4YVUA

Crystal structure of cota native enzyme in the acid condition, ph5.6
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
510
structure length
506
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of CotA laccase complexed with 2,2-azinobis-(3-ethylbenzothiazoline-6-sulfonate) at a novel binding site
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Oxidoreductase
molecule keywords Spore coat protein A
total genus 152
structure length 506
sequence length 510
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4yvuA02
2VMJA 2EIKB 4NERA 4DP4X 1GS7A 4F2EA 1SFDA 1MDAA 1HAWA 2BWIA 2RACA 1BXAA 1ET8A 2BP8A 2HRGA 2AFNA 1L9QA 1KDIA 2XXGA 3ABLB 2GSMB 3X1EA 1NIBA 4A68A 4E9XA 5B1JA 3DTUB 1A8ZA 4HHGA 3KW8A 1ZV2A 3PXLA 1HAUA 4G72B 1JXFA 2VSMB 4KO7A 4AI7A 2IH8A 2AZAA 1L9OA 2AZUA 5B7MA 2XU9A 4YSRA 4GP5B 3FU9A 5I6KA 1BAWA 3EHBB 1AS8A 2IWKA 1EZLA 3NJFA 3CDZB 4AZUA 4PAZA 2BP8B 1ZIBA 4HHWA 4K9JA 4RH4A 4DP1X 4BDVA 2H3XC 2PP7A 1ETJA 3NP4A 4M3HA 3C75A 1IC0A 1J9RA 3T6VA 2XX1A 3H4HA 4FAAB 2XLLA 2MRYA 1L9SA 2PP8A 2J56A 2BP0A 1DZ0A 4WTQA 3AY2A 5B1KA 4AKOA 4DP8X 1CURA 1E30A 1OCOB 3OD3A 4NAJA 3NT0A 2PPCA 2I85A 1BYPA 3NSFA 8PAZA 2IDTA 5D4JA 1M56B 1NIEA 3QJQB 3TASA 2HX9A 2B08A 1V54B 1GSKA 3WNIA 4AX3A 1JVLA 2YXWA 3IE9A 2VW7A 3ASOB 5TK4A 1IKOP 2YAMA 1GW0A 2QT6A 1AZUA 2PCFA 2B3IA 2QDWA 1X9RA 1A3ZA 2CALA 2GB2A 3QQXA 1BQRA 1A4AA 1MG3C 1RKRA 1MZZA 1JOIA 1BYOA 4CSZA 4E9QA 2HXAA 1T5KA 4KNUA 1AOZA 3ABKB 1ET7A 2BW5A 3FQYA 3MBWB 3NJLA 4FA7B 2DY2A 3TBBA 3FU8A 1V10A 1NINA 1XB3A 1R1CA 2BW4A 1AG6A 4HIPA 5AZUA 3NJKA 4YSTA 2R7EA 4N4YB 1KV7A 1PNCA 4QLWA 2DWSA 3UABA 2FT8A 4JHVA 2EILB 1ASOA 1BQKA 1KCWA 5D4IA 2EINB 3D12B 1L9TA 3QPKA 1MG2C 4EF3A 1NPJA 1WS8A 3UAEA 2XUWA 2IDFA 1SHWA 2FJSA 2DYRB 4BDVB 2YQBA 1SHXA 4TXVB 1E67A 2WO2B 1CC3A 3CDZA 5I5IA 1RZQA 2FT6A 3PCYA 3FPXA 4A2GA 1JXDA 4GY4A 3OQRA 1NIDA 2YAPA 2DWTA 4BK5C 4DP6X 3UGEA 2UXGA 5ANHA 4YSQA 1NWPA 2DV6A 2IDQA 1RCYA 1N70A 4GYBA 3WIAA 1J5DA 2N0MA 1SF5A 5IY5B 4YVUA 3EH4B 2IWFA 2WO3B 2CBPA 2BHFA 3EH3B 3GDCA 1QHQA 2HX7A 3ZX1A 3QJTB 4E9WA 3RYMA 4M4RB 1ZDSA 2QPEB 3FT0A 2IDUA 3CVCA 2XX0A 3TA4D 1WAEA 3PLYA 2XVBA 3AG1B 2OJ1A 5B1BB 2AVFA 1AZRA 4KO5A 3AG2B 4UF7C 2VW6A 1AG0A 4YSDA 4KO9A 1PZAA 1OE2A 2FQFA 1WA1X 5D4HA 1JXGA 4HZ1A 4HCGA 4BXVA 1KBVA 2IAAC 3S3DB 1PZCA 1WA0X 4YSOA 5B7EA 3UAAA 1W8EA 3X1NA 1OE3A 3EF4A 3AG3B 1MZYA 1RZPA 4AKQA 5F7BA 3FSVA 1J9QA 1EHKB 3ABMB 1QLEB 3UACA 2XV0A 1BQ5A 2EIMB 3IN2A 3NJIA 5PAZA 3SBRA 2PPFA 3TU6A 1GY2A 1JVOA 1PLBA 1URIA 3L45A 3WI9A 1SFHA 1JZGA 2NRDA 3SBQA 4DP9X 4HCIA 4UAHA 4DPBX 3HB3B 3NJNA 2YXVA 4YVNA 1AS7A 2YAEA 2EIJB 4E9YA 1ASQA 2PPEA 3QJUB 5E9NA 4F2FA 2BZCA 1KYAA 5I6LA 3HEIB 3QJRB 1BXUA 3S8FB 2WSDA 3CG8A 1PF3A 5TK2A 2HX8A 4YL4A 2YAOA 3IN0A 3N55A 4DP2X 2GIMA 4ZK8A 3WNJA 1J9TA 2W8CA 4CSPA 1UATA 4AKPA 2CCWA 1KBWA 1OV8A 3U25A 4G7QB 4E9RA 2VM4A 1ILUA 1XB6A 1XB8A 3NJHA 1XMEB 1KDJA 1ILSA 3BVDB 2FQGA 3SBPA 1BEXA 3PPSA 2YAFA 3V9EA 2XWZA 3FYIB 1AANA 1GY1A 1B3IA 4GXFA 4JHUA 1IBYA 2AANA 1J9SA 2OV0A 1NICA 1ZIAA 3PAZA 2PLTA 3G5WA 2IDSA 2ZXWB 1BXVA 4N8UA 4G7RB 4YSAA 1ZDQA 1SDDA 1FA4A 1E5YA 3X1FA 3ABGA 4A2EA 1SNRA 1M57B 4A67A 1TKWA 2ZOOA 4KOCA 3X1GA 4A2DA 1PLCA 5F7AA 4G7SB 1E65A 4GP4B 1TEFA 3GXUB 1JZJA 1NTDA 1AS6A 2P80A 4BWUA 1AIZA 4KO6A 1KCBA 2XV3A 5FC9A 2HZHA 4A66A 2BWDA 2QDVA 3FU7B 2Q9OA 4X4KA 1PLAA 1CUOA 3AW5A 2BZ7A 2FWLB 1NPNA 1ZPUA 4G70B 4Q8BA 1WS7A 2CAKA 3QJVB 2I7OA 1AAJA 3CVDA 1JZEA 3AG4B 4L0PB 2TSAA 4YSSA 3FSAA 2HLEB 2JXMA 1SJMA 2YAHA 3T9WA 2VN3A 3JT2A 1AZBA 3EH5B 3X1BA 1IBZA 4MFHA 5I28A 3ZBMA 1OE1A 2FQDA 1A4BA 1TU2A 2XV2A 3FPYA 3FSZA 1PNDA 4W9ZA 2Y1AA 1V55B 1ADWA 1X9UA 1TEGA 3T6XA 3WKPA 2YARA 1FFTB 5I5MA 1AACA 1AZCA 1PZBA 3FU7A 3TBCA 4P5SA 1JERA 4DPCX 5I5JA 1PAZA 2DYSB 2VW4A 2TSBA 1L9PA 2XXFA 2FQEA 3S3CB 1SF3A 4YSCA 1WA2X 3CZUB 1ASPA 3FS9A 1N68A 4JKNA 7PCYA 1DYZA 5EHFA 4PCYA 3OM3B 4DPAX 3DIVA 3OMAB 5I26A 3JTBA 1J5CA 2PPAA 2VSKB 1AQ8A 1NZRA 2X88A 5I6OA 1QNIA 2H5UA 3UADA 3ZDWA 2A3TA 1JZIA 3T6ZA 4F7KA 1NWOA 3IBOA 2GC4C 5B1AB 5PCYA 1OCCB 4DP7X 2Q5BA 1HFUA 2PCYA 3IEAA 2FNWA 1JZFA 2UXTA 1NIFA 3AZUA 2LLNA 3GYRA 3DKHA 3T6WA 4E9TA 2PP9A 3N2JA 2HRHA 5I6PA 1AR1B 2YAQA 1ID2A 3CVBA 1JZHA 2J5WA 4NB7A 1F56A 4G71B 1W6WA 2ZONA 1IUZA 5A7EA 1I53A 3S3BB 4A2HA 4W1TA 4UANA 4YSPA 5LDUA 3NJGA 2UXVA 2JFCA 2UX7A 2J55A 4KNTA 1NDTA 3NJJA 1FWXA 1NIAA 1PY0A 1GYCA 2I7SA 4QKTA 2X87A 2H47C 1E5ZA 3QJSB 3NSCA 4BWTA 3X2QB 2MTAA 3FQ1A 4HAKA 1SDDB 2CUAA 1GS6X 2QPDB 5AFAA 4YSUA 2IH9A 1GS8A 9PCYA 5AKRA 2P80D 5B1JC 3SQRA 3ZIYA 6PCYA 3S8GB 1M9WA 3T71A 3PAVA 1PMYA 1ET5A 1GR7A 3H4FA 2VM3A 4YSEA 5B7FA 1W6LA 2GHZA 2OCCB 3FSWA 4DP0X 3WG7B 3OMIB 4DP5X 1OOWA 5I6NA 1A4CA 2JKWA 2PPDA 2BO0A 2XYBA 1OCZB 2BP0B 1KGYE 2Y69B 3PAUA 4HALA 1L9RA 3NP3A 3ASNB 3MX0B 3NYKA 2GI0A 4P5RA 5B3SB 1OF0A 6PAZA 5I6MA 2UX6A 2W88A 4KOBA 3FYEB 1YLBB 4A2FA 4WKXA 4Q89A 4E9SA 2ZWNA 1CYWA 2GBAA 3V9CA 1VLXA 3FQ2A 3NSDA 4KNSA 3OMNB 2UXFA 4HCFA 4BXSV 2FT7A 4GP8B 1A65A 3ERXA 2R7EB 4BWWA 3H56A 2J57A 4ENZA 3WKQA 7PAZA 3NJMA 2FTAA 3NSYA 2E86A 3BQVA 2CJ3A 1AZNA 1OCRB 2IWEA 4E9VA 2GC7C 3KW7A 1PCSA 1CYXA
chains in the Genus database with same CATH superfamily
2EIKB 5JXED 4POZD 2Y23A 4DETA 4JY6B 4L4VB 1XFPA 1LEGA 3ATBA 5E00A 5C08B 2JCCA 3MNVB 4FG0A 4M6OH 2D7MA 1P4UA 1L3WA 3L3GB 3V4VL 2WINB 5E2TL 1TTAA 1ZV2A 5TGBB 2Y06H 2HT2C 3BSHA 4ORZC 3FCSB 3MNDA 1R3JB 3FF7A 2IH8A 2AZAA 3HE7D 4O58H 3TN0D 5B38B 4GP5B 4PJ8A 3VG0L 5DHEA 2IH3A 4QTIL 4LPYA 4IRSD 3UPAA 3AREC 4LNRA 2NLJA 5LN8A 2PP7A 1RUAL 2YUVA 4FQ2L 4XXCA 4LARL 3L1OL 3ZDXB 3QDMD 4WU5B 4ILDA 3SE4A 4PY8J 2YZ8A 3O6MH 3H4HA 2A77L 2WKLA 1TQTA 3E6HB 1EDHA 2MRYA 2PP8A 1FBIL 3UZVA 4AUUA 5GSVA 1NCDH 3VMOA 3WY2A 3AWEA 1I7RA 3LAFA 2AXGB 5GJTH 4OTXH 3UTTD 1KULA 1RVFH 1IU1A 5DEZA 4GIOA 1FV1B 3QIUD 1W0WB 5F2FA 1NKOA 4GRWE 4JHZA 1YNKL 3QORB 4NJAL 3SOBL 1LWHA 2OR8A 5EU4B 4TQEH 4XMKH 1L6ZA 3L9EA 4XBEL 3GEWB 4F1SA 5LKNA 4F7CA 2NNFA 3GJFA 4U6YA 1XZ0B 2VDRL 5FKPA 1PQZB 1VFMA 1JVKA 2VTFA 3CZFA 3MGTA 1SYVA 5TQ0H 2PCFA 2GSGB 4NQXB 2GB2A 1JCKA 2LFGA 3UO1L 1Y7VA 2ESVB 1CGTA 3N3EA 4NQEA 5E7FA 1HYRC 4J3OF 4DN4L 2X4PB 4M5ZH 1KGCE 3WTYA 1G87A 4W4OA 1O7DC 4MAZA 3FB7B 4NWTL 2WWOA 3TA3D 4B97A 4MA1C 4QOKD 2Q8AL 5ILTH 4YZWA 1W72H 3WEMA 1WC7A 1W72A 1NBZB 2VLJB 3MBWB 5TE4L 3TPUA 2DY2A 3P4NA 2GCYA 4MJ6B 2NNRA 2V17L 2X2HA 3MR9A 3L9RB 1K8IA 2VLJD 3Q9PA 4K55A 1NBVH 3PGCA 1BLNB 3LV3B 4KNQA 4H40A 4R2GB 3RHWF 1CXEA 1TMQA 3JSSA 1UUSA 2FIKB 1ADQH 2UZPA 2HH0L 2ORBH 3BKJL 3Q7JA 4M8QB 3WIHA 4HISA 1E4WL 1MWAL 1Q9WB 5DRNA 4KJYA 1MNUL 3VXUB 1L0QA 5BJTB 1TR7A 3CFCH 4DH2A 2EH7L 2WLYA 1KCWA 2BM3A 1FG9C 3D12B 3FTGB 1OXYA 1L9TA 1W2KT 4FI8A 3TBSB 4ZZKA 2JB5H 3SYAA 2XUWA 3QXDA 5AZEH 4L1HA 1FZJA 4QTIH 1KXVA 1ZS8B 3GSVA 4AWJC 3FSOA 3QNYB 3LS5H 3D2UD 4AL8C 4DKEH 25C8H 4XP9L 2VDNL 3QI9B 4E42B 1A2YA 1JXDA 4GY4A 5FUOL 4WTZG 3GSQA 4R7DB 2VAAA 2QTEA 4AE0A 4A37A 3WEBA 4M93C 2OULB 4ENED 1WGVA 3REVA 2ZE0A 3P4OA 4NO2A 4AITA 1JRHL 2IOMA 3F84A 4AENB 5JZ7D 3HC3L 4H26A 4KZEH 3UC0L 2YSSA 4M5YH 4B96A 3ZDZF 3SIKA 5LGHH 5GS1A 4Z8FH 4RGNC 2CXGA 4JJ5A 3QUXB 4QHNB 3GSXB 3QI9C 3NQIA 3DUUB 5LVEA 3SD2A 3D30A 4KRPD 3EFFB 1ZDSA 2K8MA 4ABUA 5AENA 5CD5C 3TA4D 4YLCA 2ZSWA 1XGUB 2MCPH 1P7HL 1D2PA 3OKKA 5GGUB 3RP1A 1UZ6F 1GKOA 5JIHA 2MHAB 3TJEL 4XNMA 4ENEC 1BWMA 5LJYH 2V5MA 2H6OA 2Y2TA 4PGZA 2AEOA 2D7OA 4S1QH 2DWDA 2APWA 3FO1A 1U8CB 1JV5B 3JV6A 3T4AB 4H8WH 5ICXA 1BBDH 4GFXA 3HNSH 1I1YB 2L04A 4L8SA 2DQIH 4U3HA 1DN0A 1EJFA 3B2UC 1A14H 5DJAA 5IP4A 4DGIH 1GGUA 1IBDA 4Z7OB 1U8HA 1LP9A 3DGGA 4CGTA 4LVOC 4KK5D 2A9AA 4LPTA 5ALCH 2P8PB 1TVBA 3QARA 3DX4A 5DJ6A 1NCUA 2E7BA 5EBGA 1J9QA 1C5CH 4C56B 3UACA 2VDLH 4XVUD 5KSUA 3SBRA 3P77A 3W0WA 5GRZA 3TWYA 5AG8A 4OU3A 3B3IB 5CEYB 4IOSA 2YD3A 5IVNA 3BT2H 4L3FA 1NC2A 1XGYH 3INUL 1B6DA 1J1XL 1BJ1J 5HGDB 1UM5H 5EUOF 3CBJB 5IVXA 5AVUB 1FFOA 2F7OA 4JY5L 4IMLA 2XI9A 3AITA 4F8QA 4M03A 1HHJB 4LHUD 3N91A 3WJLA 5EBWA 5ITBL 3V5KB 3WKYA 4E9YA 3EOBB 4LSSL 1C5CL 3JBG7 4ZMAT 5LUMA 1BXUA 4XP9H 4P5KA 4P07A 4LCUA 1Q94A 1ND0B 2XZZA 5IQNA 3SPVB 1O7SA 3HG3A 2YAOA 3EJJX 4DP2X 4LVEA 4U3SB 5DJ2A 1CMOA 1F5WA 2Y7OA 5T1MA 5DJZB 3WNJA 2CU9A 1RUKH 3W39B 3DX8B 2FSEA 4A6YB 5IB2B 1D5ZA 5DJ8B 4ODBD 5D1XE 4P2RD 1QFPA 4BSVB 3HS0C 1A1NA 5IBUG 4X4ZA 3CPUA 5IF0B 5T1LB 4PY7A 2ATKB 5ITFA 5JOFA 4NOFA 1IJNA 1ZIAA 4JS7A 3RJQB 5C0RL 2NT1A 1A0QL 3HJEA 1UOVA 3QR2A 4MXWL 1S7WA 4Z7UA 1ZDQA 4G5ZH 4IBYA 4LP8A 3GJFH 1J8HD 3FCGA 4ABVA 3K6DA 3NCCB 5DA4A 3FT3A 1TJHH 5GIRB 3DRQA 4JL2A 5F96H 3ECQA 1P7KA 3H9YA 4GUOA 1MUJA 1NEUA 3UTSA 4A1RA 5IMLB 2EH8H 2ZF8A 4F8LA 3KNBA 1FFNA 3U9UA 1CBVL 2NY3B 5ABDE 5I15H 3W9EA 3NCYP 3NQKA 3VGDA 2HTLD 2YN3A 3Q6GH 4FXGA 3WNMA 5IROC 4BZ2A 2C3GA 3S5ZA 2AI0L 2Q10A 4GRLD 2PN5A 1CVSC 2ATKA 4P46B 3GHEH 3WMQA 2G0KA 1CU4H 2YEZB 4K9EH 3UEQA 1B4JH 2I60L 4YDNA 1FIGH 4DPRA 1IBBA 3AJ7A 3G5ZB 5KYXA 1INQA 4OD1L 3BH9A 2R2EA 4P46D 5JXAL 3VFSB 3FL7A 4HD5A 4N1CA 1SMAA 4WI6A 3LRLA 4ODUA 3ZE0F 1UJ3C 3EH1A 1VEMA 2A0LC 4Z7NB 3C9NB 1IAKA 4IM8A 4Q6KA 1S7QA 1PU0A 1PGRB 2ZXAA 3BZFA 4PJ7B 3H3PH 4XNYH 5EG6C 2VKXA 3MN8A 4FERA 5A2LH 3U9PH 1HL5A 1XBDA 2X0UA 4Y5YA 3QFDA 1TUPA 4PRNB 2OMYA 3LKOB 4L3CB 3VD2A 4AG4H 1BREA 3M8OL 1E43A 3CN3A 4ABQA 4NQVB 1ZJAA 3TYGL 4Q6IB 3VDCA 3SGEI 4PRIE 3B2PA 4XC1L 1CDYA 1Z0NA 3QJFA 1QBBA 1T5WB 5I5JA 3RI5K 4X5WB 4AH2B 2LAGB 3CN0A 1L9PA 4P2OC 1LQBC 4MBRA 4JGJA 1OAXL 4MD4B 2WSPA 4M93B 5HI4D 1XGRB 4M5ZL 1I3GL 1K8IB 5I1JL 4TL4A 5EHFA 2CCLA 3T3PE 2CD0A 3OM3B 2EVIA 3PV6A 3D3VB 1BIIB 3DIVA 4AIZA 1BLIA 2XRAH 2HFFB 2AK1H 3ZSTA 3MO1A 3FTWA 1WPCA 4F2MA 2P26A 3PNRB 2FJHA 4LKCA 4APXB 1JPSL 3GF8A 3VDAA 5E6IB 4B9YA 5EEZA 2G5RA 4BQ9A 3T6ZA 2NYYC 1OTTC 1YMHA 3KG5A 4YHIA 5B1AB 5IESL 4AW7A 3B7YA 2CO7B 4JDVB 1KYOJ 3IDJB 3HNTH 1YNTF 1GZPB 5AWNH 1TJHL 1AVAA 1I3UA 4MJJA 2J2ZB 2EYRB 2FO4A 4N6RA 3PWLB 4N8CH 1OAJA 2J5WA 3DARA 4RNRB 5KYWB 4LEOB 1XF2A 5L9DH 2VRQA 5A43C 5C0BA 4I87A 2QHRH 4FFZL 4G6ML 2CUHA 2ZXEB 3SKNB 3BEWA 1P6WA 1FL3B 3NJGA 3Q8BA 3NA4A 1G4RA 3D25B 3DYPA 3MBXL 2HG0A 3PNWA 3MJ9H 4FNUA 4XE5B 3IGUA 1ZV5A 1NJ9A 4MMXB 1PY0A 4F8PA 1CICA 2WC7A 1GYCA 1U21A 1VIWA 1ZWIA 1DVFC 2VH5L 3PGFL 4QHNA 2P44B 2TRYA 5F0MB 4HKBB 2PNDA 1PX8A 3NACL 1DUZA 4TVUA 2WZPD 1ANUA 4NO0A 1A4JB 3AGWA 3UC0H 1AIFB 3C08H 3SQRA 3L7EB 4L8BA 3GINA 2YD5A 3ILEA 3PAVA 4OKVA 5HHXL 4NOBA 3GO1L 5IEKB 2C3HA 1X4YA 4UDUB 1BZQK 3T0DA 3EJSA 2ICWA 5DHVB 1W6LA 2BNRD 2DQUH 2W0KA 4OQ1A 4K8RC 4POYA 4XPHL 1MIMH 3ILDA 1IQDA 3MXWL 2MJWA 3BPLB 2JKWA 4EMZA 4WI0B 3RB7A 2XYBA 4WWNA 2A1WH 1CPUA 3WO4B 3OB0K 4HFUH 3IKCA 3KYNB 4MMZC 5A7BA 5IVOA 3QO0A 5IM7A 3V4PA 5GRJH 2OBGA 5EZIH 3QNFA 1NCBH 4JKLA 1JPEA 1E8ZA 1KTLA 1JMXA 1J8RA 1Q9WA 3ULAB 2HKHL 4PJCB 1F2XK 4AYFB 4OIFA 2YA1A 3FT1A 4ICWA 4MCYB 2ZWZA 4PCTA 5HSFA 4XNMB 1XSOA 5ABAA 5B4MC 3MLYL 1A6VH 3IMSA 1TT6A 3K71B 1F3RB 1A65A 5IV2B 2G60L 2YPLE 3GMRB 3MRHB 1MAML 3IRZA 4KH2A 2W9LA 4N2IA 2IWGA 1G7QB 5BV7L 4M7JH 3SGJC 3HE6C 4MMZA 4PS4H 1BOGA 3OGCB 1A6WL 3RNKB 1JRHH 1ORQA 5GRXG 1O0VA 3ROOB 4E9VA 4XNXH 1GHFL 3SB3A 2GK2A 3PDDA 1A9BA 4NZTL 4H2AA 4W9CC 2GJ6B 5F3HB 1JV2A 2RFXA 3D7PA 3NFPA 3O6FA 5EZJA 1BJMA 1WG3A 3KPQA 1SY6L 3PWVA 4JFZH 4U7KA 1R3IL 2VLKE 3HAEB 4S10A 2RACA 4YQXH 1OK0A 3KCPB 2WAHA 1MCFA 2JKIS 5EO1A 1BP3B 4LEXH 5HD8C 1PZ5B 2A6JB 4G72B 2CUMA 2KQNA 3B43A 1U3NA 4MJID 4TMPA 3BSGA 2HJKB 4LVNC 3EUDA 3EHBB 1AS8A 1OGPA 3UP6A 4KDTA 2OX5A 4WGVB 3FU6A 1KV3A 2KKQA 3IS1X 4HHWA 4N2HA 4OKDA 4LCUB 4HMEA 4WO4C 5E03A 1ETJA 5K9JH 4HYTB 4NZDA 4DGUA 3TH3T 2GJ6A 3QISA 4JFZL 5DO2C 2GTWB 4QRPD 4GG8A 1AHWC 5INCA 2CHDA 3IPFA 4UV4H 4AVKA 2GSIA 2V7HA 4X98A 5IMKA 2IANB 1Y6NR 2X6BA 4H8QA 4GI9A 2WCPA 4JN2B 1DCEA 5JDSA 1IVTA 4P9HH 4QRPE 4R4BA 1R9FA 1J48A 4JMXA 2DKMA 4QNPE 1NC4B 2IDTA 3BMWA 4UM9D 1V54B 1IAIM 3AU1B 3BP7B 2MQ3A 5KOMC 4OZIA 4FP8H 4HIHB 2WK2A 4NQCD 4W9KC 3TT3L 3JWOC 1AD9B 5CZRA 5E8OA 3MLUH 1KLGA 4HAGA 4M1GL 3QQXA 4JKWA 1JUFB 2VCOA 3LIUA 1GYWA 3LQAH 4APQA 4AVJA 4ZMYA 4OF0A 3KLAA 1J8HE 3MUUA 2R69L 1FDLH 3T2QA 3D4ZA 3A5VA 5G5DB 5I24A 1BJ8A 1KG0B 2BW5A 2OMYB 3DVGA 4L3CA 2CRZA 3ZMEA 3LEVL 5C9JA 1JFQH 5CZKA 5KEZA 5DSCB 1E7VA 3AQZA 5T1MB 3AS1A 3CMOL 4JRXE 2M83A 3EYOA 1C08B 3OKNA 3MFGB 3MJ7A 3O3BA 4J3OD 4D0DB 4H1LA 4R5VA 1BM3H 4HIJA 4WI5A 3CNKA 3O3AB 3MHZA 2ZUVA 1E4JA 1XH2A 4AG4L 2V0AA 3KPQB 2GUYA 5D72H 4KTGA 3QUMA 2V2XB 3ES6A 3W9DA 1TJIL 1MFEL 4CVZA 4P4KA 1IGTA 1MG2C 5IZ7A 5KBLA 4R7VA 3T09A 1A6ZA 4PS3A 3ZL4L 4WW2B 2IXQB 2G0LA 1XR8A 4M02A 5EH1A 3SQBB 4N0UB 1FRGL 2IFFL 1ZS2A 4NDMA 1MEXL 5FGBA 1MJJA 1A8JH 2AJUL 4PJGF 5CEZD 2ICEC 1DQQB 1KJMB 2XN9B 1A2YB 2Z7ZA 3I6KB 3KR3L 4J5VA 1ZD6A 2H2PC 3NIFB 4KUZL 2ARJQ 1K6QH 3NDZE 1S78C 2KLRA 4NJAH 4U1SA 2YAPA 1SMOA 3GPEA 4P2OB 3WLBB 5MENB 2FEEI 4MD5A 2JCCB 3L4WA 1UD5A 1G9MH 2DV6A 3L5IA 2NNXA 3SE3C 1EXUA 4N0YH 3LRKA 3VFTB 3SDXE 3F2LA 4N0UE 1A9EB 3IK2A 3WIHH 5IB3A 4JR9H 3F5WB 2VLRB 2BIQA 3Q3GA 4G9FA 3MLRH 3GUFA 1SEBB 2QQNH 5BS0A 1B3JA 1I1FB 4DOHB 4OLXL 3U6RA 3TS8A 1QG3A 2CDEA 1IM3A 5D2LF 2HVJA 3VXSB 1OSYA 1NC4A 4JUSA 1MJ7L 3FT0A 4R90H 2H2PD 4GXUN 2GTQA 2EE0A 4LOUC 1E28A 3C60C 3FTZA 3OZ9L 4OIAA 2N0KA 3LZFL 4NKMA 2WO4A 1INEH 1OM3H 3TBTB 4ZFOB 1P1VA 4G3YL 2Z8VC 1U8KB 3BZ5A 1OPGH 3HRZA 4Z3FA 1FG2A 1CICD 3NEEA 3G5XB 3QS2A 4QHKI 4CA4A 1KBVA 2WVVB 3GJEA 3UO8B 3FB5A 1IEBA 3V5HA 2ETWA 1UKQA 5GGSB 3CHXA 1GGBL 3S8WA 1R3LB 3L4TA 1Q0YH 2DEXX 5TF1L 1MFMA 1BXXA 2H3NB 2Y36H 4PWKA 1GC1H 2X1XR 4NC1E 3VFMA 1FGVH 3VNYA 1PSKH 2X2JA 2RMNA 3KYMB 1G6RH 4FXTA 2B1OA 5DS2A 4OIIL 4FFVC 4FFYA 2CJSA 3U83A 4LIQH 4OLWH 3LXUX 1HHHA 4XP4H 4DP9X 3ZJAA 4K0OA 5GGSY 4G80A 4DPBX 4M1DL 4JCLA 3HB3B 5JPMA 3SDXB 4ELMA 5IEHB 3V5KA 1RJZA 5DQJB 4JW3A 1KPUA 3GKWH 4YVNA 3MUHL 3HCVB 3N0AA 3WN5C 2Y72A 4Y1AB 5KYUA 5E99L 2I25N 3H9ZA 4LCVA 4Z7IA 2JF1A 1FL5B 4JO2H 3LXAA 2ZCZA 5I6LA 2ATPA 1CLYL 5T5FL 1F6LL 4HLJA 2M2DA 4QXGL 3GLZA 5C0AA 4Y1AD 3MNWA 3JV0A 1T1YB 3PGCB 3E38A 4ZNCD 1WEJH 4LCWD 4ZNEA 3GMPB 5B38A 2BIMA 1KBWA 1G0DA 4QRBA 1TQCC 2GITA 4UT9L 3W1ZA 1SVBA 3Q48A 5DZVA 3B7RL 2UVEA 2OTWB 5F72S 1TZIA 5I8CB 1QBLL 1E27A 4UTAL 2K4AA 5C3IA 2MCAA 4S0TD 3UIYA 3TNNA 1FF5A 3U2JA 4WNQA 4WDIA 3NZHL 5IROD 4QCIB 1IKNC 5F0LB 1J9SA 1YQVH 2J4WH 5LGYA 4ZX3A 5ID1B 1WFUA 3K6FA 2NY7H 3TO4B 4MCZA 2NY3C 2FNBA 4W93A 5E2WL 2LABA 2VITA 4HIXL 4R3SB 5JLZB 3U2IA 1ED3B 1QRND 3MV8D 3IXAB 2NX5D 3H1ZA 5CJ8A 3S3PA 1OHQA 4UIMB 2VQTA 4G7VH 4TUKL 2GUOA 4ZT1A 2JNZA 1RSFA 5DS8B 3WMPA 5IQ9A 5IT2H 1SYSA 1BQSA 2HT4C 4IYKA 2XV3A 3D34A 1EEZA 2C9SA 4HA1A 3VI3A 4OH2A 1F11A 1F8TL 3UZQB 5HYJE 2GPZA 2ZUUA 1IBGH 3SDDD 3VQ2C 5KSBF 3PL6D 1S9YB 3RVTD 2IADA 3U4EB 3K91A 4DN3H 3VYPA 15C8H 5BZWB 5T8IA 2QGEA 1J0ZA 4GRWB 4R5XA 3ARRA 4GI6A 1ADQA 1P1ZA 4IK6A 3SKJL 4F3FA 1AKPA 1T4KB 4XOCA 1J1PL 2ZPKL 1SM3H 4FMVA 2DEYX 2JXMA 1X4ZA 1WT5A 1CB4A 4OCYL 4JGMA 5IT2L 3X1BA 4M4RA 1ONQA 1CFQA 4H8WL 3PGDA 2F1AA 1RK7A 2A74B 2AJVL 3MRDA 3ML8A 1Y18B 4NQDD 4CU8A 1R46A 3GZKA 3KYAA 4M6ML 2E5EA 1TEGA 4EUPG 1CFNA 4N2KA 3WKPA 3KPTA 1CLOH 5HDQL 3I6GB 5C0CB 5T1DH 3RUGB 3W57A 2NNAA 3TEYA 3TO2B 2ZD0A 5CM1A 4FADA 3MI6A 4BFNA 1F90L 5F44A 1VESA 2WXRA 1M7DA 1IAOA 1XZ0A 4RIRA 1OAXH 2JKTM 5E5RB 1MHHB 2WPGA 2V9QA 4IKKA 1X5JA 4WY7L 2WQXA 5EFIA 3BLBA 3DOIA 4CW1A 2Y7SA 2Z7UA 2ICWB 4KZDH 3UTSB 1JZIA 2P47B 5C08E 1L3NA 5KSAD 3NCYS 5DD1H 4UM9A 1QPPA 1FVDA 4LQ1A 4TYUA 1CLCA 3OJDA 3TBWA 2Q3AA 1OCCB 2K6YA 2OW6A 5E7BA 2O93L 2Q5BA 4L37A 1KFGA 2FNWA 2ODHA 4PVBA 1H3WM 4K94H 2EUWA 4N2LA 5IK3B 1PFCA 4P0DA 4N86A 4TQHA 4GG8B 1UM5L 5INCB 3QIWD 1JZHA 2PUQT 4P2RA 4ZAKA 5LN4A 2ZONA 1C08A 2UY6A 1IUZA 3RTQD 4DZ8A 3BAYA 1OWRM 1OT2A 4GMTL 2FWOB 1SPDA 2PF6A 4N25A 3C5SB 4XPTH 3TVMB 4ONGL 1UUNA 5K9KA 3U7YL 1C12B 4IOFC 1ZT1B 3UTSE 3NJJA 5C6PB 4IS6B 4NKDB 2MKWA 2V5SA 1QI4A 2N1KA 3HI1B 5ALCL 3CSFA 2DLIA 2YIHA 3BFOA 5ALBH 4EN3B 1IJ9A 2W59A 2MTAA 3RAJL 3KVQA 4XVTH 1NLBL 3I6LD 3L7EA 3P11L 4L8BB 3IGLA 4DQOL 1WAAA 4B9CA 3LPOA 1SOXA 2XZCH 4HIIB 1PMYA 1JUFA 5FW7A 5MP6L 1FFQA 4MNGB 5KS9A 2OFQA 1JK9A 3HUJE 4HJIA 4TOYL 1A9BB 4IEFA 3TEXA 3IGFA 4HS3A 2YO3A 3WN5B 1N5AA 1V3MA 4K3GA 2N4IA 1OOWA 3CZEA 3ATFA 3PV6B 2E9WA 2IANA 1DLFL 1CN4A 2CHWA 2YGNA 3EO9H 3IS0X 1XF3A 3MX0B 4EUPH 2X4OA 5ADPH 4K3HA 2KI6A 1EAPA 3KPSE 5I23A 2VZSA 1RH8A 2N7BA 5FFGA 1FNSL 4FQLH 3VXRB 1TTCA 3FFCB 3QQ4B 5IR1B 1CDGA 2JJTC 1G9NL 4KAQH 1NFKA 3EOTH 3QUZD 4J3BA 5F97E 2OX5B 1I9JH 4F7EA 5E6IC 5BW7C 3HS8A 5JQIB 5BS0D 4KFZC 2ZKXA 3N1FC 3QCUH 4PJFE 5AAMC 1JZ2A 1ZY9A 3K0YA 4Y16D 4LKXA 5D72L 1D5IH 1G6RL 5B39B 3WELA 5K9OB 5HD8D 4UYPA 1HINL 3EGXB 2JQAA 3FRPA 3E7JA 5GHWL 5EEYA 1MDTA 1K2DA 2W60B 7CGTA 2Z0UA 1C5DA 5KBMA 5HVFB 4C83A 3FT9A 3I02A 1FRGH 2IFFH 4RMQA 4U4IA 3UCRA 3L4VA 1NGQH 3H0TA 3QHZH 2RD0A 4XNZB 4HBCL 3ARBA 4OZHE 5GGRB 3H2PA 5GGVH 2PXYC 3D6GA 4MMXC 3MRIA 1UXLA 2APXA 1U9KA 4XC3H 3X1EA 5JIPA 2DS4A 1CDHA 2CR3A 3O4OC 3V8CA 4YBHA 2HTLC 1N0LA 3TOPA 5D7KE 1SXNA 1ID5I 1QLEL 1XX9C 4RFOL 4V1DB 4R7DA 1QW8A 4MSWB 4NM8H 5F1IA 2YKKA 1MSPA 1RZKH 5F88A 3ARFC 1R24A 2QPUA 5A2JH 1D6VH 2BP8B 5MEQA 2IEPA 5GJTL 1PEWA 1B0GA 4GQZA 5GJSH 3KHQA 1LP9F 3QJHB 4Z7OF 1UGKA 3NP4A 3V0IA 5C0BB 3TYFA 3QRBA 1KPVA 3T6VA 3JWNH 3EO1B 2QSQA 4OM0L 2XQBH 3CVHL 2DDQL 1JPFA 1H5BB 2Z31A 4PJBE 1K6QL 4MLIA 3UIZA 4H25B 1KN4H 2VXVL 3GMQA 5GGRY 1U3ZA 1MLCB 4YDJA 3RDTA 4OSUH 1ODUA 3ZY7A 1LEIB 4QRUB 3FTUA 3LEXA 2DI9A 12E8H 1MW1A 4AYSA 2BXZA 4EDXB 4L4JA 4JG0H 3GXNA 5HPMB 2W81C 1NIEA 3CXHK 3VH8A 3Q6FB 2HRPL 1WBZA 2KPNA 3ARFA 5LBVA 3NIGF 3T0VA 5IG7A 1QBMH 2IBBA 2YD1A 2YXWA 3QZOA 4B0MM 4XOBA 5TK4A 4TNGA 4RSVA 4BGLA 1JWMA 2QDWA 1JSYA 3BYTA 1I7UB 1Y6KR 1KGWA 1KPUB 1UXWA 3BEVA 4EXKA 1BQLH 2VXSL 1A4AA 5DD5H 5GISL 2H1PL 3KLQA 1PKQB 3TT3H 4GRLC 1NAKL 3SYQA 4MMXA 1KIUA 4N2CA 2XKUA 1E4XH 4WUKH 4ZPVB 4O5LL 1RK0A 1IKFL 4LCCB 4UQIM 1VDGA 2F74B 5C0JB 3FQYA 2RJMA 3WTXA 1KLFA 2G3ZA 1XH1A 5JUEL 5EBMB 3TF7C 4H8UA 4HT1L 3STZA 2AJXH 4MZ2A 3GEFA 2VZ1A 3KPLB 5HY9B 4XWGL 4PJCF 3WEXA 2JIXD 3IMBA 1AJ7L 4H0GA 4ONFH 4F91B 4BJLA 1IEHA 3WJMA 2FUQA 3E2HB 1QSED 2CO7A 4JDVA 3EOBA 4P3CH 4NT6A 1DP0A 3FRUA 4LCIH 5D1XB 2JV6A 4HKZA 5AAMA 3TM6A 2IJ0C 3WENA 1T6BX 4Q74A 4OGQC 4Q4IA 1GJUA 1J5OL 4R7LA 5BW7A 4OBRA 1LMIA 3I2CH 3OHXB 3TJPA 3S4SG 1SHWA 3T65A 1KTDA 2CH8A 4Z0BH 3DO3A 2HKHH 2F61A 5TGBA 4M1DH 3FN9A 2QKSA 3TL5A 5TPWH 4K7FB 3ZMRA 4ZO8A 1V7NH 1JI1A 1AXTL 1LO3L 1V05A 4OCMC 4LLQB 1DE4A 4E41D 5C07A 3O0RL 1IX2A 3RIFK 3GSWA 3GI8H 4LLMA 3DX3A 3WIAA 3AS0A 4X83A 2O4EA 3CX5K 4XVSL 3M17B 4G8AC 5JW4R 5BOJA 3K8MA 4Y5YB 1I75A 1AXIB 1V3KA 2FR4A 1GHFH 3BYYA 4XCEB 4YDLB 4PTTB 2WUCL 4NQVA 5ICZB 2FEJA 2WUBL 4G83A 2XVKA 3DHPA 3IWVA 3KLLA 4WI8A 2CMRL 4QRPA 1PPIA 1JJUA 1XGZA 4I0CC 3M1BA 2AVFA 1IQDB 4PBXA 2XFXB 3MBEC 3GTVA 2VXQA 2XIDA 4YHZH 5GRUH 1XGRA 1KENL 3OKMA 1BYNA 3OZ9H 4TL5A 4NIKB 1OTUC 4GW1A 4MNQE 5E5UB 5T1DL 4CMHC 1PZCA 1TITA 1PKQA 3Q2VA 4J7RA 1WUZA 2P7TA 4TLSA 2R2EB 1P7QA 1KPRB 2J72A 5EZPA 2Q7YA 3AG3B 2XWJA 4JM2F 4HLZH 4HK3N 3QB7C 3QZWA 3NSJA 3MRJA 4FZ8L 2DWYA 2B4CC 1X44A 3FCSA 4NBYB 2PPFA 4R97C 1TFHA 4KVCH 3A24A 1CK0L 3VD1A 3DPDA 4UT6H 1RMFH 1ED3A 3ECVA 3EOAB 4AQEB 3OKLA 4XE0A 4JPIB 3F7VA 1DLFH 1ZA6A 4MWFA 1KFAL 4UAHA 4J4PC 4X6BA 3SGDI 1J5OH 4FHKA 1NUGA 2YGPA 4XP1H 1OP3H 5FA3A 5DRXB 1S7TB 1TYEB 3CTTA 4EZLA 3CFTA 4MZ3A 4M48L 3VFRB 2Q87A 5JW3H 1IGYB 3H55A 5EZLB 5KSBE 1TO4A 3T3PF 4BSVA 5H94A 2F58L 3DROA 5DRZA 3DGGB 2NOYA 3US0A 2VISB 2BJML 1QYGL 5JW4Q 2HAZA 5IM7B 3NGBB 4FMFA 2YGQA 2AJYL 4MBOA 2WB1A 3QR0A 1RIUH 2EXSA 4G8GD 4KJQC 1FNEB 1NGPH 4X6FB 4XMZA 4ZODA 3V6OC 3GZQA 2HLFC 4G9FD 3WE6A 5FOJA 1RUML 2GITB 1RHHB 2ZG2A 4G7QB 4PJAF 1XB8A 2V7NA 4G3YH 3OKYA 5F1OB 2F2HA 3QYNA 3L4UA 2F7IA 1MHCB 2GTZB 1WT5C 4Q56A 1RJLB 1K4DA 2ESVA 3O81A 3ZTDC 4MD0B 4JRWA 4N8PA 1HWHB 1BXVA 3GMNA 2F7RA 4G1MA 4ZMPA 4UU9A 2P1YA 5KVMC 1M71A 5JHLH 1EA9C 2GAZA 1TLMA 2VN5A 4A2EA 1K8DA 4YFDB 4U0QB 5ERWB 5F7FA 1N5YL 1UZGA 3S2AA 2AEPH 1I31A 4BHUI 3B2VH 2EIZB 3V2AR 1SYSB 1QFWI 2G75B 5GQBA 4ODTH 4XNZC 3QG6B 1NTDA 1N4XL 1AP2A 2E8ZA 2EDHA 1CFVH 3FUMA 4TOYH 3OQ3B 3A3YB 4HS8H 4HFWA 3BAIA 1BVLA 1YNLH 4OFDA 4PJIE 4TLTA 5H37A 5GS0L 1VGKA 4OR1A 4AMKH 2JELH 2G4EA 2E7LC 2GEEA 3V0FA 1WFTA 3UGXA 4MNHA 3BRDA 4JZNB 4JRFA 3PFQA 4G70B 1WDAA 2Q3XA 3CLWA 4X0KA 5M94B 3ILQC 1ORQB 3N41B 4PYGA 3VAEA 3UJTL 5IVZA 1TTRA 2O30A 4N0CC 1J86A 3B2VL 5A2FA 1CFTA 1KFAH 1WZ1H 3H9HA 3OR6B 2YAHA 4FXLA 1BQHG 5DR5L 4Q58C 2R15A 1GGTA 1U8QB 2AKRA 2J12B 3BQUB 3LH8A 5IJVA 3OHXC 3PQYE 4XWOC 4KK9D 1O9WA 3MCKB 2VUKA 3CMOH 3ZDXE 1X9UA 1FORH 1QW9A 4X6DB 5CU9A 5GS1B 2N59A 3NEOA 5FV1L 4YHYC 2EUZA 1IM3B 1HKLL 1Q0XL 2YD9A 4UCFA 4TNVF 2QGBA 1PLGL 4BRVA 4KKBD 3GHEL 1OAKL 1DSWA 3U9PL 3FS9A 3S88L 4Y7OC 1N68A 2NY6D 2YPVA 4KY1H 4IU3B 5KTEH 1S78D 4P9MH 4PCYA 4UINH 1NDGB 3CZSA 1KYOK 1U8IB 2LU7A 5FHAL 1J5CA 1J0JA 3DECA 1I1RA 2JJUA 2NR6D 3BWSA 3PWJA 2XWBA 3E3QE 3O3EB 5DJZA 1MQ8A 3LHPH 4P5MB 1QNIA 5KANI 2ZCKH 4NEHB 3IYLW 4PS7A 4LAQH 1HCZA 1NGXA 3RZCD 4OLEA 5BJTA 4EI5A 1SLXA 1T04A 1A5FL 3UAJD 3MCLH 1OCWL 1DQLH 1OD9A 3DGDA 5IK3A 4KX9A 3PUUA 4GKOA 3QUKB 4KRLB 4NO5B 1L6PA 2XN0A 4HQQH 4U6XA 1MCIA 2BC4A 1T5XB 4J6IA 4W70A 5H35A 2ICWJ 3HHMA 4ZMTA 1I8LA 1ZE3H 3KLKA 1MCLA 2ITDB 3E2HC 4R8WL 3HW7A 1ZCRA 4QXVA 4XN2A 4PJGE 4QTFA 1A25A 2AMUA 1T0NB 4GQQA 2KT6A 2IO5A 1T3FA 1NCHA 4Y2OB 2WBJC 1E8XA 2NX5A 3DSFL 2Y07L 3ZLQC 2BSSA 1EHLL 5KVGH 1KT2A 2YA2A 5HPOA 3FT2B 3IMVA 3FB7A 2PCPB 1QEWB 3SDAB 1MHEB 2DTMH 4ODXB 3OC5A 4ONOA 3CFKA 1T1XA 3QYCA 4BFRA 3RAJH 5FCSH 2CBOA 5CJOH 4D8PA 4R9HA 1JZ8A 4MB1A 4ZDHB 4IDJL 4NGHH 4KJWC 4RISH 1TKWB 3NACH 3M1OA 4ZUWB 3A4AA 2H32H 3DTXB 4DP0X 2GY7B 1RY7B 4HSQA 4XNXL 2BO0A 1RZGA 1JHKH 3FFDB 3ZTNL 4L8CB 3ULVC 2Q7YB 1E2VA 3NGBC 5F7DB 1PYWB 4QHLB 5AB1A 4LIQL 3MJWA 3ESPA 5HDWA 2VMEA 4C59B 2XACC 4NQCA 4N0FB 4L23A 2E9BA 2NTSP 2EJ1A 2FH8A 4OSUL 1E6OH 4MB4A 2I5YL 4WV1A 1A3LL 3QWRA 4U6HB 1FP5A 4WW2F 1BVNP 4CL7A 3MRNB 1TJMA 4P5TA 3TJHD 2F54B 4HCFA 4XMUA 2UZXA 3BT2L 5AOJA 3IFNL 3VFPA 5AOKA 2R4RL 1QR4A 2VQ1A 1EQWA 5D70L 4S0HA 1RZJC 3H56A 3EF7A 1T0OA 2MPVA 4JREB 4NN5B 4O51B 2LU3A 4D0DA 1WWAX 4OZ4B 2CJ3A 25C8L 4WCYL 2AV1A 2GJ6D 5E95B 1P9MC 1AY1H 4LLUA 5B22A 4XCYA 5EOCH 5AVRB 1VADB 4N0FA 2A6IA 1KCKA 2VO5A 3IDJA 4NKIH 1AGEA 3Q2LA 4ZTPH 3WFZA 3ULVL 5DVLA 2JKNA 3ARFB 5CEXA 5DFWH 1T21B 2BWIA 2WBJB 3MAWA 5KN5B 3L3DA 3MGOB 2FEDD 5KANG 5DHXB 5GRVL 5I6XC 3KW8A 2FGWL 2WQSA 2VSMB 5IV2A 1N6QL 2NX5B 4G2AA 3BMVA 1VGEL 2XNAB 3E0GA 1KTRL 3TPUB 1E2WA 4PJEA 2OTPA 3GB7B 2UWEA 2XG5B 5JNYB 1LP9B 3QCTL 4RH4A 1UQSB 3DUUA 4RVBA 1PAMA 3QJFB 1Q9LA 5BS0B 4B7LA 2C4XA 35C8L 3UYOD 1H5BA 2Z31B 4WO0A 1U3HD 1HH9A 5DJDA 1LE9B 2EUXA 3H54A 1J88A 4XO3A 1B0RB 3MLVH 1EEYA 5AOZA 3OX8B 1IFHH 3UTOA 1DJYA 5DD0H 3L08A 5KVFL 2IALB 2JLLA 3OD3A 4UUJA 1VPOH 2PPCA 3LS5L 2I85A 2VDOB 3NSFA 4M1CC 4PUBL 3I3EA 4XBEH 1CZ8H 5I0XA 3Q6GL 2P5WB 3EDFA 5D8JH 1NOAA 3KAAA 2BIOA 4X8CA 2BMKB 4XPAL 2EC9U 1E6OL 1XBRA 1QFUL 2V2TB 1SN2A 4X8JA 2VSDA 1YEFH 4PG2C 4AEFA 4AX3A 5JHLA 1JWMB 2CHNA 1IC1A 1LK3H 3ASOB 4P4KD 4X2UA 3SE8H 3SPGA 2X09A 1HZHL 4O2FB 4RDQG 3BESR 5T33H 4F7PA 2GY5A 1O6SB 5E1QA 5E6UB 3VW3H 1M6OA 1OGTA 3NFNB 3VVVA 1MNNA 3PP4L 1OL0A 5IVXE 4X4ME 5I1IH 3D25A 2N7SA 4M62L 3ATAA 1BVKA 2RIKA 4W4NA 5MERB 1RK1B 2XCMC 3RIFF 3GGWA 5FX3A 4YHKL 4PB0H 2JB6A 4QRRE 3FN0H 3QFGA 5ICZA 5FCUL 3DX9B 2Y06L 4HWEL 4L0YA 1GGCL 3CZKA 1FQ9C 3FNKA 4EQ3A 3IM1A 1RUQL 2O6DA 3FQTB 5I0YA 3V4UH 3VJ6B 2RALA 4ZPTB 3H85A 1XSJA 4X4YB 4NNXA 3UTPE 3L7FA 4K2UH 1A1MB 1HS6A 3CXFA 4X6CE 4GSDL 4ALAH 1RUAH 4DCQA 1W8OA 1MHPH 4WWKD 5HHOD 1Z9LA 5C0AD 3MX0A 1W0VB 1S7RB 2WO2B 2UWEB 2Y4SA 1NCDL 2NY1B 3H2WA 1FI8C 2CIIB 3OQRA 4CBZA 5A1AA 1P1ZB 3U7YH 5DUPL 1T0MA 5GGRA 3CN2A 1AZVA 1OAUH 4PLNC 2DKSA 1YAZA 5HHOA 2X4NB 2NY4C 3MGTB 4BK8A 4FG2A 5FM4A 5IFJA 3SDCB 1RLBA 4Z7VB 2XBZA 5FYJU 3GMOA 3R7RA 4I85A 2P24B 3W3BA 3LNEA 1FYTE 3QUMH 4QO1A 4YVUA 4U3CA 3HC0B 5LDSA 1U33A 3ZOAA 1IBHA 4K9EL 5F7LB 1YEIL 1AZZC 2VZVA 3I9AA 3VGGA 3HS0B 2ROXA 3WNOA 4XPFH 1MVFA 4XVJH 2C1OA 2HLAA 5TF0A 2Z6FA 2XFXA 1YEJH 3V4VH 3TZVB 1SEQL 4GKLA 1U58A 2GEQA 1CICB 4XHJD 4NPYB 1GJIA 5CILH 2A4CA 4YSDA 2R4RH 1BZ9A 2GFBA 1LDSA 4PBVC 5D1XD 1CTNA 2J1WA 3QEUB 2FWOA 5L6YH 1FAIL 1IM9B 4F9LA 3MYJA 2HWZL 4YOKA 5FYLD 1I1CA 1YEDA 3X3FL 4Q9QL 3VU1A 3M8OH 2AP2A 4Q9QH 4MXWH 4LSPH 9CGTA 4HUCA 1UCTA 4U1KB 2P46B 4BFKA 1Z6JT 3CHOA 1JGDB 4GO8A 5EF1A 1X4XA 1NSNL 4FFWD 2GBUA 4LBEA 1PYWA 4LHJB 3U1PA 2WLHA 1M1SA 3KLDA 3NABH 1XGQB 3SDAC 4AQEA 4FA8A 1JVOA 4JO2L 3CFJB 2NUTA 1SFHA 5I1CH 2IVFC 5IB1B 3QWOA 1JPTH 4NP4L 1C8PA 2IG2H 4L4VA 3AAZB 4DEPB 4E2OA 3UL4A 4AW4A 2VC2L 4CKVX 4K7PH 4PWEA 4FABH 2F7PA 3DV6B 2J6EH 2VABB 1LMKA 2MPAL 4Z0XA 3ZQ9A 2CLZA 3DSNB 2F53D 1LDPL 2R51A 1S9VA 2BSDA 2E3VA 3L95A 4DKFH 1W16A 2BS9A 2I9TA 5F89A 1E4WH 4J3TA 2J4WL 5BV7H 1CQYA 2DZEA 4PGBB 4ZK8A 3ULUF 2IQ9H 1KJMA 4AKPA 5FO7A 1D5XA 1P9MA 4HD9A 4JX0A 4Y5YC 3MV7A 3I9IA 5I0VA 2R56L 5J6GB 2V8LA 2XTJC 1BEXA 3PPSA 3DX7A 4L1DA 3QDGE 5IHLB 2YK1L 1TIUA 3D3VE 3II2A 3OKOB 1ADQL 3QEQD 3V0WH 1IBYA 3O6FB 5EZJB 4N2NA 3W38A 5T3ZD 3VI3B 3LN4B 2DQTH 5DMGD 3RWJB 5ESAB 5F8RC 2ADJA 4ADGA 2X53A 5KVDL 3LJ3A 1S9YA 2QMKA 3S37L 4JFPB 3L5JA 1URZA 4JO4L 1UT2A 4FZ8H 5IW6B 3WBDA 4JNXA 1ZWIB 1YECL 5CEYA 2DICA 3MUJA 4WFFE 2COQA 5TPWL 3T1FA 5EEXA 5C07B 4M5YL 4XGZB 2IBZY 2ODIA 5E8PA 1BFTA 2EECA 3GRWA 4TV3A 4PG9A 1CFSB 2DM7A 2P80A 2YBGA 1ZGLA 3O45A 2IV9A 4JFTA 4N85A 4K5MA 4ZYKB 2Y1ZA 2BWDA 2ATAA 5T3ZH 1UEMA 3OF6A 4PM1A 2I27N 5AW8B 4F57L 3CUPB 4NQEB 1E9QA 4HUWB 4YHLH 5EBLB 3HVNA 2WLJA 2YMTA 4WUKL 3U30B 3T8VA 4FQJH 1R5WB 2XIIA 5GRJL 3D4CA 4NENB 1KXQE 2DLFH 5HDOA 5DFVC 3C6LB 3CIAA 5DJXB 4YFLI 3FMGH 1QTSA 5EU7E 4L8SB 1B0GB 1ZVHA 2P45B 1QTYT 4OI9A 5BO1L 5AZ2L 1P4IL 4OT1H 4FG6D 4TVPE 2R0KH 4MTMA 2VN3A 3K4AA 2FATL 1E4KC 3PY9A 4ZG1A 3DPBA 2FSEB 5I28A 5IB2A 3LHAA 4QAWA 4JFEA 2XBTA 1WHOA 3EZJB 3I85A 4Z76A 2R1WA 3O6ML 3ISRA 3NCMA 1OP3K 3ARVA 1LHZA 2OQJA 4IGBC 4QXUL 4HC1H 3VCLA 1UM4L 3SDXA 4ELMB 3POHA 5IEHA 4NT6B 4GAYB 5F7EH 5CN1A 3LDBB 3ZK0A 4MA8H 4G9FE 4KAQL 3PHQB 2WAQA 3RGBA 5IW1A 1D5RA 3JV5A 4P2CG 4YLQT 2CO6B 3CZUB 5E9AA 1YMME 2VLLB 3TGXA 3V5DB 3LKOA 3CIQA 1KCUL 4LPCA 4N2EA 2EYTA 2EE6A 2IAMB 1VAHA 2GJZB 3RZWA 3WJLC 2C1PA 2IH1A 2V3EA 3D85B 5I26A 2IAND 2Z65C 4DFIA 3SKUD 3FULA 4ZFFB 1K8DB 1PW3A 5D93B 2VJ8A 2H45A 3OC8A 1F42A 3C5SA 4XVSH 3BHBA 4F7KA 2ZWLT 2GC4C 1QSFE 3Q8FA 3PWVB 4GW4A 2OP4L 3T0XA 3QGVA 4NWTH 5LG1A 4AMKL 5KBKA 3B56A 2UY7B 3B2DC 4IDLA 3T6WA 2LT9A 2ZAGA 4NZRL 5HI5C 3TO4A 1LE9A 2GBTA 1EAJA 3AWFA 4MX7B 1M4KA 4PCSA 1U30A 4FQIH 1H9DA 1T22B 4PP2A 4GKNA 4YHIB 5DZAA 3VFNB 4XP1L 5IHZB 2BNQA 2ZXGA 4I2XA 2FB4L 3NZUA 3SHSA 1I8IA 3X13A 4AEEA 1A9VA 1KN2L 5EIQA 1WC7B 3B9KC 2DWDB 4RAVA 3RL2A 4RFOH 1G7MA 2J55A 3D52A 4XMTA 4UTBA 1MHHA 5LXGL 2IGLA 2ZICA 4M7KH 1UXMA 2DOCA 5HHVL 2I7SA 2VDPH 3WY1A 3OHXA 3GPSA 2A38A 1E5ZA 5MEPA 1OEZW 3FMGL 5FF6A 1QI3A 1FFRA 4PJIA 4WWID 3KPSB 1KBBA 3SKMB 9PCYA 1TXKA 3O4LE 4X7SL 5HBBA 2R9HC 2EE3A 2VDLB 2WQRA 3D51A 3Q8CA 1TF4A 5IF0A 4U1GC 4WJ5B 3T8XA 2G75A 1XGTA 5CMAA 1IAII 3DURB 5F7WC 2MPAH 2PO6D 4B9FA 5GS1C 1OGAE 5EOQH 3SDCC 1N7ML 3ESOA 5I18H 1PZ5A 2A6JA 4PREA 3V0EA 4NO3B 2J1XA 5FKAA 2Q20A 2H6PB 5CEZL 1JFQL 3EJRA 3FFCD 5CILL 5FGCB 3QQNA 1KEGL 5E6RB 4ZS7L 5HJDA 5C6TH 2ID5A 4KI5D 3IMRA 3KL3A 3MBED 1MOEA 2W88A 2HMID 4OFPA 3CK0H 4WW2A 5LCVA 3CV5A 1DHKA 4LDCA 4KJQD 1NLDL 2ZG1A 5D5ME 2C7UB 3FQ2A 3KPRB 5IESH 4DQOH 5IJKC 1Z9SA 2K8QA 5B39G 3S9DB 1ORSB 4XTRC 4GP8B 5IJVB 5A2KH 5LNEA 3QZBA 4PD4K 4X6FA 3SO3B 4BWWA 2ZWKA 4ESKA 3VXSD 5DUBB 5DUPH 5MENE 3U46A 3NCJH 1EFXD 1FVEB 2XBDA 2J5LC 3MXVH 4OGYH 7TAAA 3VFGL 3JV4B 3QH3B 3BUIA 1BZOA 5EC1A 4AYMC 1NBCA 3IJ7A 1C7SA 1QWNA 4Z7UB 5EOCJ 2JKSA 3GK8H 4NERA 4IRSC 1HILB 4MJIE 5CZVL 5C2BL 4FXKC 3VXRA 4L4TA 3D08A 4QXTA 4YZFF 5DJAB 4ELDA 5EOCL 2PTTA 3MRGA 2XG4A 4FQXA 3QHFL 4UQCA 2NUTB 4ODXA 3VTTA 2W07A 2BVOA 3L48A 3MLPA 3AU0A 4HHGA 1A8ZA 1RFDL 2G3XA 3A4FA 3FQWB 1G7LB 4QR7A 3DO7B 2XZQL 3MZGB 3JZYA 3LPPA 4PTUB 5BV7B 5AVSB 2FD6H 4DVBA 2IDCA 3NJFA 4U1NA 4HCRL 4ATTA 1I8UA 4G6KH 3STLB 4JM2A 5KVGE 2ENJA 3IFPA 4MQXD 1D7DA 1R0AL 3G04A 4DUWA 4GUQA 3WDHA 3MYJB 1B4JL 1A1OA 4YR6B 5C7XH 2IPTH 4JPWH 4MQ7B 1SOKA 2FBJH 2QSCH 2XTJD 4B3EA 4UQ3A 2BP0A 2WKGA 4UTAH 2EZ0D 4NUJA 1MCHA 1CD8A 4OGAD 4B9IA 4KK9C 4XWGH 3G9VA 4JMNA 4C4BA 4PJ5E 3QWRD 1M56B 2YXFA 2ZYSA 1XMWA 5E6SB 4HUVA 3TASA 4P5TD 3KBHE 3NA9L 1FFPB 1Q9OB 2YPVH 4O5LH 5CJBA 3ZW3A 4G8EB 3BQUD 1CDIA 2AW2A 1KN4L 3PE9A 5DC9B 4HKXB 4Q9CA 3ZYIA 4ANXA 5E9DA 3QXTA 4XPHH 1KCRH 2V37A 3QVAA 4PWJA 5IR1A 2NYKA 5I71C 5E4IA 1KPVB 4MJ2A 3FB6B 1EHLH 2VIRB 1EHXA 3HZKB 1T3FB 2FDBP 4JZJA 4KKPA 2VLME 4LHUA 5HHXH 1ZGLB 3JV6B 3QZPA 2HXAA 4ANKA 1JTTA 4E9QA 5C9KA 5F7UA 5ANMB 3IGAA 1QKZL 1EMTH 4XODA 2BHZA 2W9EH 1SLVA 3UAFA 4IIZA 3DJ9A 5GXBB 2OR9L 5CJOL 43C9A 2K7QA 4N4YB 4LQFH 3MLYH 3UBXA 4N5ED 4CC4A 2ATPB 3JXAA 4M8UA 2AQ1A 4XPGL 3TH2T 4S1DD 4MJHA 1C5BH 2AEIT 1Z3GH 4HS6A 5DRZB 3LVEA 1JZ4A 4Z3TA 3BGAA 3MV11 4NO5A 2DJSA 1OF2A 5L9DL 1BECA 4XH2A 1LEKA 3UAEA 1OB0A 2A73A 3ARDB 1TU2B 1LK2B 3VX1A 3LRSA 4PWIA 2FJSA 3G08A 1XT5A 2DYRB 5I1CL 2FX8H 1R5IA 1QPXA 4BDVB 3IPEA 2LGNA 1EEZB 4TXVB 3CDZA 3HG1A 4I0PD 4NM8L 5I5IA 2DQFB 3JTTA 4JVUA 5ID0B 1UZ6E 1KB9K 4TSBL 3HR5B 4IJTA 2Y1VA 5JHDB 5TE6L 4XN9A 3CDFA 5JYLA 2VN4A 1ZLEA 1MCQA 2ZSVB 2CLVB 2NR6C 1F4WH 3BXNA 4JPVH 4AJWA 5D70H 3WGUB 4OLXH 1X5YA 5J7CC 3DSFH 1HWWA 2KHAA 3IXAA 4FLSA 4UDUA 1OTTD 3WO4C 2CA4A 4CMMB 3EH3B 3K7UA 5DZ9A 3GDCA 3FZUC 4GRLA 1KGJA 3MLXH 3T4AC 4E9WA 2CM5A 3RYMA 4TF4A 1T2QH 2QPEB 2IDUA 5L8LB 2XG5A 3DDGA 5BZDB 3ULVD 4YDJB 3RDTB 5CU5A 3FTYA 1M05B 2CHZA 3GZOA 4OF5A 2O61A 1RZ7H 2AK4D 2B0SL 3GBMH 3MACL 5HI3C 4ODTL 2ZXBA 5IB4A 3UG5A 3DPBB 3KLHD 5EIIA 2Y7QB 1XIWD 4FEIA 4NPKA 2PMZA 4F37K 4WSKA 4DN4H 1QZ1A 2P48B 2HVJB 3B9KD 4FQ1L 4JG1H 4NQTA 3C5ZA 2J25A 4HZ1A 4HCGA 3QA3A 4AYFA 4DAGL 5KN5A 4J4PA 2W95A 4IHOB 3D5OF 4MNQB 3FB6A 3ZQXA 1GC1L 3MTRA 4G6FD 5EO0A 5MP6H 4GW5A 3RDTC 3EYUL 1SZNA 3PHOB 2X28A 3UTTA 2R0LH 4G8GA 3HRPA 1TQUA 3X3GH 4NWUH 2DMGA 4JDTL 3S3SA 1NMBL 2NXZB 4NNYB 4AGNA 4HUWA 3ATEA 5EBLA 4OLWL 1XGPB 2IPKB 3EGDA 5D9SA 3KS0J 5GRWA 2FLRT 3N04A 4GIAA 5CAYB 5TDOB 3Q05A 4RDQF 1OP4A 3HLKA 5KW9H 5E2TH 4KJWD 4QYOB 4YK4C 4ZQKB 3ZGHA 4HCIA 1A7RL 1FDLL 1KBGL 1IBGL 3VVWA 4KFMA 2GYSA 3AXIA 5ACZA 2AV7B 4Y4FA 4F9PC 1DUZB 4F20A 1TYRA 2EIJB 4X99B 2Y22A 3MBEA 3FRUB 1YJDH 2OL3B 4KY2A 4BSJA 1JDCA 5E5MA 4OV5B 2D03L 2Z34A 3FBKA 1LO0H 2QSTA 3II1A 3ARSA 4MKTA 5BPPA 3EADA 4ICXA 1I8KA 3CZJA 4F37F 2DQFA 1ZSHA 3U2SA 2FX9H 5AKVA 4JFHE 5KAQG 5AVYB 4GJTB 3KGSA 1QQDB 1UATA 1Y0LA 3J8F7 5ERWA 2QTVA 4E9RA 2EH8L 2D0HA 1BG1A 4U1LA 2YEQA 1IC4H 4NQDE 4ZDHA 4CAGA 3MOAH 3V9EA 2DMHA 2OCFD 4YBLC 3B9AA 2XWZA 3KJ6H 3FYIB 1AANA 4GXFA 2WLLB 2NY0B 1CTMA 4GO9A 4YDVB 3VXNA 4OLYL 1FYTA 4AC4A 2NZ1A 2A5UA 5ECJE 3VXRD 5E6IA 1BBJA 3CQPA 4A7GF 5IB3B 4P2QE 3ZE0B 3GGWB 4G11A 2XA8L 2H9GB 4JB9L 3C09C 2Y9RT 5T3XD 3U30C 2JJTA 4MSWA 5F1IB 4DTGL 3BPOB 1JGDA 4IRSB 3WUWG 4YLBA 2XZQH 4G43A 2NQDA 1VPOL 2FEDC 2WW8A 3MMEA 3O11A 4JO4H 1NCWH 4N1HB 4HGWB 4A66A 5GIRA 1K72A 4MAYA 1ZXQA 1MHEA 3VD5A 3X12A 2DM3A 1QAWA 2Y5QA 4NHCL 5FM5M 1R3IH 2WCSA 1NH6A 1XSIA 2YUWA 3DRTB 4U2ZA 1MCWM 1PLAA 1EAQA 3IKKA 2NW3B 4H4NA 4POUB 3VGFA 2D3JA 4FQXD 3FFOA 1R4XA 2FWLB 5ESVA 1WS7A 1I82A 5I1EH 4OQTA 3MRDB 3SE9L 2R0ZH 1L7IH 3CN4A 1AAJA 1MCOH 2BNUA 3ZDYE 4B9ZA 2I24N 4RBPH 4W9FC 3FUEA 2EDTA 3WS6C 3OWRA 4Y1TA 2V33A 1UT9A 4H1LB 1E42A 1PG7X 4ZW8A 4XBGA 2VWEE 3QEHA 4JDEB 3ZBMA 4ZZFA 5H4YA 3MLZH 1JGVH 4Y9FA 1U8IA 3BKYL 3FSZA 3AY4C 4UTAA 5SWSB 1V55B 4X99A 3BH4A 5C0BE 1FCGA 5F9OH 3OJ2C 2D9QB 3DRTA 4WTWA 5IW1B 3R06A 1AMXA 4MCZB 3SYOA 4BZ2L 1P53A 3NPZB 3OSKA 1DEEA 1NCBL 2QGDA 4ZAKC 5JNYA 2I26N 4ODSH 1JP5A 4ANVA 5F7EL 1ZVSB 2WYIA 3GQFA 2Y2WA 3MFFA 4N2FA 1L5GB 1I1AA 1K2DB 2W60A 1JAEA 3IJ8A 1IC4L 2EDLA 2WQAA 5E1HB 2VSKB 3P4NB 3QNXA 3FQWA 4NFCA 1QBAA 4KK8D 1BF8A 3BUTA 2H5UA 4J23A 3NTCH 4RCAA 4X5LA 2V9UA 4PLKC 4UOJA 2AXHA 3RWHB 3RWIA 3EXLA 2VKWA 3S88H 3WIHL 3LNHA 1AI1H 2XWTA 3ULUD 4JPWL 2B5IB 3DUSB 4EPSA 3RGVA 1NIFA 1JDDA 2LLNA 4PRHB 2AS5M 4UI2A 3H9SE 1M7XA 1D5MB 3BAWA 4N2OA 2MCG1 1T83C 4UYQA 2JKXA 4E41A 4U2YA 4QHUA 1SGKA 5EC1B 1S9WA 1RI8A 4NZTH 1I53A 2APBA 1KZYA 3S3BB 3KMDA 4W1TA 4KMTH 2JXMB 2A6KB 1H8NA 1J87A 3SGKC 3H42H 2G4GA 1NDTA 1AGFB 3AADB 3L3KB 4NQSB 3NRPA 5IWLA 1S9KC 4N68A 4L3EA 1AR1C 2VDNH 4L9LB 1F00I 3FO2A 4GOSA 5JMOC 5EDSA 3BP6B 3MV9A 3IJHA 4M8RA 3FQ1A 3GC3A 4OCNC 3VFVB 2CUAA 5HJBA 2BSTB 2VXTH 2AHIA 1KIUB 2QZ5A 1YVLA 4ECNA 1HCYA 5D1QD 4OLVH 2EADA 3ZIMA 3VXUD 3QQ3A 4IKIA 3Q1SH 5ID0A 4ZD3L 1NGWA 5I1LA 5JMRA 2GHZA 2CKBH 2NY2D 4XVOA 4F15B 4CJ1A 2QVMA 2ZSVA 1WZ1L 3IFLH 2F5AL 3GSNA 2Z91B 3DHMA 2J8HA 2N01B 2OMUB 3RDJA 3BZEA 4J39A 3A47A 4PV8B 5AD0B 3PQYB 5KSAB 4WI7A 4JFEE 2C9PA 4LGPB 3BIKA 1W9XA 4PRDA 3S5LA 1QVOB 2P5ED 1W72L 3HE6D 3SO3C 4MDIA 1G7IB 1I1YA 3HFMH 3IPBA 2YLKA 4KOBA 4UQBA 3KLHC 4ZW3A 2VT0A 4E9SA 2VABA 4C56D 1YYLL 3EKCA 4E0RB 4JAMA 3HE6B 1CVRA 3ZUNC 2PTUA 4PP1D 3QDMB 4LSRL 4AZ8B 4PIBA 4IRJC 3NCFB 2HYMA 3QUXD 1MWAA 5E1GA 3QUYB 3K8KA 3VGEA 4A7UA 4DKEL 4AXWA 4OZFH 4NXKA 4FNTA 5DUBA 1UENA 3MXWH 4HX1B 5CD3A 5AW7B 3EYSH 2HVKB 3VA6A 4Q9RL 2FTAA 4JFDA 1QUPA 1T4KA 3QZNA 1KJ3H 2KZKA 4EDWH 1QOKA 1RJCA 5E8NA 3D39E 2ED9A 2IXQA 5IMOB 4MNHB 3ECWA 3Q0HA 1IGIL 2XY1A 4KMLB 3TJHC 2AQSA 1A66A 1RIHH 3N42F 2F1BA 1FFPA 1Q9OA 4XP5L 3S4SB 1HAWA 5CCKL 1JFHA 2CO1A 1N59A 1U3JA 2BP8A 4V11A 4AQ8C 3V4LA 4DIXA 1RUMH 1E4XI 4OZIE 2ESVD 4QHKJ 1FVCB 4RDBA 4TS6A 5D8JL 4S11A 1H6UA 3CFDA 3VWKD 5TH2A 3SJVA 4AI7A 2DQCL 2D3NA 4Y5VB 5EU5B 5B7MA 3ZYJA 5F1NB 4XNBA 1BAWA 2BJMH 4JQIA 1W15A 4PAZA 4NCC1 1CGVA 1KPRA 4CBPA 4K9JA 3ARBD 4BDVA 4RZCB 2YOAA 3QXUA 4YR6A 2R0WL 2EAEA 3HC0A 2C3VA 2HFGL 3CH8A 4WVRA 1HVXA 4TRPL 3BD3A 4UQ3B 1L6XA 1RZ7L 3CSYB 3T3ME 4FAAB 5HVHB 3PDOB 1MRDL 1QFUH 1KWKA 1E9PB 3I2CL 5ADPL 3TCTA 1X7QB 1KIPB 3VD9A 5B1KA 2O26U 5IG7B 1QSZA 5DMGC 1BG9A 1CFMA 4ODHL 1WTGT 3O3DA 1T89A 3K1KC 1M2OA 3W5MA 1HI6B 3QJQB 1I1FA 2B08A 3MLVL 1ZTMA 3VI4E 3O9WA 5I0DA 4QRFA 4MX7A 4GKSB 1UWYA 3OXSB 4K3DL 2EDBA 1FE8L 3GSUB 4U1JA 3CAFA 4IMKC 2OS7A 5LAXB 4LDLB 4A7TA 3B7SA 3CPLB 2I60H 1V8HA 4JFOA 3KWWB 5I8KL 1SLWA 4ZYKA 4G8FA 3LRMA 1Z7JA 3R0NA 3ABKB 4IRZA 1DVQA 4HPHA 1KGUA 5SWSA 3MNZB 4FA7B 2R2CA 3ZE0E 1R34A 5D7HA 4EOWH 1MFNA 5CP7B 1XB3A 3MV8A 1FJ1A 3WFCL 2PR9A 5IBLD 3E6HA 1N2RA 3RU8H 4YSTA 1Q90A 1CGYA 1KV7A 3CJJA 4R4BB 3FKUS 4H8HA 2Z4QA 5GZOC 1I7RB 3WCYA 2N3JA 2YD6A 3LKRA 5TQ2L 3T2NH 2UY6B 3NUKA 5LCVH 4JM2B 1FZKA 2R2BB 4HEPA 1A6TB 1BIHA 4AL8H 1F4AA 4ZFOL 4WEEA 2IADB 3S7GA 1NPJA 5L2JA 1NFDA 5DZOA 4DWHA 1SLUA 5IHUL 4Q6IC 4IS6A 4NKDA 1FPTH 5IHWA 5DVKA 2LV4A 3RTQB 1JYNA 3JTTB 3BAEL 3MREA 5KJ4A 3WV0A 3KLAB 4AJ0A 5H2BB 3CLFL 4KI5E 2Y7MA 1IKNA 8CGTA 1VHPA 1TJGH 2DWTA 4HMDA 4JY4A 5EV7A 3SCMB 2HG5B 4QXTB 4WIQA 4B0MB 1QZNA 2ARJA 1K5NB 1RCYA 1RZFL 5FLVA 1XIWC 2ZOLA 4IBVA 1SXAA 2H2SD 4MRBA 4XBPA 2C9AA 4JFQA 3FB8A 2XTSA 3GZPA 3SE9H 5FHBH 3N9GH 5M95B 3EH4B 3VJ6A 4AYGA 4AQ1A 3BZ4A 3TO2A 1I8MB 2OMTA 4JPQA 1DBBL 3PL6A 1R33A 1WBXB 3RB5A 1DR9A 1P6FA 2XX0A 5CSBA 5E8PB 1CO1A 2H32B 3VXTB 5HYIA 3MREB 2CGRH 3TO4C 1JK8A 1FIGL 2MNWA 5IHHA 3RA7H 2OMXB 2D4DA 3IGAB 4KO9A 5JOEA 4HXBH 4LMQI 4D9RE 1MAJA 4P04A 1S7XA 4YXHL 1TQBB 1UZ8A 1QNZH 3U2SB 1U8MA 1J10A 2BNQB 4R84A 3X13B 4HJGB 3KWXA 2R83A 4L1BA 5FHBL 5IVZB 2ZOKA 3QXAA 4LSQH 2F0CA 2ZXDA 3CFCL 1MIEH 3C08L 3LEYL 2JJVA 1BD2A 4FQQA 2HRPH 4HUUA 1L0PA 3OKMB 3PQYA 4AKQA 2Q2LA 3IF1B 3O3EA 3ABMB 3GIZL 3F8UB 4EAEA 4RRPG 4ZTOL 4Q2ZB 5CJQL 5CP7A 1IEAA 4Y5XA 3OJVC 4XXDB 4HDIB 4DO4A 2C1OB 5HDLA 5AKTA 2YPVL 4WI0A 3SKJH 5DK0B 2J71A 3HZMB 5D1ZB 4ZPVA 3SODB 3FQRB 1AYRA 2BNUB 3CC5B 4HQQL 3VRLE 3QDJD 3O4OB 2O5ZH 4FQHB 4QCIA 5I1LB 3IE4A 1FLRH 1T0PB 3VFGH 2AK1L 1AS7A 2NY5H 2OLDA 2D73A 3RVTC 1KSRA 2PPEA 3CFNA 3BAKA 4HWZA 4PRHA 5D7IF 2PYEE 2VDKL 3NIDB 5FK9A 3C60A 3BWAA 3U4KA 5D7LA 2G2RB 4U1MA 5JORB 2F5BH 5EWIH 2WSDA 1DL7H 2P4AB 4R0LB 5FF6B 3FONB 5ICXB 1N0XH 2GUOB 3B7TA 4L3AA 2CA3A 4IBTA 5F3FA 3V95A 2UZIH 4R4ND 1HTYA 3EBGA 1W0VA 4BE6A 4HWBH 2GCYB 3HG1E 2W0LA 4RETB 1E3ZA 2J6EL 5K1NA 1AGFA 3L3KA 3EJQA 4R26L 5C0GA 5L7XL 4P57A 2ZCLL 3HE6A 4AIXA 5I30H 1Y1DA 4GSUA 3MFFB 4V1DE 1H6EA 3O3UN 1IAOB 3CHSA 2VIRA 1FC1A 1MFVA 3HG1D 4I0PA 3CFUA 1B3IA 5DLMH 5IQOA 1TCMA 3DUHA 3RX7A 4D0CB 5SWZA 3RPKA 2IDSA 3BFQG 2VDKB 3D9AL 1LWRA 2L7UA 3VQMA 2HVBA 4JUTA 1TZIB 1PZ3A 1XCQA 3OAUL 4JQIH 1GAFH 3C87A 1HT6A 3B83A 2RA1A 1FHGA 1R5WA 3KE0A 3MA9H 3V4PH 1HINH 1HSBB 2HPOA 5FGBC 3MYZA 4F2MB 4XXWC 4K94L 3EHBD 2KS0A 4Y4KD 4LBAA 3UBXG 2BFGA 4UT6A 1UG9A 5D1QE 1J0KA 1FUNA 1IQWH 3WGVB 1CFQB 3GXPA 2CDFB 5I8KH 5L7XH 4P4KC 1ZMYA 1FNGB 3EOAA 4JKKA 4LVOB 4K9EC 1TPXB 4JFUA 1BM7A 4UU9B 4EVNB 3Q43A 1HCFX 3KYOA 3D39D 5FC9A 5C8JA 2W91A 5I1KL 3VXPB 1P4IH 4DKDC 4HEME 4XP6H 4OV6F 2WXGA 1NEZB 4P5TB 1KELH 3OAZK 4PWFA 3PWNB 5E94A 4M43H 4JBSA 4HH9A 4UNVA 3UTTE 1PVHA 3LN4A 3QIUA 4MQXC 1TPXC 3W9DB 2VRKA 2ZCHL 1F11B 5HGDA 1SQ2N 2TAAA 3STLA 1WSST 1U4EA 1S7VB 1D5BA 4L8CA 4WJG3 2BCKB 5A16B 2P5WA 3RVVD 5HVHC 1K5WA 4ELKB 4F93B 2WXHA 4XCEA 3BN3B 5AW9B 2FWUA 2Y3NA 4RX4A 5CNHA 1B2WL 2HFEA 1X5IA 1DVFA 3PF2A 4OLVL 4P2RE 2QLVB 1DO5A 1ZLSL 1RD6A 3HI6L 3BSZH 4ZUTA 3EYUH 1VSCA 4NUGH 3ZE2B 1E9QB 1XL6A 1UOWA 3ILQD 4KY1L 4NAMA 3U0PB 2Z93A 5CGTA 5LGKA 4MWFB 4KU1A 2PCPA 1A0QH 1UWGH 2ZX6A 1WA2X 3U9UB 3RVVC 2ZUXA 2LW3A 4CJ0A 4PJEB 4GBXA 4QHPA 5E4EB 4Y4FD 1F1AA 4GKSA 1N10A 4WHTA 2WHVA 4A55A 3SKOB 1KIRB 1QBLH 2QKIB 4LLQA 3GSRB 1HNYA 4DW2H 3MRJB 1AHWA 3JWNG 3ZDWA 3V7MA 3HZKA 1JWSA 2P3YA 1IFGA 4OJYA 3T0BA 5EU6E 1YEDB 4DP7X 4K71B 5HHMB 1HFUA 3SZKC 4LLWA 1YA5A 3R19A 2ENSA 5D96C 4JZNA 5I6PA 5EBWB 1Y18A 4L9LC 4P4KB 4UBDC 1AR1B 3HVDA 3VXQB 3HMXH 2UWEE 3HZVA 3M1BB 2FHCA 4Z18A 3RWEA 5EUOA 4YSPA 3L3HA 1A21A 1E0OB 4WW1B 5IVXF 3ZE1B 4B9JA 4LCCA 5CUSL 1GL4B 3HNSL 4I88A 2BLFA 2VQ1B 1HQ4A 1NIAA 5D2LA 3W39A 4UIMA 3J07A 2ZKHH 3VMPA 3RURA 1C8QA 1NDMA 3RDTD 3D1MC 1TNMA 5BRZA 3TJEH 3X2QB 2Q8BH 1J7VR 4E9LA 5C0RH 3APCA 1OT4A 4KKAC 4MQ7A 4PJHB 4UBDD 5IQ7L 4XO8A 4YSUA 1FYHB 4NKIL 5DJYB 1GS8A 3VYNA 2VXUH 4GSRA 3ZIYA 2GK0A 3PIQA 3K2UL 5JIMA 2KLTA 2FBJL 4HJTA 5J1SC 3TBWB 3APFA 3B37A 3HPJB 2GTZA 5F7MC 5CHNA 4G43B 2WOYA 3G5YA 1L0YA 5EEVA 3K1DA 5IMOA 5DZNA 2BS8A 2R23A 4WFGD 3LEVH 5EORH 4ACTA 4OI7A 3UZEA 5AW6B 2WBKA 1HL9A 5C9JB 4JL1A 3RWGA 3FZUD 5FYKH 3SBWC 4DJMA 5J1AA 2PPDA 3RL2B 5IROA 5TDOA 3K72A 2XN9D 5T1LD 3NP3A 4Q0XL 3L7FB 1WFIA 2KPWA 3FQNB 4Z7NE 4LEOA 5B3SB 5I6MA 5ICYB 4GB9A 2R9HD 2E7CA 2UX6A 3QDGA 5MEND 4HXAL 5CINH 3GSXA 4ZW5A 3WO3B 3V10A 4BSWB 3QHFH 3D8MA 2ZWNA 2QKIC 2NXYD 5AVWB 2WXMA 3FOMB 3S5YA 4HJEA 3IMTA 4EN3A 5EIIB 1VLXA 4E5XA 4MYWB 3O9WB 8FABB 3VRJA 2AV1B 4K8RD 4QRRA 4BXSV 4OJAA 1P84J 4QGTA 2SEBB 4J3VA 3WTUA 5AAWC 1YYLH 3WJMB 1AO7E 3DX9A 1IE4A 4LVHC 7PAZA 2BSRB 5F88B 1I3RA 2AABH 4PJBB 3NSYA 4ZFFA 2Z7YA 4W9EC 4M1GH 4GRLB 3MLTA 4ANUA 3VGAB 2VC2H 1ES0B 3DGCR 1NBVL 5FYKD 1XVSA 2NCEA 5E9DD 4QO1B 4V2BA 4HXAH 5KVFE 3IF1A 3GXFA 2GC7C 1CDUA 1RK0B 1DEEB 1JF1A 1PCSA 1RJZB 4HUMB 4BRJA 4PRAA 4KK6C 5LB1A 4GRMB 3JYCA 3N50A 3K3QA 4H1LG 3IFPB 3UBFA 3VD3A 4ANWA 4F8NA 1CG9B 1HXYB 4XMXA 2F8IA 4R6UA 1E40A 2AFNA 4BZYA 3Q2WA 5AUMA 3G6JE 2UUDH 4QRUA 2CO4A 5DHMC 5IB5A 3JVFC 1CR9H 2XTJE 1VRSA 1F1DA 1D5XB 4UILH 1I7TA 1L9OA 3MRFB 3Q6FA 2YPKB 3NIGB 3QDJA 1EZLA 4LT7A 3NH7L 2VXUL 4MCYA 1FNHA 2WWMD 1YEKL 1XCQB 2R0ZL 4R4NC 2H3XC 1XF4B 5BRQA 4LRIA 3K71A 2BVQB 4JANB 2ZP8A 3BDYL 2EVHA 1MEXH 5CR8A 1U2HA 3T3MF 1A5FH 1UOLA 4LGSB 3VFRA 1BFOB 3GLEA 3LKSB 1Z9OA 1MRCH 2J56A 4U7MA 5F3BB 4ZTEA 4O9HH 3L4XA 1NOLA 4CDGC 4MMZB 3ECUA 4CU7A 3V4PB 3QIBB 1T66C 3DI2B 3EUUA 3RWIB 3RWHA 8PAZA 2JKLA 4PJFB 4LARH 3EFFA 4D0BB 3UTZB 1S5HB 4L05A 1VFAB 1H3TA 3BW9A 1HE7A 5I8EA 5KZCB 3TF4A 5ILTL 2VO8A 2Q8AH 3LQAC 1XIWA 1N0LB 4ZRGA 3QIUB 4AIZB 4HG4K 3BT0A 4X7DC 5DO2D 4U1KA 1GW0A 2VDRB 1NGWB 4M7ZC 1A3ZA 5D7LD 4PGJA 4QKXB 1OPOA 3B1TA 1P69B 5CEXB 3ZHDA 4Z7QF 1G94A 2X4RA 4PGEA 5K59E 5JPNB 4MGXA 3VD4A 32C2A 5IFAL 3QI9A 4E42A 5DLLA 5I9QC 4TULH 4Q6IA 5BS0E 5C07E 4J12A 3HAEH 1RHFA 3ZDYF 2YKLL 4LPXA 1P7BA 4TVPL 2Q76A 1YN7A 3NJLA 4P5TC 5ETUA 3MV8B 3UTPD 1AH1A 1AD0A 4YDMA 3N44B 4WV1C 3GS4A 3NVQA 3QORA 2E7DA 3NIGE 4RNRA 1IGMH 6FABL 1UEYA 2XWXA 2JQZA 4K15A 4JM0A 4ZUVA 2P5EE 5GGVL 1GW6A 1N8ZB 3D39A 3K80A 1YQ2A 3DJSA 3GSOA 2HUHA 4JHVA 4FXGC 3BSZL 2Y6TE 3ZRSA 3LN5B 1R19A 3QFJA 4Y0GA 5D4IA 3BH9B 1IB5A 4XWOD 4DGYL 1OM9A 1NAKH 4Z95L 1D5MA 5TE6H 1QLEH 2D03H 4ZFGH 2YA0A 4DF9A 4LPUA 4Y4KA 5AG9A 2YKLH 4HC1L 2QFRA 3M1CA 2YGOA 5CJXC 2VR9A 1JZ6A 3K6IA 4MAUL 1NBZA 3P0YL 1G9MC 4RX4D 3C5XA 2HN7B 2DBLL 4U6VH 5FW6A 5FYLL 2W65B 5JHDE 3RWDB 3MGOA 2CMRH 2OCJA 2XWRA 2IIJA 4CW1B 5KSVB 3IDNB 1A6PA 4HH8A 2OI9B 3LKNB 3N06B 3DVNB 4U1MB 2ARWA 5AYTA 4AUJA 4YDLC 5JORA 5D1QC 5KAQF 5JW4M 5JOPE 5DJ6B 3QDMA 4HHAA 3IDXL 3PGFH 3FDWA 5DK2B 5F6IB 3S36X 1WBYB 2W9DL 2VXVH 1VZGA 5E70A 4MD4A 2JE8A 4PLOB 3VM7A 3D2TA 2XTLA 3TYFB 5L0QC 1J05B 4ERSH 3RVWD 2OI9C 5JA9A 2HKAA 3P2TA 4K71C 1USQA 5LO7A 1OHZA 1TZAA 3S36L 5EZIL 4QF1A 1Q1PA 4C56E 2WQVA 4FJYA 2NY2B 4O4YL 3ZZSA 2NY4D 1PZAA 5MHSE 1M71B 1UJTA 1OE2A 1U91B 2FQFA 3EJUA 3LPWA 5C0CE 3RUGE 4LCWA 1L7TL 1S5IL 4B3VA 3VWJB 1PDKA 1KJ2L