4YWVA

Structural insight into the substrate inhibition mechanism of nadp+-dependent succinic semialdehyde dehydrogenase from streptococcus pyogenes
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
455
structure length
455
Chain Sequence
b'AYQTIYPYTNEVLHTFDNMTDQGLADVLERAHLLYKKWRKEDHLEERKAQLHQVANILRRDRDKYAEIMTKDMGKLFTEAQGEVDLCADIADYYADKADEFLMSTPLETDSGQAYYLKQSTGVILAVEPWNFPYYQIMRVFAPNFIVGNPMVLKHASICPRSAQSFEELVLEAGAEAGSITNLFISYDQVSQVIADKRVVGVCLTGSERGGASIAEEAGKNLKKTTLELGGDDAFIILDDADWDQLEKVLYFSRLYNAGQVCTSSKRFIVLDKDYDRFKELLTKVFKTAKWGDPMDPETTLAPLSSAQAKADVLDQIKLALDHGAELVYGGEAIDHPGHFVMPTIIAGLTKDNPIYYQEIFGPVGEIYKVSSEEEAIEVANDSNYGLGGTIFSSNQEHAKAVAAKIETGMSFINSGWTSLPELPFGGIKHSGYGRELSELGFTSFVNEHLIYIPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinic semialdehyde dehydrogenase
publication title Structural insight into the substrate inhibition mechanism of NADP(+)-dependent succinic semialdehyde dehydrogenase from Streptococcus pyogenes.
pubmed doi rcsb
source organism Streptococcus pyogenes mgas1882
molecule tags Oxidoreductase
total genus 163
structure length 455
sequence length 455
chains with identical sequence B
ec nomenclature ec 1.2.1.79: Succinate-semialdehyde dehydrogenase (NADP(+)).
pdb deposition date 2015-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4ywvA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4ywvA01
3RHDA 5KF0A 3INLA 4GO4A 4WP7A 1AG8A 4KWGA 1WNDA 3RHOA 4H80A 4NMJA 2EJDA 4PXLB 2J40A 2QE0A 5EKCA 4GO2A 4I1WA 2W8PA 3K2WA 2W8OA 5L2OA 4E3XA 2BJAA 5KLLA 3N80A 4K57A 2WOXA 2ONPA 2W8QA 2EHUA 2ONOA 5EZ4A 3VZ3A 2Y51A 4FR8A 2BHPA 2EHQA 4PXNA 4CBBA 4V3FA 4OE6A 4L2OA 4C3SA 3VZ0A 4CAZA 4GO3A 3ROSA 3SZAA 3PRLA 2IMPA 4O6RA 3SZBA 5AC1A 1ZUMA 5L2MA 4ZVXA 5J6BA 3V9GA 1CW3A 2O2RA 3JZ4A 3RHLA 4ZVWA 3V9KA 2J6LA 3RHJA 3RHPA 4V37A 1UXQA 3IWKA 1T90A 4I25A 4IDSA 4WB9A 1AD3A 2EUHA 3RHMA 2W8NA 5KLMA 3V9HA 1UZBA 1A4ZA 4QETA 4L1OA 3ETFA 4ZWLA 3PQAA 4I3UA 4OU2A 4QTOA 5FHZA 4OGDA 4QN2A 5AC0A 2XDRA 4DALA 3ZQAA 3MY7A 1BPWA 1BXSA 5KLKA 3EFVA 5EK6A 4I8QA 5F2CA 3RH9A 4QF6A 3U4JA 4MPBA 3EK1A 2J5NA 4I9BA 5AC2A 4X0UA 1BI9A 4NEAA 3V9LA 3I44A 4LH0A 1O04A 4LEMA 4YWUA 1O05A 2BJKA 3N82A 4IDMA 4DNGA 1NZWA 3R64A 4PZ2A 2EITA 2O2QA 4LH1A 4NU9A 4FQFA 3RHRA 4ZULA 3SZ9A 3TY7A 4A0MA 2D4EA 5A2DC 1WNBA 4X2QA 1O02A 4WPNA 4I3VA 1NZXA 2ID2A 4X4LA 2EIIA 4I3WA 4IYMA 5KLNA 1UXUA 5DBVA 1O9JA 4NPIA 5EYUA 3R31A 3V4CA 5EXFA 2Y53A 4NMKA 2EIWA 1UXVA 3RJLA 2W8RA 4ITAA 5ABMA 1EZ0A 4E4GA 4JDCA 5J7IA 1UXPA 5JRYA 1UXRA 4KWFA 2Y5DA 1QI1A 3N81A 4LGZA 2VROA 5EUYA 3V9JA 1KY8A 3B4WA 1UXTA 5KJ5A 4I3TA 2O2PA 4QJEA 4ZUKA 4QGKA 4I26A 4JBEA 2WMEC 5J78A 1O20A 4MPYA 4JZ6A 4NS3A 4Q92A 5EEBA 3N83A 3VZ2A 5L2NA 2JG7A 5A2DA 4IHIA 1QI6A 2EJLA 4H7NA 3K9DA 4YWEA 2ONMA 4GNZA 4WJ9A 4I8PA 4OUBA 4YWVA 3JU8A 4I2RA 1UXNA 4LIHA 3V9IA 4KNAA 4U3WA 2ESDA 1EYYA 4GO0A 4QJEB 5A2DD 3INJA 4GHKA 4ZVYA 4ITBA 4OE2A 4OE5A 5DIBA 1O00A 1A4SA 3IWJA 4IT9A 4LH3A 4V3FC 3VZ1A 5L13A 2EJ6A 2OPXA 2Y52A 4PXLA 4OHTA 2IY6A 4ZZ7A 1NZZA 2VLEA 4I3XA 3QANA 4O5HA 2BHQA 1EUHA 2HG2A 2ILUA 4H73A 4X0TA 1VLUA 4ZXUA 5KLOA 4QYJA 5DRUA 2ONNA 1O01A 2WMEA 2H5GA 3RHQA 4F3XA 3RHHA 4OE4A 4LH2A
chains in the Genus database with same CATH superfamily
3RHDA 5KF0A 3INLA 4GO4A 4WP7A 1AG8A 4KWGA 1WNDA 3RHOA 4H80A 4NMJA 2EJDA 4PXLB 2J40A 2QE0A 5EKCA 4GO2A 4I1WA 2W8PA 3K2WA 2W8OA 5L2OA 4E3XA 2BJAA 5KLLA 3N80A 4K57A 2WOXA 2ONPA 2W8QA 2EHUA 2ONOA 5EZ4A 3VZ3A 2Y51A 4FR8A 2BHPA 2EHQA 4PXNA 4CBBA 4V3FA 4OE6A 4L2OA 4C3SA 3VZ0A 4CAZA 4GO3A 3ROSA 3SZAA 3PRLA 2IMPA 4O6RA 3SZBA 5AC1A 1ZUMA 5L2MA 4ZVXA 5J6BA 3V9GA 1CW3A 2O2RA 3JZ4A 3RHLA 4ZVWA 3V9KA 2J6LA 3RHJA 3RHPA 4V37A 1UXQA 3IWKA 1T90A 4I25A 4IDSA 4WB9A 1AD3A 2EUHA 3RHMA 2W8NA 5KLMA 3V9HA 1UZBA 1A4ZA 4QETA 4L1OA 3ETFA 4ZWLA 3PQAA 4I3UA 4OU2A 4QTOA 5FHZA 4OGDA 4QN2A 5AC0A 2XDRA 4DALA 3ZQAA 3MY7A 1BPWA 1BXSA 5KLKA 3EFVA 5EK6A 4I8QA 5F2CA 3RH9A 4QF6A 3U4JA 4MPBA 3EK1A 2J5NA 4I9BA 5AC2A 4X0UA 1BI9A 4NEAA 3V9LA 3I44A 4LH0A 1O04A 4LEMA 4YWUA 1O05A 2BJKA 3N82A 4IDMA 4DNGA 1NZWA 3R64A 4PZ2A 2EITA 2O2QA 4LH1A 4NU9A 4FQFA 3RHRA 4ZULA 3SZ9A 3TY7A 4A0MA 2D4EA 5A2DC 1WNBA 4X2QA 1O02A 4WPNA 4I3VA 1NZXA 2ID2A 4X4LA 2EIIA 4I3WA 4IYMA 5KLNA 1UXUA 5DBVA 1O9JA 4NPIA 5EYUA 3R31A 3V4CA 5EXFA 2Y53A 4NMKA 2EIWA 1UXVA 3RJLA 2W8RA 4ITAA 5ABMA 1EZ0A 4E4GA 4JDCA 5J7IA 1UXPA 5JRYA 1UXRA 4KWFA 2Y5DA 1QI1A 3N81A 4LGZA 2VROA 5EUYA 3V9JA 1KY8A 3B4WA 1UXTA 5KJ5A 4I3TA 2O2PA 4QJEA 4ZUKA 4QGKA 4I26A 4JBEA 2WMEC 5J78A 1O20A 4MPYA 4JZ6A 4NS3A 4Q92A 5EEBA 3N83A 3VZ2A 5L2NA 2JG7A 5A2DA 4IHIA 1QI6A 2EJLA 4H7NA 3K9DA 4YWEA 2ONMA 4GNZA 4WJ9A 4I8PA 4OUBA 4YWVA 3JU8A 4I2RA 1UXNA 4LIHA 3V9IA 4KNAA 4U3WA 2ESDA 1EYYA 4GO0A 4QJEB 5A2DD 3INJA 4GHKA 4ZVYA 4ITBA 4OE2A 4OE5A 5DIBA 1O00A 1A4SA 3IWJA 4IT9A 4LH3A 4V3FC 3VZ1A 5L13A 2EJ6A 2OPXA 2Y52A 4PXLA 4OHTA 2IY6A 4ZZ7A 1NZZA 2VLEA 4I3XA 3QANA 4O5HA 2BHQA 1EUHA 2HG2A 2ILUA 4H73A 4X0TA 1VLUA 4ZXUA 5KLOA 4QYJA 5DRUA 2ONNA 1O01A 2WMEA 2H5GA 3RHQA 4F3XA 3RHHA 4OE4A 4LH2A
chains in the Genus database with same CATH topology
3RHDA 5KF0A 3INLA 4GO4A 4WP7A 1AG8A 4KWGA 1WNDA 3RHOA 4H80A 4NMJA 2EJDA 4PXLB 2J40A 2QE0A 5EKCA 4GO2A 4I1WA 2W8PA 3K2WA 2W8OA 5L2OA 4E3XA 2BJAA 5KLLA 3N80A 4K57A 2WOXA 2ONPA 2W8QA 2EHUA 2ONOA 5EZ4A 3VZ3A 2Y51A 4FR8A 2BHPA 2EHQA 4PXNA 4CBBA 4V3FA 4OE6A 4L2OA 4C3SA 3VZ0A 4CAZA 4GO3A 3ROSA 3SZAA 3PRLA 2IMPA 4O6RA 3SZBA 5AC1A 1ZUMA 5L2MA 4ZVXA 5J6BA 3V9GA 1CW3A 2O2RA 3JZ4A 3RHLA 4ZVWA 3V9KA 2J6LA 3RHJA 3RHPA 4V37A 1UXQA 3IWKA 1T90A 4I25A 4IDSA 4WB9A 1AD3A 2EUHA 3RHMA 2W8NA 5KLMA 3V9HA 1UZBA 1A4ZA 4QETA 4L1OA 3ETFA 4ZWLA 3PQAA 4I3UA 4OU2A 4QTOA 5FHZA 4OGDA 4QN2A 5AC0A 2XDRA 4DALA 3ZQAA 3MY7A 1BPWA 1BXSA 5KLKA 3EFVA 5EK6A 4I8QA 5F2CA 3RH9A 4QF6A 3U4JA 4MPBA 3EK1A 2J5NA 4I9BA 5AC2A 4X0UA 1BI9A 4NEAA 3V9LA 3I44A 4LH0A 1O04A 4LEMA 4YWUA 1O05A 2BJKA 3N82A 4IDMA 4DNGA 1NZWA 3R64A 4PZ2A 2EITA 2O2QA 4LH1A 4NU9A 4FQFA 3RHRA 4ZULA 3SZ9A 3TY7A 4A0MA 2D4EA 5A2DC 1WNBA 4X2QA 1O02A 4WPNA 4I3VA 1NZXA 2ID2A 4X4LA 2EIIA 4I3WA 4IYMA 5KLNA 1UXUA 5DBVA 1O9JA 4NPIA 5EYUA 3R31A 3V4CA 5EXFA 2Y53A 4NMKA 2EIWA 1UXVA 3RJLA 2W8RA 4ITAA 5ABMA 1EZ0A 4E4GA 4JDCA 5J7IA 1UXPA 5JRYA 1UXRA 4KWFA 2Y5DA 1QI1A 3N81A 4LGZA 2VROA 5EUYA 3V9JA 1KY8A 3B4WA 1UXTA 5KJ5A 4I3TA 2O2PA 4QJEA 4ZUKA 4QGKA 4I26A 4JBEA 2WMEC 5J78A 1O20A 4MPYA 4JZ6A 4NS3A 4Q92A 5EEBA 3N83A 3VZ2A 5L2NA 2JG7A 5A2DA 4IHIA 1QI6A 2EJLA 4H7NA 3K9DA 4YWEA 2ONMA 4GNZA 4WJ9A 4I8PA 4OUBA 4YWVA 3JU8A 4I2RA 1UXNA 4LIHA 3V9IA 4KNAA 4U3WA 2ESDA 1EYYA 4GO0A 4QJEB 5A2DD 3INJA 4GHKA 4ZVYA 4ITBA 4OE2A 4OE5A 5DIBA 1O00A 1A4SA 3IWJA 4IT9A 4LH3A 4V3FC 3VZ1A 5L13A 2EJ6A 2OPXA 2Y52A 4PXLA 4OHTA 2IY6A 4ZZ7A 1NZZA 2VLEA 4I3XA 3QANA 4O5HA 2BHQA 1EUHA 2HG2A 2ILUA 4H73A 4X0TA 1VLUA 4ZXUA 5KLOA 4QYJA 5DRUA 2ONNA 1O01A 2WMEA 2H5GA 3RHQA 4F3XA 3RHHA 4OE4A 4LH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHD A;  5KF0 A;  3INL A;  4GO4 A;  4WP7 A;  1AG8 A;  4KWG A;  1WND A;  3RHO A;  4H80 A;  4NMJ A;  2EJD A;  4PXL B;  2J40 A;  2QE0 A;  5EKC A;  4GO2 A;  4I1W A;  2W8P A;  3K2W A;  2W8O A;  5L2O A;  4E3X A;  2BJA A;  5KLL A;  3N80 A;  4K57 A;  2WOX A;  2ONP A;  2W8Q A;  2EHU A;  2ONO A;  5EZ4 A;  3VZ3 A;  2Y51 A;  4FR8 A;  2BHP A;  2EHQ A;  4PXN A;  4CBB A;  4V3F A;  4OE6 A;  4L2O A;  4C3S A;  3VZ0 A;  4CAZ A;  4GO3 A;  3ROS A;  3SZA A;  3PRL A;  2IMP A;  4O6R A;  3SZB A;  5AC1 A;  1ZUM A;  5L2M A;  4ZVX A;  5J6B A;  3V9G A;  1CW3 A;  2O2R A;  3JZ4 A;  3RHL A;  4ZVW A;  3V9K A;  2J6L A;  3RHJ A;  3RHP A;  4V37 A;  1UXQ A;  3IWK A;  1T90 A;  4I25 A;  4IDS A;  4WB9 A;  1AD3 A;  2EUH A;  3RHM A;  2W8N A;  5KLM A;  3V9H A;  1UZB A;  1A4Z A;  4QET A;  4L1O A;  3ETF A;  4ZWL A;  3PQA A;  4I3U A;  4OU2 A;  4QTO A;  5FHZ A;  4OGD A;  4QN2 A;  5AC0 A;  2XDR A;  4DAL A;  3ZQA A;  3MY7 A;  1BPW A;  1BXS A;  5KLK A;  3EFV A;  5EK6 A;  4I8Q A;  5F2C A;  3RH9 A;  4QF6 A;  3U4J A;  4MPB A;  3EK1 A;  2J5N A;  4I9B A;  5AC2 A;  4X0U A;  1BI9 A;  4NEA A;  3V9L A;  3I44 A;  4LH0 A;  1O04 A;  4LEM A;  4YWU A;  1O05 A;  2BJK A;  3N82 A;  4IDM A;  4DNG A;  1NZW A;  3R64 A;  4PZ2 A;  2EIT A;  2O2Q A;  4LH1 A;  4NU9 A;  4FQF A;  3RHR A;  4ZUL A;  3SZ9 A;  3TY7 A;  4A0M A;  2D4E A;  5A2D C;  1WNB A;  4X2Q A;  1O02 A;  4WPN A;  4I3V A;  1NZX A;  2ID2 A;  4X4L A;  2EII A;  4I3W A;  4IYM A;  5KLN A;  1UXU A;  5DBV A;  1O9J A;  4NPI A;  5EYU A;  3R31 A;  3V4C A;  5EXF A;  2Y53 A;  4NMK A;  2EIW A;  1UXV A;  3RJL A;  2W8R A;  4ITA A;  5ABM A;  1EZ0 A;  4E4G A;  4JDC A;  5J7I A;  1UXP A;  5JRY A;  1UXR A;  4KWF A;  2Y5D A;  1QI1 A;  3N81 A;  4LGZ A;  2VRO A;  5EUY A;  3V9J A;  1KY8 A;  3B4W A;  1UXT A;  5KJ5 A;  4I3T A;  2O2P A;  4QJE A;  4ZUK A;  4QGK A;  4I26 A;  4JBE A;  2WME C;  5J78 A;  1O20 A;  4MPY A;  4JZ6 A;  4NS3 A;  4Q92 A;  5EEB A;  3N83 A;  3VZ2 A;  5L2N A;  2JG7 A;  5A2D A;  4IHI A;  1QI6 A;  2EJL A;  4H7N A;  3K9D A;  4YWE A;  2ONM A;  4GNZ A;  4WJ9 A;  4I8P A;  4OUB A;  4YWV A;  3JU8 A;  4I2R A;  1UXN A;  4LIH A;  3V9I A;  4KNA A;  4U3W A;  2ESD A;  1EYY A;  4GO0 A;  4QJE B;  5A2D D;  3INJ A;  4GHK A;  4ZVY A;  4ITB A;  4OE2 A;  4OE5 A;  5DIB A;  1O00 A;  1A4S A;  3IWJ A;  4IT9 A;  4LH3 A;  4V3F C;  3VZ1 A;  5L13 A;  2EJ6 A;  2OPX A;  2Y52 A;  4PXL A;  4OHT A;  2IY6 A;  4ZZ7 A;  1NZZ A;  2VLE A;  4I3X A;  3QAN A;  4O5H A;  2BHQ A;  1EUH A;  2HG2 A;  2ILU A;  4H73 A;  4X0T A;  1VLU A;  4ZXU A;  5KLO A;  4QYJ A;  5DRU A;  2ONN A;  1O01 A;  2WME A;  2H5G A;  3RHQ A;  4F3X A;  3RHH A;  4OE4 A;  4LH2 A; 
#chains in the Genus database with same CATH topology
 3RHD A;  5KF0 A;  3INL A;  4GO4 A;  4WP7 A;  1AG8 A;  4KWG A;  1WND A;  3RHO A;  4H80 A;  4NMJ A;  2EJD A;  4PXL B;  2J40 A;  2QE0 A;  5EKC A;  4GO2 A;  4I1W A;  2W8P A;  3K2W A;  2W8O A;  5L2O A;  4E3X A;  2BJA A;  5KLL A;  3N80 A;  4K57 A;  2WOX A;  2ONP A;  2W8Q A;  2EHU A;  2ONO A;  5EZ4 A;  3VZ3 A;  2Y51 A;  4FR8 A;  2BHP A;  2EHQ A;  4PXN A;  4CBB A;  4V3F A;  4OE6 A;  4L2O A;  4C3S A;  3VZ0 A;  4CAZ A;  4GO3 A;  3ROS A;  3SZA A;  3PRL A;  2IMP A;  4O6R A;  3SZB A;  5AC1 A;  1ZUM A;  5L2M A;  4ZVX A;  5J6B A;  3V9G A;  1CW3 A;  2O2R A;  3JZ4 A;  3RHL A;  4ZVW A;  3V9K A;  2J6L A;  3RHJ A;  3RHP A;  4V37 A;  1UXQ A;  3IWK A;  1T90 A;  4I25 A;  4IDS A;  4WB9 A;  1AD3 A;  2EUH A;  3RHM A;  2W8N A;  5KLM A;  3V9H A;  1UZB A;  1A4Z A;  4QET A;  4L1O A;  3ETF A;  4ZWL A;  3PQA A;  4I3U A;  4OU2 A;  4QTO A;  5FHZ A;  4OGD A;  4QN2 A;  5AC0 A;  2XDR A;  4DAL A;  3ZQA A;  3MY7 A;  1BPW A;  1BXS A;  5KLK A;  3EFV A;  5EK6 A;  4I8Q A;  5F2C A;  3RH9 A;  4QF6 A;  3U4J A;  4MPB A;  3EK1 A;  2J5N A;  4I9B A;  5AC2 A;  4X0U A;  1BI9 A;  4NEA A;  3V9L A;  3I44 A;  4LH0 A;  1O04 A;  4LEM A;  4YWU A;  1O05 A;  2BJK A;  3N82 A;  4IDM A;  4DNG A;  1NZW A;  3R64 A;  4PZ2 A;  2EIT A;  2O2Q A;  4LH1 A;  4NU9 A;  4FQF A;  3RHR A;  4ZUL A;  3SZ9 A;  3TY7 A;  4A0M A;  2D4E A;  5A2D C;  1WNB A;  4X2Q A;  1O02 A;  4WPN A;  4I3V A;  1NZX A;  2ID2 A;  4X4L A;  2EII A;  4I3W A;  4IYM A;  5KLN A;  1UXU A;  5DBV A;  1O9J A;  4NPI A;  5EYU A;  3R31 A;  3V4C A;  5EXF A;  2Y53 A;  4NMK A;  2EIW A;  1UXV A;  3RJL A;  2W8R A;  4ITA A;  5ABM A;  1EZ0 A;  4E4G A;  4JDC A;  5J7I A;  1UXP A;  5JRY A;  1UXR A;  4KWF A;  2Y5D A;  1QI1 A;  3N81 A;  4LGZ A;  2VRO A;  5EUY A;  3V9J A;  1KY8 A;  3B4W A;  1UXT A;  5KJ5 A;  4I3T A;  2O2P A;  4QJE A;  4ZUK A;  4QGK A;  4I26 A;  4JBE A;  2WME C;  5J78 A;  1O20 A;  4MPY A;  4JZ6 A;  4NS3 A;  4Q92 A;  5EEB A;  3N83 A;  3VZ2 A;  5L2N A;  2JG7 A;  5A2D A;  4IHI A;  1QI6 A;  2EJL A;  4H7N A;  3K9D A;  4YWE A;  2ONM A;  4GNZ A;  4WJ9 A;  4I8P A;  4OUB A;  4YWV A;  3JU8 A;  4I2R A;  1UXN A;  4LIH A;  3V9I A;  4KNA A;  4U3W A;  2ESD A;  1EYY A;  4GO0 A;  4QJE B;  5A2D D;  3INJ A;  4GHK A;  4ZVY A;  4ITB A;  4OE2 A;  4OE5 A;  5DIB A;  1O00 A;  1A4S A;  3IWJ A;  4IT9 A;  4LH3 A;  4V3F C;  3VZ1 A;  5L13 A;  2EJ6 A;  2OPX A;  2Y52 A;  4PXL A;  4OHT A;  2IY6 A;  4ZZ7 A;  1NZZ A;  2VLE A;  4I3X A;  3QAN A;  4O5H A;  2BHQ A;  1EUH A;  2HG2 A;  2ILU A;  4H73 A;  4X0T A;  1VLU A;  4ZXU A;  5KLO A;  4QYJ A;  5DRU A;  2ONN A;  1O01 A;  2WME A;  2H5G A;  3RHQ A;  4F3X A;  3RHH A;  4OE4 A;  4LH2 A; 
#chains in the Genus database with same CATH homology
 3RHD A;  5KF0 A;  3INL A;  4GO4 A;  4WP7 A;  1AG8 A;  4KWG A;  1WND A;  3RHO A;  4H80 A;  4NMJ A;  2EJD A;  4PXL B;  2J40 A;  2QE0 A;  5EKC A;  4GO2 A;  4I1W A;  2W8P A;  3K2W A;  2W8O A;  5L2O A;  4E3X A;  2BJA A;  5KLL A;  3N80 A;  4K57 A;  2WOX A;  2ONP A;  2W8Q A;  2EHU A;  2ONO A;  5EZ4 A;  3VZ3 A;  2Y51 A;  4FR8 A;  2BHP A;  2EHQ A;  4PXN A;  4CBB A;  4V3F A;  4OE6 A;  4L2O A;  4C3S A;  3VZ0 A;  4CAZ A;  4GO3 A;  3ROS A;  3SZA A;  3PRL A;  2IMP A;  4O6R A;  3SZB A;  5AC1 A;  1ZUM A;  5L2M A;  4ZVX A;  5J6B A;  3V9G A;  1CW3 A;  2O2R A;  3JZ4 A;  3RHL A;  4ZVW A;  3V9K A;  2J6L A;  3RHJ A;  3RHP A;  4V37 A;  1UXQ A;  3IWK A;  1T90 A;  4I25 A;  4IDS A;  4WB9 A;  1AD3 A;  2EUH A;  3RHM A;  2W8N A;  5KLM A;  3V9H A;  1UZB A;  1A4Z A;  4QET A;  4L1O A;  3ETF A;  4ZWL A;  3PQA A;  4I3U A;  4OU2 A;  4QTO A;  5FHZ A;  4OGD A;  4QN2 A;  5AC0 A;  2XDR A;  4DAL A;  3ZQA A;  3MY7 A;  1BPW A;  1BXS A;  5KLK A;  3EFV A;  5EK6 A;  4I8Q A;  5F2C A;  3RH9 A;  4QF6 A;  3U4J A;  4MPB A;  3EK1 A;  2J5N A;  4I9B A;  5AC2 A;  4X0U A;  1BI9 A;  4NEA A;  3V9L A;  3I44 A;  4LH0 A;  1O04 A;  4LEM A;  4YWU A;  1O05 A;  2BJK A;  3N82 A;  4IDM A;  4DNG A;  1NZW A;  3R64 A;  4PZ2 A;  2EIT A;  2O2Q A;  4LH1 A;  4NU9 A;  4FQF A;  3RHR A;  4ZUL A;  3SZ9 A;  3TY7 A;  4A0M A;  2D4E A;  5A2D C;  1WNB A;  4X2Q A;  1O02 A;  4WPN A;  4I3V A;  1NZX A;  2ID2 A;  4X4L A;  2EII A;  4I3W A;  4IYM A;  5KLN A;  1UXU A;  5DBV A;  1O9J A;  4NPI A;  5EYU A;  3R31 A;  3V4C A;  5EXF A;  2Y53 A;  4NMK A;  2EIW A;  1UXV A;  3RJL A;  2W8R A;  4ITA A;  5ABM A;  1EZ0 A;  4E4G A;  4JDC A;  5J7I A;  1UXP A;  5JRY A;  1UXR A;  4KWF A;  2Y5D A;  1QI1 A;  3N81 A;  4LGZ A;  2VRO A;  5EUY A;  3V9J A;  1KY8 A;  3B4W A;  1UXT A;  5KJ5 A;  4I3T A;  2O2P A;  4QJE A;  4ZUK A;  4QGK A;  4I26 A;  4JBE A;  2WME C;  5J78 A;  1O20 A;  4MPY A;  4JZ6 A;  4NS3 A;  4Q92 A;  5EEB A;  3N83 A;  3VZ2 A;  5L2N A;  2JG7 A;  5A2D A;  4IHI A;  1QI6 A;  2EJL A;  4H7N A;  3K9D A;  4YWE A;  2ONM A;  4GNZ A;  4WJ9 A;  4I8P A;  4OUB A;  4YWV A;  3JU8 A;  4I2R A;  1UXN A;  4LIH A;  3V9I A;  4KNA A;  4U3W A;  2ESD A;  1EYY A;  4GO0 A;  4QJE B;  5A2D D;  3INJ A;  4GHK A;  4ZVY A;  4ITB A;  4OE2 A;  4OE5 A;  5DIB A;  1O00 A;  1A4S A;  3IWJ A;  4IT9 A;  4LH3 A;  4V3F C;  3VZ1 A;  5L13 A;  2EJ6 A;  2OPX A;  2Y52 A;  4PXL A;  4OHT A;  2IY6 A;  4ZZ7 A;  1NZZ A;  2VLE A;  4I3X A;  3QAN A;  4O5H A;  2BHQ A;  1EUH A;  2HG2 A;  2ILU A;  4H73 A;  4X0T A;  1VLU A;  4ZXU A;  5KLO A;  4QYJ A;  5DRU A;  2ONN A;  1O01 A;  2WME A;  2H5G A;  3RHQ A;  4F3X A;  3RHH A;  4OE4 A;  4LH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...