4YWRA

Structure of a putative phosphomethylpyrimidine kinase from acinetobacter baumannii in non-covalent complex with pyridoxal phosphate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
237
structure length
228
Chain Sequence
RPTVLCFSGLDPSGGAGLQADIEAIGQSGAHAAIACTALTIQNSQQVFGFEATSKELLLAQANAVVGDLPIKCVKSGMLGTTDNIAALAEFLRAHPDYQYVLDPVLVANSGGSLGDQATLVKAFVELIPLATLITPNTVELRALTGVTDLDQATQKLFEMGAKAVLVKGGHEDTPDFIKNSLYIDGELAASSTCPRCSLASFIAGRLALGDSLKIAVQHAETWLFGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a putative phosphomethylpyrimidine kinase from Acinetobacter baumannii in non-covalent complex with pyridoxal phosphate.
rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
molecule keywords Putative hydroxymethylpyrimidine kinase/phosphomethylpyrimid
total genus 75
structure length 228
sequence length 237
ec nomenclature
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4ywrA00
4K9CA 3EWMA 3RPHA 3RU3A 3UMPA 5C3ZA 1LIOA 2AFBA 3KD6A 4EUMA 3RRJA 3QA2A 1U2XA 2A9ZA 4K8KA 1V1AA 2A9YA 3DRWA 5COJA 4LC4A 4E84A 2I5BA 3GO7A 2YXUA 3KEUA 3K9EA 2F7KA 3QAIA 5B6AA 1V1BA 3RRBA 1L2LA 3IKHA 4XCKA 4LCAA 2ABSA 3DZVA 4E3AA 3RTAA 2R3EA 2NWHA 4S1MA 2HQQA 3OTXA 1C3QA 1LHRA 1BX4A 3FHYA 3HICA 2YXTA 4S1IB 3RQQA 4DU5A 4JJPA 3VAQA 3RQ8A 4E8ZA 3RSFA 2HW1A 2DDOA 5EY7A 4E8WA 3B3LA 4KAHA 1JXIA 1UB0A 4EBUA 2PKNA 4XF6A 2AJRA 3BGKA 3Q1YA 3NCAA 3CQDA 3N1CA 3IE7A 3NBVA 2C4EA 3H49A 1RFTA 2RBCA 2AX3A 4YWRA 3RS8A 3LHXA 3PL2A 5C41A 3FHXA 4KANA 3UQ6A 2VARA 3NL3A 2AA0A 3UMOA 3BF5A 3NL5A 5CGEA 3HYOA 2ABQA 3RQ2A 3B1PA 3RO4A 3Q92A 1VM7A 2PKKA 3RTDA 2DCNA 2PKFA 3IN1A 3RU2A 2I6BA 4E8YA 3RQ5A 2V78A 1KYHA 5F11A 4C5MA 5F0ZA 3RY7A 4O1GA 3RRFA 5CGAA 3IH0A 4JKSA 1TYYA 2JGVA 4N08A 2DDWA 1RKSA 2C49A 1LIIA 2DDMA 2JG1A 4KALA 3RQXA 2F02A 3NC9A 4WJMA 2AJPA 2Q5RA 4XF7A 3NBWA 5CM5A 5TRWA 1YHJA 4K8PA 4UBEA 1YGJA 2HLZA 3JULA 1VI9A 3RSQA 3RT7A 4LBGA 4O1LA 5C40A 3UQEA 3B1NA 3RPZA 4LBXA 3LJSA 1TZ3A 2I6AA 1TZ6A 2AWDA 2AB8A 2PKMA 3GBUA 4S1HA 3RQHA 4GM6A 4C5NA 4DC3A 1RKAA 3NC2A 1JXHA 4B8SA 1RK2A 1RFVA 3RS9A 3HPDA 1GC5A 3LOOA 1V1SA 3UQDA 2QHPA 2JG5A 2XTBA 3ZS7A 3VASA 3H74A 4EN4A 4B8RA 3B1OA 3GO6A 1WYEA 3NL6A 3PZSA 1ESQA 3RSSA 4K93A 4KBEA 4C5JA 5BYDA 3RSGA 4YL5A 3NM3A 2R3BA 4KADA 4X8FA 3MBJA 3RTGA 1ESJA 1LIKA 3IQ0A 4PVVA 3RQ6A 4C5LA 3W4SA 1TD2A 3KZHA 4N09A 2FV7A 3RTEA 4K9IA 4E69A 1LHPA 1RFUA 1YGKA 3K5WA 4S1IA 5EYNA 3LKIA 5BYCA 3KTNA 3RTBA 3B1RA 3UBOA 5BYFA 1VK4A 3IBQA 4C5KA 1LIJA 4U7XA 3UQ9A 1DGMA 3RT9A 1V19A 1UA4A 4K8CA 1EKKA 2QCVA 3MBHA 4JKUA 5TQIA 3RM5A 5BYEA 1EKQA 3B1QA 3I3YA 3NM1A 4EOHA 4XDAA 1GQTA 3RREA 3RTCA 1RKDA 3NL2A 5C3YA 4K8TA
chains in the Genus database with same CATH superfamily
4K9CA 3EWMA 3RPHA 3RU3A 3UMPA 5C3ZA 1LIOA 2AFBA 3KD6A 4EUMA 3RRJA 3QA2A 1U2XA 2F00A 2A9ZA 4K8KA 1V1AA 2GCBA 2A9YA 3ZM5A 4CVMA 3DRWA 4QDIA 5COJA 4LC4A 4E84A 2I5BA 3GO7A 2YXUA 3KEUA 3K9EA 2F7KA 3N2AA 3QAIA 3QCZA 4C12A 5B6AA 2GC6A 1V1BA 3RRBA 1L2LA 2UUPA 3IKHA 4XCKA 4LCAA 2ABSA 3DZVA 4E3AA 3RTAA 4HV4A 2R3EA 2NWHA 4S1MA 2HQQA 1E0DA 1C3QA 3OTXA 1LHRA 1BX4A 3FHYA 3HICA 2YXTA 4S1IB 3RQQA 4DU5A 4BUCA 4JJPA 3VAQA 3RQ8A 4E8ZA 3RSFA 2HW1A 2DDOA 5EY7A 3PYZA 3B3LA 4E8WA 2XPCA 2Y66A 1J6UA 1JXIA 1UB0A 4KAHA 4EBUA 2PKNA 4XF6A 5A5FA 4CVKA 2AJRA 3BGKA 3Q1YA 3NCAA 3CQDA 3N1CA 3IE7A 3NBVA 2C4EA 3H49A 1RFTA 2RBCA 2AX3A 4YWRA 3RS8A 3LHXA 3PL2A 5C41A 3FHXA 4KANA 2UAGA 3UQ6A 2VARA 3NL3A 2AA0A 3UMOA 3BF5A 3NL5A 2WJPA 2Y1OA 3RQXA 5CGEA 3HYOA 2ABQA 3RQ2A 2VTEA 3B1PA 4ZIYA 3Q92A 3RO4A 1VM7A 2PKKA 3RTDA 2DCNA 2PKFA 2VOSA 3IN1A 3RU2A 2I6BA 4E8YA 3RQ5A 2V78A 1KYHA 1UAGA 5F11A 4C5MA 5F0ZA 2WTZA 3RY7A 4O1GA 4UAGA 3LK7A 3RRFA 5CGAA 3IH0A 4JKSA 1TYYA 1P3DA 4BUBA 2JGVA 1JBVA 2DDWA 1W7KA 4N08A 1RKSA 2C49A 2X5OA 1LIIA 2GCAA 2DDMA 1W78A 1FGSA 2JG1A 4KALA 2F02A 3NC9A 2Y68A 4WJMA 2AJPA 2Q5RA 4XF7A 1E8CA 3NBWA 5CM5A 5TRWA 3ZL8A 1YHJA 4K8PA 4UBEA 1YGJA 2HLZA 3JULA 1VI9A 3NRSA 3RSQA 4LBGA 4O1LA 1O5ZA 3RT7A 4C13A 4CVLA 5C40A 3UQEA 3B1NA 3RPZA 4LBXA 3LJSA 1TZ3A 2I6AA 1TZ6A 2AWDA 2AB8A 2PKMA 3GBUA 4S1HA 3RQHA 4GM6A 4C5NA 4DC3A 1RKAA 3NC2A 1JXHA 3EAGA 2GC5A 4B8SA 1RK2A 1RFVA 1GQYA 2Y67A 1GC5A 3HPDA 3LOOA 3RS9A 1V1SA 3UQDA 2QHPA 2JG5A 2XTBA 3ZS7A 3VASA 3H74A 4EN4A 4B8RA 3B1OA 3GO6A 1WYEA 2JFGA 3NL6A 1ESQA 3PZSA 4K93A 4KBEA 3RSSA 4C5JA 5BYDA 3RSGA 4YL5A 2JFFA 3NM3A 4QF5A 2AM2A 2R3BA 2XJAA 4KADA 3MBJA 4X8FA 3RTGA 1ESJA 1LIKA 3IQ0A 1EEHA 3HJ6A 4PVVA 3RQ6A 4C5LA 3W4SA 1TD2A 3KZHA 4N09A 2FV7A 3RTEA 1GG4A 4K9IA 4E69A 1LHPA 1RFUA 1YGKA 3HN7A 3K5WA 4S1IA 5EYNA 1JBWA 3LKIA 5BYCA 2VORA 3KTNA 3RTBA 3B1RA 3UBOA 3UAGA 5BYFA 1VK4A 3IBQA 4C5KA 1LIJA 2JFHA 4U7XA 3UQ9A 1DGMA 3RT9A 1V19A 3ZM6A 1UA4A 4K8CA 1EKKA 2QCVA 3MBHA 4JKUA 5TQIA 3RM5A 5BYEA 1EKQA 1GQQA 3B1QA 2VTDA 3I3YA 3NM1A 4EOHA 4XDAA 1GQTA 2AM1A 3RREA 3RTCA 5A5EA 1P31A 1RKDA 2UUOA 3NL2A 5C3YA 4K8TA
chains in the Genus database with same CATH topology
4K9CA 3EWMA 3RPHA 3RU3A 3UMPA 5C3ZA 1LIOA 2AFBA 3KD6A 4EUMA 3RRJA 3QA2A 1U2XA 2A9ZA 4K8KA 1V1AA 2A9YA 3DRWA 5COJA 4LC4A 4E84A 2I5BA 3GO7A 2YXUA 3KEUA 3K9EA 2F7KA 3QAIA 5B6AA 1V1BA 3RRBA 1L2LA 3IKHA 4XCKA 4LCAA 2ABSA 3DZVA 4E3AA 3RTAA 2R3EA 2NWHA 4S1MA 2HQQA 3OTXA 1C3QA 1LHRA 1BX4A 3FHYA 3HICA 2YXTA 4S1IB 3RQQA 4DU5A 4JJPA 3VAQA 3RQ8A 4E8ZA 3RSFA 2HW1A 2DDOA 5EY7A 4E8WA 3B3LA 4KAHA 1JXIA 1UB0A 4EBUA 2PKNA 4XF6A 2AJRA 3BGKA 3Q1YA 3NCAA 3CQDA 3N1CA 3IE7A 3NBVA 2C4EA 3H49A 1RFTA 2RBCA 2AX3A 4YWRA 3RS8A 3LHXA 3PL2A 5C41A 3FHXA 4KANA 3UQ6A 2VARA 3NL3A 2AA0A 3UMOA 3BF5A 3NL5A 5CGEA 3HYOA 2ABQA 3RQ2A 3B1PA 3RO4A 3Q92A 1VM7A 2PKKA 3RTDA 2DCNA 2PKFA 3IN1A 3RU2A 2I6BA 4E8YA 3RQ5A 2V78A 1KYHA 5F11A 4C5MA 5F0ZA 3RY7A 4O1GA 3RRFA 5CGAA 3IH0A 4JKSA 1TYYA 2JGVA 4N08A 2DDWA 1RKSA 2C49A 1LIIA 2DDMA 2JG1A 4KALA 3RQXA 2F02A 3NC9A 4WJMA 2AJPA 2Q5RA 4XF7A 3NBWA 5CM5A 5TRWA 1YHJA 4K8PA 4UBEA 1YGJA 2HLZA 3JULA 1VI9A 3RSQA 3RT7A 4LBGA 4O1LA 5C40A 3UQEA 3B1NA 3RPZA 4LBXA 3LJSA 1TZ3A 2I6AA 1TZ6A 2AWDA 2AB8A 2PKMA 3GBUA 4S1HA 3RQHA 4GM6A 4C5NA 4DC3A 1RKAA 3NC2A 1JXHA 4B8SA 1RK2A 1RFVA 3RS9A 3HPDA 1GC5A 3LOOA 1V1SA 3UQDA 2QHPA 2JG5A 2XTBA 3ZS7A 3VASA 3H74A 4EN4A 4B8RA 3B1OA 3GO6A 1WYEA 3NL6A 3PZSA 1ESQA 3RSSA 4K93A 4KBEA 4C5JA 5BYDA 3RSGA 4YL5A 3NM3A 2R3BA 4KADA 4X8FA 3MBJA 3RTGA 1ESJA 1LIKA 3IQ0A 3HJ6A 4PVVA 3RQ6A 4C5LA 3W4SA 1TD2A 3KZHA 4N09A 2FV7A 3RTEA 4K9IA 4E69A 1LHPA 1RFUA 1YGKA 3K5WA 4S1IA 5EYNA 3LKIA 5BYCA 3KTNA 3RTBA 3B1RA 3UBOA 5BYFA 1VK4A 3IBQA 4C5KA 1LIJA 4U7XA 3UQ9A 1DGMA 3RT9A 1V19A 1UA4A 4K8CA 1EKKA 2QCVA 3MBHA 4JKUA 5TQIA 3RM5A 5BYEA 1EKQA 3B1QA 3I3YA 3NM1A 4EOHA 4XDAA 1GQTA 3RREA 3RTCA 1RKDA 3NL2A 5C3YA 4K8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K9C A;  3EWM A;  3RPH A;  3RU3 A;  3UMP A;  5C3Z A;  1LIO A;  2AFB A;  3KD6 A;  4EUM A;  3RRJ A;  3QA2 A;  1U2X A;  2A9Z A;  4K8K A;  1V1A A;  2A9Y A;  3DRW A;  5COJ A;  4LC4 A;  4E84 A;  2I5B A;  3GO7 A;  2YXU A;  3KEU A;  3K9E A;  2F7K A;  3QAI A;  5B6A A;  1V1B A;  3RRB A;  1L2L A;  3IKH A;  4XCK A;  4LCA A;  2ABS A;  3DZV A;  4E3A A;  3RTA A;  2R3E A;  2NWH A;  4S1M A;  2HQQ A;  3OTX A;  1C3Q A;  1LHR A;  1BX4 A;  3FHY A;  3HIC A;  2YXT A;  4S1I B;  3RQQ A;  4DU5 A;  4JJP A;  3VAQ A;  3RQ8 A;  4E8Z A;  3RSF A;  2HW1 A;  2DDO A;  5EY7 A;  4E8W A;  3B3L A;  4KAH A;  1JXI A;  1UB0 A;  4EBU A;  2PKN A;  4XF6 A;  2AJR A;  3BGK A;  3Q1Y A;  3NCA A;  3CQD A;  3N1C A;  3IE7 A;  3NBV A;  2C4E A;  3H49 A;  1RFT A;  2RBC A;  2AX3 A;  4YWR A;  3RS8 A;  3LHX A;  3PL2 A;  5C41 A;  3FHX A;  4KAN A;  3UQ6 A;  2VAR A;  3NL3 A;  2AA0 A;  3UMO A;  3BF5 A;  3NL5 A;  5CGE A;  3HYO A;  2ABQ A;  3RQ2 A;  3B1P A;  3RO4 A;  3Q92 A;  1VM7 A;  2PKK A;  3RTD A;  2DCN A;  2PKF A;  3IN1 A;  3RU2 A;  2I6B A;  4E8Y A;  3RQ5 A;  2V78 A;  1KYH A;  5F11 A;  4C5M A;  5F0Z A;  3RY7 A;  4O1G A;  3RRF A;  5CGA A;  3IH0 A;  4JKS A;  1TYY A;  2JGV A;  4N08 A;  2DDW A;  1RKS A;  2C49 A;  1LII A;  2DDM A;  2JG1 A;  4KAL A;  3RQX A;  2F02 A;  3NC9 A;  4WJM A;  2AJP A;  2Q5R A;  4XF7 A;  3NBW A;  5CM5 A;  5TRW A;  1YHJ A;  4K8P A;  4UBE A;  1YGJ A;  2HLZ A;  3JUL A;  1VI9 A;  3RSQ A;  3RT7 A;  4LBG A;  4O1L A;  5C40 A;  3UQE A;  3B1N A;  3RPZ A;  4LBX A;  3LJS A;  1TZ3 A;  2I6A A;  1TZ6 A;  2AWD A;  2AB8 A;  2PKM A;  3GBU A;  4S1H A;  3RQH A;  4GM6 A;  4C5N A;  4DC3 A;  1RKA A;  3NC2 A;  1JXH A;  4B8S A;  1RK2 A;  1RFV A;  3RS9 A;  3HPD A;  1GC5 A;  3LOO A;  1V1S A;  3UQD A;  2QHP A;  2JG5 A;  2XTB A;  3ZS7 A;  3VAS A;  3H74 A;  4EN4 A;  4B8R A;  3B1O A;  3GO6 A;  1WYE A;  3NL6 A;  3PZS A;  1ESQ A;  3RSS A;  4K93 A;  4KBE A;  4C5J A;  5BYD A;  3RSG A;  4YL5 A;  3NM3 A;  2R3B A;  4KAD A;  4X8F A;  3MBJ A;  3RTG A;  1ESJ A;  1LIK A;  3IQ0 A;  4PVV A;  3RQ6 A;  4C5L A;  3W4S A;  1TD2 A;  3KZH A;  4N09 A;  2FV7 A;  3RTE A;  4K9I A;  4E69 A;  1LHP A;  1RFU A;  1YGK A;  3K5W A;  4S1I A;  5EYN A;  3LKI A;  5BYC A;  3KTN A;  3RTB A;  3B1R A;  3UBO A;  5BYF A;  1VK4 A;  3IBQ A;  4C5K A;  1LIJ A;  4U7X A;  3UQ9 A;  1DGM A;  3RT9 A;  1V19 A;  1UA4 A;  4K8C A;  1EKK A;  2QCV A;  3MBH A;  4JKU A;  5TQI A;  3RM5 A;  5BYE A;  1EKQ A;  3B1Q A;  3I3Y A;  3NM1 A;  4EOH A;  4XDA A;  1GQT A;  3RRE A;  3RTC A;  1RKD A;  3NL2 A;  5C3Y A;  4K8T A; 
#chains in the Genus database with same CATH topology
 4K9C A;  3EWM A;  3RPH A;  3RU3 A;  3UMP A;  5C3Z A;  1LIO A;  2AFB A;  3KD6 A;  4EUM A;  3RRJ A;  3QA2 A;  1U2X A;  2F00 A;  2A9Z A;  4K8K A;  1V1A A;  2GCB A;  2A9Y A;  3ZM5 A;  4CVM A;  3DRW A;  4QDI A;  5COJ A;  4LC4 A;  4E84 A;  2I5B A;  3GO7 A;  2YXU A;  3KEU A;  3K9E A;  2F7K A;  3N2A A;  3QAI A;  3QCZ A;  4C12 A;  5B6A A;  2GC6 A;  1V1B A;  3RRB A;  1L2L A;  2UUP A;  3IKH A;  4XCK A;  4LCA A;  2ABS A;  3DZV A;  4E3A A;  3RTA A;  4HV4 A;  2R3E A;  2NWH A;  4S1M A;  2HQQ A;  1E0D A;  1C3Q A;  3OTX A;  1LHR A;  1BX4 A;  3FHY A;  3HIC A;  2YXT A;  4S1I B;  3RQQ A;  4DU5 A;  4BUC A;  4JJP A;  3VAQ A;  3RQ8 A;  4E8Z A;  3RSF A;  2HW1 A;  2DDO A;  5EY7 A;  3PYZ A;  3B3L A;  4E8W A;  2XPC A;  2Y66 A;  1J6U A;  1JXI A;  1UB0 A;  4KAH A;  4EBU A;  2PKN A;  4XF6 A;  5A5F A;  4CVK A;  2AJR A;  3BGK A;  3Q1Y A;  3NCA A;  3CQD A;  3N1C A;  3IE7 A;  3NBV A;  2C4E A;  3H49 A;  1RFT A;  2RBC A;  2AX3 A;  4YWR A;  3RS8 A;  3LHX A;  3PL2 A;  5C41 A;  3FHX A;  4KAN A;  2UAG A;  3UQ6 A;  2VAR A;  3NL3 A;  2AA0 A;  3UMO A;  3BF5 A;  3NL5 A;  2WJP A;  2Y1O A;  3RQX A;  5CGE A;  3HYO A;  2ABQ A;  3RQ2 A;  2VTE A;  3B1P A;  4ZIY A;  3Q92 A;  3RO4 A;  1VM7 A;  2PKK A;  3RTD A;  2DCN A;  2PKF A;  2VOS A;  3IN1 A;  3RU2 A;  2I6B A;  4E8Y A;  3RQ5 A;  2V78 A;  1KYH A;  1UAG A;  5F11 A;  4C5M A;  5F0Z A;  2WTZ A;  3RY7 A;  4O1G A;  4UAG A;  3LK7 A;  3RRF A;  5CGA A;  3IH0 A;  4JKS A;  1TYY A;  1P3D A;  4BUB A;  2JGV A;  1JBV A;  2DDW A;  1W7K A;  4N08 A;  1RKS A;  2C49 A;  2X5O A;  1LII A;  2GCA A;  2DDM A;  1W78 A;  1FGS A;  2JG1 A;  4KAL A;  2F02 A;  3NC9 A;  2Y68 A;  4WJM A;  2AJP A;  2Q5R A;  4XF7 A;  1E8C A;  3NBW A;  5CM5 A;  5TRW A;  3ZL8 A;  1YHJ A;  4K8P A;  4UBE A;  1YGJ A;  2HLZ A;  3JUL A;  1VI9 A;  3NRS A;  3RSQ A;  4LBG A;  4O1L A;  1O5Z A;  3RT7 A;  4C13 A;  4CVL A;  5C40 A;  3UQE A;  3B1N A;  3RPZ A;  4LBX A;  3LJS A;  1TZ3 A;  2I6A A;  1TZ6 A;  2AWD A;  2AB8 A;  2PKM A;  3GBU A;  4S1H A;  3RQH A;  4GM6 A;  4C5N A;  4DC3 A;  1RKA A;  3NC2 A;  1JXH A;  3EAG A;  2GC5 A;  4B8S A;  1RK2 A;  1RFV A;  1GQY A;  2Y67 A;  1GC5 A;  3HPD A;  3LOO A;  3RS9 A;  1V1S A;  3UQD A;  2QHP A;  2JG5 A;  2XTB A;  3ZS7 A;  3VAS A;  3H74 A;  4EN4 A;  4B8R A;  3B1O A;  3GO6 A;  1WYE A;  2JFG A;  3NL6 A;  1ESQ A;  3PZS A;  4K93 A;  4KBE A;  3RSS A;  4C5J A;  5BYD A;  3RSG A;  4YL5 A;  2JFF A;  3NM3 A;  4QF5 A;  2AM2 A;  2R3B A;  2XJA A;  4KAD A;  3MBJ A;  4X8F A;  3RTG A;  1ESJ A;  1LIK A;  3IQ0 A;  1EEH A;  3HJ6 A;  4PVV A;  3RQ6 A;  4C5L A;  3W4S A;  1TD2 A;  3KZH A;  4N09 A;  2FV7 A;  3RTE A;  1GG4 A;  4K9I A;  4E69 A;  1LHP A;  1RFU A;  1YGK A;  3HN7 A;  3K5W A;  4S1I A;  5EYN A;  1JBW A;  3LKI A;  5BYC A;  2VOR A;  3KTN A;  3RTB A;  3B1R A;  3UBO A;  3UAG A;  5BYF A;  1VK4 A;  3IBQ A;  4C5K A;  1LIJ A;  2JFH A;  4U7X A;  3UQ9 A;  1DGM A;  3RT9 A;  1V19 A;  3ZM6 A;  1UA4 A;  4K8C A;  1EKK A;  2QCV A;  3MBH A;  4JKU A;  5TQI A;  3RM5 A;  5BYE A;  1EKQ A;  1GQQ A;  3B1Q A;  2VTD A;  3I3Y A;  3NM1 A;  4EOH A;  4XDA A;  1GQT A;  2AM1 A;  3RRE A;  3RTC A;  5A5E A;  1P31 A;  1RKD A;  2UUO A;  3NL2 A;  5C3Y A;  4K8T A; 
#chains in the Genus database with same CATH homology
 4K9C A;  3EWM A;  3RPH A;  3RU3 A;  3UMP A;  5C3Z A;  1LIO A;  2AFB A;  3KD6 A;  4EUM A;  3RRJ A;  3QA2 A;  1U2X A;  2A9Z A;  4K8K A;  1V1A A;  2A9Y A;  3DRW A;  5COJ A;  4LC4 A;  4E84 A;  2I5B A;  3GO7 A;  2YXU A;  3KEU A;  3K9E A;  2F7K A;  3QAI A;  5B6A A;  1V1B A;  3RRB A;  1L2L A;  3IKH A;  4XCK A;  4LCA A;  2ABS A;  3DZV A;  4E3A A;  3RTA A;  2R3E A;  2NWH A;  4S1M A;  2HQQ A;  3OTX A;  1C3Q A;  1LHR A;  1BX4 A;  3FHY A;  3HIC A;  2YXT A;  4S1I B;  3RQQ A;  4DU5 A;  4JJP A;  3VAQ A;  3RQ8 A;  4E8Z A;  3RSF A;  2HW1 A;  2DDO A;  5EY7 A;  4E8W A;  3B3L A;  4KAH A;  1JXI A;  1UB0 A;  4EBU A;  2PKN A;  4XF6 A;  2AJR A;  3BGK A;  3Q1Y A;  3NCA A;  3CQD A;  3N1C A;  3IE7 A;  3NBV A;  2C4E A;  3H49 A;  1RFT A;  2RBC A;  2AX3 A;  4YWR A;  3RS8 A;  3LHX A;  3PL2 A;  5C41 A;  3FHX A;  4KAN A;  3UQ6 A;  2VAR A;  3NL3 A;  2AA0 A;  3UMO A;  3BF5 A;  3NL5 A;  5CGE A;  3HYO A;  2ABQ A;  3RQ2 A;  3B1P A;  3RO4 A;  3Q92 A;  1VM7 A;  2PKK A;  3RTD A;  2DCN A;  2PKF A;  3IN1 A;  3RU2 A;  2I6B A;  4E8Y A;  3RQ5 A;  2V78 A;  1KYH A;  5F11 A;  4C5M A;  5F0Z A;  3RY7 A;  4O1G A;  3RRF A;  5CGA A;  3IH0 A;  4JKS A;  1TYY A;  2JGV A;  4N08 A;  2DDW A;  1RKS A;  2C49 A;  1LII A;  2DDM A;  2JG1 A;  4KAL A;  3RQX A;  2F02 A;  3NC9 A;  4WJM A;  2AJP A;  2Q5R A;  4XF7 A;  3NBW A;  5CM5 A;  5TRW A;  1YHJ A;  4K8P A;  4UBE A;  1YGJ A;  2HLZ A;  3JUL A;  1VI9 A;  3RSQ A;  3RT7 A;  4LBG A;  4O1L A;  5C40 A;  3UQE A;  3B1N A;  3RPZ A;  4LBX A;  3LJS A;  1TZ3 A;  2I6A A;  1TZ6 A;  2AWD A;  2AB8 A;  2PKM A;  3GBU A;  4S1H A;  3RQH A;  4GM6 A;  4C5N A;  4DC3 A;  1RKA A;  3NC2 A;  1JXH A;  4B8S A;  1RK2 A;  1RFV A;  3RS9 A;  3HPD A;  1GC5 A;  3LOO A;  1V1S A;  3UQD A;  2QHP A;  2JG5 A;  2XTB A;  3ZS7 A;  3VAS A;  3H74 A;  4EN4 A;  4B8R A;  3B1O A;  3GO6 A;  1WYE A;  3NL6 A;  3PZS A;  1ESQ A;  3RSS A;  4K93 A;  4KBE A;  4C5J A;  5BYD A;  3RSG A;  4YL5 A;  3NM3 A;  2R3B A;  4KAD A;  4X8F A;  3MBJ A;  3RTG A;  1ESJ A;  1LIK A;  3IQ0 A;  3HJ6 A;  4PVV A;  3RQ6 A;  4C5L A;  3W4S A;  1TD2 A;  3KZH A;  4N09 A;  2FV7 A;  3RTE A;  4K9I A;  4E69 A;  1LHP A;  1RFU A;  1YGK A;  3K5W A;  4S1I A;  5EYN A;  3LKI A;  5BYC A;  3KTN A;  3RTB A;  3B1R A;  3UBO A;  5BYF A;  1VK4 A;  3IBQ A;  4C5K A;  1LIJ A;  4U7X A;  3UQ9 A;  1DGM A;  3RT9 A;  1V19 A;  1UA4 A;  4K8C A;  1EKK A;  2QCV A;  3MBH A;  4JKU A;  5TQI A;  3RM5 A;  5BYE A;  1EKQ A;  3B1Q A;  3I3Y A;  3NM1 A;  4EOH A;  4XDA A;  1GQT A;  3RRE A;  3RTC A;  1RKD A;  3NL2 A;  5C3Y A;  4K8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...