A3TA 1PY0A 2XV2A 3NJJA 2UXTA 4YSAA 3PXLA 3FYEB 3NJFA 1IC0A 4HIPA 1ID2A 3FQYA 2NRDA 1GSKA 1QHQA 4YSQA 1PCSA 1CYXA 1BXAA 2VW7A 3ABLB 1RCYA 3IN0A 3X1BA 1GS8A 3DKHA 4YL4A 2HX8A 2ZOOA 1PMYA 1E30A 2HRHA 5B7MA 4M3HA 3TU6A 4KOBA 2QPDB 4FA7B 2QDWA 2EILB 2JKWA 3D12B 1A3ZA 3AY2A 4HZ1A 4TXVB 1L9TA 2B08A 2FNWA 3AG4B 1ADWA 2FT8A 2WO3B 1AAJA 1ASOA 4DP4X 3NYKA 2PPFA 3T6WA 1GY1A 4DPBX 5B7FA 2YAHA 1ZV2A 4YSTA 2H5UA 3TBCA 2XXGA 1KBWA 3NJNA 1AS7A 3QJUB 4GXFA 2YAMA 4ENZA 2VM3A 1KCBA 1KV7A 3AG1B 1NDTA 4AKPA 1FWXA 2BZCA 1JZJA 1BEXA 3FS9A 3CDZA 1NIEA 2EIJB 3NP3A 4X4KA 3H4FA 2BO0A 3UAAA 1PF3A 1NTDA 2I85A 3MBWB 4A2GA 4QLWA 2GB2A 1SJMA 2FT6A 1JVOA 5AFAA 2WO2B 1SHWA 2PP7A 2UXFA 1CC3A 3QJTB 1OF0A 4BWUA 4HHWA 1T5KA 3CZUB 4A2HA 3EHBB 5ANHA 2EIKB 4YSUA 3FU8A 1M56B 3CVBA 3V9CA 1A8ZA 4E9YA 1BYOA 3HB3B 1AOZA 1NZRA 1ET7A 4A66A 3N2JA 3NJLA 6PCYA 5A7EA 1VLXA 1AZNA 3H4HA 2WSDA 1AACA 2OV0A 3C75A 1N70A 4AX3A 3IBOA 2AZUA 3FQ2A 4F7KA 2YXVA 4GY4A 1RZQA 2BP8B 3N55A 3WKQA 4E9VA 2FTAA 4GP5B 2PPDA 2QDVA 5D4HA 4F2EA 4AZUA 2FQEA 1SNRA 1RKRA 5PCYA 1J9QA 1A4AA 2XXFA 5I6OA 1SHXA 4A2DA 5I5JA 3OMIB 1KGYE 5TK2A 5IY5B 5B1JA 3G5WA 3WIAA 1JXFA 2I7OA 4DP7X 4HHGA 1MZYA 4G70B 3EH4B 4DPCX 7PCYA 2TSAA 1TKWA 1NPNA 2P80A 7PAZA 2VSMB 2IDSA 2JFCA 2GI0A 4JKNA 4HAKA 5B3SB 3NJHA 3PLYA 2PPCA 1PAZA 9PCYA 2ZONA 4A2EA 2GSMB 1AR1B 1PNCA 4N8UA 2UX6A 1L9PA 2YAEA 3FSWA 1WA2X 1OCZB 2AANA 3ERXA 4FAAB 4G7SB 2VW6A 1J9RA 3NP4A 2UXVA 4DP9X 1WA1X 5TK4A 3FSZA 1AQ8A 1NIAA 1AZUA 1PZAA 4G7QB 1CYWA 3PPSA 1BXUA 3TA4D 1NIFA 2EINB 3IN2A 5B1KA 2IWEA 5I6KA 4KO6A 3JT2A 3DIVA 2IWKA 2IH8A 1SF5A 2AZAA 3BQVA 4JHVA 1KBVA 1NIDA 4YVNA 3T6VA 5I26A 1ILSA 5D4IA 3NSDA 2UXGA 1F56A 1ET5A 1R1CA 1SFHA 2BW5A 5AZUA 3AW5A 1PNDA 1J5DA
chains in the Genus database with same CATH superfamily
2HP4A 1MG2C 2G3ZA 3KCWA 4MMXC 2MHAB 3UAJC 2X4PB 1F90H 3HVNA 4ZBJA 2J8UF 3OC8A 4N8VB 4B60A 4F15C 2BP0A 1NCNA 2VXVH 1FJ1B 3NCYP 4GSRA 4J27A 4A7VA 4M56A 2A9AA 1MG3C 2ESVE 2Q87A 3X3GL 1XZ0A 2PPAA 3JUYA 4WEBH 4J12A 4YX2L 4NIYE 1QWUA 4RNRA 1WFUA 1I9JL 2P8LB 3QNYB 1GMIA 1WZAA 2W95A 3DYMA 1G9HA 3V4UH 4BXVA 3PNRB 5CJOL 5EU6B 3ARBA 2ZWSA 4X80H 1PDKB 3O3DA 5DD6A 1NIBA 4UV4H 1SXBA 1B2WL 4U05A 3VXUD 1X5AA 3G08A 1LK2A 5GZOA 2ZOKA 1M53A 4YAQB 3ULVF 4QKTA 3X11B 4JR9L 2BMKB 1IX2A 3LPGA 1OAXH 2J73A 4KBPA 1T1ZA 3GSXB 3B34A 3WO4C 1EFXA 2PP9A 1M6UA 5IBLC 4CMMB 3MQIA 3IJEB 4XZUA 1MPAH 4PJCF 1X7QB 4U6VL 4X9GA 4F7PB 2F8XC 1ZDQA 3FPXA 3HZKA 4F1ZA 1DTUA 3K80A 1GR7A 5BS0A 1UZGA 2VH5H 1BF8A 1JZ8A 5KZCB 3LZQA 4HD9A 1NFDF 4N2BA 3WLBB 1GGTA 3CN0A 2XA8H 3BRFA 2WB7A 3DUUB 4W9HC 5MI0B 3W9EA 3BQUB 2CDGA 5CNHA 3NZ8B 3CVDA 1A2YA 4OSUL 4YSCA 5IT2L 3D85A 3TJPA 4I89A 1U8PB 3BVWA 4NNPL 4FZ8H 1BBDL 3OX8B 1HL5A 4I48A 4DFIA 1YEDA 1F4WL 1BHGA 3KPSA 4E5XA 4N90D 3ETBF 3TIEB 1CJYA 1P5VA 4OBSA 5JXED 5MENB 3W38A 1UXSB 2VABB 4WHYH 5F72S 2YPLB 1KJ3H 2C4XA 4POZC 4X7SH 4FXGC 1RIVL 2UUDH 4LP5A 3VGFA 1KXQA 3LZLA 5EZLA 5E8NB 3GM0A 1NANH 3HAEB 1QSFE 5KG9B 2AQPA 2WXIA 4X0KA 4YHLH 2E4TA 4HUXB 4V33A 4GRMA 4QF1A 1GL4B 2ICWB 1E67A 3NCFB 4HGWA 3RY6A 4ZUSA 4XRCB 1MCIA 5L6YH 4FFZH 4MD0A 1GIGH 2CK2A 6FABH 3AREA 4Z7VF 4XVTH 5A6MA 1GVIA 3VFSA 1A7NL 3F12A 4PJIF 3RIAK 1B3IA 1IC7H 3PGDA 3Q8BA 4G6JL 4XNMA 4MJIA 2J44A 5CMAA 4QOKA 3RTQC 4K7FA 1AP2A 2KDYA 4CADA 4LLMB 5I1AB 3V6OC 5MEQB 1XH1A 2G5RA 3IS0X 1JZHA 3K5SA 3LXBA 4KI5D 1P6WA 5JO5B 3BCDA 1ORSB 1UQSA 2WIIB 3AWFA 4HH8A 2F54B 3HLAA 1NMBL 4W9GC 4DHLA 3UYRL 2RCSL 3BAIA 2XTJB 1HKFA 3A21A 1F90L 4X2UA 3L1OH 4YUEH 1VGEH 4BZ1A 1SBBA 2VXVL 3D05A 3QRLA 1HE8A 1KJMA 4L23A 3ESUF 3CFIC 2ZUYA 1NGQH 4N87A 3VW3H 3IYLW 3I6LD 3GIVA 4JHZA 3P73B 3PDDA 3IJSB 1XAUA 3T6ZA 4WEBL 3ZDWA 4FHKA 3FCSB 3MTXA 2CU9A 4MMXA 3A5VA 3UAJA 2J1WA 4R7VA 3V4UL 3EOBB 4MQSB 4X80L 4X9BA 4UV4L 3VJ6B 4JVUA 1MEXH 4WTQA 4U6XA 5KSAD 1U8NA 3ZIMA 3UGEA 3AY4C 3BDYH 3RYMA 1BZ8A 3FB7A 5B38G 1OAXL 2E74C 2WD0A 4JB9H 1HVXA 3EO9H 4U33A 4KK8C 4AV4A 1KYOK 1Z0MA 4AMKH 5IGXH 1MPAL 3N42B 2IANB 4PGDB 1BAFH 5A2JH 3DJ9A 1YJDC 3RDTD 3RTLA 1I75A 1QSED 2Q76B 2VH5L 2DYPB 1GZPA 3ATBA 3B43A 4GW1A 5EHFA 3IDMB 1F3JB 1G94A 1Q94B 4OGAC 3VMNA 8FABB 3D52A 5J3HD 2WTOA 2XA8L 1M05A 4UDTA 2EDYA 5I8OH 3T1WA 2ITCA 4F8OA 5MI0C 3BQUC 5L4FA 4LP8A 4M4RB 3SDAB 2BNRD 4KVPA 4WJG3 1NAKH 4K3DH 4FZ8L 2GJJA 5HDQH 2IH3B 4RWYH 4P46C 5ACMA 3LS5H 4MD5B 1QR1B 4ZFFA 1OAQH 4LHUB 1X5FA 2CH8A 2P45B 3UPRB 1KJ3L 1CDGA 4X7SL 1FNGA 3J8F7 3CXDL 1EA9C 1QA9B 3QJVB 4BH7B 4DPAX 6PAZA 4BKLA 3KLKA 3VUAA 3TASA 1N8ZB 4BRJA 3OD3A 5IJCC 4MNHA 4M1GH 1YN6A 5F9OL 2BOCB 3NIFB 3CZEA 4I88A 3ZKSD 4F27A 2B59B 5BRZD 3U36A 3ROOB 3U46B 4YHLL 3CFJB 1RK0B 1KBBA 5DK2A 2J1ZA 2WCSA 5D72H 1J1XH 5DVNA 2GKIA 4FXGA 4Z7NF 1G7MB 1HE7A 3HE7C 5L6YL 4FFZL 4R4NC 3UEQA 1GIGL 1HEZA 6FABL 3H9SA 4XVTL 5D4QA 1G0XA 3GSNB 1HOCA 1IC7L 4UQDA 5E5UB 4U1NA 3RPIB 3SY0B 4G9DA 2EUWA 5BZXA 1R0AH 2VRKA 4CMHC 3GS4A 3M88A 3SJVD 1IKFH 4ZFZA 2PKDA 1J0YA 4K5MA 4W6XB 3S3BB 4FLOA 1FDLH 2EH8H 5EULV 2VLRD 4MB1A 2VM4A 3WNIA 1Y6MR 2H1LM 5IMKB 2IAMB 3HKFA 4EMZA 4RMVA 4UAHA 3L1OL 4YUEL 1VGEL 2XTJC 3RTQA 3V52H 4NAQA 2G4GA 4N2DA 4O2CA 3V6OA 1WTGT 3PHQA 4L29B 5EU4A 1FNHA 2EABA 2WZ0A 3T4AC 4DK5A 1NGQL 3VW3L 3BVVA 4DUVA 4UIMA 1NWOA 1EEZB 3L4WA 4YDZA 5C07A 4N9GA 1DQJB 4GEIA 2CKNA 3B2VH 3KWXA 1MW3A 4AOFA 4NRZB 1QABA 1XIWD 3KWVA 2Z0BA 1RJLB 2XPYA 2XV2A 2UXTA 3O4LA 5JIDA 4LKXB 2WLJA 2MHAA 3QUZB 2X4PA 4JJOA 3K8LA 4N8VA 5D1XD 3HI6H 2BSDA 2D03H 2XN9E 3S6CA 3CLEH 2RAMA 1KTCA 1E4JA 5F3BA 1MEXL 1DQLH 3NMEA 3RBGA 3S9DB 1B0WA 3BDYL 4IW4C 1S7SB 3RPBA 1Q9OB 2WLNA 4JB9L 3EO9L 2ZJSH 3DDFA 4ONGH 4CGUB 3KYAA 3QNYA 4AJVA 4H8UA 4AMKL 5IGXL 1C12B 1BLIA 1M6OA 1WF5A 3D0LB 5FAAA 5C0EB 1BAFL 3KPRD 1PDKA 1WDAA 3FTGB 3QUMB 4X6DF 4PI0A 5F7UA 3AY4A 4FA6A 4FTVD 2DB8A 3G3LA 4W4NA 4YAQA 1OTTD 1BFSA 2BMKA 4B5EA 3T6WA 1X5GA 4TUUA 5I8OL 1MLCA 3MDJA 3FOLA 5D7LD 2WKOA 5C92A 4HT1H 5FF6B 2J71A 3SOBH 3X14B 4BUGA 3ALWA 1AQKH 4CMMA 1NAKL 3DTXB 5HP5A 2SEBA 4K3DL 3SDAC 5HDQL 1X7QA 3K0WA 2NY6B 4F7PA 3MLRH 4RWYL 1A9BA 4Z7OE 4JKPH 3LS5L 5E4OA 3MNZB 1OAQL 3GLDA 3VSTA 3LVEA 1S5HA 4PJ7F 1ZHNB 5GGUB 4LOVA 3BE1H 1U30A 5D1ZC 4KWUA 1JVKA 4XMXA 5FYKD 2V5YA 3BQUA 5AALA 3NZ8A 4FULA 1C8QA 2CBOA 4P06A 1S7TA 4HETA 4M1GL 3UCRA 4D7PA 2WO2B 4P46A 3T0XA 5K33A 4M6AA 2H2SC 1NFIB 1JIBA 2KBGA 4M8QB 3TIEA 5DTFB 5D72L 1J1XL 1UXSA 2VERA 4MXVF 4XCYA 4X4MA 5EU5B 2YPLA 3F04A 4AQAA 4M3KB 4MLIA 5CILH 5JW4R 4LRIC 3STBA 5FUOH 2CR0A 4S1DC 3KBEA 3KGSA 1VLXA 3N44B 4S0SD 5E8NA 4OD3H 1UG9A 2AI0H 2AXGA 2AZUA 3HI1A 3QDMA 4F7KA 5KG9A 4AYBA 3GF8A 3L3JB 4P0DA 5BOPA 1IKFL 4R97C 2DQGH 3P9MB 4UOW0 2AJZA 4Y2OB 3PV6B 5FGBC 3TFBA 5D2LE 2ESVD 2ICWA 4XRCA 5KN5A 2EH8L 1SHMA 1A5FH 4AYGA 2E7BA 2XBDA 3H9HB 2N0KA 2F53B 3RFZC 2LU7A 3DV4B 4EJ1C 5ISZE 2JI3A 3V52L 5HHNB 5AVVB 1UB5B 2V7HB 2PWGA 1OTSC 4IDJH 3QG7H 2OZ4A 4LLMA 5I1AA 1DLFH 4GKNB 5MEQA 2PO6D 3FT2A 3G04B 4HHGA 2B5IB 2K6ZA 4KZCA 4MVBC 3TEYA 4OGYH 5JO5A 2ISDA 2ZX9A 1ORSA 1ODUA 2J8UA 3B1TA 4NQDE 4J8RA 2F54A 4XNDA 1UADC 2P80A 2ROYA 1OLLA 1XMWA 1P53A 2PR9A 3CBJB 2E46A 2GEEA 1JGDB 4ISVB 1B9KA 4IBYA 4MZIA 3BISA 2Z65C 2Y7QA 5E7BA 3HI6L 3QUZC 3T4AA 2D03L 3I85A 4IU2B 3CLEL 4ZPTB 4ELMB 2A4ZA 2QJDA 1DQLL 4FFYH 4GKLA 1JE6A 1KY6A 2VAAB 3OAWA 2FWUA 3QIBD 3HG1E 3VXUB 5C3TA 3VCLB 3FCSA 2ZJSL 4EUPG 4NI3A 4ONGL 3EOBA 1JNHB 3PQYE 4H44C 4Z7UE 2FAUA 1CF1A 5JXAH 1VGKA 4JFQB 3DIVA 5CR8A 4UOZA 1MFMA 3FQRB 4H8QA 2B4CH 5D4IA 1RPQA 1TTCA 2D3NA 4R26H 4CVUA 4HT1L 1F56A 1HT6A 4N1CA 1R1CA 5I8CB 1GRWA 3SOBL 4N1HB 4D9RE 5INCB 4NRXB 4DEPB 4LVNB 1QSFD 3MLRL 1J0IA 4JKPL 2C8NA 3AQDA 4W70A 2DYPA 2YEVB 5CINH 3GMPB 3IDMA 3GI8H 1F3JA 1Q94A 1TNMA 3IAGC 4WI2A 3BE1L 1J0KA 4I18C 1PZBA 1KLGB 4HUWB 1OAUH 1N6UA 1ZRUA 2KZKA 3FQ1A 3TVMC 4DQAA 4QHKI 3SDAA 4OD2B 2N59A 5CGBA 3O8XD 2IPTH 4WI0B 1UT2A 2IH3A 4Z7WE 3HS8A 4CC1A 2VWEE 1WUZA 5DJCA 3TP4A 4Q6KA 4ECNA 1QR1A 2GTZB 2LVEA 4XNZB 5D1ZA 5AUMB 1CLVA 2OTWA 1OGAE 3L17A 5CILL 4ZYKB 4Y5XB 3VFPB 1XF5B 3MPCA 5FUOL 3VDBA 4BH7A 1ZS8A 2FX8H 2P46B 2FATH 1N8ZA 3DX2A 3II2A 3MACH 5DZOA 4ZX3A 4OD3L 2AQTA 5JOEA 4UQ3A 2AI0L 2BOCA 3EFFA 1A4KB 1OCRB 4OF7A 4AIOA 4DKEL 1BJ1J 3L3GA 4PJXE 3U46A 4P59H 2DQGL 1KPRB 1RK0A 1TJIH 2DMCA 3MUZ1 2FT7A 2GT9B 4J3VA 4PJIA 1A5FL 2OX5B 4LRIA 1G7MA 4NO5A 2WANA 1S78C 2V7NB 1Q0EA 4ABUA 1NCCH 1KLFB 3ARPA 4PM1A 4WO4D 3ARUA 4IDJL 4X8JA 3QG7L 5FGBA 5FO9B 2GG1A 1DLFL 5DJ2B 2FIKA 2GJZB 1J87A 4XCNA 4OGYL 2W0FB 4A7GF 3KEDA 2WGNB 2QVFB 3ZDYB 1NEZB 2OS7A 4QT5B 1Y6NR 2JB5H 4MAUL 4NYLB 3BD4A 4YC2B 3RFZA 1BQ5A 3GRWA 3ZX1A 1HTYA 3BWAB 5HD8D 3E8UH 3DX9B 3FC8A 4BV1A 4Y4KD 5DK3A 4N2KA 1A9VA 4L29A 4FFYL 1U95B 3O9WD 4O02B 3EKCA 1D5MB 4YDVA 1EEZA 2QMKA 1U21A 3VSQA 1GYCA 1DQJA 2FUQA 4F20A 1RJLA 5KSAB 3UBXG 1RZGA 4NT6B 2D7QA 1QBLH 4LKXA 3IFNH 3B8YA 2XV0A 3MLXH 3JV5A 3QUZA 1ZTXH 5DF0A 1FV1B 2Y7LA 3MCKB 3IEAA 5GGRB 4M6MH 1I85C 5JXAL 5HDBE 2UV3A 1P7BA 1WO2A 1B0IA 3ABGA 3R0MA 2B4CL 4UDUB 5E4EC 3RDTB 4PLKC 2YGOA 1S7SA 4KITB 1S7RB 1Q9OA 1QSEB 1KCSH 4WU5B 4PW4A 3RWIB 4ZMZA 4DAGH 4XR8C 2OMUB 3SPVB 2WWKT 4NXKA 3WENA 2PCPA 3D0LA 3LTVA 2XG4B 5L2JA 2Z9TA 4FQ1H 4E68A 3T2NH 5CINL 5C0AE 1M3IA 3HMXH 4UTBA 2AK1H 2BNRB 2B15A 3GI8L 2BSEA 3BUTA 3TA3C 5A6LA 3MREB 2QR0A 1I9EA 1G4MA 4JPQA 1K3IA 1OAUL 3OAZH 3GBMH 2F7OA 3X14A 4LOEA 3DO4A 4WI5A 3TBWB 3GJEA 3DTXA 3LVTA 1QASA 2IPTL 4GBXB 4ZW7A 4FCHA 3T3MB 3FTWA 5DZ9A 4F2FA 1KCWA 5D6CB 4U3XA 4KPHH 3MNZA 2AMGA 2VOTA 5K93A 4I18A 1ZHNA 5GGUA 5CCGE 3T0BA 5DUJA 5BRZB 3DOIA 3TVMA 3EO0A 2IPKB 2FX8L 3A4FA 2OCCB 4LL4A 3MRDB 2FATL 4UB0H 1DO6A 4Y5XC 4G9FE 3MACL 4LHQB 1BG1A 1CXEA 4LNVA 3F7VB 1IGTA 1ZDSA 4PJFB 5SWSE 5B4MD 4UM8A 5DJ0B 2XX1A 4P59L 4Z0BH 1TJIL 2WNXA 4M8QA 4X5XB 2V3EA 4L05A 2COQA 5EU5A 5F0LB 3ZDXE 1YPZF 3SJVB 5EOQH 3GMMB 1YAIA 2YQBA 4AENB 2JV6A 1NCCL 1PG7X 1QUNB 2OJ1A 2VXUH 3A6BH 3AQZA 2R83A 4U1IA 2XN9D 4JBSA 4PLJD 4NN6C 3T3PB 1QSZA 1D7DA 4N0UB 4WI4A 5ACZB 4PR5B 1LQBC 3R06A 3PV6A 4GP8B 3RIFF 4PJHB 2JB5L 1YYLH 1KIRB 4B9PA 3H9HA 2F53A 1HQ4B 3DV4A 2FQFA 2KS0A 3D0VB 4YSSA 3E8UL 3QG6A 4CC0A 2VL4A 1IAIM 3ZE0F 5F0PB 5BNXD 4ZS7H 3US0A 3H7BB 5HJ3B 3CFMA 4BQ6A 4UTCA 4GKNA 1HWGB 2Y1AA 4RRPG 1NC2A 5LN4A 2EVFA 5D1XB 2R27A 3WLWC 3VRJA 2VCOA 2ZUTA 2ZOTA 3MAWA 1QBLL 1JGDA 4ISVA 3IFNL 5FFGA 3MLXL 3NRQA 4WDIB 3VM7A 3CZJA 4DZ8B 1ZTXL 3HG0A 4RGMB 4HIEB 4BHUI 3JWDC 3FU7A 4M6ML 5J5EA 2YLKA 4DP0X 3JWOH 1U36A 5AB0A 2I9TB 3NUKA 3UTSB 1U8JA 3ZVVA 2C26A 1GJIA 3F83A 2BOLA 2EC8A 2NY1D 4M4PA 5I5IA 2Z34A 3N40F 1BJ1H 1KCSL 2DQTH 2X89A 3RDTC 2B7DT 3VCLA 4DAGL 1Q9LB 2ZP0T 2NQ3A 4FTVB 4X7CC 4CU8A 2UZPA 1JNHA 3L1GA 4X6CF 4LLYB 3QJHB 1I85A 1EVTC 5J3HC 4FQ1L 5D7LB 3UFIA 4V11A 3T2NL 4OZIF 3MRBA 1VFAB 3EFDL 3HMXL 2AK1L 1DVFC 4RFEA 3FQRA 3NCMA 2YXFA 1L6ZA 3FN3A 3MFFA 4NNXB 1QHOA 4OZFA 1S9VB 3QCTH 5EPMB 3GBML 2F6AA 3CTTA 3O2VH 2ZT9C 5I8CA 2EAEA 3CX5J 5CIPH 4Z1PA 2R2BB 5INCA 1G7QA 4NRXA 4LCWB 4QHKJ 4FTDA 1NEUA 4GBXC 3OGOE 2XBTA 4KPHL 3TA3A 1IC0A 1RAMA 3CD4A 3QIWC 4D8PB 2R9HD 2HLAB 5GS3A 3K4AA 3KBPA 1SEQH 5B8CC 3IDIB 4PGCA 2NRDA 5E2VH 2BIOA 3TPUA 1F4HA 3IDXH 4YSQA 1PCSA 4J6IA 4UB0L 3MJGX 2NY5C 2AJUH 2Y5TB 5JXEA 3OKKB 5ISZD 4QRPB 4YL4A 3D39E 2NY3C 4OD2A 3T8MA 4HUUA 3DROB 2GYSA 4H25B 4Z0BL 4HG4J 5D9SB 3ARGD 4RAVA 4X9IA 3T0VA 3RZCD 1E6OH 3F84A 4MA8H 1KV3A 3IDNA 4D0DB 4NQDD 1JGEA 1RUAL 3KPMB 5AUMA 1NDMB 3JTSB 3PJSB 1BREA 2DD8H 2B08A 2QSVA 4Y5XA 3VFPA 3QXUA 3OKDB 2ESVB 4X4XB 3QZWG 2VXUL 3A6BL 5FM5O 5ICXA 1EDQA 2HFTA 3TH3T 3ZGHA 1MW1A 2XZZA 3NFNB 5T1LD 4JFDE 5B7FA 2RA1A 3SD2A 1KPRA 3OR6B 1WP6A 1M7IA 1T80A 4GXFA 1GGUA 2EKJA 2GT9A 3BAXA 5F6IB 2OX5A 1MXGA 1YYLL 2DQJH 4AW7A 3D7PA 2PO6B 3BKML 4YQXH 2MFNA 1HSBB 2ZTBA 3SHSA 4L3EE 4TF4A 5EEVA 3PQYD 3IMBA 1KLFA 2APVA 4ZS7L 1PF3A 4D94A 1SQ2N 3BP6B 4FZEH 4OCWH 1UH4A 3DMMD 5FO9A 2IBBA 1MFUA 5DJ2A 2GB2A 2FT6A 4GQ9H 3L4CA 4HF5H 2EIDA 2XN0A 1GGYA 5AB1A 4QT5A 3ZRSA 2ADFH 3L3HA 3S2CA 3OG4B 3MLVH 4XXCC 3MV9E 1T2XA 1IB5A 1J8HD 1AXTH 4L2LA 3JTTB 4XCCH 1YUKB 3HS0B 4D9RD 3BWAA 5CHNB 3TBSA 3QIBB 5F88A 3DX9A 5K1NA 2N01B 2CGZA 2ADGA 4OAWB 4GUPB 4RGMC 2X0WA 4KKAD 3BO8B 2HFGH 3I2CH 3JWOL 1U95A 4O02A 3CC1A 3T04D 2BWQA 1D5MA 3E3QE 4WU7B 3I9GH 1DL7H 4FQQB 1FLTX 1RZJH 1EUUA 4D0BA 2DQTL 4ZOAA 2P24B 5KSAA 1X5HA 2X40A 2WXPA 2LHAA 2AKRA 2C9QA 3DX6B 4H4NA 5IESH 3E6HB 1AGBB 2YEQA 4NUQA 1FV1A 2D0HA 3MCKA 1U8HB 4PMEA 5GGRA 5H37G 3SDXE 1RKRA 3MBXH 4M02A 1OM3H 4PJ9D 3LIUA 1I8IB 5I9QC 1A4AA 3C60C 3E7JA 4X99B 1LEGB 3LZPA 1H3PH 4TLUA 3MKKA 4ZUVA 5IB3B 3OMIB 2ENQA 5HGDA 4NQVB 4NKOA 4RFOH 4G5AA 4AJYV 1QSFB 1RULH 5HJBA 3RDTA 2XBZA 1OGAD 1TZAA 1QSEA 3IETB 3FFCA 3QCTL 4XC3H 4IBZA 1PPIA 3ARSA 3RDJA 3O2VL 3U4EA 3UTTA 2DMGA 5CSGA 2OMUA 4JFZH 3SPVA 3U2SB 4G6FB 3F62A 1VCAA 2XG4A 2JFCA 4JKNA 2VJXA 1A4JA 4TQEH 1UXLA 1DVFA 2EYRB 1G9NC 4Y5YB 3PUUA 5KSUB 1AYRA 3O8XB 1SEQL 3B3IB 5E2VL 4JVWA 3VQ1C 4CU7A 3WEAA 3QCVH 3IDXL 3GSQA 1JDDA 2WWNA 1BM7A 2AJUL 3RX8A 5IUSA 4Z9KB 3VE0B 2X4TB 3HNSH 4FRWA 3ZTNH 1FYTE 1N8OE 2IV8A 4H7VA 4GBXA 1Z0NA 1QSVA 1XD1A 3GSVB 3LNFA 3AVEA 3QIWA 4PREA 4RDQG 5FUZH 1E6OL 1F5WA 1UASA 4MA8L 1E40A 2HLFD 5B8CA 3JT2A 1QFUH 4HIIB 5BRZA 2ZG1A 2DD8L 4WJ5A 1KGJA 4PEEA 3QORD 2X6CA 5D55A 2G3MA 2IPKA 3FHEA 4FQLH 3B7TA 3VRIB 5C0DB 1XGZA 4F3FB 3T6VA 3R4RA 3VWJB 4LZKA 5ESAA 3F7VA 1IFGA 4IBSA 4JM2D 5JORB 1HHGB 2PUQT 1WD8A 5CFHA 4LQ1A 5G4OA 4HJJL 5T3ZE 3LKSB 3BZ4A 3II3A 1UZ8A 4WO4B 5BW7C 2DQJL 1D7BA 1NCBH 1S8DA 4N8VG 4RWHA 2YSTA 4RX4A 2JQMA 4DGVH 4YQXL 3GMMA 5EDSA 1KBKA 4XN8A 2PO6C 1SY6H 4A7GA 1QUNA 4OCWL 4FZEL 1E65A 3R8QA 1ZHKA 1WCBB 5IEHB 2D0FA 2IGTA 3VGBA 4HGMA 4GQ9L 2KC0A 3LKRB 4KVNH 4HF5L 5LBSA 4KX8A 4WZ9A 3OXRB 2DTSA 4Y4KB 2CAKA 4GH7B 1T4WA 3QJFA 1WIUA 2ADFL 5CCHE 1CF8H 3MLVL 3O4OB 3ZT6A 4O4YH 3MRJB 4XCCL 1AXTL 4OY9A 2NT1A 4J3OD 4X7FC 5F9JA 2CRZA 3D0VA 1QEWB 1MCCA 1QNIA 3NT0A 4K8RD 3F7LA 3FTXA 3QIBC 5HJ3A 4DGWC 2HFGL 3I2CL 5E8EA 5C0AD 1JZEA 1WGOA 2NNAA 3OAZK 1YYCA 3I9GL 4OI7A 3L3OB 1DL7L 3N41F 4J23A 5F7FA 3G6JF 5C0CE 2DIBA 4XXCA 3QUYC 1JCVA 4GFTB 2EXWD 4XAKD 3BRGC 3V10A 2RHEA 1LO3H 3AS1A 4DZ8A 2J8OA 4IIQC 4WDIA 3OKMB 3ZXAC 5IESL 3W0WE 4HIEA 4LRNH 2WQVA 3MBXL 1OM3L 3T0EB 1A1NB 3CDZB 4CU6A 4PLNC 3SYPA 3UTSA 1H3PL 4BA8A 5KVDE 1JPFB 1FC2D 1XGYH 4RFOL 1RULL 5JHAA 1JXGA 2GC7C 4WHTA 4IOIB 2WBJC 5I1IH 1NGPH 3CN3A 3QP3A 5CU5A 4XC3L 2CIKA 5C09D 4R7DA 4FTVA 1I8KA 3EGDB 1HS6A 1K8IB 2ITDB 3CXHJ 4G9FD 4TKWA 5EO9B 4WIQA 4LLYA 3QJHA 3LQAC 1VZIA 3C60A 5SWSD 3FUNA 4TQEL 2IADB 1VFAA 5C3IA 4A7QA 3N40P 1I53A 5CR1A 4Y5YC 3L6FB 5CJ8A 5JOFA 1F1AA 4PCYA 3QCVL 4NNXA 4HKZA 3NIDE 4PRIE 5AOIA 5EPMA 5GS0H 1IVLA 3HAEG 2HT3D 3HNSL 2LT9A 2R2BA 4JRXA 5KSVA 4UZGA 4RQQA 3ZTNL 5IKCB 4LCWA 1GJUA 2C3VB 2YAFA 3S34H 4JGUA 4PAZA 2FQDA 1AGEB 3B7YA 1JBJA 5FUZL 4D8PA 2BP5M 2ORBH 2QELA 4Z18A 5DHEA 1N26A 4Z6AT 1JGLH 1QFUL 1WLHA 1IQWH 4H40A 3IDIA 3RQ3A 2E27H 3KL5A 4ZNCD 1EAPB 1G7HA 3D06A 1NINA 4FQLL 4QRPA 3RWEB 3L95B 1U58B 2W81C 5HI5C 1M9WA 3VWJC 2B3IA 3MBEB 3ZBMA 3GUFA 3WFBH 4DTGH 3P4LA 4JJHA 1SPDA 2DM7A 3U82B 2HXAA 2K9UA 3FO2A 4XO8A 2XN9B 3IDGA 2FO8A 1U8MA 3JTSA 1NCBL 4PMFA 1BZDA 3O6LH 4DGVL 3OKDA 3EZJB 2ESVA 3IRCA 1ZT4B 1SY6L 3JXAA 4OCXH 4X4XA 5BVPH 3NFNA 1B0RB 3LD8B 4YHMH 3WNJA 4NC1E 1MJ8H 1WS7A 3U4KA 1DBAL 4KVNL 5LCVH 3MNWB 4RDQF 1PU0A 4JDTH 2YD3A 3QYNA 2V6HA 3MJ8B 3ROLB 1FIGH 1CF8L 3GO1H 3NFPB 4O4YL 2PO6A 4JN2B 4L37B 1HSBA 4YZFE 3W39B 4B3VA 2UZYA 4F1SA 5E99H 3OB0K 3NGBB 4UBDC 2WXKA 4KNTA 4GQQA 1INDH 3BP6A 1PKQA 1M7XA 1K4CA 1NUNB 3QNXA 4JL1A 4NAMA 3ZL1A 5C9JA 1FGVH 3FFOA 3LJ3A 3VH8A 4KAQH 3CGTA 4FDWA 5C0BD 4Z7OB 3L3OC 2CKBB 3B7SA 5C0NC 4AUYA 4Z76A 2NY1B 3JTTA 5F7AA 3HS0A 3LNDA 5CHNA 2I5YH 3QIBA 4LRNL 3T5WA 4WGVB 4N6RB 4OAWA 4GUPA 2F15A 4E9RA 4HAGA 3WDJA 2FLMA 3T0EC 3T9WA 5C2BH 4PV8B 1XGYL 4WU7A 4X6CA 3W37A 3IGAB 5DS2A 3QUYA 4XPHH 3VQ2C 5I1IL 1NGPL 1ET8A 4OZIA 1FG2B 2P24A 3B2XA 1BVKB 4IIQA 1L7TH 3CQFA 3DX6A 2XVBA 1ZS2A 3D39D 3APDA 3E6HA 2O93L 4HW6A 4LHUG 4KJWD 2AV7B 4OZ4B 5DUBB 1OQOA 4Q9RH 4XMLH 3OKOB 3K6DA 5IB3A 3VDCA 1F4YH 4UTAH 2WBJA 3FTUA 3KLAB 5CAYB 5E23A 4OFYD 4XOAA 3WDIA 2VXQA 2XTLA 3IETA 3SN6N 5GS0L 5J89A 4XMWA 5D2LB 5DMYA 2OR8A 1XB8A 2O61B 3B2UC 5ICUA 2LLLA 2UX7A 4HV8A 1GOGA 4JFDD 2AK4A 1E3FA 4MYWB 4GB9A 4FI8A 1SMAA 5F7MC 4C4BA 5ISZB 1GCYA 3BLBA 2ORBL 2BVEA 4IS6A 4Y5YA 1JERA 1Z5LA 1IGIH 4YXKH 1JGLL 1WIOA 2DWXA 4Y16D 1IQWL 1R24B 5I6PA 2E27L 3H2QA 4NERA 4P3WA 3DARA 2FL5B 3ARGB 3MYJB 4LFHD 3RZCB 1DVTA 2Y5EA 4NQDB 2H6OA 1UOLA 3VE0A 4Y9GA 4DKTA 5I75C 5KBPA 3IF1B 2VT0A 3U7AA 4LSQH 5D93B 3GSVA 3WFBL 5H8DA 4DTGL 1RV6X 3CHOA 1OGTB 3MBEC 1SZNA 4JANB 3FYIB 4DP5X 3AQXA 4M6NH 4PRBB 4QRAA 3MRLB 4GMTH 4OIAA 5FS5A 1ZA6B 3EGXB 3O6LL 1O9ZA 5JW4M 2EVHA 3BIKA 3MV9D 1UJTA 1RHHB 4OCXL 3VRIA 4F3FA 5BVPL 3CVCA 1AC0A 4MYPA 3VWJA 4AE0A 3HG1B 2P7TB 4HD5A 4NQXB 2YEZB 2JLLA 4G8GA 4YHML 4OV5B 1MJ8L 3DGGB 2J21A 3HE6D 3O6KH 4XN2A 5LCVL 3V7AE 4JDTL 1QATA 3PQYB 2VKWA 4WO4A 4Z7UB 4HKXA 3U9WA 2J12B 1FIGL 3GO1L 3DMMB 4L1TA 4FYQA 1CFQA 5JHDE 4HZLA 1H3UA 4PJBE 2B9AA 3DPBB 1V27A 2AGJH 5E99L 1INQA 1GSKA 2FE0A 3WHE0 5DRXB 4B9ZA 5FPIA 1INDL 5DEJA 1RCYA 3IMVA 3NGBC 4MXQC 4P05A 4Q0XL 1BVNT 4H8PA 2VDNB 2ZOOA 1FGVL 4U3SA 1E30A 3LKRA 1T7ZA 3TU6A 5D2NE 3OXRA 4KAQL 3N9GH 3MV01 4HK3J 3S48A 1AQMA 3AABA 3UCQA 2Z8VC 4XP9H 4NWTH 1HKLH 4L48A 5DK0B 5I0DA 2CDEB 2I5YL 3QWQB 1QEWA 1GJWA 2NY1C 1KIPB 3K0YA 2VISA 1CBVH 2FT8A 1JF5A 3WHXB 1AAJA 3MO1B 4OGQC 3RJQB 5C2BL 5C08E 3I75B 1FH2A 3P02A 3CXFA 3U30C 2WQUA 3L3OA 1L5GB 1I1FB 1HOEA 2CLZB 4XPHL 1NGYA 1MIEH 3UPAA 3HUJE 1FAIH 3QUXD 4PJ9B 5GGVH 3KH3A 4Z7WB 4KMLB 2XXGA 4BCYA 1SN2A 5FA4B 4JO3H 4ZPVB 5B3JE 4OLUH 1L7TL 3DBSA 4YDKH 3UL4A 1FYTD 1OGAB 4QXUH 4PW9A 3APMA 3RNKA 4JRFA 3T0EA 1YY9D 2GY5A 3CDZA 1L6XA 4Q9RL 4TRPH 4XMLL 5IJKC 1F4YL 3I9PA 5FW8A 3RUGE 2CE6A 4S10A 1J12A 4JO8A 5HYEA 2NYKA 2V8LA 4PJXB 4ZX4A 2EYTA 3N42F 5F8RC 3E0GA 1U6AH 3GGWA 5CJBA 1G9EA 2WUCH 2I32A 5EO9A 3CZUB 4HJ1A 2D9CA 1WAAE 4JGNA 1MCRA 2C9XA 5T3ZD 5FKAA 3V79C 4HS6B 5IQOA 2F7PA 1IGIL 2DQEH 4WW2B 4H8VA 4YXKL 2EACA 3N1FC 4A66A 1C1EH 4HPOH 5GSRB 1RPKA 4WFED 5DEFB 2PWFA 1KTKE 1DHKA 3VFRB 4WHDA 3ZHDA 4F8LA 4AX3A 4UNIA 1MI5E 3CX5K 3ARGC 5BZZA 2WCGA 4LLDA 1J5OH 2D4FA 1KNOA 3QORB 4LSQL 2C3VA 4L1HA 2F0CA 4PSRA 1OZTG 4M6NL 4GMTL 5GGQH 5SWQB 4QRUA 4GAFB 1UUSA 4LASH 2EDXA 1MLBB 4WFFE 5IY5B 1CGUA 4K71C 1PZUB 4WTZA 3JWNE 1U58A 2RMNA 2D31B 3MBEA 3SEPA 4HG4K 5CEYA 3O6KL 4C8XA 1EWHA 5DD0H 1I82A 3B9AA 1EFQA 3FJTA 5IW1A 1QR4A 2I9LB 1B4LA 5GIRB 4XVUC 5HDBB 2W0LA 4U0RC 3WY4A 1JNNH 2XPGA 1HU8A 4EN3C 1ZT4A 1U3YA 4ZFOL 5FR3A 2AGJL 3ARDD 5J6HB 3W0WD 1IAOB 2XPZA 5LBVA 2LVCA 1B0RA 1CFNA 2ZSVA 1AKPA 2Y2TA 12E8H 4O00A 1XSKA 3N9GL 2ZCHH 2EEXA 5J6GA 3MJ8A 3ROLA 3ZPDA 3NFPA 3NIGE 4XP9L 5C0AB 3VX0A 4NWTL 3U1QA 1HKLL 2W91A 4JN2A 2WVSA 5JDSA 3LNGA 3G6JA 5DWPA 2UWEE 5EU3A 1CBVL 4KV5E 3JZYA 3K2UL 2FZ3B 1NIDA 3COOA 3Q3GB 4APQD 2XY1A 5FWRA 4AM0Q 2UXGA 1PW3A 1UXMA 3MN8A 3R7QA 3PP4H 4HLZH 1OAYH 1FAIL 5GGVL 3PREA 1HHKA 3F3HA 1KGUA 1NSNH 3ARVA 1LK3H 4PRID 4JO3L 4PJ9C 1ETA1 3B56A 1IZKA 2ICEC 2BSCA 4OLUL 4TUKH 4B9KC 4YDKL 1W9XA 3F6IA 3BD3A 4NDMB 1UYWH 4QXUL 3W2DH 2MH4A 4U1KB 4HWBA 1DQQB 3S5ZA 4AYSA 4FQ2L 5KYYB 4TRPL 1UWYA 4WW1A 4OM1H 2G5BA 2OTUB 4MJ5A 3IGAA 2QSCH 2X1QA 3L5JA 5SWSB 3U25A 3LHPH 1U6AL 1UD8A 4JFUA 1FG2A 2R23A 4JM4H 3ELQA 4LCUB 3BVNA 1RJCA 2VNCA 3GJFH 4DP2X 3ZDXB 3LV3A 4FN0A 2DWSA 3HC3H 2AV7A 4OZ4A 5DUBA 5IJKA 2I07B 2FSDA 4MQXC 4P9HC 2DQEL 3OKOA 1WAEA 3F65A 1BFOB 1C1EL 4HPOL 4WW2C 3VWKD 1HYRC 2LU3A 4HALA 3K6OA 3STLB 1B4JH 4N2EA 1S2EA 2JNZA 1J5OL 1MXDA 3N5AA 1IGJA 4F7TA 2DWYA 5G4NA 3QORC 2CBPA 5KBLA 1DP0A 2ZOLB 3IS1X 3J07A 4E9LA 1R3HA 5GGQL 2Q2EB 4NPKA 1R24A 4ZUWB 4LASL 5GSVB 4KQ0A 3U6XS 1L0YA 3ARGA 3MYJA 2YN5A 1Q1JH 3ET9F 4NQDA 1E2VA 2A6IB 3D6GA 4G1EB 3WKMH 4QNPF 1WZKA 2Q9OA 3ES6B 5JQ6H 1NEZG 1PFCA 3DHJA 4FLHA 5CLTA 5DD0L 1OGTA 3WELA 1ID5I 1MHEB 4NQEE 1DJGA 4PRBA 3DGDA 2TRYA 3SPCA 5L4MA 2CJTA 5I8EA 3V4VH 1UZ6E 1FZKB 1JNNL 1OK8A 3KR3H 2Y36L 2X10A 3Q7JA 2BS71 3SYQA 4IBUA 3OKLB 4P3DB 4L5FH 3HG1A 1CUOA 2NZ1A 2YEZA 4MAYD 4KMQA 1NPJA 4W9KC 5D70H 4OV5A 5JMRA 5DUPH 1ZVSB 12E8L 1HAWA 1W0VB 1ONQB 2P5WE 4B0MB 1YNTF 4Y4FD 4Y9BA 2ZICA 4HK0A 2E86A 2Y7NA 2ZCHL 5F0MB 1S46A 1TTBA 5IFAH 5DQ9B 1Y7VA 4EN3A 5C97A 4GRWE 5GRZA 1IE4A 3DPBA 2VLKE 5CN2A 1FZMA 3DRQA 3OF6D 3LIZH 3RAJH 4MCZA 2NZ9D 3HW7A 1NCJA 2EXWC 1JGVH 4JFFE 4N2MA 4MS6A 5CN3A 4WQOA 3FONA 3G5XB 3PP4L 1FNEA 4X8GA 1OAYL 4K7PX 5FIEA 2C4FU 2XVKA 3LZRA 3RVXC 1NSNL 1WFTA 1LK3L 4LB8A 4EPSA 4Y8AA 1KMGA 1KXVC 4TUKL 1S9XB 4ATWA 2CDEA 4ELMF 4Z77A 5K9OB 1BBJA 2XN1A 3W2DL 4OKVA 1UYWL 2WNGA 5CJXC 4IIZA 2JMRA 4KRPB 3WHXA 3HG2A 5CCKH 3MO1A 2O6EA 4PJEA 1FFTB 4OM1L 2Z7ZA 3HHRB 3D39B 4JY5H 2CCLA 4KRMB 2QSCL 3BZ5A 1I1FA 3MOQA 2CLZA 3LHPL 3OC5A 4UQ2A 3I3BA 4PRDB 2DI8A 3BWUC 4PJ9A 1JK8A 4R96B 4Z7WA 2HX7A 2DLEA 2ICEA 2X4OB 3MRPA 1AANA 4JM4L 1EANA 3QUKB 4ZPVA 1U8CA 2KI6A 2JK5B 4HC1A 1OGAA 2DI7A 3HZMB 2X9YA 2DQFB 3HC3L 4Y2DD 1RVFH 1TQCB 1HI6B 2EXYC 4NO3B 1OTUD 2N7AA 1OKEA 2HT3C 4CSPA 1YDPB 2UYLA 4JFDB 4XZ4A 3ZIYA 3OR7B 1URIA 4ZXBD 4PJXA 3EBAA 3QUGA 1WS8A 5E8OA 1B4JL 4R3SB 3CXHK 1EHLH 1AGDB 1OEZW 2GCYB 4G72B 4QHNA 1KEMH 5LNEA 4J28A 3HB3C 5D7IF 2NZIA 4L3EB 2OR9H 3L1EA 1DUYB 3BP7B 4U1GB 2P5EE 4BK4A 4WW2A 3VI4F 2YRBA 5CP7B 1RQ5A 3LN5B 5GSRA 1E3ZA 5DEFA 2E8ZA 4DGYH 1XH3B 4WKZA 1QO3B 5JHDD 4U2ZA 3RWCA 3OMZA 2K78A 3TN0D 2PYEA 1Q1JL 2HLEB 3WJMA 3VG9B 3WKML 4RAUA 1ZT1B 3STZB 3QORA 2HTKD 3MV9B 5JQ6L 3HC0B 2J1KA 3ZE2E 2ZP8A 2IXQB 5BQ7B 1F6AA 1UD4A 43CAB 4LPTA 2J5WA 4ZUUB 3V4VL 5SWQA 4ZQKB 3RGVD 2CGYA 4I8DA 3HE6B 3MUY1 1BEYL 2NPLX 3ARXA 4PI2A 2YC1B 3KR3L 1MLBA 3ZYJA 3HPLA 1TCRA 4L5FL 1RK1A 1O0VA 2IDCA 2VSKB 1DBMH 3QZOA 1IFRA 4FJZA 3EUDA 4K2UH 4CVZA 5D70L 1T3FB 5C08D 5DUPL 4CUCA 4EKXA 4RCAA 4G43B 5EUOF 2JXMA 5GIRA 3SDXB 4L4VA 5IFAL 3WIHH 2H1PH 4BFNA 1MWAL 2AMUA 2OYPA 3UTQA 1E4XI 1HXKA 3FQXB 3GDBA 3L2NA 1IAKA 1OLZA 4K9EH 5IIEB 3K7UA 3LIZL 2I60L 5F6HI 3RAJL 1U42A 3HOGA 1NGXB 5EF1A 5C86A 1JGVL 4YBHA 1FL5B 1O6SB 3GMQB 4F7EB 1YRKA 3UJJH 1JYWA 3L5WB 2VL5A 1W0YT 2B8OT 3BH9B 3UPCA 4EZLA 1XGPB 4GPVA 1VRSA 3SBQA 4H0GA 4B6ZA 3QUXB 3HKZA 4UNUA 2OQJB 4Z3EA 3ETBJ 2DQIH 3SE3C 1V3JA 3Q3GA 3ILEA 3ZHFA 4KRPC 3P9LA 4K3HA 1Y18B 2WLZA 3H3BC 1UB6A 2NXYC 3EH5B 1DVSA 1X9UA 1FYTB 4JY5L 3MI6A 1TYJA 2WBXA 1U93B 1KXVA 4K4KA 1MI5D 3SQRA 3KHOA 5KANG 4B9JA 2BVQB 1CE6B 1TT6A 2OMYA 2HMID 3PXLA 3FYEB 3W57A 3QRBA 5ELIA 5CJXA 4YGVA 5IV2A 4NDMA 3H85A 4H13C 1RVFL 1DQQA 1HL8A 3IJ9A 1BJMA 3BWSA 2IOOA 5KYYA 1TQCC 3TF7C 1JUFA 4KTDH 4ZMXA 3K81A 1O75A 3DLQR 5SWSA 3ULUD 4DVRH 3ATAA 3V5HB 2P28B 2HX8A 2QVMA 3B7UX 3TH4T 1ACXA 3CQPA 3PAYA 2A38A 1SYVB 5FHBH 4WFFD 4G6MH 4LCUA 4BUHA 5TDNB 1EHLL 4FA7B 2CDFB 4IKIA 4B9CA 4KU1A 1LO5B 4NPYA 5GGSA 1KEML 3D30A 4BQBA 2X28A 2I07A 2OR9L 5E7FA 3IU4H 1BFOA 4U1GC 2X2JA 1J8RA 4DGYL 4ZMVA 1I1AC 3DK2A 3NQKA 4GMSH 5I16A 1WBZB 3NYKA 3QDJE 2ZWYA 4Y9EA 1U3HD 4JFEA 3BZFA 4U0QB 2YR3A 5HYJE 1SBSH 3RNQB 2YA0A 5E9DA 3FH8A 4ZMTA 4P4RB 1AJ7H 3VG9C 3FO1B 3QJUB 2Z91B 4GAAA 3BESR 1BG9A 5F9AC 2XWBB 2ED6A 2ZOLA 4UMSA 3U0PA 2DKUA 2PR4H 4MRBA 5GSVA 1NIEA 5F7YC 3P0VH 3ZRCC 3RL1B 4PD4J 3R18A 5F89B 5C0CB 3VXMB 1DBML 2OJEA 1WICA 5AFAA 4K2UL 4GIPD 4ZW3A 1MHEA 1O9WA 1TJHL 3ARDB 3OXSB 3W0WB 2ZAGA 4I3RH 1KN4H 1WFIA 3CVBA 4PJ8B 2H1PL 3WIHL 5K59F 1FZKA 1SMOA 3AU1A 3WTXA 5IM7B 2D3LA 4H88H 3OKLA 2B77A 3QWRA 4LLWA 4P3DA 4MA7H 4NQQA 2X3AA 4K9EL 1LNUA 3KLDA 3EDDA 4QTIH 5DFAA 4ZDHB 3QRFM 1IFHH 1ZVSA 2BP8B 4M5ZL 3WKQA 5IR1A 2JJTC 3H0TA 3GJFK 1C08A 4HP5A 4MDIB 3UJJL 1GTNA 5DQ9A 1FORH 5F7KC 4S1RH 2FX7H 3KYMB 3V5KA 3DC0A 4BKTC 3VMOA 5C8JB 5T5FH 1KGIA 2R0KH 3NIDB 4PRIB 4LGSB 3ZZ1A 1A64A 1T5WB 2Z7YA 2EEFA 3BGFB 3BPNC 2VDKB 3G5XA 1DJYA 7PAZA 1YY9C 1QUPA 3GPSA 1RZKH 3UC0H 3BUYB 4G8AC 1E4KC 5D1QE 3SE3A 1R3KB 3G9VA 2GSMB 4NO0A 1GMEA 4DERA 3EHBD 4KTDL 2NY4D 3D39A 3GBNH 4A7UA 4DVRL 3ULVH 4PRDA 3B9VA 1U41A 2OA9A 5HJGA 2X4OA 3QUKA 5FHBL 3PPSA 4MA1C 4G6ML 1DBJH 4AYMC 3DX8B 2X2IA 4ODHH 2JK5A 5HHME 3VWKB 4E41A 5ESVA 2DQFA 1HI6A 3Q8EA 4R5TA 5F7LB 3S5LB 1JF1B 3NJVA 4PJAF 2IWKA 3IU4L 5TDOB 1QVOB 2WK2A 3D4CA 3DOSB 4NQED 4FG4A 1YDPA 4G1MB 1R5VB 4JFDA 4YK4C 3OR7A 1A7PH 3EH1A 1YEHH 4G7VH 2Z8RA 2VDRB 4AGPA 3HFMH 3MZGB 4XPBH 2NT0A 2MCPH 1P2CB 1QTYT 1SBSL 4WTXA 2G2NA 5AZUA 4Y1TA 2Q7YB 1AJ7L 2GCYA 2PTTB 5H4YA 4OZGF 5GHWH 1ZPLA 2OI9C 5DJZB 5JOPD 3WL9B 3SKMA 1U8IB 2HKFH 2AVFA 2OMTB 2XRAH 4L3EA 1DUYA 2J56A 2OMVB 2P5WD 3BP7A 4F8QA 2RBLA 1I1AA 2Y3NA 4J3XA 5CP7A 2PR4L 4J6RH 5I24A 1QO3A 1C16A 1MFAH 3VFMA 1WWCA 3DVGA 1AFVH 1UA6H 5D71H 5F9DC 3RGBA 2VLKD 4KK5C 2NYZA 2MOGA 1ZT1A 4M61B 3STZA 1OO2A 2HJFB 4JFFD 5BQ7A 1EZLA 3ASOB 2IPUK 2V5MA 4YZWA 2PXYD 5C7ZA 1P7QD 3EF4A 1KN4L 4I3RL 4JPIB 4MAYB 4ZUUA 4PJ8C 3DBXB 3DSNA 4WI8A 1XDTT 4LCYB 2XWZA 4Y4FB 3U2JA 1HHHA 1YNTA 3RJOA 4MA7L 5F1NB 2GJ6D 3WN5B 4QTIL 3HTLX 1AH1A 3IJYB 3BJLA 1EO8H 5E5MB 5F6HJ 1IFHL 2Z35B 4P48A 1NJ9B 1NCWH 3IDYB 1T66D 4KK9C 4N2HA 3SDXA 1A7QH 2WQ8A 1FORL 2GK0A 4S1RL 5L0QB 2FX7L 3IE9A 1MRFH 1YO4A 2VZ3A 2HJKA 1PLGH 1UVQA 4UNTA 3ESMA 3FQXA 2Z8WC 2R0KL 1P5UC 5T5FL 3TT1H 1DQDH 2R2EB 1NGXA 2JJTA 4PJ5D 3FCUB 5AQ0A 3GLEA 3VD1A 3GMQA 5B1CA 2G0KA 1RIUH 2WWMD 3BGFC 4HJSA 3L5WA 3VAEA 4XP4H 1KBGH 1RZKL 3G5VB 2Q8AH 1XGPA 3UC0L 1G1CA 3LS4H 4PV9B 1W8NA 2C3WA 2K4WA 3FKUS 2I26N 1S7WA 2VITB 3KJ6H 2OQJA 1MJJA 1SVZA 3QISA 3CG8A 1QQDB 4JFPA 1U8OA 1DCLA 1JDCA 1KOAA 4OFKA 2P5ED 4MKTA 1F58H 4ZUTA 1X4YA 1DBKH 1FYTA 4HWZB 3ZKND 3GBNL 5CEZE 1BF5A 3VXPB 3ULVL 4YSRA 2N1TE 5DI8A 1G0DA 3IDJA 3KYOB 2NQCA 4GUCA 3D25B 3L48A 4PP2B 4RIRB 2BVQA 5TGBB 1E4KA 1DBJL 5FA3B 4MB3A 4ODHL 4FEIA 4DP1X 2C1PB 2BM3A 1ETJA 1SXZA 4EF3A 3ZYOA 2BIIA 1V05A 4YN3A 3VWKC 2ADIB 4GO8A 4Y9CA 3W81A 2WTPA 3QC6X 2D73A 2BSRB 1SDAB 1RJYA 3ZE1B 1A7PL 3MJ6A 1YEHL 4RA3A 4G7VL 1IL1B 4WTZG 5DD5H 5F7BA 3S8WA 1JPEA 1XB3A 1Q0YH 1F11B 3HFML 4MWFB 1SYVA 2MCPL 2A6KB 1CICD 4MX7B 4KKBD 4NQTA 2MKLC 4N9OB 4AWJC 1D7CA 3U9PH 4E9XA 4UQBA 5GHWL 5JHDB 4S0HA 4F93B 4XI5D 2X4NB 4NAJA 3TN0B 2HKFL 3GYRA 3I74A 2XRAL 4PJBB 2YGNA 3P3TA 5EU7E 2EEDA 2CXGA 4CKVX 1UD3A 4KK6D 2WOBA 4J6RL 3UDWC 5GZND 1WBZA 2K6YA 1MFAL 1XR8A 4MJIB 1CBJA 1AFVL 1UA6L 4N0CD 4OZHF 5D2NB 3IU3B 1EO5A 1UA3A 3ULUL 3RGVB 2K7QA 3QARA 3KGUA 4P4RA 1XF2B 4XMTA 3FO1A 2Z91A 5CZKA 5HVHB 4GAJH 1CU4H 1MFDH 4YPJA 2NXZD 3BW9B 3RB5A 1RL1A 1PCXA 3CSPA 3FB6B 4XCFH 5T3XH 2V8MA 1PX4A 1D6EB 5ALCH 2PCYA 5C08B 4O2EB 4MAYC 2EDJA 4B0MM 4HH9A 2B4CC 1KCRH 4MGXA 2BPBA 1TEGA 4PPTA 3TO2A 5C0CA 3HUJB 3QIUD 3VXMA 3REVA 3M17B 3IXTB 2BWDA 4AYID 1XCWA 5HTSA 3BAEH 3VQLA 1E9PA 2WSKA 2G5UA 4AT6A 5CCJA 1NCWL 3KDMB 4RBPH 3PJNA 1A7QL 2P5PA 2GFBB 4PJ8A 1JYVA 4JNXA 1MRFL 1AD9B 2XVGA 2EVIA 1PLGL 3MTRA 3RUGB 1R33A 4L9LC 4OGXH 4GO6B 1EO7A 3TT1L 1DQDL 4ZDHA 1KFGA 1MN4A 2R1WB 3BT2H 4MHHI 2BP8A 3TT3H 4KKZA 3C6EA 1URLA 4G8EB 4PS8A 1RIUL 3LCYA 3NDYE 2B2XH 1QLEH 4AGMA 1JOIA 2D4DA 2YRLA 3FRPB 4XP4L 1KBGL 2Q8AL 3ZYIA 3UC2A 3LS4L 1J0JA 1IM3D 2Y6TE 3MGOB 1P5UA 1DYZA 3KJ6L 5ES4B 4P5MB 1MI5B 1KIQB 2AEIT 3FO9B 3GSRA 3T77B 4BA0A 1ROWA 1T5WA 4TM9A 4WI7A 4B9GA 2BCMA 1F58L 4QXWA 1DBKL 2NQDA 3FT0A 1TMCB 1NC4D 3QDJD 2ALAA 1CT8B 3OWEA 4X9YA 4PUBH 4FLRA 5HYJD 3BUYA 3LKQA 5LXGH 2QV2A 5FYJU 3DYOA 1E4XH 1UEYA 3VD7A 4FG6D 4EDXB 5E94B 4NNYA 5EEXA 2ITEA 2MOVA 1L0XA 5BS0E 2MRYA 2WJ5A 5DD5L 3H3PH 3KPLB 1Q0YL 2H9GB 4OCSH 2XWJA 1N5AB 4PWJA 4GG8B 2XA3A 1KFAH 4J1UB 3VWKA 3U9PL 1QI5A 4PTUA 3L5IA 1U3HB 4S0TD 3S5LA 1JF1A 4OFPA 1EEYA 5TDOA 1PBYA 4G1MA 2AQ1A 1R5VA 4KUCD 4ZAKB 5IB5A 1OCCB 3KPSE 3H8NA 3NZHH 4I2XA 5T1KD 5JQIB 2G2RB 2HTKC 1GCFA 4KVCH 4OIBA 1UH3A 2YLHA 1U8QA 5BZDA 2IBZY 1JTPA 2DBLH 1JD7A 2BHUA 3B9EA 2Q7YA 2AEOA 2Y72A 1KXQE 3NIGB 2CA4A 3RGVC 3BVXA 4GAJL 5DVMA 1CU4L 5DJZA 1ZHBB 1MFDL 2CMRH 3NPZB 4U6HA 5HVHC 1WBXB 4WTWA 4FFYA 2R4SH 2OMVA 2BSSB 2VDMH 4XCFL 3UDWA 1KYDA 2UWEB 5T3XL 5DDHB 3WEXB 5KYWB 4Z7QE 2CLVA 5ALCL 2XWDA 1X4ZA 1ZMYA 1KCRL 4ODTH 1JYNA 4NP4H 3EYQC 3FH7A 1TG8A 3UZVB 3DKHA 4HWNA 1R3LB 4XH2A 4LSSH 1DVUA 1AMYA 2HJFA 5C2UB 3BAEL 3V9FA 2HVJA 4FFWC 4MJIE 1IQDA 3ZMRA 4JPIA 4MAYA 1JXKA 4EXPX 4YHNA 5FECA 2E6PA 3L9RB 3A24A 3MMEB 3G9AB 3DBXA 4FNLH 5AVQB 4FNTA 1MFVA 5ACLA 5ID0B 4W6WB 5D1QD 5F1NA 1XEDA 5CIPB 2ZNWA 4OGXL 4WHCA 4BQ9A 1A14H 2H6PA 3T2LA 3IFPB 3IJYA 4P5TB 5E5MA 2FRGP 4MS8C 2Z35A 3BT2L 3QAZC 4YHYC 3TT3L 4NQCE 1MSPA 1NJ9A 1AS7A 5C3LD 2B2XL 1QLEL 2GJRA 5I6XB 4HJGA 4ODXB 1YNLL 4Q9CA 4GRLD 4OV6F 1PX3A 3UP1A 4LDCA 4L9LA 5AVUB 5B39B 2V17H 4IRZH 3AROA 4OVUA 4R5XA 1FE8H 3GMLB 5HHMD 1D6VH 4LCCC 1ZSDB 3EW3B 4PGBB 4EQ3A 2R2EA 1Z9MA 1BVNP 2I85A 4BKSC 2PWHA 3O3BB 1AGFB 4OLXL 1F86A 1MUJB 5IUCA 3QYMA 4OT1L 4PCSA 3QJTB 3KM2A 1OP3H 4R7LA 4LL1A 3NCBB 2OXHB 4ELKB 3BYTA 3LN9A 3LRGA 1SVCP 3EHBB 2NY4B 4PUBL 5E0FA 3OHXB 3U1SH 1T0MB 5LXGL 2AHIA 2OW6A 2HVKA 4XBPB 6PCYA 1O7DE 1QQDA 3D2TA 3CU1A 3MJ7B 3TV3H 1E4WH 1AACA 2F18A 4NKDB 3V0DA 5DVPA 4XO3A 1PJ9A 1G9MH 4ATTA 2E4FA 3VXPA 2HH0L 2XT1B 1ROCA 2BOBA 3JV4A 3VDAA 3H3PL 1G4RA 3MV8A 4DEWA 4PP2A 3N55A 3D25A 1CE1H 4JUSA 2F68X 4NQEB 4OCSL 5TGBA 3SY6A 4FQCH 1DSYA 4PJAA 5FA3A 1KFAL 3UAFA 3CK0H 3HBQA 2WP3O 5AAMC 3S7GA 5JPMB 2C1PA 5GISH 4AQ8C 2FQEA 3B2MA 5DGRA 3CN2A 1JTOA 1Q1PA 4JHWH 3M7FB 4PYGA 2BSRA 5JLZB 1FAKT 5D2LF 1BLNB 2J8HA 3NZHL 1O5PA 2MCMA 3V5DB 4ZAKC 5TF0A 1F11A 4KVCL 2P5WB 4MWFA 5DSCB 1RMFH 2A6KA 4MX7A 1GC1H 1CFSB 2FX9H 2DBLL 3QXDB 1DSFH 1U3NA 4HXBH 4G2AA 2JTDA 4QLRA 2AQQA 3BIBX 3S2AA 2WXQA 5B3SB 3N0AA 4GRWB 35C8H 2CMRL 4PJBA 5AL8A 1U8KB 2VLKB 2R4SL 4XP1H 3OAUH 2VDML 3ZTDC 3JWOC 2HFFB 1ZE3H 5CGYD 4ELDA 5FM5M 3BIAX 4JFFB 2YN3A 5FKAB 3AITA 2XY2A 4ODTL 1HHIB 4NP4L 2PXYB 3L9EA 1J8KA 1G0YR 4PVNA 5KS9F 4J3OG 3RGVA 3FW6A 3H9SE 4LSSL 5AOJA 5BUPA 1S7VB 1AZUA 1PZAA 2VDPL 4IRSD 5JHMA 4JKMA 5KSBB 1KUMA 2ZUWA 4H2AA 3BW9A 1XWVA 3FB6A 3QFJE 1RIHH 5AG8A 3ZJAA 3HBGA 5DS1A 2WMPB 5C08A 4O2EA 5K69A 5F44A 1PTZA 4U1HB 1EGJH 4FNLL 4EZKA 2AZAA 5LLIC 4IBTA 1KBVA 4AVKA 3BVTA 3AFLA 4YVNA 4I3GA 3HUJA 3M17A 5T1DH 1A14L 3D4GA 1YAZA 5CEXB 2IFGA 3T0DA 1UHVA 4PGZA 4L8BA 1ITCA 2BW5A 4KKCD 4P5TC 3KDMA 5EFIA 1LEKB 3CU7A 3V6OE 5CEZD 3EUUA 1OD9A 1EXHA 3E1F1 3H6AA 3B8SA 3KLQA 4ANKA 4GXUN 2O6CA 3VXRE 2V17L 4IRZL 3VNZA 1FE8L 2VR6A 3D2UA 1D6VL 3LB6C 3SGDI 1OB1A 5EMYA 3O4LE 2QGCA 3ZQXA 3MNVB 1KJ2B 3H9ZA 3KBFA 1JPSH 1OSZA 4K5OA 3CWGA 4G8EA 1WAAA 3P77A 2FQGA 2YKLH 4QTHA 4R7NB 1KTDA 4OI9A 2XLLA 5I6NA 3VFWA 3N85H 2QTVA 3FRPA 1TEYA 2P5EB 2JCCE 1A66A 1EUTA 3MGOA 2NY4C 1O7VA 3AG2B 4JMXA 4QRTB 3U1SL 5DVLA 1MI5A 4ZX6A 3OHXC 5J1AB 1N2RB 5HDLA 5JIQA 3TV3L 1E4WL 2OP4L 4CKQA 3VB9A 2BIPA 5JIMA 1G9ML 1KGXA 2Y1ZA 4BXSV 3MOAH 5EH1A 3ZE2B 1OVZA 5C6WH 1X44A 2C7UB 1J0HA 4K0OA 1AO7A 1CE1L 3HCVA 4FQCL 3BX7C 3CK0L 3NEOA 2W65A 5GISL 2R0WH 3MRFB 5JPMC 5EORH 3AXIA 4XN5A 2J1XA 3CPUA 3QFDB 1CICB 1V10A 1MCBA 2O5ZH 3BPLB 4JHWL 4YSDA 5HSFA 4EDXA 3VQMA 4ZX5A 3SB3A 2XV3A 4H0LC 2YJLA 3FRUA 4H1LB 4EUPH 2H9GA 4FKHA 1RMFL 1QBBA 4QXGH 5AAMA 3UAEA 4E36A 1N5AA 2FX9L 4NI6A 1DSFL 4RBPK 1G7LB 4AQ8A 4ABVA 2E5EA 2E9IA 2XIIA 1Z2KA 3P4OB 5EF0A 35C8L 2GVYA 3OAUL 5FM8A 4M7JH 4QRQA 4ZAKA 2HRLA 1CD8A 3NSYA 3WSQH 4X6FA 1JGUH 2G2RA 5F3FA 1RZJC 2D7PA 1E5BA 2DTMH 5DC9B 1EQWA 3C09B 5DHMC 3W3BA 1TOXA 5IEKA 4JM2F 1JD9A 2O5YH 2G60H 3QI9D 3VFVB 4HK3N 2NOYA 4KHTH 1WBXA 3TESA 3QIUB 3QDME 3QDAA 4PY8I 1RIHL 2UWEA 3GTTA 3UYOD 3WEXA 4RMUA 3OWRA 3HG4A 2DJSA 2NR6C 4G8FA 1EGJL 1BCIA 5M7QA 4B9FA 5DJDA 4IBWA 3UZVA 4Z95H 1JZFA 4I7ZC 5KTEH 1WFOA 3DJRA 5T1DL 4AIZB 2X4QB 3P30H 5CLYA 4GFXA 1QRNE 1FC1A 2AFNA 3ARBD 1K85A 1TKWB 4CBPA 5FHAH 3HZYA 4HPHA 1F41A 2XZAH 2CM6A 4JQIH 4TUOB 1WZ1H 1SJHA 5EIIB 1V3KA 3VI3F 2R0LH 5GZOD 2Y6SC 3CV5A 3SKUD 1DJSA 2J8UE 3MMEA 4JKLA 4LEOA 3EYOB 1OALA 3BAJA 3KWWA 4MNQE 2EZ0C 5IFHH 4LMQI 5CIPA 1TZOA 3H7LA 1EFXD 3U6RA 3IFPA 1FNAA 1OE3A 4P5TA 4LXFA 1IM3B 4ZW6A 5LAXB 1ASPA 1JPSL 2EDQA 1FVEB 1Z5HA 3MRQB 5DZNA 2YKLL 3CHXA 1IIIA 2H32H 2XVLA 3W9DB 2GIMA 4Z5RB 5BS0D 4LARH 3N85L 5KJRH 3QEUB 4NOBA 4TNEA 1AY1H 5MEPB 2ODIA 2YJQA 4O51B 5I1DA 3V7MA 5B39A 2VQ1A 4NRYB 3ZKNC 2DI9A 1NC4B 2NY0B 2QQNH 4NKMB 3QDJB 2V0AA 3WEBA 4PGBA 3BN9D 4XGZB 3D85D 2FHFA 3QJRB 4HLJA 2NW3A 1I1RA 4MRCA 3ULVE 5HYJB 3O3BA 4PSPA 2VDQH 4KNUA 1MUJA 1VJSA 1FIEA 1MCOH 4U6TA 3CN1A 3KPSD 3MOAL 3TURA 2EH7H 4U1JB 2BW4A 5CD3B 4LFHG 1FVDA 4PJCE 3CZLA 3NK3A 5HGHB 4WK0B 1RI8A 2YUXA 5C7XH 4N5EC 3OHXA 1T0MA 1CI3M 5EORL 3GWJA 3N43B 1PLAA 1SMDA 1T5XB 5CGMA 2UY6B 1NFDE 2Y2WA 2ZWKA 1AHMA 2O5ZL 1OCWH 1SLUA 4UU9B 1G43A 4PB0H 3BPLC 2ADJA 3FAWA 1P0SE 1PD1A 2X1OA 5DVKA 3TJHD 5GJSH 4XI5C 1QZNA 4QXGL 5L88H 3HG5A 1L9SA 3KZ8A 1DZ0A 3GFUA 3UOAB 5T1KB 3SDDC 5JPMA 4XHJD 4KK6C 3ARED 3GMOB 3MRHA 1YSOA 1N3NB 3N6YA 1SN5A 5D5MF 4NOFA 3HRZB 1CVRA 4MJID 5DRNA 4QOKD 2EP6A 1OIOA 4M7JL 4X7EC 3C8DA 1BLNA 3WSQL 1JGUL 1RFDH 4TVPE 4FQHB 2NX5A 3IMRA 2DTML 2P5WA 5GRVL 1I3UA 4NZFA 2DWEB 4OI8A 1OE2A 2ZXQA 3WUWA 2HFEB 3WFCH 1ZLWH 1XHHA 2YSSA 2VDOB 4MFHA 2WNWA 4KDTC 3C09C 3N1MC 2O5YL 2G60L 3VD4A 5TD4A 5DURB 5AW7B 5IJVA 4KHTL 1ES0B 4NQCD 5J6SA 3CVHL 3S5YA 3PWUB 3T1FB 4Z7VE 2VC2H 2YD6A 3QJQB 4JFFA 5DRWB 4YSOA 3NCJH 5E00B 4PJIE 1HHIA 4TNGA 3NSFA 2CK0H 5JIKA 5F70A 3T2PA 1F97A 4O5LH 4DKFH 5LGJA 4Z95L 3SYCA 2LFGA 3UAJD 5B1JC 3ME0B 4JDEB 1S7VA 3NEXA 3P30L 1J8SA 1OP3K 5FC9A 3TIDB 5KSBA 1OT2A 3FXIC 4ZMOA 5FHAL 3M7OA 1BZEA 2ODHA 2XZAL 3HC4H 5D1QB 1X7SA 4AQEB 1OE1A 3FQNB 4WV1B 3BAKA 4JQIL 1WZ1L 2NR6A 3GHBH 5HDOA 2R0LL 3Q01A 5E2WH 5FM4A 1A9EB 2W80C 1D5XB 4U1HA 4HUVB 3RJDA 5IFHL 2OL3H 3BC9A 1LD9B 5CEXA 3BUBA 5EEYA 6CGTA 2VO8A 2ATAA 4GRLB 1SJEB 4F7CB 2X2YA 4PG9A 5HHMB 1DEDA 4TUJB 2K3TA 4LARL 4ESKA 5KJRL 1G1YA 2E9BA 1AY1L 3NJFA 2WYHA 4M5YH 2A4EA 4YGAB 3SGEI 2X2HA 5I1LB 4BM7A 4ZOBA 1BOGB 2K70A 2QQNL 3CUPB 5IBLD 3BP4B 5J13C 3G6AA 2NY0C 3TBYA 3Q2NA 3OGCB 1HC1A 1AE6H 2IV9A 3D87B 3MVSA 4JM0A 2XNAA 1VEOA 4NLAA 4QRSA 1BQSA 1TFPA 2BS8A 1W72B 2VDQL 1MCOL 2XJKA 2DQHH 4LF3A 1F3DJ 2EH7L 1F0LA 2QPDB 2DWDB 2QDWA 3QS3A 1VCBC 1A1OB 4A6YH 3IFOB 5CBAB 2Q10A 5C7XL 1IC4H 4QRTA 3SKOA 5DJ6B 3QE5A 2FNWA 32C2B 5J1AA 1BQHB 1N2RA 4XC1H 4WAFA 5JDJA 1OCWL 5I0YA 1HXYB 4ANXA 1UA7A 5CLZA 4PB0L 2O72A 3FOMA 5GJSL 3OPUA 1S3KH 4YSTA 2C7UA 1O6TA 4POZD 3GSOA 3TOPA 1KBWA 5L88L 2ATKA 2XQYG 2RALA 1R3JA 1V3MA 1QNZH 2A6JB 1X5LA 2P52A 4F5CE 2A9DA 1OZUA 4ZO6A 4IBLT 1SY6A 5I17A 3H9SD 5DJXB 1U2HA 2PWDA 1ZLVH 5FLUA 3QFDA 4QAWA 1FGNH 2OXGB 3H4FA 5BUGA 3HN3A 3KPOA 2G4EA 5BZWA 3ALXA 1RFDL 3KJ4C 3LHAA 2AEQH 1T6BX 4NHCH 4RMWA 3SDDA 4HDIB 5E1IA 1AD0B 1M7DB 3WFCL 5ALBH 4BWUA 1RZIA 1Y1DA 2Y1VA 3P4OA 1JYXA 3ECQA 5EA0H 2QLYA 3FU8A 1MFCH 1KG0B 3BKYH 3RTQD 3VTAA 2VLME 5E03A 4X8XA 2N1KA 5KS9A 1N18A 3LEYH 4PY8J 4P5KB 5SX4I 1Z3RA 4KY2A 4IRSB 3X13A 2VC2L 4KXDA 3NCJL 4WRLA 5ECJE 2F8VA 2CK0L 5JHLA 4O5LL 3VXRD 4DKFL 4FJ6A 1I7UA 3TNNB 4IU3A 4KDTA 1GW6A 1MCNA 2E56A 2P9RA 1RZQA 3O4LD 3WV0A 1NCGA 2FTAA 1I3GH 3BYYA 4GSQA 4GP5B 3HC4L 3LQMA 4JCMA 5I15H 2ZX7A 3MRRB 3RVVC 1JZDC 1JHTB 5D1QC 3TO4A 5FYJH 4LSPH 5E2WL 4D3CH 4A2DA 1F2XK 1YECH 1EZVY 3MGAA 3Q2VA 4XN9A 4YPGA 3C6SA 4YDMA 2OL3L 2X9XA 4Y9FA 5B1JA 2Y9RT 3HR5B 2RFXA 2ZX6A 3RKPA 4S11A 5LGHH 2H4EA 1MZYA 4AIZA 2X4QA 1H3WM 4X5QA 4CN1A 5JPNC 3WMQA 1TKWA 2B16A 4OCRL 3FB8B 4AIXA 2CHXA 1K5NB 3NJHA 1E8ZA 3LMJH 1D5BB 3PLYA 1TXKA 4M5YL 4BZ1H 1HNGA 3CZFA 5IB1B 1UD6A 3L4UA 2GBVA 4N8UA 4KK8D 1G87A 2AITA 4HISA 4DSYA 2KLRA 5ICZA 3X3FH 3GZPA 1LO0H 2ZXAA 3L16A 1AE6L 4UOQA 1ED3B 2YIHA 3MCG1 5TK4A 2ZXEB 3MA7A 3MRQA 2DQHL 5DMJB 1ZGLB 2EINB 1LXMA 4OGAD 4XCEB 3QEUA 4HUKB 4A6YL 5MEPA 4DO5A 3A22A 5LNDA 5MERA 1H6EA 1Q72H 3HHMA 3L3DA 4X6DE 2NUTB 2YD1A 3S5LG 1IC4L 3BQUD 3AWEA 4EN2A 3PP3H 4DOHE 4XC1L 4GKOA 1KIUB 4P46D 5GRVK 1KB5B 5FYLE 3RY4A 4OUUB 4G83A 3O0LA 5IOKA 3RRQA 5JR1H 1S3KL 3U48A 4U1JA 1JZ6A 3UO1H 5CD3A 2ROXA 1QNZL 4TNWK 5CO1A 1OL0A 1MHCB 2YPLD 1BXVA 5HYIA 2A74C 2JKSA 1ZOXA 2JQZA 2ZOUA 3PUCA 5FB8A 2NY2C 4PJ7E 3NJMA 4AK1A 5DGQA 1FGNL 3QDMD 2ZKYA 5LCVA 1H8OA 3SGDH 3ARWA 1H6TA 1YLBB 3CC5B 3HE7D 2AEQL 2RIKA 4J3WA 4NHCL 1PY4A 4R4ND 3OAYK 3A67H 1YEFH 5ALBL 3V6ZB 3MV11 1TR7A 4MQ7B 3RIFK 2UZXA 4BFFA 3WGUB 4KH9A 2VXSH 2WBWB 3OLEA 1N3NA 5EA0L 1QRND 5H37H 1MFCL 3BKYL 4L0PB 4NN7B 3TBBA 1E27A 1A6TB 1ZD6A 3LEYL 1FL3A 3DPDA 4XP6H 5AVYB 4DN3H 2WJ7A 2E3VA 3QI9B 4LK4A 3E1ZA 1WISA 3QQ4A 1JRHI 3P11H 2F54D 2ZNXA 3VGGA 3EJJX 4GUOA 2EVJA 1F3DH 4JREB 4FL4B 3MX0A 1I3GL 5FK9A 1E90A 3RL2A 2Q7NA 4NKQB 1ES0A 5I15L 1URZA 1HSAA 4JW3A 4LSPL 4YO0A 4D3CL 3T1FA 5LWYH 4OKDA 4N0RA 5E00A 3O3DB 1A6WH 1YECL 3MLSH 3AM8C 5HI4D 1EDHA 1JI1A 4IBVA 1EJFA 2FR4A 1LK2B 5LGHL 2ZOKB 3CDCA 3VVWA 2CR3A 3ME0A 4JDEA 4L1LA 1OAZH 4OLEA 5JA9A 1SRDA 2BWIA 1SJVA 4LBEB 5KVFE 3ILDA 2C9VA 5D1QA 3H42H 1T1ZB 4C59B 1KCKA 2QFRA 1EFXB 2VRQA 1TPXC 3LMJL 2WQXA 4UTAA 2R8SH 4HMCA 4CL7A 1A9EA 4YSEA 1D5XA 1GA2A 3Q2LA 4BZ1L 1X5MA 4YVUA 5FEBA 3HZKB 1MHPH 5BS0B 3SOTA 2R7EA 4JPKH 4NBZB 2CXKA 2GITA 5JPNA 1LD9A 2YMXH 2NSXA 3X3FL 2V2XA 2X0UA 1E6JH 1LO0L 2V9UA 3SODB 3VXTA 1A4CA 1OANA 1SJEA 3KXFA 4GT0A 4NQSB 4PJGF 2MEJB 4UWQB 2CDGB 2EKSB 4XT1C 5F96H 3RILA 4TUJA 1A2YB 4FYTA 4BHUA 5AOMA 4KO9A 1KWGA 2QGBA 4JFYA 3Q8AA 3C5ZC 3PAVA 3AZUA 1Q72L 2O5XH 1YEDB 2AP2A 3KPSB 4E5XB 3ZR5A 3BLKA 3CUPA 3ECWA 4WEUD 3LKNB 4WCYH 3UTZA 2P42B 4JHUA 3I50H 1I7TB 1BZOA 3SDAD 3OGCA 4AEIH 4ZO8A 3V7AG 2JJSC 3DOHA 5DHDA 3TEUA 1W72A 3L5XH 4YS4A 5IHHA 3RVUD 4L8CB 4HFWA 1RZFH 1ZLWK 5JR1L 4QYOA 3ENEA 3V0EA 5EZLB 1BSIA 1R5WA 4TVPD 5TQ2H 4HA1A 3V4VB 2L7UA 5GS2H 4LNRA 1BVOA 5D1ZD 3UO1L 1NCHA 1PS3A 2VZOA 1PG7W 3IFOA 5CBAA 4L4JA 4Z7QB 3WI9A 3FFCE 3UTTE 2P8MA 3C5XA 3MCYA 4ZUSB 1S6NA 32C2A 2BFVH 4RMTA 4KTGA 5IHLB 1E5YA 4MD0B 3D50A 3QJZA 1HXYA 2N7SA 3LKOB 1C9SA 1X9RA 4PRPA 4BH8B 2H2SD 3FSAA 1CO1A 4ZMNA 4JHBA 3SO3C 1JWMB 3F12B 3L2MA 4LVOC 5CMAB 5D5MA 3GTNA 1YJDH 2FHCA 2VN5A 1FPTH 3IAPA 3A67L 2A74A 2A6JA 1L9RA 1AP2B 3KPNB 4KJPC 4XTRC 1YEFL 4CADB 4S1DD