4YVVA

Crystal structure of akr1c3 complexed with glibenclamide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 116
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4yvvA00
4QBXA 2PD5A 2F2KA 3CV7A 3H7UA 4PR4A 3B3DA 4YU1A 2ISFA 2FZ9A 1S1PA 1ZGDA 1IEIA 5AZ1A 5LIKX 4FAMA 3M64A 4PRRA 3FJNA 1Z89A 3GHSA 3UG8A 4WDUA 2PDWA 4GACA 1ZSXA 3M0IA 1HQTA 4ASTA 1YE6A 3LENA 4WDTA 1T41A 2IPGA 1S1RA 2HEJA 2ALRA 1Q13A 1X97A 3WBXA 2DUXA 3N2TA 2HVOA 4JTQA 2FZ8A 3LBOA 4FALA 4Q3MA 1C9WA 3V35A 3BV7A 3UZYA 2HV5A 4ZFCA 1Z8AA 3EAUA 5C7HA 3S3GA 3MB9A 3QKZA 2HE5A 4XZLX 1ZUAX 3BURA 4AUBA 5LIXX 3VXGA 1YE4A 2PDJA 3FX4A 1J96A 1R38A 4MHBA 2PDGA 4WRHA 4JIIX 4JIHA 1YNQA 1PWLA 1JEZA 1PWMA 2PDMA 5LIYX 1OG6A 3H7RA 2PF8A 1MZRA 4DZ5A 2PDLA 2BGSA 1HW6A 2PD9A 3LD5A 3UWEA 2PDIA 1T40A 2IS7A 1X96A 2R24A 2INZA 2ACSA 4JTAA 4H7CA 1M9HA 2PDKA 4LB3A 3P2VA 2NVCA 4PRTA 5KETA 5LIUX 3UYIA 2PDQA 4JQ4A 4IJCA 2FZDA 3V36A 3UZZA 3Q65A 3CASA 1XGDA 1GVEA 4IJRA 3G5EA 3M4HA 4ICCX 4JQ2A 1K8CA 4NKCA 2IPJA 1ADSA 4XO7A 2HVNA 5LIWX 1Z3NA 3H4GA 3MC5A 4QX4A 1XJBA 2PDFA 3V0TA 4YVVA 2R9RA 3T42A 2FVLA 3CAQA 3CAVA 4JIRA 1RY0A 3LZ5A 4LBRA 3R6IA 2FGBA 4XZHA 3WCZA 4QR6A 3F7JA 4YVXA 3LUTA 2IKJA 4JTDA 3BUVA 4GQ0A 4JTCA 3UP8A 1LWIA 2VDGA 2PDHA 3LZ3A 4R9OA 3GUGA 1ZQ5A 3R94A 3O3RA 2HE8A 1AH0A 4HMNA 3V0SA 1SM9A 1S2AA 4DBSA 1UR3M 1RALA 3N6QA 4G5DA 4XVDA 5M2FX 4JQ1A 1VP5A 3EB3A 3LQLA 3R8GA 4XZNX 1AH4A 1IHIA 1EL3A 3UZXA 2QXWA 4WDWA 2I16A 3LEPA 1RY8A 2PDUA 5JH2A 1MI3A 3LQGA 2HDJA 2PEVA 3UFYA 2ACUA 3ONBA 2P5NA 4QXIA 3LN3A 1AZ2A 3U2CA 2PDXA 2INEA 3WG6A 3ERPA 4JQ3A 3D3FA 4EXAA 4PUWA 2PDCA 3EB4A 3WBWA 4XO6A 2PDYA 4FA3A 4F40A 4LAUA 3R8HA 3BCJA 4YS1A 2A79A 4XZIA 3C3UA 1LQAA 1X98A 4RPQA 1PYFA 1US0A 4L1XA 2PDNA 4I5XA 1QRQA 4JQAA 4LBSA 3CV6A 3GHUA 3GHTA 3O0KA 3UZWA 1AFSA 3KRBA 2NVDA 4WDXA 4YVPA 2DUZA 2C91A 3ONCA 4H8NA 2PZNA 1AZ1A 5HNUA 2BP1A 3DOPA 2DV0A 4GCAA 5DANA 1PZ0A 3RX3A 5JH1A 3WBYA 4LB4A 3LNMA 4HBKA 1XF0A 1Q5MA 1YNPA 2I17A 3R7MA 1VBJA 2PDPA 1MRQA 4GA8A 2IKIA 2WZTA 2AGTA 4XAPA 1EF3A 2IKHA 2FZBA 4WGHA 2CLPA 3GHRA 2PFHA 4XZMX 2ACQA 2IQDA 5AZ0A 4PUUA 5HA7A 4OTKA 1FRBA 4FZIA 4DBUA 1AH3A 5HNTA 3R43A 3NTYA 4PMJA 2IKGA 2IQ0A 2J8TA 4EXBA 4Q7BA 2IPWA 1EKOA 4JTRA 4LAZA 3COTA 1QWKA 3G1RA 3DN5A 3UGRA 3V0UA 4WEVX 2BGQA 3CMFA 1PZ1A 2PDBA 4GABA 1Z9AA 2WZMA 1EXBA 3RX4A 2ACRA 4IGSA 1S2CA 4GIEA 3Q67A 3RX2A 2IPFA 4DBWA 2F38A 3R58A 4L1WA 4XK2A 1A80A 4XVEA 4GQGA
chains in the Genus database with same CATH superfamily
3VO0A 5A6SA 1OX4B 4JY9A 4DO4A 3I6TA 3B06A 2PD5A 4UQBA 2A5HA 3K46A 3S8HA 1XPGA 3WL1A 1LL6A 3MV01 3GM8A 3NL3A 4PMVA 2VT0A 4JN6A 2C1IA 5FSEC 2Z2UA 2YSWA 2V5BA 4CCCA 5AHIA 2D22A 3TAKA 4R9XA 3A3WA 3SCVA 3GHSA 3AHXA 1GZ1A 3T1GA 4K38A 1MEWA 4V28A 4FR6A 5EFDA 3RR4A 1ZSXA 3V3WA 1YE6A 3NVTA 3VMPA 4I7VA 2X09A 1VPYA 1OVDA 2NQHA 2YXXA 2QUMA 3B0UX 3ES8A 1K8YA 5I3JA 3ARZA 4CVUA 1CGTA 1ESWA 1VC4A 1NF7A 4OBSA 3AMCA 3CH9A 4HCDA 1XIGA 1JXKA 1E9YB 3G22A 4AY7A 1UR0A 2RH9A 5C7HA 5DX7A 1CB7B 3UWUA 4KCUA 4L56A 1ISVA 2YX0A 3HF3A 2V8ZA 3IIOA 3IJ6A 3VM5A 1JCLA 1TPDA 3ISIX 3MY9A 1H1ZA 5EMYA 3R2GA 1H09A 1UR8A 4B9YA 3POCA 1FUYA 4Q7IA 3CK5A 4D6FA 3FYPA 4UTWA 3OLEA 2J66A 3AJXA 2Y88A 5LIYX 1PUDA 2V9DA 4NI8A 1W9DM 3HG4A 4XD3A 1KGXA 1TIWA 3VVGA 1RVKA 3QR1A 4BI7A 4N7QA 3BWWA 2ZBTA 3KTCA 1SFLA 5CPMA 3I6EA 2R24A 4MWAE 4H7CA 4WK9A 1M9HA 4HKPA 3RPDA 3RR1A 5LA0A 1UWAA 3JR2A 5FF2A 5C0QA 4ENLA 4G7EB 4M6PA 2XSBA 1G67A 3TJLA 4DI9A 3V36A 1AVAA 2C14A 2WJEA 3PTQA 3UGVA 4N4PA 1W9VA 3IIXA 2Z7KA 2A7RA 1DE5A 3PSWA 3EA3A 4YTUA 3FKKA 3B03A 4V2XA 1ZLPA 3MC5A 4DWSB 3KOXA 3PF3A 4CNSA 3H2MA 3MUCA 3LRKA 4WSJA 4GFIA 4O13A 5HMDA 3C2FA 3MSGA 4JDYA 2FGBA 3NOEA 3O06A 3S46A 1EJVC 1SSDA 5XIAA 1JJKA 2BY3A 4ROPA 4O57A 4MPKA 1M03A 4YVXA 3RM4A 1V6YA 2QAPA 2REQB 3A21A 4JTCA 4W9TA 1NEYA 3NSNA 3U8GA 2PRHA 4G6CA 4PCNA 2PDHA 4RXGA 2VZVA 1XHGA 2O9RA 2HWGA 2FHFA 1NFBA 4GRSA 3AIWA 4LH8A 3N18A 2XHYA 1RALA 3WDJA 2QCEA 1RA5A 4WR3A 1H41A 3W1PA 1LL7A 2PZ0A 3G1SA 1E0XA 5I79A 3VD4A 1PS9A 4QNWA 2HZGA 3MVIA 1SZEA 2NX3A 3ALGA 3SR7A 1RCOB 3QV9A 2G0WA 1EYEA 3TYZA 1UR4A 3UR5A 3SFWA 3WUBA 3N2BA 3NEHA 3N17A 4H00A 3H21A 1M7XA 3BQ5A 3PZGA 1GJWA 1MI3A 4A3HA 1UH4A 3PUOA 4AZ7A 1A5UA 1MRAA 5C6MA 1OX6A 3PANA 4AY1A 2EAWA 1JD9A 3SY8A 1V51A 3H23A 3VILA 3VMNA 3AALA 4JTEA 1F3TA 2PDXA 3EDDA 3IJ8A 1LWHA 2QIWA 2WKJA 2DVTA 3QQWA 3ICJA 2OGYA 1N82A 3ZVHB 3E12A 2GSJA 5BXTA 2VDIA 4B4HA 1H60A 3GVRA 4F40A 3AQUA 4WOZA 4XZIA 3H70A 5AC8A 4DYEA 1NWUA 4DBEA 3ALFA 4GYKA 5HMSA 1X1ZA 1ZBKA 1L6SA 5FACA 1ISYA 4PTDA 3W7OA 1F61A 4WVXA 1GPFA 3B05A 1BQGA 3GHUA 3IUHA 2Y5JA 3KRBA 4DVOA 3KDOA 3MKCA 3SFKA 3P7YA 3H2FA 4ZA0A 2OQYA 3SGUA 4FOKA 3PULA 4XISA 1R2TA 3C56A 4RE2A 6PTDA 3QMTA 2Z24A 2VFHA 3VNZA 5BCAA 3OJGA 3FJ6A 4I9TA 5CCZA 4B5VA 1UW9A 3TOYA 3UJSA 4O12A 3MI2A 3ANYA 4OIFA 4XAPA 3GYEA 2CLMA 1R85A 3JW7A 3QSTA 2DDXA 3UY8A 3JZUA 1UD8A 4W8BA 4FNQA 4LRSA 2OJPA 1JFHA 1V6TA 1NM9A 1QPNA 4NXSA 3QY6A 1RCXB 2B7NA 3O16A 4MPQA 3RM8A 3P93A 2FTWA 4I8YA 4ZSTA 3L4XA 2PCQA 4D1JA 1TQJA 4L80A 2W3ZA 2J8TA 3TWBA 1Z7AA 4UZSA 3K2GA 1QOQA 4TVCA 2E6YA 2WMFA 3RJXA 4LUTA 3G0SA 3QZAA 3DN5A 4KFNA 4DY1A 3RCYA 2A6NA 4A2SA 3NQMA 3I7RA 2FPTA 2GJLA 2OB3A 5SWUA 5A6AA 3OOQA 1D7FA 4UTLA 1XFBA 1YNYA 5FA5A 1XX1A 1HL8A 1TPC1 4ZQMA 3U6WA 3GZAA 5HPOA 3NR0A 4M3PA 3RX4A 3UR2A 4X9SA 4CN6A 4GIEA 1H7WA 1W32A 1VD6A 2VGGA 2Q01A 2F38A 3Q45A 4LVDA 4GISA 3S5NA 4MZ1A 3TH6A 2BVWA 5HANA 3A24A 5CBIA 2F2KA 4HYRA 1XLKA 4DJDA 1RUSA 1TTIA 1W3HA 2WZHA 4GYPA 4B16A 3GZ3A 3AXHA 1KCXA 4GHRA 1O68A 3RCMA 1H3GA 3MMWA 3TU9A 2ZUTA 3GTXA 5LNWA 4HT3A 1SZRA 3M0IA 1VLWA 1LORA 1Q6RA 1TZ7A 3EEZA 5C2CA 3IAPA 5AYZA 1NVMA 2HEJA 1RBAA 1RXOB 3EPMA 5AHFA 3OA3A 4EF9A 2DUXA 2VENA 4INFA 3PZMA 1E1EA 5XINA 5GQBA 3LBOA 1PZ3A 2BS9A 1HJVA 3BV7A 4AWEA 4RZBA 1DORA 2PWEA 1YHTA 4UMCA 1EHNA 2OZ3A 5EMJA 2WPBA 3NUKA 3R25A 2B81A 5D8WA 1CLVA 3FFSA 3CM4A 3KBJA 1FWFC 2NUXA 5HINA 3F4CA 2HVMA 1EGVA 1V02A 4LVGA 4LAOA 1YX1A 3GTHA 3MV11 3M41A 6TIMA 4CD4A 1E71M 2RKXA 3MMUA 1YNQA 3F2DA 4UR9A 3AIBA 4H2CA 3V5OA 4WF7A 4DM2A 3B8IA 1YDOA 2TRSA 3H2NA 2DSWA 4XUGA 1XINA 4ZO8A 4AZCA 2PDIA 4WY0F 4XIAA 1P43A 1E6NA 1JULA 4B4FA 3AZRA 1QATA 2WYSA 2X30A 1VQTA 5J5RA 2Z6JA 1V79A 4HK5A 1PAMA 3IACA 2EPOA 3PG9A 1FHDA 1A4LA 5ABTA 5DLCA 1UWIA 1BYBA 3TK7A 3MZNA 3KDNA 3W71A 2VTFA 4FIQA 2ABBA 2HVNA 2IW0A 1GOKA 1VFMA 3LV5A 2J7BA 4GO9A 4OFCA 4YVVA 3E2SA 4U3CA 4IIEA 1LQ2A 3AMLA 4FXFA 3GB6A 1YPXA 4I7WA 1PKMA 1W1TA 3DYOA 2YCLA 2X2YA 4NVTA 1YDVA 2O9PA 4HMCA 2B31A 2BY1A 2Z1KA 2XFYA 2JE8A 1XCWA 2BZNA 1Y65A 2CLEA 2QF7A 5KMYA 1SPQA 2CPUA 3VNJA 1L6WA 3W7QA 3PG8A 1E6SM 1VB9A 4BEUA 4LANA 2E25A 2POTA 3W7NA 1HKIA 5CPOA 3P84A 2WCAA 3SCNA 4J40A 5HMEA 3ITGA 2WVTA 3STPA 4JYEA 4U33A 1GG0A 1I6NA 3MUIA 4E3VA 3S5YA 5H91A 2X1RA 3SO7A 4GYPC 4WDWA 3EXSA 4RE3A 1UR1A 4FLQA 2VFEA 2B7OA 3MJMA 3FAWA 3W02A 4XG1A 3WLTA 3NURA 3EYPA 2E67A 2D2HA 3R89A 1QI3A 2NXHA 4XTDA 5KSWA 2UBPC 2YKKA 1NQKA 3MKKA 3UFYA 1XYFA 2GLKA 1BLIA 5A8PA 3QTGA 1MW0A 1VCGA 1QNQA 3WEZA 2V0TA 3NL2A 3U2CA 1THFD 1XWYA 2YFOA 3TQKA 3N29A 4YWSA 1VFUA 1F9CA 4HA0A 1XYZA 4GZ7A 2O56A 3VKKA 3H2EA 2OYMA 1B9ZA 5CBJA 1PX8A 3FK4A 1XDJA 3GXDA 2FQIA 1U1HA 4W85A 1ZL1A 5CZJA 2CZFA 3DH7A 1OSEA 1G94A 4AD2A 3TCSA 3BL3A 4ONVA 7XIMA 3RPTA 2ZX8A 4QGCA 3LHYA 2Z2BA 3OQEA 3SCPA 4UZUA 1LOSA 2DW6A 3U48A 2VEFA 3L4WA 1AZ1A 1GZGA 4P61A 1UMYA 2POZA 4HPNA 4BJHA 1UZ4A 1O6IA 4US5A 3GC4A 5CC5A 4O0KA 2G37A 2GQ9A 2XH2A 2I17A 4D6EA 2GGIA 1B3OA 2TAAA 1SO3A 2PDPA 4R5EA 3GH7A 5A6LA 3FSTA 1WOBA 3L2LA 1S5WA 2G50A 3HTWA 4RX0A 3ZR4A 3FHAA 3IJ9A 1WDSA 4W4QA 2G4JA 2WSYA 4N2YA 4LW7A 1FWWA 2LLEA 2QLYA 1R47A 3VKBA 3W28A 1VFLA 4D8LA 2X1IA 1BD0A 1UKTA 3E0IA 1TE6A 1OWQA 2DSVA 2OQHA 5I7GA 2Z2AA 4UTJA 4Q8QA 1DJYA 2V3GA 2YW4A 4O15A 1MDRA 5IHSA 3VCRA 1R8LA 4E4PA 1WUFA 3PJTA 3DG3A 3W81A 4JTTA 4UBPC 2P88A 3OIHA 1UWUA 1N8WA 3QFWA 2PP1A 2GVLA 3O6YX 1UWTA 1PX3A 4YPJA 2XVNA 4HPHA 2V69A 2DW7A 1OY0A 4Q4RA 3CEUA 3HIJA 1ZJBA 5MKGB 1CECA 5HULA 3P3BA 1EHAA 2ZUWA 1VAHA 3SW6A 5E93A 3HG3A 1W3IA 4PUEA 3MO4A 3OYZA 1Q7ZA 2IQTA 4DRSA 2I1OA 3MA8A 1HIZA 4MG4A 4JBRA 3WYZA 3UZ5A 2G3FA 4JCMA 1KB3A 2QMJA 5M3WA 3DFQA 1SR0A 4O54A 5EPDA 3TTQA 4UTHA 1E70M 3SY5A 4JEQA 2EG8A 3GRIA 1OYCA 2P0OA 4PL1A 4C7DA 3BJTA 3OQ8A 1WXZA 1K9TA 3PUEA 1EJUC 4NYYA 2E1DA 1SO5A 4J3UA 4BQ5A 2DQWA 1KM3A 1GONA 1H0GA 3WBXA 1KM5A 1S5TA 5DRIA 1W1IE 1TWZA 2HVOA 3INPA 3ATYA 3N14A 2PU1A 4TX9A 3RO8A 1QNVA 3CT7A 3BAXA 2VOMA 1KFBA 5EMLA 4A35A 4A3QA 4TIMA 3F5LA 4M0XA 3MO7A 3RILA 3KCOA 3BOXA 4PZVA 2PDJA 3IK4A 3DFHA 1V93A 4LC8A 1XDMA 3UPBA 3RO6A 1TWWA 5KEZA 2CITA 1O95A 3BCFA 3VNKA 4NILA 2YL6A 1VJSA 2PC4A 2ZDRA 3BGJA 4IX0A 2Z1XA 3ELFA 1DYSA 3URAA 4FSAA 3THDA 2PF8A 1V6UA 1GKQA 1PCWA 4QSFA 3VC5A 2BB0A 4HNCA 3EMZA 2RUSA 5C54A 2Y70A 1P0EA 4REQB 2BOGX 4RXFA 3MUAA 1CXHA 2QCHA 3W6MA 1OT1A 1XP3A 5G4EA 1GVYA 2C16A 7A3HA 1KXQA 2VUNA 5CGQA 1JIBA 1FKWA 4KEMA 4MNJA 4IFOA 1KV5A 1ITQA 4HJWA 4IXHA 4BWLC 1TZZA 3HPZA 4H8HA 2D0GA 5KZ6A 3K4DA 3H4XA 3C0LA 2DY3A 5DBTA 4EOUA 3ZSSA 5E0CA 1FHUA 1ISXA 3E0VA 4P7QA 3VK5A 2FZMA 2ZWZA 1F2JA 2VWSA 3NL6A 2DUAA 3PZQA 4EWJA 5H2ZA 1U5VA 2WHMA 3EA2A 1OFDA 1FBAA 4ATLA 3EXTA 4NRRA 1RPKA 5ABEA 3THUA 1T8QA 4MLJA 5T91A 1RP8A 3UP8A 5IHRA 1JUBA 2WOQA 1MUWA 2YB4A 2VDGA 4AYGA 4FP1A 5JUVA 1XC6A 4HMNA 4UOJA 4DBSA 3NEVA 3POHA 4JTLA 1KM0A 1JI1A 3IV3A 5HDRA 4DJED 8XIMA 3P60A 5KZEA 1VP5A 2OODA 1SMDA 4MIMA 2PGEA 3GWQA 3L7RA 4XIMA 3W6YA 5AC7A 2ZXQA 1HJUA 1WKFA 2KX9A 3OO2A 3CL6A 3G2GA 3BLOA 3WZ0E 1IXQA 3UT0A 3FIGA 3SJ3A 3GW3A 1VS1A 3GC5A 1CPUA 1A0EA 1J01A 1JDAA 4F3HA 1CW2A 1OABA 4YL2A 4IGNA 4QXIA 4GFSA 1MMFA 4ACZB 3EXRA 4C6QA 4JQ3A 3PJXA 2PDCA 1CX9A 1GOWA 1W37A 1YPIA 3MWAA 3UWQA 2YFNA 3E9AA 3QC3A 5H8PA 1PIFA 4LAUA 1BYDA 2QUUA 3H24A 2QULA 3URNA 4A4AA 3C86A 1DWJM 5E70A 1VJIA 4NZ1A 5F7UA 4L1XA 1UZDA 2Z4GA 4F9JA 4I9JA 3CWHA 3H12A 3O0KA 2XN2A 2V38A 4MNLA 2NVDA 2ZZ6A 3CHFA 2Z0IA 4A8LA 1EOKA 2YOCA 1XRFA 4R85A 4HMEA 4LVAA 5FEWA 2WVUA 1REQB 4OZOA 4M8UA 1XIJA 2DP3A 4H83A 2ODOA 1A49A 1OK4A 3U5YA 4BFAA 4LYRA 4C6PA 4LYQA 3OTRA 3I4EA 3SM0A 2WXDM 2GK1B 1QNSA 5D9MA 1XIEA 4PMZA 4BF5A 3N6JA 3ZJ6A 3DYMA 1FVPA 1V3LA 1DWHM 1ECEA 2WHJA 3BC9A 5DT5A 1I9CB 3A3HA 4AD0A 4KWOA 1N8FA 4AB4A 3GW0A 4PCSA 4AIEA 3M1ZA 1FY6A 3C4UA 5I09A 4JTKA 4QCEA 3A64A 1UUQA 4U4MA 2BVYA 3PBWA 4Q8UA 2XM1A 1QDSA 2VNCA 2ZADA 1C91A 4UQAA 3ABZA 3W82A 1P6BA 2XU2A 2BXZA 3VDGA 4TV5A 5JQ9A 1XPYA 3M0YA 1LOQA 3V0UA 3ZT7A 1WAWA 4UNIA 1F07A 1EXPA 3WJZA 3WD4A 6A3HA 2GL5A 4Y90A 3NQFA 2ZC8A 3EOEA 3PUDA 4POCA 1I1WA 3SIZA 5EL1A 1GGOA 3KL5A 2Y85A 5CBBA 4GUIA 1W1PA 4C1KA 3NIYA 4L61A 3VINA 4Q4PA 4BEQA 4NUWA 2P1FA 4IFRA 1ZB5A 3HQOA 5HXMA 5I23A 5LXXA 4MLRA 2F84A 1GKRA 2BASA 1MXDA 3USBA 3SRDA 4F66A 1BEUA 1K8ZA 3ZWSA 4IL0A 1GTEA 4GPNA 3LRMA 1DE6A 1NELA 1R46A 3GKFA 5DT7A 5BMWA 2JALA 3MVTA 3N1AA 1Q85A 4GGBA 1J8VA 3BJFA 4EPKA 2V5DA 3PK7A 3OVQA 3LHWA 1ZBVA 1XG4A 3RDKA 5CGMA 4GZEA 1TFVA 1T5AA 4LX4A 3QOMA 4K1GA 3FDGA 4C5ZA 2P8BA 3OVRA 2ALDA 2VWTA 4JFTA 3UXAA 3BLLA 1K70A 1DKWA 1NOUA 2VRKA 3ENLA 5BNKA 2ISWA 1LF1A 1PB0A 2E1WA 3LNPA 4B91A 3VDCA 4FMVA 3UZYA 1ZAHA 1K02A 3TZFA 5TAOA 1HL9A 4J5NA 1O94A 3UXIA 1RV8A 1EC8A 1PDZA 2G3NA 4NNBA 3HPAA 4BR1A 2VURA 3S1UA 4PMNA 1TO3A 2OYLA 3YPIA 3WDIA 3WLPA 4J28A 5FF0A 4NIRA 3U4FA 1JGMA 5GNZA 3NO1A 4IX2A 4JIIX 4LTSA 2NWRA 4H2HA 1JDFA 3I10A 1TKKA 4JIHA 3W2JA 4NNAA 3PB2A 1A5AA 3WKZA 5AHNA 1EDQA 1JFXA 2G41A 8CGTA 1XD1A 4HA3A 3M9YA 3W7HA 2INFA 3UD6A 5H8MA 4S23A 3CZ8A 3SN4A 1WNOA 1OZQA 4GQRA 5C9WA 4RZ5A 4UFMA 1B9BA 4JXCA 1JF6A 5F4XA 2CBVA 1Y5WA 2PTDA 1XBZA 3RAOA 3VC6A 3E96A 1QPRA 2C8NA 3G6LA 3FGCB 2AAAA 3N9KA 4D6GA 5KETA 3TFCA 3AIVA 5AFDA 2GFTA 1D3HA 1TZ9A 1XUUA 2B4GA 4M7SA 4LEQA 4JQ2A 4MKSA 1ITCA 2RFGA 3RGTA 1TV4A 1RJRA 4EK7A 4XBSA 2Z28A 5CC6A 1OFAA 3AJ7A 1SJCA 1J12A 1IEXA 1I60A 4L5ZA 2FB3A 2FLIA 1SYTA 4YN5A 1W5QA 2OGJA 4CQBA 3T44A 5JIPA 3FGCA 4JTUA 2D2JA 1KFEA 3GAYA 1FCUA 4IUOA 3VPLA 2YIHA 3E2QA 2JBMA 4OGZA 1OFBA 2HE8A 4MFDA 3ZVIA 2Q8LA 4FLRA 1UR3M 1NP2A 1C8QA 2E09A 3H53A 4WSHA 8A3HA 3MP3A 2BBFA 1OEPA 1O60A 1YKWA 1WBJA 2BXYA 1YADA 5DXXA 4LS2A 2DSZA 3QN3A 5HQEA 3GU1A 3MHGA 5DQPA 9CGTA 4KRZA 4XKMA 2A21A 4GI8A 1A47A 3RK8A 5HJYA 1PE1A 3CPGA 4AHOA 4LS1A 2QXWA 3T40A 2WQPA 4Z0JA 3DERA 3DZ1A 2FJKA 2OX4A 2GOUA 2ZRUA 1J0KA 1YMYA 1ZALA 1VR6A 5AYBA 1S2TA 1IWAA 3GDLA 3UVAA 3M5VA 1ZP4A 1S38A 1Q66A 1P48A 4OOZA 1J4EA 3OLDA 3GVGA 1JZ3A 1HO1A 3PJUA 2VX5A 2OLAA 1FP9A 1JZ2A 1MSSA 3RRXA 3GDRA 1H51A 3LN3A 4MFEA 5K4XA 1AD1A 3OZPA 1E6PA 2WC7A 1KFWA 1F6PA 3AICA 1POKA 3HGOA 3KAOA 2GQ8A 1VKFA 1TX0A 3BCJA 3W7GA 4BCEA 3AYSA 4O8AA 5AHLA 3W7KA 3L23A 3PB0A 4DLFA 3R11A 5BOFA 4DUWA 1DJZA 1US0A 4N9BA 4S3KA 1UR9A 1R3YA 3W2LA 3VUPA 1XR2A 3CLWA 1TV5A 5HQLA 5DFAA 2FKPA 1U5HA 5IXEA 4C6IA 3KLLA 1JVNA 4YVPA 3TWAA 2DUZA 3WELA 1E56A 4Y9AA 2PCEA 1QHZA 3QRHA 3GBEA 2CLLA 4H8NA 1CBGA 4L4LA 1RJPA 2V6AA 3CWNA 5EYWA 5A6TC 4YWIA 4RDVA 3WF3A 2I14A 3UCCA 3VA8A 3IRDA 5FEZA 1QI2A 3M47A 5HR6A 4H41A 2J4GA 3EX2A 3T55A 1H2JA 5I77A 2D23A 3GR4A 3LYEA 3M46A 1LLWA 2Z26A 2OZTA 1NFGA 1XL9A 2Q3RA 3LPOA 4UFIA 4TX8A 4XBKA 4GNJA 3GNRA 2YCJA 3AWNA 1EP3A 3OPSA 1KFLA 2VEPA 3TC3A 4IXXA 1P1MA 2JGQA 4HZMA 1K77A 2EG6A 3MHUA 1E3ZA 4J7RA 1O66A 4GUFA 1ZU8A 4GJ1A 1F76A 2WMGA 3BMVA 2XGZA 1SFTA 1VENA 4AWTA 3SUWA 3T8QA 3WX7A 3NTYA 1OM0A 4QJ3B 2QDHA 1VYPX 1QHPA 3APTA 3PJWA 1EC7A 3BXWA 4XD6A 3KOZA 2GDQA 2WVSA 3LTYA 2E77A 2ASHA 3AXXA 3DI0A 1HO4A 3WD2A 1GOOA 5J8LA 4QCFA 1V0KA 3WH9A 1LP6A 2JEQA 1CLXA 1VH7A 4K3ZA 1XLHA 2QIIA 1R3RA 3U0HA 1GUVA 1QU4A 1EXBA 5EBUA 1VRDA 2VD9A 4ILSA 4PMRA 4OBTA 1YW1A 3DI1A 4LAMA 4UTUA 4JKLA 4UXDA 1I0BA 4PBEA 1JCYA 4RW3A 1WDDA 3CUXA 4AD4A 5CEWA 2MNRA 4TUFA 1LLOA 1NWSA 4R7WA 3BTNA 1AW1A 3B3DA 4LT9A 2NT0A 4HCHA 4JOMA 3BE7A 2CCRA 4CVWA 3UA4A 3BCDA 4KS0A 3SECA 4TTGA 3HA1A 5LIKX 1I2OA 1UKSA 4DF2A 3EX3A 1E40A 4JICA 5FCZA 1FWEC 1NDWA 6CGTA 3UA3A 4DJFD 5A2BA 2OYKA 2CZVA 2DVUA 2PTZA 1EDTA 3PC0A 1WUEA 2E8YA 1EOMA 2BHUA 4D6HA 4QE5A 4JFVA 4PMDA 3WLMA 2ALRA 3P82A 4KBXA 1X97A 4U10A 2NLIA 3CIVA 4JTQA 3SJNA 3BG3A 1RZMA 5EY5A 1L6FA 2VFDA 3KW3A 4Q22A 2EPLX 1W3LA 2YDQA 2QCNA 4IZGA 2DORA 3P8JA 1XM3A 4PMXA 3RG6A 4HYWA 1CI1A 1XIDA 3ARVA 1VIZA 4KCTA 5F4WA 3GXNA 2EPMX 1UH2A 4AZBA 3VFLA 4BF9A 1IF2A 4TQTA 2J6XA 3GNOA 3PZUA 2HQAA 1WE5A 4B90A 2XWEA 4Z2GA 6TAAA 5F2MA 4OT7A 3SEPA 1JAKA 2ZVIA 1OG6A 2PB1A 3L4ZA 3AUJA 1DHKA 3K8MA 1HGYA 3VE9A 1XLIA 4RE4A 4M1BA 2QPSA 3HG5A 4DZ5A 3CZGA 1EJTC 2FHCA 3Q94A 3UQNA 3M0VA 2W66A 3WF2A 1LUCA 4KH2A 4MAVA 4A22A 2GZXA 4XQ6A 2XH4A 1ISWA 2YB1A 1IXOA 2Y5SA 4AH7A 4N9DA 3T4CA 7TAAA 3WJXA 3UYIA 4K8GA 5F2LA 5GNYA 1E1CB 2PDQA 3L5LA 4JQ4A 1E51A 4IJCA 1RQHA 5AKQA 2FZDA 2VJXA 3BDKA 1S2UA 1BKSA 2OT0A 2UY3A 2OOFA 2VL4A 2DPEA 3AIRA 1DEDA 4RV8A 2O92A 2IPJA 4P7RA 1XSIA 3WK3A 4MB5A 1PKYA 1ENUA 3VDHA 3I6RA 3FV9A 3WK0A 3W22A 1GORA 3CO8A 1D9EA 4H6EA 3T42A 1US3A 3IIVA 1SO6A 2OX1A 4LALA 3U7BA 3KOYA 3AC0A 3W73A 4HMDA 1JDEA 1W1B1 4MVAA 1W2PA 3DIPA 4MM1A 5MKGA 2R6OA 1XIMA 5BWAA 3OLGA 3F7JA 4D8ZA 4IGMA 2CU0A 2I56A 2PP0A 1M5WA 4AC7C 1TCMA 2YCKX 4K37A 1J79A 7REQA 1N2VA 4R9OA 1GWJA 4DF0A 1F4HA 2BODX 4UQEA 3BSGA 3QZ6A 3L2IA 1O1ZA 1DJQA 2FVMA 2J7GA 1RQBA 2FPVA 4W87A 3G1FA 1W5NA 1DXEA 2CBUA 1QI4A 3IANA 1O4UA 3W27A 4GH3A 1DJNA 5F1UA 1AJZA 4L9YA 2I16A 1VJZA 1U1JA 5CXPA 4WXZA 2VEKA 1C93A 3Q4DA 4H3DA 1J0YA 4FLSA 3BO9A 3XIMA 4CN1A 2VR4A 3GUWA 1HF6A 3VM7A 3A6OA 4K1WA 1QW7A 4GUJA 4WJXA 1YBQB 1AZ2A 2FMOA 3BMWA 4O1DA 3DHUA 2JQXA 3W86A 3P0WA 2X41A 1KR1A 3U7VA 3D3FA 4XBJA 4ERGA 2NVAA 3CGTA 2V68A 3WNNA 2FGZA 1IYXA 3GC2A 2ZZ5A 1KRBC 1GQIA 3VE7A 3TN6A 5A1AA 3LCHA 1Q65A 2I9EA 3N04A 4PE8A 2RAGA 4GIRA 3ES7A 3WUGA 4KKXA 2B7PA 1Q6GA 3NM3A 2PDNA 3OYXA 1OB0A 3PZOA 3CL8A 4XKYB 2OWXA 2ZC1A 5C9RA 1KXHA 4IPPA 1GYLA 1IZCA 1ALDA 4KMQA 5C9XA 2HNHA 3M43A 2VYOA 5C70A 3MT1A 3QY8A 3QHOA 4XB3A 3TQVA 2WVVB 4UTMA 1JCMP 1DQUA 3NDZA 5B7ZA 5KITA 3UJFA 2Z1BA 3O8AA 4LB4A 2FTYA 1V3JA 4KRUA 2CHRA 5LNUA 3AU6A 4E2BA 1EPVA 4O16A 2QMKA 3PPGA 2D2OA 1GVRA 1VEOA 1XIHA 2VGIA 1NP0A 2VO5A 2HXUA 4N42A 5HWJA 2OO0A 3PPFA 2ANUA 4GXPA 1DWFM 4AIUA 5I5RA 2PFHA 4NZ4A 3JU2A 3TN3A 3TSMA 3UWWA 4W5UA 1EUAA 5HA7A 2O7QA 2XVLA 2EF9A 5DCEA 2FB2A 1G69A 4GXWA 3QHMA 2IQ0A 1VFOA 4IWWA 1TTQA 1XLDA 1J6PA 4Q7BA 3VUSA 1EB3A 3VX0A 4WSKA 4F2UA 4DO7A 4JTRA 3NG3A 4Z2KA 3KHJA 1LT8A 4E8GA 3UGRA 1XISA 1B4KA 4WEVX 1Q2RA 2ZXDA 5ECVA 3WLOA 1GVOA 1KNWA 4H9VA 4PTNA 3WJYA 4RCXA 2Z7GA 3V7PA 1RBLA 1VLIA 2E7FA 4OKDA 3WK1A 2HMCA 2WW5A 3CQJA 3GXPA 2NV1A 1MW1A 4DBWA 4XK2A 5E6ZA 1WBHA 1X7IA 1EDGA 1KD0A 4NJGA 5A8GA 1OF6A 4UMAA 1ML1A 4JAWA 1L2UA 3W1RA 1QMLA 3OU8A 4PR4A 1KCKA 1UD5A 3DXIA 3DAQA 5K9CA 4E2VA 3E2VA 1EPXA 3H6OA 2NUWA 2DSKA 1IZKA 1LQ0A 3VGBA 4QAWA 4GKTA 2ZZ2A 2ADAA 4IMDA 1RD5A 3AIUA 1T41A 5T26A 2H9AA 4JPGA 1V3IA 2I57A 4MMWA 1MQPA 4IIDA 2RDTA 4NJKA 1EX5A 2A2IA 1IT0A 3LCLA 4XSLA 3KTXA 4B5NA 3G1DA 3LLDA 1B0IA 4Q8TA 5CG7A 1NOFA 1Q8JA 1ZUAX 1DOSA 4N9EA 1KBIA 1V3KA 1R30A 2EGZA 1V0NA 2C13A 4AYSA 1TG7A 3L0NA 4MHBA 3VYLA 3V5FA 2PTWA 4ORMA 2OU4A 4J3SA 2Z1VA 3A13A 3DBPA 4CU8A 4X60A 8XIAA 4DO5A 3T0CA 3KBWA 4PUNA 1E43A 4JFWA 3VFCA 3UJEA 3LY0A 2C19A 1G6CA 3UJRA 4O17A 3LU2A 4CNNA 5FJTA 2XIJA 3IJIA 4UCFA 3UWEA 3VGDA 3AS3A 2Z6IA 2VP8A 3PFRA 3KS5A 1X96A 4AFYA 2ACSA 3XINA 3PS7A 4ZBCA 3TSDA 3HG2A 1WDRA 3NWRA 4NL1A 5B7YA 4UFLA 1KGWA 4WKFA 3SADA 5DEZA 2P0IA 2DIKA 1W5PA 4GH1A 3QYSA 5GPRA 4S3JA 4ICCX 1KFKA 2J6VA 4E2OA 1PVNA 1RAKA 2NUYA 3NQCA 4O1EA 2OFJA 3FA3A 5CAKA 4URIA 1A3HA 2ON3A 1JRBA 2QZRA 3S2LA 1R9ZA 3QV6A 1TTJA 2E28A 3HMCA 4NAEA 4GWEA 5JBDA 3IUDA 3LZ5A 3W1TA 4NT0A 3CH0A 4JD4A 4EPDC 4KWUA 3UETA 1O5QA 3ANVA 3WCZA 2VKZG 4Q6XA 1X38A 1AD4A 2BLEA 2ZTJA 3N2XA 2GWGA 4WXYA 6XIAA 4GQ0A 2HK0A 3HURA 3WF0A 2J13A 2REQA 1LWIA 1EGZA 2QJJA 2OPJA 5EGRA 3G8RA 1UOZA 2DZUA 3M6DA 3N34A 5H6HA 3AFBA 4FOUA 2F6UA 5BYWA 1QPQA 1J0IA 3MUY1 3LQLA 2KAUC 3V1PA 4KGLA 1I45A 1VCFA 4KEZA 4C6EA 3ZVHA 5PTDA 4QS6A 1SFJA 3AMGA 1EBHA 3IK2A 3BV4A 3A47A 4O1AA 1TV7A 4ADUA 5AHMA 1QI0A 3S2JA 1UQYA 2ATMA 2AQVA 1W0MA 4OE7A 1LUCB 3ARTA 4C6JA 1O1HA 1JR1A 2WSKA 1SJAA 3LCWA 1A5BA 1K4GA 4GY7A 5CGTA 3IRSA 1OGSA 3H26A 1FWRA 1LOLA 5HUPA 4FO4A 4GC3A 3WLHA 2VVNA 3WG6A 1KLYA 4D6JA 4EXAA 5GJPA 5EBAA 5G1YA 4FA3A 3H4WA 1MEHA 3GYCA 3R8HA 4HOXA 4IMGA 2AMXA 4YS1A 4P5UA 2C0HA 4Q8VA 2D2GA 3B0VC 1FCQA 3BQ6A 3TMLA 1QUMA 3NM1A 3PWGA 2BTMA 2EBNA 1TPVA 1BF2A 3WLJA 1D7KA 2B0MA 3DC0A 3NZGA 4H9UA 1CWYA 2QW5A 4GG9A 3CIWA 2ZTKA 3SUTA 3GDMA 5HAOA 4BS0A 4PUKA 4NJHA 4AEOA 3E74A 1JCTA 3WF4A 2DV0A 1V3HA 3F5KA 1GVQA 3WF1A 3GY1A 2EKGA 1QO5A 4B3ZA 3QQ0A 2QEZA 3FW6A 2BV9A 1ECQA 1GHSA 4LYPA 1JCXA 1V3MA 1X39A 2GUYA 1ONRA 5GJMA 4JNYA 3IEBA 5E9XA 3TLQA 4H9XA 4HGXA 1K7FA 1EUNA 1H4PA 1KKRA 4Y8EA 5KZDA 3WLLA 2DZTA 2ZZ1A 3TMQA 2G5WA 3KE0A 2WWDA 2W61A 3EWDA 4LCRA 4PBFA 4U2YA 3GD6A 4K6AA 4LVFA 3TC7A 4J9JA 4FNPA 5K3VA 1AH3A 3CJPA 3PPCA 1XLAA 3TXVA 2Q8ZA 4MGGA 5IOBA 2XFRA 1P7TB 4EIVA 3SIMA 1EF2A 3O6DA 3RF9A 1Z48A 1UZHA 2ZZ3A 4N9CA 3QGVA 1YXYA 5A2CA 4JKMA 1QAPA 4OVXA 5LYRA 3GVVA 1E15A 3H2CA 2RDUA 4UTWC 3ITYA 1EP2A 3MP5A 1UPMB 4L4OA 4LSBA 4NP7A 1HJSA 3E1F1 4A2RA 3S6DA 1U33A 1DIDA 1OX4A 2PGWA 4X9YA 1XDLA 2F61A 2ZCGA 2DT0A 1IGWA 6REQA 4UCGA 1UWRA 3GG8A 1A80A 3LSCA 5LIXX 4V1YA 3KBSA 4A6GA 2C18A 4LEFA 2E40A 1E6QM 3SQMA 1JYXA 4JTJA 1Q2SA 3W23A 3H22A 4EP8C 5AOUA 3RPMA 4HNUA 2D69A 1KRCC 2ICSA 4MDPA 3CQHA 5CPLA 3TA9A 2NW0A 4RV3A 2QCGA 2V67A 2V5LA 3LCGA 4AF0B 3VMOA 3WN6A 4CQAA 1VRXA 2IPGA 5D2VA 4ZB5A 1S1RA 1CXEA 2SFPA 2CKRA 1Q13A 4PSPA 3LPPA 1TUFA 3O15A 4PN2A 1SU5A 4DYKA 1ICPA 2Y2WA 4PBGA 2OOGA 4PEEA 3EWUA 3UR7A 3C2RA 3NQAA 4MNKA 2PTXA 3CU2A 2CFFA 4AZHA 3W2UA 2GVJA 1IR1A 4OU1A 2CWXA 4FEZA 4AUBA 1W31A 5KINA 3EEGA 3W76A 1ELSA 3TYUA 1J96A 1KCLA 2J25A 4HK6A 1KV8A 1T96A 1J10A 4RE0A 1BWKA 1PWLA 1FDYA 1JPKA 1IT7A 1LRNA 1UD6A 1MFUA 1UJQA 2Q02A 3FN9A 3M0LA 1H7OA 1VFHA 1Q6OA 3ZR6A 1OQFA 3WL0A 1TWIA 1S5NA 4LCQA 5D4YA 4WCJA 4HP5A 5DMMA 3HPSA 3ARYA 2A7NA 4E5TA 3WO8A 1LG2A 5D8ZA 3FCPA 3NPUA 4HN4A 3WLQA 4LB3A 3N9SA 3M5ZA 2NVCA 3CZLA 4IL2A 4OBRA 2BXVA 3K8KA 2E9BA 3TTOA 3CEPA 1EJSC 1WZMA 3GU2A 4HQVA 4LGXA 3S9IA 4WY0B 3W25A 3W1UA 3OODA 2E3ZA 3CUJA 4G1KA 3H4GA 4MADA 3FY1A 4FPSA 4HU4A 2TYSA 1M04A 4FX7A 1JNDA 2RGMA 4L9ZA 4GXMA 2PLJA 3EWWA 1Q6QA 1TV2A 2YA0A 4LC6A 4DJDC 1JZ8A 3PTDA 4WD0A 4C6OA 1NY1A 3CQIA 3PR2A 1PTGA 4PRWA 3WLKX 3LZ3A 1FH7A 3L5AA 1QT1A 3LGEA 4JTIA 2I5IA 3ZZ1A 1KM1A 1NOWA 1M01A 3OHMB 1FX6A 1UZ1A 2F9RA 2P8CA 3H7VA 1H63A 4XAZA 4MKNA 3GH4A 2QGYA 1C7TA 1EGMA 3WDHA 3WBEA 3O63A 5E5CA 3QZEA 1AW2A 1OINA 1KBKA 1OZMA 3M0KA 2PWGA 2ZX7A 5D2TA 1EC9A 2FVKA 2ZKMX 1PX4A 1U22A 1J93A 4X61A 1DJGA 2XIOA 4CD8A 4C6LA 1GOXA 1CENA 3AAMA 3L2MA 4YCOA 2ACUA 3ONBA 4CEXC 1KBBA 4GQBA 2DJXA 4K8EA 1XICA 3E3HA 3A4WA 4HHLA 4J3VA 4CNUA 2NV9A 3KXQA 3ERPA 3GFXA 2DFAA 5E1QA 1PCKA 2CERA 2F7FA 3REQB 4QJ4B 2PRMA 3G3DA 2Y62A 4M24A 4GCXA 2Q6ZA 2QVNA 1K7XA 4AZGA 3DC8A 2VRJA 4PTMA 1PYFA 4MJ4A 3IGUA 1M7OA 2FYMA 1MW2A 3KZSA 5D2YA 1BGGA 1QR7A 2E0PA 3ZSTA 1V7AA 4HN8A 3DFSA 3UXLA 3GHTA 3S4TA 3L4YA 4G56A 3VIIA 3QBUA 4O28A 1GJUA 3R8RA 2Y1HA 4E0CA 1PZ0A 2O9TA 1VHNA 4ZTYA 2DZVA 3TR2A 3LNMA 1EJ7L 2TPSA 3QR3A 3LCFA 2FH8A 1UA3A 4H8VA 1M65A 4JTHA 4S2BA 4Y9PA 1P1XA 3HN3A 3WH5A 5EB8A 4QM1A 4D2JA 2O55A 5CLWA 3U2OA 3WNOA 5D03A 2E68A 1I8JA 2IKHA 4GY0A 3W00A 1F8MA 2X1TA 3ME3A 4ML4A 1SJBA 3DFNA 4R7JA 2XSXA 3VIMA 2JKEA 2ZZ4A 3HGRA 4GNVA 4NZFA 1JXJA 1NJJA 2I5QA 1UD4A 2VDHA 1UBPC 1B1YA 4LS0A 3LXCA 5A6KA 1OFRA 1P4CA 3NGFA 5HUOA 3HB9A 3P6LA 5FJPA 5M17A 1EKOA 2CZ5A 5MF5A 2YL9A 3A23A 1UIPA 2NV2A 4W7VA 1XLBA 3E0LA 2DT3A 4W7WA 1LL4A 3KWSA 1RPXA 1UD2A 1GNXA 3PWIA 3QSRA 1W1ZA 4TVUA 5K2ZA 1IT8A 4FF5A 3WJWA 2W6RA 3AU2A 3FA4A 3O07A 1B2YA 4Q8WA 1ODZA 4KWSA 1IEVA 1EFZA 2PC8A 3WEMA 4B5WA 1F6YA 4DJDD 5AC4A 3O2LA 2OEMA 3ZWTA 2CC0A 1C8VA 1RCQA 3R58A 3VNIA 1B5TA 1B3XA 5C55A 2PRLA 1F3EA 3VOJA 3CO4A 4DF1A 4GQGA 3W1QA 5IRPA 3SQSA 2W4XA 4QBXA 1PKNA 4QEEA 3F2CA 2QPUA 1F4AA 4JX4A 5I3GA 2ISFA 1R2RA 3OGSA 1S1PA 1UWQA 3S1XA 1XYCA 2V3EA 4YTQA 1TVPA 5HNRA 3UESA 2YXOA 4RNHA 5A8NA 3ZR5A 6ALDA 1JPIA 1XS2A 4XWUA 3SQLA 5CLTA 2PDWA 4FR1A 4JYFA 3NL5A 4IMEA 5HJXA 4JTSA 1HXJA 5K9DA 3TAOA 1Z44A 4KWVA 5I3DA 5BOEA 3WUFA 5C9ZA 2A6LA 2ATSA 2RJHA 4KERA 4HCLA 1O7AA 1GZJA 3AWOA 5D33A 1GVFA 2GQ3A 1CXKA 4ERAA 3KBNA 3W6LA 4ZFCA 4M80A 5CSYA 4Q6JA 4DUVA 2QCCA 2Z27A 2KZHA 5FJJA 5LGXA 4B5TA 3QOKA 4M51A 1QFEA 2XUCA 2O9OA 3TROA 2MANA 3TXZA 1PIIA 3FYOA 3ITOA 7TIMA 3C2OA 5BXSA 4WRHA 4LNYA 4D6DA 1B3YA 1ZY9A 1PWMA 2PDMA 4QROA 2QF8A 3EDEA 4NZCA 1HP4A 1A5LC 2A7PA 2DSUA 5CZKA 2XN0A 2WV8A 1T6MA 1K3UA 3ITLA 4NYUA 3LD5A 3CZKA 4MYXA 4CCDA 3P5YA 3FXGA 2INZA 3OB8A 1O5XA 4NU7A 1NQ6A 3PNZA 3MJYA 5CSSA 1P6CA 5M1TA 3WFLA 2GJNA 3CUHA 4Z2LA 4IQJA 3W87A 3DECA 4GQQA 3RHGA 2FGLA 2FH6A 3CASA 1XGDA 4AVFA 4CQDA 1QVBA 4S3AA 3B8TA 3N19B 2AQOA 1GG1A 5A6JA 2V2CA 2R9RA 1Q7MA 3SGGA 1R9YA 3VKDA 3NPVA 3URQA 5HK4A 2GUUA 4QLLA 3UPMA 4PUDA 1ZBWA 3AXIA 4LBRA 2CLOA 1JAEA 5I07A 4G7EA 3OZOA 1EWDA 4HOZA 2J7HA 4OECA 2W0UA 4N02A 4DZHA 1E0TA 4E3TA 5BWFA 1G9HA 1ZQ5A 3L67A 4WJEA 3PP7A 3T0TA 1VPXA 1R5YA 4TU1A 3K4AA 3LHVA 2UY4A 3N6QA 4GIYA 2VR2A 4G5DA 1A5SA 4MKVA 2WANA 3TTSA 1QJWA 1GT8A 1RK6A 2Y6ZA 4D72A 3S6TA 4H6QA 2BWGA 2QS8A 2X1UA 2WKGA 1HNYA 2UV8G 1XIIA 4OHQA 3CZEA 1A5NC 4DWDA 4EPBC 1FWGC 1F3XA 1V8EA 3EKZA 2OO6A 3O6AA 2WLYA 4S39A 4OWGA 2HDJA 3A5FA 3C0QA 3L12A 4DB7A 2R1KA 2D3NA 4I7UA 3IUIA 3IGSA 3W7MA 2AAMA 4OUEA 2ZX9A 1OIFA 4PYSA 1NWTA 4AF0A 3EB4A 1Z32X 1J0JA 2PDYA 2TMDA 4A8IA 1WQ5A 3WJSA 3F4DA 2PF0A 1OC5A 3OW1A 1K4HA 1LQAA 5D37A 3B0YA 4GVGA 4TVDA 2WPGA 3SCQA 2RDWA 3UG5A 3WMSA 3Q37A 1D2KA 4BWLA 4C1NB 4LBSA 4QFUA 1W1YA 3TYDA 1DQWA 1A3WA 1J11A 1EH9A 5HR7A 3K4WA 3WQ8A 2C1HA 3IJDA 3B0PA 3WLRA 3ARSA 4GLEA 4L6HA 3P67A 4C6KA 4DLMA 5A6MA 1FA2A 4M6UA 3F4NA 4J2MA 1B54A 2RJGA 2VZSA 4Z1DA 2A3LA 9RUBA 1QPKA 2GUBA 2W79A 5G2HA 3QV8A 3C3NA 1TR1A 1XQKA 3A9BA 1XC4A 3AS1A 4GUGA 5DXYA 1KBLA 4QRNA 3L0KA 3T81A 4TX6A 2FZBA 3SSZA 2DT1A 3TP4A 2CLPA 1C29A 4MZ8A 3QPYA 4DJEC 3VIGA 2XDFA 4IM4A 1TMQA 1FCVA 4HSHA 4PUUA 1BSIA 1KTNA 4YTTA 5HWMA 4BZYA 2J8GA 4FZIA 4AD5A 3RLVA 4KEUA 4WZHA 4JKKA 3ZJ7A 3B8SA 3RLGA 5C71A 3GBDA 5D9OA 4HTBA 3K30A 1XSKA 1H11A 1OG0A 2R1MA 2CBIA 3BARA 3PBYA 1R6WA 3KCLA 3TCEA 2WCSA 3TX9A 3HGJA 2QJGA 3G8EA 4C65A 2CZDA 4Z42C 3COTA 3ID7A 1FH8A 1BHGA 3N4FA 2CXGA 2VCCA 3QXBA 1PZ1A 2UZ9A 1G5AA 3GSMA 1XV8A 4CCEA 1R9XA 3DESA 4IPIA 1MNSA 3ITCA 1S3TC 3NJ3A 2F6KA 3AS2A 3QH2A 3DENA 3W53A 3PBUA 4B15A 5LA2A 1OFEA 3PUGA 4PB5A 5LKYA 1T7LA 1WKDA 3WQDA 4A21A 4LUTB 4YU1A 2XWDA 1CGUA 3I3EA 1J9YA 1UIOA 3VD3A 3EWBX 1RA0A 4YMZA 4PTXA 5I3HA 2RDXA 4PRRA 4KIEA 3A9IA 2DVXA 2CWNA 2QNEA 2ZX6A 4X2RA 3UG8A 1E3XA 5AC5A 1JUEA 1B31A 1KRAC 4DIAA 4IQLA 4KF1A 3UBPC 1FHLA 3T08A 3TE9A 3BPWA 1GW1A 4LCSA 2OT1A 4I6KA 2QCMA 2ZUSA 3ABXA 4KIRA 1HP5A 5A5WA 4EPEC 3OEXA 2J7FA 3EDKA 4AG0A 3LHTA 2YR1A 3JRKA 1Z8AA 3EAUA 4ES4A 4A3RA 3QKZA 1B3ZA 3WQFA 4DUXA 2HE5A 3CTLA 2CHOA 2PP3A 3BAIA 1X6NA 2ZE0A 2YZRA 1SZNA 3EWCA 5CKSA 3L4TA 2I7GA 3FAXA 2PDGA 1E6ZA 3NFUA 2HBXA 1FH9A 4B92A 4ZO7A 4H6KA 1KWKA 3SUVA 3EPNA 4BI6A 1C9DA 3C8FA 3S5SA 3HBLA 2QV4A 1QTWA 1TPH1 4Q8OA 2YZ5A 4H04A 3WQOA 1GOQA 3WNMA 3MP4A 3TTEA 3TN4A 5D04C 1WDWA 1YDYA 3IGXA 1PL9A 3HV9A 3KRSA 2V2DA 1HVQA 2ZUUA 4O14A 2CKSA 3P81A 3AYRA 3GTNA 3W7DA 3UNDA 4C6NA 4P8XA 1IEQA 3LB0A 4PMOA 3OGRA 4RKAA 1LCOA 1YBQA 4F4RA 1TREA 2QPXA 3KBMA 2H90A 5BXRA 2CYGA 2XVKA 4C6FA 2WAGA 4RZ4A 2HPMA 2O4QA 2ZRYA 5JU6A 2J9YA 1QHOA 1T99A 2FVLA 3MCMA 3CAQA 3CT2A 1WOAA 1KBJA 3CAVA 4FNRA 4ZZ9A 3NDOA 4L7ZA 1RVGA 3ZLFA 5CJNA 3CMGA 3IS4A 4QR6A 5GNXA 3AYTA 1E55A 2W63A 3IVUA 1S2WA 4F8XA 3WENA 2Z00A 4ZR8A 5TBOA 3GDTA 4MY1A 4DO6A 3LM3A 2OZ8A 1GKPA 4ML9A 3WBAA 4AZCB 1IWBA 3G1AA 2HK1A 4XD4A 2CLFA 5A8QA 2Y7GA 1SM9A 4XUYA 4BY3A 4LUSA 1LROA 1Z69A 2QUNA 3LLFA 1EA9C 1QXLA 3UR8A 1F05A 1VEPA 2AKMA 1ZFJA 2WZEA 1U2YA 3ZFHA 3PBMA 3LEPA 1Q63A 5CPQA 3EX4A 1GEHA 1FWAC 4DWSC 3R0UA 3WD3A 4UOZA 1H5YA 3WNPA 1ME8A 3ARRA 1W54A 3IV8A 3QFEA 1YYAA 2HISA 4H6RA 3E49A 3EX1A 4QS5A 1DP0A 4ZQPA 1UWSA 1B30A 2QR6A 4JHOA 1AQ0A 5FL1A 1RHCA 2FDMA 3TFXA 2NQ9A 2BVTA 3QHNA 4DHGA 3ARWA 4IIBA 2DGAA 2QJHA 1KRMA 2NX1A 1ZAJA 3LHUA 2EHHA 2V81A 4AHQA 1KLZA 4B3LA 4UR8A 4O11A 5TD4A 1Q4NX 1VHCA 3GXFA 1A5MC 5JBFA 1TPWA 3MU7A 5AYIA 3L68A 4O1FA 5BRQA 2CW6A 3CLMA 2PLMA 4AMAA 2PWHA 3EMCA 2NLYA 1SR9A 4JS3A 4I3GA 4GK8A 3DOPA 1EIBA 3EOUA 2OQLA 3CL7A 2EKCA 4I90A 4AX6A 3NXLA 4OV9A 3DU0A 1XLCA 1W8SA 3VX1A 1E0UA 3UXKA 4RK8A 1UASA 6ENLA 3BSHA 1RH9A 2UWFA 4XAYA 1D3CA 3T9PA 2G96A 2AMGA 2IKIA 3WQPA 3O05A 1UKPA 1EJXC 3EOLA 3KRZA 5J5DA 1AQMA 3UERA 1OD8A 3W7LA 5I06A 4OOUA 1AG1O 3BLDA 1C7SA 5G4WA 1R3TA 1EA0A 2X1SA 2WNWA 4HNOA 2VRQA 1TWDA 1TMHA 3W24A 1CGWA 3R43A 2XSAA 3E0WA 1V0LA 3N11A 3GH5A 3UWYA 4LPCA 2XVPA 2A85A 1OX5A 4R27A 1EJWC 4LAZA 3NZQA 4KCVA 1KA9F 3QQ1A 5CSUA 2ZZ7A 2NSXA 2VM8A 1R86A 5G2IA 4P7LA 1FDZA 2QJNA 4QISA 4N4QA 2X2GA 3NPWA 3KVMA 4WHBA 2PDBA 4GABA 2HNEA 3DFPA 3BOFA 2WZMA 1OFQA 2VC9A 3VIOA 2X0SA 2V63A 1BG9A 4IP7A 3Q67A 1XLEA 2OSWA 1XCXA 2OEKA 1K6WA 4PSRA 3W3OA 4MB4A 2PWDA 4KCWA 4B5UA 2D73A 4LUJA 3G1YA 4LJ3A 4ZQNA 3B97A 4DNHA 4DELA 1R3WA 2X42A 3A4AA 3JS3A 4KFOA 1A5CA 1PHWA 2JIEA 2J47A 2QUTA 1H5VA 4PUJA 2BHZA 5AY7A 5J04A 1SW3A 3QKEA 1XGZA 1H1NA 4Z1BA 4I9MA 2IXUA 3ANUA 4J3XA 2OLHA 3NPXA 3S0CA 3N2TA 4OUIA 1FFRA 1GCYA 3CPRA 3QW4B 2XGBA 4Q3MA 3DUGA 3BG5A 3H55A 3RMJA 1TPB1 2ZUNA 2G95A 3MB9A 4NJIA 3SCRA 4C7GA 3U57A 4BF7A 3FEQA 3F4VA 3ZMRA 2TODA 3ABQA 2WM0A 4V33A 4C6BA 4CGTA 5D30A 3MI6A 4YYFA 4GINA 1RK5A 4RNJA 1FWJC 4PFMA 3GS6A 3GNDA 4RDYA 1PYMA 3WMLA 4E2DA 4JX5A 5DMYA 2ZFAA 1X1OA 3U3HA 2HPIA 3H7RA 4I5UA 3CAWA 4DAIA 1XH0A 2VOTA 2PD9A 1KO0A 1R3SA 1H49A 4HNLA 1US2A 5DBUA 4IH3A 3EPOA 2WCGA 4JTAA 2XN1A 3B8VA 4G2DA 4EANA 4MB1A 3E02A 4F9DA 1IXNA 2G97A 4DUOA 3W37A 3W7EA 5LIUX 3SB0A 3WQWA 4MNMA 2DU2A 2Y7EA 4AEEA 1YEYA 3M5XA 4L6OA 4XZWA 2AOSA 1XH2A 3OG3A 3VD5A 3ZLHA 2P53A 1F3WA 3MBFA 1JQVA 1Q6CA 1ADSA 1TB3A 3M6YA 3S2NA 2HJPA 3ABSA 2OMAA 1PJ9A 4AHPA 2PDFA 1TYGA 1KQYA 2DT2A 2ESCA 2XG9A 1V5XA 2Y8UA 5DCDA 2GDUA 4JIRA 1WZKA 3WY1A 1E4LA 2XINA 3R6IA 4ECLA 4XZHA 3KHDA 1GQLA 3D0CA 2X7VA 3KWXA 3P5ZA 4MYAA 1W8GA 3LERA 3ZJKA 3M0JA 3VOGA 4PODA 2PUZA 2DIEA 2PE4A 2YJQA 5I78A 2ZDSA 3W83A 3B8DA 5I3IA 1HGWA 4MWAA 4O52A 4PMUA 4Z1AA 1MZHA 1TUXA 4S3DA 3LPFA 4A29A 3N73A 4M29A 1WZLA 5GVJA 5I00A 4ZEPA 4IT1A 4XKYA 3EB3A 4XZNX 2JGYA 4IOTA 4PCTA 3PY2A 1IGSA 2BDQA 2YPIA 3N3MA 4M19A 5D2WA 1E72M 3N9RA 4M56A 1XIFA 2J27A 1RY8A 4BQ4A 3VD9A 4DXKA 2W67A 4I6VA 3T6CA 3RLHA 1PKLA 1W17A 3GKAA 3ARXA 1MFVA 5LGZA 4WLCA 1W2VA 2XISA 3QPEA 4FXJA 1I2QA 4ZENA 2EQDA 1TPFA 2J7CA 4MWAB 1P7TA 5FEPA 1GTHA 4IPLA 4DXXA 1FQ0A 4QG6A 2ZA2A 2YBTA 5A2AA 2RHGA 4N0RA 4L6DA 4HSOA 5FJIA 1YTDA 4DBDA 4JIQA 3H8AA 3BGGA 4GBDA 1WX0A 4XTIA 1W5MA 1WO2A 1XD0A 1JCNA 4QSHA 1TX2A 1YPFA 4RPPA 4QG9A 1BYCA 3BZGA 1VF8A 3NSMA 4LOCA 5DRCA 1K8XA 1POJA 1QRQA 4QLJA 2J7DA 3JUGA 3K8LA 4EVZA 4HHHA 2E6AA 2OLSA 4HZ7A 2EO7A 2UY5A 3M7SA 4QDWA 4LRTA 3MKVA 1P0DA 1NARA 2C91A 4F48A 3EWXA 3QPZA 3IJ7A 3OIXA 2GGJA 2VELA 3DG6A 3NQ6A 3QMRA 1UUOA 5A3HA 5JH1A 4FI4A 4LV4A 3G3MA 1XRSA 2QCLA 1ZENA 2WSRA 4HBKA 4LUSB 3LI1A 1KTBA 1HKKA 3OBEA 5DELA 3HOJA 2BG5A 3QJAA 3VD7A 5REQB 2ZICA 1JI2A 2F2HA 1P0NA 5C5YA 4HTYA 4GI9A 1YDNA 1I2RA 2O4MA 3O6CA 2V5JA 3GHRA 4XZMX 1SSGA 5E6YA 3DDMA 1YLVA 1G7VA 5LNRA 3LDVA 4YLWA 2R8WA 1WXJA 1QK2A 2NWSA 4WX2A 3EKGA 5I3FA 4ZFMA 1JQXA 2W27A 3ZT6A 3HZ3A 3MHFA 4QE4A 3AZTA 3H2OA 4RDWA 2ZQ0A 3B8UA 4G1NA 4XD5A 2ZRXA 2XYLA 1I2PA 2XH7A 3DGRA 4H7VA 3APGA 4Y6GA 1S3HA 3RITA 3NNTA 1TVLA 2GVEA 1G01A 2BHYA 4NF7A 1W1VA 2Z25A 4P8WA 2P10A 3TV8A 4RZ6A 3CHCA 4ZXOA 2GK1A 5TNVA 3WDQA 3E38A 5A8MA 1H50A 1PIGA 2BY0A 2IPFA 4AZ5A 3K1DA 4K2SA 3GXIA 4O1CA 5FEXA 4CD7A 5AECA 1OFPA 3H7UA 3WQ4A 4FIRA 4U31A 7PTDA 3BJSA 4CNOA 4PCFA 1SO4A 3D47A 4RNIA 2D24A 2H8XA 3T2OA 3BG9A 3ZOAA 2GJRA 1E9ZB 3VNDA 2DZWA 2PAJA 4IG2A 3W29A 5EMKA 1G1YA 2BVDA 2HCVA 3EOOA 4S2CA 3LENA 1JPDX 1WP6A 3BVJA 4DEFA 1TTPA 5D09A 5FSDC 1V6VA 3MCOA 3NQGA 4WJ8A 3DHPA 3QY7A 4N6EA 1UKQA 4FNTA 2OTDA 4Y96A 1BGAA 4J3WA 3AYVA 2HXTA 4UTTC 2W5FA 3VOHA 4PC8A 5FESA 2VD8A 3UXDA 4PMYA 4GE8A 4Z2IA 3DKLA 3MUZ1 1EJRC 4UR7A 1CIUA 2DIJA 2XIBA 4EXQA 3MSYA 1RJQA 2ISVA 3W85A 4FXRA 4JNZA 1TJ0A 1M7JA 4Q33A 4PUMA 5BU9A 1Y5VA 1HW6A 3B9DA 1BXCA 2VZOA 1T40A 2IS7A 5BZAA 3QF0A 3T2QA 4O18A 3W2MA 1AA1B 1M1BA 3DEQA 3GIYA 3P2VA 3W75A 3ZS4A 4DPQA 3STEA 1XLMA 3G1XA 4JIEA 1IV8A 2NX9A 3JVAA 4HYVA 2ZE3A 4M6QA 2HRWA 1CDGA 1I4NA 3BW3A 4EACA 2WMHA 4UB9A 4MB3A 3VCNA 1K9FA 3LS9A 4TOQA 4Q8PA 2CETA 3GQYA 3N2MA 3B40A 4ZL1A 2OCZA 2A3HA 4EF8A 3S6OA 1XJBA 3F2BA 3WDRA 4ZXLA 1C90A 1U5JA 3REQA 8RUCA 3FYYA 3WQVA 4LY8A 4ERIA 3GR7A 4GVHA 5FD0A 1WPCA 3LA4A 1UH3A 1L0PA 3V18A 3FJLA 1AL7A 1BYAA 4MJZA 2IKJA 4JTDA 4MAZA 3RU8X 3W72A 4C1LA 4UUIA 1XBVA 3PVFA 2WHLA 4LF1A 1FP8A 3KL0A 4ZODA 4KRTA 4S3GA 3EDFA 4P7OA 1ME9A 2QDGA 5IDIA 2ZRVA 2GSEA 2WMJA 4RJEA 3WD0A 1UOKA 3QGKC 4JQ1A 1CGVA 1ISZA 3VU2A 4O0ZA 1CLKA 1IHIA 1TV8A 4NJJA 4V1XA 1EL3A 1L2QA 3ABOA 3ARUA 3MDUA 1SJDA 4UTIA 4Q4QA 4Y7EA 2PWUA 1EQPA 3KVLA 4AZIA 1PPIA 3KL3A 1RLCL 3WEOA 1GOIA 2CESA 1UMLA 1VFSA 3FJ4A 2V2HA 1G4PA 3MWCA 3V75A 4J3TA 4AY8A 1EX1A 5ECUA 3W1MA 4O19A 2YGYA 4PB3A 4PULA 3T0DA 2EEXA 3THAA 2VX6A 2E5DA 4ZOAA 1IZJA 1ZJHA 3IVSA 1XRTA 3U2ZA 3W1LA 5CC3A 4DM1A 4IPJA 4CNTA 2F8QA 2VC7A 3DCPA 3WLNA 3AUOA 1XXXA 4F0SA 1XSJA 3N4EA 3KP0A 5KTLA 1V08A 3A22A 1K7EA 1QW8A 3ZIZA 5MHBA 1Q6LA 3EDJA 4JQAA 2GQAA 1VBGA 2VXNA 4C5YA 2YDAA 3GXTA 3NOYA 2VC6A 4ADTA 3RUBL 3WSUA 3EOSA 4UNKA 2YDRA 4CU7A 4AXKA 2JKPA 2PWFA 1E5NA 1CXIA 2PZNA 1VBUA 4JY8A 2PWVA 4GCAA 4XZBA 2YDSA 4QNEA 3CBWA 3EA1A 3K13A 1KR0A 4UQCA 2R82A 4Q4OA 1LM1A 2IMRA 4G8TA 4IMCA 1VBJA 3FXYA 1XYBA 4FF7A 4NY2A 3PFMA 3BK0A 3G0UA 4W86A 1MQQA 1O5RA 3PZNA 2WQDA 5FOOA 3KM8A 1EF3A 4AD1A 3CC1A 3LM7A 3M0ZA 1KM6A 4J2PA 4LXFA 2Y7DA 1DJHA 3TJXA 5E09A 3VIFA 3ARQA 5AZ0A 4AVNA 1V77A 1SQ7A 4AISA 2XVGA 3G1VA 2EJAA 5A95A 1AQFA 1UROA 3LI0A 4PB4A 1QBAA 3GNNA 5HNTA 1UA7A 1EBGA 1WAUA 1IXPA 2YLLA 4TO8A 2IXVA 6REQB 4DJEA 3R10A 3TR9A 4Z08A 2WWCA 5G1MA 4JEJA 4DJFC 1QWKA 3W1NA 1A3XA 5LHEA 2YYUA 1JCJA 1E0VA 3B9AA 3MW7A 3PPHA 4MY8A 1FFQA 2Y8VA 5CH9A 4B5SA 1AODA 1JYVA 3NSXA 1Z9AA 1Q6FA 3WQCA 2QYGA 4L65A 2RGLA 1GQJA 3GO2A 3WNKA 3LXBA 2ZRZA 3VCCA 3CQ0A 1TMLA 2D3LA 2PA6A 3LG3A 3I3BA 3RX2A 3PZVA 2GGHA 4TR9A 1BF6A 4PH6A 2GOKA 4UIOA 3AXMA 4D9PA 1RQEA 1WV2A 2XH0A 4D71A 3DGBA 1X8CA 3OHIA 3URBA 4JFSA 2AL1A 3CTTA 3VKAA 1L6GA 3HU7A 3W70A 3AROA 5EMMA 4DI8A 1GK8A 1CB2A 2QAFA 1ZGDA 3GDKA 3NAVA 2A1YA 3LBCA 5IDZA 1L8PA 4GJJA 4ORIA 4XV0A 5FKYA 5ABFB 5A94A 5HOSA 5RUBA 2O0TA 1SW7A 4NX0A 3GTIA 1W5OA 3STCA 3B04A 3TLLA 2ZUVA 3UCQA 1ZZMA 5AN7A 3MMDA 4YNGA 1FTXA 3JZEA 4HPXA 5L6UA 1S5MA 2DH3A 3N6HA 3OZMA 4R3UA 1OCBA 2XFWA 3CHVA 5I03A 5A8OA 4GC4A 2ONEA 3M5YA 1DV7A 1C3FA 4J4KA 2OEJA 1LBMA 4L64A 1XIBA 1TE1A 2PMQA 1MUMA 4WIWA 1AW5A 1AK5A 3ZQ9A 1MW3A 1MZRA 2H3DA 2WSPA 3TYBA 4OJYA 1KTCA 3MTWA 1MYRA 2EPKX 1HKWA 2JF6A 3SGZA 4WQ6A 3PM6A 3W1XA 1VYSX 1X6UA 3KUMA 4HSNA 1Q3NA 3RN6A 2FFIA 5BOOA 4CD6A 3B9OA 4W84A 4KFPA 3PZIA 3TKFA 4ZE5A 3VIPA 3LXAA 1V6WA 3LTPA 4YYCA 3LOTA 3LBMA 2Z29A 4C7FA 3CMJA 1GVEA 3DHDA 4DZIA 4DYJA 1T0OA 4JZ5A 2XZ7A 4F2BA 4NKCA 1BRLB 3S2CA 2WO5A 4JHZA 2R1PA 3OA5A 3N3TA 4IF2A 1M7PA 5FI8A 4HNVA 3TYAA 2DZSA 1PBGA 1FWDC 5FL0A 4KETA 2WNZA 3RM9A 4CEUC 1RR2A 3CAKA 3FLUA 4JL1A 1OC6A 3KTSA 1N7KA 4J3ZA 3VNYA 1GYMA 1JGIA 1PO9A 2FZNA 2WB5A 5JIWA 4FNUA 2WC4A 4IJBA 3ITXA 3BAJA 4TV6A 3GU9A 2YCLB 1SW0A 1D8CA 1JZ5A 1M53A 3APYA 1Z6KA 4FS9A 4XAFA 4H8UA 1FWHC 4GNKB 1A5OC 3KCJA 1UD3A 4NG3A 4C90A 3S47A 3QYQA 2DZAA 3FKRA 1LJYA 1HJWA 3VDBA 1NIUA 4GYJA 4GI6A 4K7VA 3W7RA 5KZMA 3NZPA 1SZFA 4H1ZA 1B57A 5BU6A 4FLOA 2X0HA 4QAIA 3LCXA 3FOKA 4JIPA 3OGVA 5JH2A 4R7OA 3U4AA 3P0XA 3QLDA 3CYJA 3LQGA 3TJ4A 5M5DA 2A0NA 3TW9A 2X40A 4J27A 2E6DA 1XLLA 1Q6EA 1CXLA 2PS2A 4ICMA 2QVHA 4UFKA 2BOEX 2PGFA 3KLKA 3S1WA 4US5D 2VFGA 1SMAA 1YTEA 3W2KA 4JDBA 4HPGA 3GIQA 2J77A 2QDDA 2P50A 4RW5A 2DZXA 3RNDA 1LDCA 1IE7C 2A79A 1VBRA 1GYNA 1NAL1 1TJRA 3NZ1A 4IMAA 4AU0A 4QTGA 3TDFA 3WQEA 5A6BA 3SCWA 2CLIA 4DXVA 4G9PA 4ATWA 1KXVA 1F74A 1LBFA 4M6VA 2ABAA 3S83A 3LCIA 4O50A 1M3UA 5BROA 1C8XA 4EX4A 3AHTA 4YCPA 5IFPA 4OQVA 1G4EA 3ONCA 1QNRA 3GNXA 4E4UA 3ZJ8A 3CB3A 4Z0SA 1XBYA 3GVQA 5CG0A 4J1OA 1YNPA 3TEVA 3T8LA 3K1GA 3T0BA 4IQEA 1XYAA 3MMTA 2WZTA 1K9EA 1LWJA 3AMKA 4AWUA 3IGHX 2Y89A 4DNMA 2DJLA 1PV8A 4GVIA 4QQ3A 3II1A 2E9MA 3N2CA 3WMBA 4GGHA 1VPQA 3FVMA 3IVTA 3BMXA 1GJPA 3QV7A 3AS0A 1W9XA 2E5CA 3AMDA 3PWAA 3TOPA 3BGAA 2HSAA 3RCNA 2BFGA 2VFFA 2FFCA 2IKGA 4EXBA 4EAYA 4HK7A 3TC6A 2WJDA 3RRAA 1UB3A 2AL2B 1O5KA 2J9XA 1EIXA 4GBUA 4MWAD 1NDVA 5L9FA 2J88A 1IR2A 3MUXA 1MNZA 1XQLA 4JCLA 4D6CA 2PPGA 4ZB0A 1U30A 1FXPA 3W0KA 2BGQA 3LK6A 5FJOA 1P0KA 3CMFA 4GO8A 1TPEA 4X2PA 3L4UA 4QHRA 1PXGA 4JN7A 2BSLA 2J8FA 1QBBA 3QVQA 4Y9OA 1E4NA 4Q4KA 5LZLA 4H9MA 3ORWA 4L9XA 3LMYA 4E38A 3DHFA 4ZGYA 4YTRA 3R0KA 5LA1A 2Y24A 1XKYA 2ZA1A 3T0AA 2UY2A 3DX5A 3CZJA 2VEMA 3DFOA 5LNVA 4Q32A 3P62A 3T09A 1PTDA 1VCVA 2ZYFA 4FAMA 3M64A 4A3YA 2WHKA 1MEIA 4EWND 2BNJA 3DFYA 4AXNA 3MSDA 1OCNA 2W91A 1TSIA 4LAKA 4E4FA 1OCJA 5AVHA 3HPXA 4NXKA 3S1GA 3HO8A 1HQTA 3GFYA 1E9IA 2V82A 4WDTA 3T4WA 3UW6A 3C2YA 5JVLA 2R91A 4DQWA 1UQZA 4NHVA 3RIKA 3VTRA 4IGHA 5C2GA 3V35A 4Z2HA 1VZWA 1A50A 3MZ2A 1DXIA 2NXGA 1DJIA 4ZO6A 3S3GA 3C8NA 4FOJA 1DWAM 5FF3A 5I02A 3FX4A 4F0HA 1TA3B 3G77A 4S1FA 4TTUA 3TN5A 1A5KC 1LTDA 5CSRA 3KEHA 1QOPA 3STGA 4REQA 3N4AA 4O1BA 4ZMGA 1EEXA 2BY2A 2PDLA 3IJQA 2Y0FA 4DWSD 4HU8A 1LLZA 1BFNA 1RD6A 1TPUA 1HVXA 2VCAA 4JFUA 2O7SA 5EMUA 3M7WA 3QC0A 4BI5A 1J2WA 3H54A 4LWWA 1DXFA 1YTKA 2YBUA 1S39A 5DCBA 1H62A 2YCEA 4NX5A 3Q65A 4CN4A 4IJRA 2XJ7A 1DTNA 3SBFA 1OK6A 1K8CA 5FJUA 4IQDA 1BKHA 4GYFA 4ATDA 3AXKA 4GJIA 3VAVA 1JZ4A 4XO7A 1CTNA 1E4MM 5M03A 2NXIA 5F2IA 5EFFA 9XIAA 2X16A 1K9DA 3WQGA 1J5SA 3VGFA 5CJMA 3NVDA 6XIMA 1G4SA 3AIEA 1OBAA 5HATA 2GVGA 3IWPA 1RY0A 1QWGA 3W38A 1OD0A 3WQ6A 4A8RA 1XH1A 3TTYA 1UJPA 1TJ2A 2R94A 1R3VA 2WSQA 1E6XM 1XCFA 4AW7A 3TZNA 3GAKA 3B4YA 3C2EA 4UFHA 4LQ1A 5G2WA 4DN1A 1NTHA 4YIWA 4Z17A 2FMNA 2L5HA 3BW2A 1AQHA 1Y7VA 2PU0A 4B3KA 3C52A 1K1DA 4JR5A 1RP9A 1L6YA 1E6RA 2J79A 2ZXAA 5E9AA 4QIUA 1YXCA 4GZIA 3R8GA 4DWSA 4YJ5A 1K03A 5HPCA 3CB8A 3NZRA 4MJMA 1MWOA 3ZM8A 1I0DA 1E73M 5CPTA 4GX8A 3J7HA 3BLFA 3MI3A 3TA6A 1ZHAA 4ACZA 1L8NA 4XAGA 1J2BA 1E1CA 2HS8A 3GNPA 4GI4A 1C92A 3HQ1A 3GVWA 4JNMA 1LG1A 4ALDA 4KT2A 1B3WA 2HS6A 2DEPA 4AIOA 2WBGA 1FXQA 4ZQOA 2WMIA 4NZ5A 1BSLA 3SCUA 3UU0A 2XGIA 3WBWA 5C2XA 4RDZA 3L9CA 5F1VA 1OC7A 3W74A 2FIQA 5BMXA 3MANA 1FWSA 1J0HA 1BAGA 4ZTXA 3VDAA 1XKJA 2D0HA 4IIHA 3BLKA 4UMBA 1KQZA 3TSBA 4CUCA 1Y0EA 3LRLA 4I5XA 2WNQA 3E5PA 4DJFA 2H3BA 1T8XA 3F5JA 1KM4A 1CZ1A 2XIQA 3O7UA 4L1GA 3FDKA 7REQB 1QO2A 1DIKA 1B90A 1ZNNA 1S46A 1QK0A 5I2UA 3T05A 2WJZA 3RLUA 1DJXA 2OKTA 4QDPA 4Q8NA 1U1UA 2B7QA 3M0HA 3P74A 3RFAA 5HNUA 3EBVA 4LNCA 3KOFA 5DANA 1ZBCA 4G7FA 3G1HA 3ZLGA 4LVBA 3WBYA 4XZ9A 5AHEA 1QCWA 2WMIB 3LMZA 2FTPA 1FCBA 1LYXA 1AL8A 1Q5MA 1XUZA 2YL5A 3BSMA 1ZCOA 4LBUA 2Y8KA 1ZP3A 4XSMA 3FA5A 5BW6A 3M16A 1MRQA 5T8GA 1PDYA 5DY2A 2WZIA 2QCFA 5FAJA 2AGTA 5D02A 5EA9A 1TRDA 1TR9A 3MBDA 1NDYA 4JYDA 1NFPA 3VZZA 1B4EA 3UNTA 2IQDA 5I24A 3EWYA 4JTFA 3S2MA 2A4AA 4QLKA 3A3XA 1FRBA 5AB3A 5D9PA 4WUIA 1OT2A 4TXEA 3LGGA 3D6NA 5FAGA 2ISSA 3GLCA 1E0WA 3IIPA 4MSSA 2YLAA 3T07A 3SCSA 1BRLA 4BK9A 3GG7A 3S9YA 1D8WA 4ZB2A 4LUIA 4Q4SA 3BW4A 5AC6A 3UJ2A 1GVIA 3KZPA 5T9BG 1FWTA 4W5ZA 2HBVA 2HTMA 4GKLA 1XG3A 2JF7A 1KWGA 1FWNA 2C0AA 1ITUA 4NQ1A 3VZYA 3CYVA 5HWNA 4LY4A 4H4IA 4HVXA 2VR5A 3EWZA 3R5EA 2E8ZA 5DMLA 4O10A 2X7WA 4HB7A 1SVDA 4S38A 2Q09A 4CCZA 2QGHA 3R0DA 1A0CA 3M0XA 3T2PA 4KW2A 1WA3A 1V03A 4CNPA 3BANA 3FEMA 4IISA 3PBVA 2JKAA 3CV7A 2CZEA 3NQVA 1UP3A 2CNCA 3PAOA 2FZ9A 3H2AA 1EQCA 5AZ1A 3C6CA 1R7AA 1U83A 5D9NA 1NU5A 4MY9A 4US6A 2QCDB 2YL8A 2PGRA 1JYNA 4HD5A 1W3JA 2JEPA 3D3AA 1JNEA 1QASA 4R33A 4FHAA 3E2RA 3HQNA 3MQTA 1BXBA 2V5KA 2G4FA 4NAFA 3F4WA 1CCWB 2XFFA 3PNUA 4KPLA 2FZ8A 4JN8A 4FALA 1NDZA 4YTSA 1C9WA 3I4KA 3FS2A 3VNMA 5HMFA 1PTAA 2OSXA 3BH4A 2FHBA 2AGKA 3SRFA 5CZ0A 3U5UA 1JUKA 3PHAA 4AQLA 3EZ4A 1TV3A 3HJEA 1YE4A 1M6JA 3BLIA 3W7PA 2BX7A 1FOBA 3WDPP 2QJIA 1R38A 1UHVA 1NWRA 4MUZA 1NSJA 2CLKA 1YXDA 2NT1A 3R12A 1W9UA 3ARPA 3IIZA 1ONEA 1GOMA 1OADA 4IPNB 4CD5A 5A69A 3S5OA 1YRRA 2X05A 4UTTA 3GX9A 1BVNP 1SUXA 4K8HA 4HIBA 3VIKA 1KM2A 3KP1A 5IBXC 5LXEA 4W89A 3W26A 5FIPA 1MXGA 3FSUA 3FNDA 1A4MA 3DYPA 5DN1A 4FK9A 3F1QA 1ZPTA 1WB0A 3R79A 4WKAA 2V30A 2E6FA 3NQEA 5LHFA 4Z1CA 1UUMA 4CQ9A 3SZ8A 5DMNA 5TF0A 4X0VA 5C8BB 4Y9NA 1FWCC 2VUYA 2Q71A 1VYRA 3G18A 4W88A 3UWVA 3G5EA 3M4HA 1I2NA 1LBLA 3V1HA 3WH6A 1OCQA 1X1NA 4O8RA 1YQ2A 1OIMA 3VABA 2P3EA 4HU0A 2I5GA 1B3VA 3TQPA 3V0TA 2Y61A 4O0QA 5G5IA 1EWEA 4HA1A 3CHEA 1DL3A 5T9CE 3LTSA 3LX9A 1KC7A 4ZQRA 2OVLA 3KVKA 2YCIX 4QJ1A 2NQLA 3M0MA 4YHEA 1AJ0A 1SGJA 5K7JA 4NZ3A 1CGXA 1EO5A 1VFFA 3ZO9A 1QNPA 3V16A 2PI6A 3R94A 1UC4A 1UKOA 4WY0A 1AH0A 4IP5A 2CIPA 3GE7A 4Q7NA 3C5QA 3MS8A 4E8DA 1LRTA 2OXNA 4S3CA 1WDQA 3AHZA 3B0XA 2ZA3A 1JYWA 1XYMA 3I68A 4J35A 4PGLA 3E5BA 3KOWA 3W4RA 3IPWA 5D38A 4RLIA 1M41A 4HZ8A 4IIGA 4BQ3A 4QEHA 4HA4A 4HHMA 1CXFA 3IJLA 2A3BA 2PDUA 3ZXWA 2WNNA 3PSVA 1Z42A 4D6IA 2C15A 3RU6A 3I7QA 2D20A 1X6LA 2P5NA 3GIPA 2WKLA 4C60A 4U5IA 4FX8A 3CIXA 4ACYA 3PAJA 1UG6A 4IFKB 4MJ2A 4MDOA 1Y8BA 2QV5A 1S5VA 2PSNA 4MTVA 4C6CA 5BRPA 2W92A 3S9ZA 1P0BA 1H1YA 4FXSA 5REQA 2GWNA 4GUHA 4GZJA 2E9LA 5HBFA 1V7YA 2W9MA 1S2VA 2DH2A 2Y7FA 1WKEA 4M81A 5AYXA 3OVPA 1DHPA 4CQCA 4I8DA 3A5VA 3HMJG 2VEGA 4IP4A 4X3ZA 3V4BA 3UZWA 1AFSA 1TJPA 3SN1A 1TQXA 3BOLA 5LNSA 2ZOXA 4ZSUA 3L66A 3TYEA 5EU9A 3OP2A 1LRQA 1UR2A 1UP2A 3LPGA 3LLXA 1WKYA 1XLFA 3W7JA 5BRBA 2PURA 3Q2DA 4NRSA 3W1AA 1AJ2A 4IFKA 1WCGA 2YW3A 1XGEA 1E1FA 2WBKA 1XI3A 3WFZA 4L4PA 4MZYA 4R88A 1VGAA 1ZJAA 3GR8A 4GA8A 5K9XA 3PTMA 4H9TA 4FNSA 2AKZA 3HV8A 3TNOA 1HG3A 3HPFA 4IG2B 2OZ0A 4MF4A 1Y5XA 3ZYZA 3RXZA 2EJ1A 1PEZA 2GGGA 2ACQA 1AMYA 3LGDA 2A3AA 4IICA 2Q8XA 2Y5EA 5H1WA 2PLKA 2GSHA 3KRUA 2WM1A 5D2XA 3GTFA 4D1IA 3QGAC 3VGHA 1XFCA 4PMJA 2X0YA 1K6AA 3N13A 3O9NA 3OLIA 3L4VA 3CQKA 1W3NA 4K36A 2HROA 2IPWA 2J75A 2E4TA 3LSBA 1RLDA 3UEQA 1H0IA 1N55A 3QTPA 1ICSA 3VZXA 1E9LA 2A3EA 1ZRQA 2ZRWA 4Y8FA 1E4IA 2TSYA 2GYIA 3E6EA 1JL8A 3WLIA 3AIQA 2PLCA 4DZAA 3NQDA 2OELA 3UWZA 2ACRA 3CV1A 5F2GA 1S2CA 3SRHA 2YA1A 1KW1A 3O1NA 4QP0A 5AYYA 1OYAA 1JPHA 1QI5A 2H9AB 3S1VA 4IHCA 4L1WA 4I9AA 3W84A 1ONWA 1UBSA 4W8AA 4KWWA 1PZ2A 2CEQA 3NGJA 4AVOA 3NQ8A 3AI0A 4AIBA 5ENLA 4NNCA 4Z1YA 1F7BA 3BAKA 1XLJA 3TW7A 1IEIA 4UTFA 1IIHA 4BHYA 4JL2A 4WGXA 4PTVA 3DBNA 2FJUB 4WDU