4YXLH

Crystal structure of syrian hamster prion protein complexed with pom1 fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
QVQLQQSGTELVMPGASVKMSCKASGYTFTDYWMHWVKQRPGQGLEWIGSIDPSDSYTSHNEKFKGKATLTVDESSSTAYMQLSSLTSEDSAVYFCSRSGYGYYAMEYWGQGTSVTVSSAKTAPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural and molecular dynamical studies of the globular domains of cow, deer, elk and Syrian hamster prion proteins.
pubmed doi rcsb
source organism Mesocricetus auratus
molecule tags Immune system
molecule keywords Major prion protein
total genus 39
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2015-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yxlH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yxlH02
1FZOB 1DTUA 2KL6A 2QR0B 3VXOB 3M07A 4WDIB 4PIRF 4MB3A 5IHUH 2JJVA 3GSOA 2CD0A 2XPGA 4HZLB 2FBJL 1MCFA 4OB5L 1C08B 2KZ1B 2HT4C 2AV1A 5AZ2L 1GHFL 4GRMA 4M7KH 4JFZH 2G5BA 2J1KA 4AEIL 4ZUSB 3BQUD 5CIPB 1G6RA 1IRAY 3RWFB 3U6RA 5E4EC 2UUDH 5KVEL 4JO1H 5DT1H 3OKMA 3BGFC 1PG7L 2DLGA 2J8UA 4AT6B 1MPAL 4PRIA 3ULUF 4H1LH 2FJFB 1FVDB 3WYRA 1K6QH 4Q0XH 3UJJL 2YUZA 2ZSVA 4N90D 5F6HJ 4PRBA 3QWQB 4KK6D 1NCBL 2Q76B 3RQ3A 15C8L 3DVGA 1FCGA 3NMEA 3LPFA 3WIHL 4I48B 3T1WA 5HJ3B 4JG1L 3L5XL 2PYEB 4UIKL 1T7VA 3ARDC 3LB6C 3EOYG 4PP2A 4TUOB 3KJ4C 4ALAL 3SE8H 4MAYB 4UB0L 3SDXE 5T3ZH 4NP4H 3G9VA 4WUUD 4E9LA 1IKNA 1JHLL 1WBXA 3B5TA 4DN3H 3PV7A 4BUHA 4ZD3H 3G04B 4G9FB 1HEZB 1QSZA 4QGTA 4YXKH 1A1OB 1H8SA 2UV3A 3KPRD 3BOVA 3REWA 1A22B 5AAWA 1GGBL 4OQTH 1I1AB 3ARGB 3SDCC 5J57B 4OLZL 1DVFC 4OGZA 4XCNA 5TF1H 2VDML 1QYGL 1BJ8A 5D70L 3WL9A 1OTSD 4XVJH 1BJ1J 4NJ9H 3QCUH 5IFJB 4J3WA 1FH5H 1J1OL 1VFUA 3FCTB 4G8GE 2VABB 4DTGH 1NC2B 5CJBA 4DUXA 5F7HA 2R8SH 2DWEB 1E4WH 1IAIM 4NO0A 4GLRH 4H26B 3THML 3ZT5A 1IKFL 3D3VB 2O61B 1L6ZA 3SE8L 4RSVA 5T3ZL 4WW2B 2I9LB 4WFGE 4LBEA 5EN2B 5LCVL 5F9JA 5IV2A 4PJEB 5FOJA 3H7BA 1J87A 3KYMA 2GFBB 2M2DA 1KYOJ 2OJZH 4DOHB 1EO8H 2D03L 3SDXA 1U8IA 4MZ3A 4DJMA 4XZUB 4NO0D 1INQA 4X83A 1GGBH 4OQTL 2QLVB 4MGXA 1KSRA 1C7SA 1LD9B 2H41A 4ZUUA 1UWXH 3DX7A 1XGUA 3LS5H 3MO1B 1U93A 2F19H 4YXLH 1RHHA 3LY6A 4Z0XB 4JRYD 4PTTA 5HTSA 2R29L 2GSGA 2H26B 2I07A 4RFNB 3WO3B 2PXYD 1FL3B 3QZWB 2OXHA 4X99B 3V5KA 5F7WC 3TO4A 5BW7A 3KPRA 3T09A 1IM3A 1FJ1B 4ZOBA 3WLWD 4F9PC 4N0FB 2V17H 4LVHB 3OHXA 3BPOC 3EGSA 3SQOL 1O0VA 3ARED 4Z7UF 1UFUA 4LSSH 4ZFZB 3MCLL 4XMLL 1T1ZA 3I50L 5CILL 3T0EB 1IVLA 1A4KB 3GDBA 1LP9A 5EIVA 2VXVH 2RBLA 2UZYB 2NLJA 3H0TA 2EYSB 3E6HA 1FDLH 4KJYA 4LL9A 4NWUH 3AM8C 4M8VA 2AJSL 1CD0A 1AGCA 1IT9H 4EI5A 1SY6L 1AH1A 4E41D 1ZVSB 4G6JH 5F9DC 1FVCB 2D7OA 1QFWI 1ZK9A 3K8LA 3BQUC 3GBML 5EU6E 1EZVX 1Y18B 3QUXA 3IJHA 2A74A 1DQJB 1T2XA 5TF0A 3IAPA 3M17A 4U6YA 2B1AH 4ODHL 1A9BA 4ONFH 1KNOA 1RHHB 4UBDD 3BPOB 5D7IB 1QSEE 2FX9L 2DYPD 2X9YA 4PGCA 4UMGA 5FIEA 4N68A 5GRVK 1ZEAH 4X5XB 2VDNL 4PJ7B 1V7MH 1RZ7H 3EJJX 1AD0B 1MEXH 5FKPB 3T1FA 3B5GA 3SKNA 3S98A 3PG2A 3PQYD 2DS4A 2OS7A 1I9EA 1T6WA 5K9OA 5KZCD 4CVXA 5EO1B 2YK1L 4LCUA 5MENE 2QSQA 1UXWB 3VI3F 3BUYA 4P57B 5D2LB 4KI1A 3TIDA 3ARBB 4HK3N 1UB6B 4K3JH 1AR2A 1ED3B 2YD2A 4M7LL 5EBMB 2ILLA 5D7LA 4PBWD 2VTFA 1SBSL 1WC7B 2R2BA 4K71C 3TWCH 1S7SA 4LCWB 3BW9A 1K5NA 3TPKA 1AJ7H 3RA7L 4Z7WA 5FM5O 1JBJA 1LO0L 1DN0B 1N6QL 3T77A 3DX6B 4ZFOL 3B3IA 5L2JB 2LVCA 3E1F1 3IXAB 5AEAA 4NHUA 4JREB 1F90H 3H8NA 2WAHA 4S1DD 5HHMB 3LSOB 1ZHLB 4FFZH 2VSCA 3OKKB 4K55A 2RJMA 4R3SB 3GB7A 1JNJA 2LU4A 5C08E 2C4XA 3MLYH 2BVPB 1D9KA 3DRQA 2VWEE 4U1NB 3FOLB 4M6ML 3ZO0A 2N7AA 1MREL 2QJDA 2W59A 1JGUL 3O81A 3W82A 5DJCB 3EO9L 3HMWH 1JI2A 1BIIB 3MRMA 3QDJD 3TZVC 4M1GH 4ZSOB 2R69H 4KJQC 2ZG2A 3ESUF 5TGBA 2VLRB 4XP9L 2X89A 1CLCA 1U8HB 2VDPH 1N5YH 1ES0A 2VNCA 4JREC 2WW8A 4WI6A 4X6DA 5I8CB 3CXHK 4XCFL 4KHXL 4HSQA 5TPWL 4OZGE 2XTJD 4LIQH 2Q3ZA 4IOIB 4GH7B 3U83A 1NL0L 3BKCL 1NDMA 2DQCH 1LWRA 2KUTA 3DI3B 2D2OA 5KG9A 1F4YL 1CYGA 3QIWA 4B53A 2GAZB 1U3HB 4D8PB 4JFEB 1TPXB 1EHLH 4PJFF 4TNVK 1A6WL 5EIQA 2BFVH 3QDMB 5CSZB 1X5IA 5IEKB 2NR6D 3F7VB 4U1HB 3S3PA 4H88H 4P3DA 5F7YC 4HJ0C 5EU3A 3DETD 1W72H 1IAOB 1QLFA 2HRPL 1CXKA 3ULUD 3ORJA 4D0CB 1BOGB 3OKOA 1VPOH 3PUCA 1EJ6A 3MRNA 2HG5B 1KYOK 5E4EB 3MRDA 1OGAD 1TVDA 3VGEA 5JDSB 3T0BA 4Q9QL 1G7LA 4IRJA 2QKIA 3EKCA 5JOFA 2CQVA 4LOUD 1INDL 1BZ7A 2HTLD 2AI0L 4GRWB 4OCXL 2QQLH 2AP2A 4G6KL 3C2AH 5J6GA 1EZVY 2ZCLH 3O11B 5DURB 4HV8B 4YHIA 4XBGA 2QADC 2X70B 5HHOA 3WFDH 4JZJC 5CSGA 5AYUH 5T1DH 5SWZA 4HF5L 4HXAL 1U6AH 4P5MA 4P4RA 5GPRA 1DQQA 5I1LB 1T21A 3P77A 1WZMA 1A3QA 3MA7B 1A4KA 4FTVD 5E8PB 1MJ8H 3GHEH 1KEGH 1FVEB 5E5UB 4YQXH 3UEZA 4QRPE 5IW6B 5F7EL 2H9GB 4BSWB 2AGJH 3MNWA 3RAJL 3MV8E 1RK0A 3VXNB 5ILTL 2NNAB 1FC1A 3WHE0 3O3EB 4LSDA 1IGCH 4C56D 3BZFA 3MYJA 3OKDA 4XCEB 3MRBB 4GAJL 2P48B 5EORH 4NSKA 3U7YH 2F58L 2I5YH 2G60L 1N8ZB 1UZ8B 4YX2H 1QR4A 1ORQA 4YFLF 4HCRA 1LP9E 3F7PC 2D3VA 1KN2H 3V6OE 5GSRB 1CDIA 3FZUD 3E8UL 4PB9L 4XNMA 4QTIH 3DX6A 4P2RD 3TNNA 1LO5B 5EZLA 2R2EB 3UTOA 2PW1A 2BY1A 3SDDB 3VXMA 3GJEB 3O6LL 4I48A 4I0KA 3TIDB 3GSXA 1EHAA 1F42A 2Y4SA 3MRNB 4YAQB 5FUOL 1KG0A 1XF4A 1H3GA 3O6FC 5GRVL 2C3VA 5IB2B 3O4LD 4M6AA 1BVLB 5E2TH 3WSQH 5IJKA 5FGSA 2EXYC 5J9PA 1Y6MR 4OQTA 4TTDC 4PJCA 1AXSB 1OAYL 3JWDC 3V4VH 4BQCA 1QFUH 1OD7A 5DQ9A 1EFQA 2IG2H 3L3OA 3SE3C 1S9WB 43CAA 5I8EA 2AV1B 4GFTB 4UV7H 3GNMH 2NYYC 5HHQB 4F8TA 3O6LH 5F1IA 1EAPA 2MTPA 5D5MB 3N50A 3AAZA 2K7PA 1K8IA 2JJTA 4KGLA 1YN7B 4FG6C 1FL6B 3OF6A 4GG6A 3H9HB 3S4SB 3FT2B 4G8GA 4LHQB 4TSAH 1H3PL 2GHWB 1KPUB 3TBVA 1NFDF 4PS4L 5DEGA 1MFEH 5ANMA 3WIIH 1CXIA 3OAZH 2BHYA 4YHNB 5ESQA 1RZ7L 2MOVA 4QRQA 4OLVH 3HZYA 4ELMA 2W60A 2PW2A 1RU9H 3R06A 3CMOL 4WO4D 4X4YB 5LJYH 3VFOB 4JY6A 5E6IB 4YBQC 5C0DA 5FM8A 4PJGA 3EGSB 4BQBA 2WSKA 3JTSA 5JNYA 1CGXA 3PIQA 1MCNA 1RUQL 3QNYB 2YEZB 4JGMA 3UP1A 1JHTB 4JHBA 4LVNB 3T04D 1A7RH 1R3IH 3NACH 5IQ7L 4UNVA 3O4LE 4O2CA 1QSFE 2HJFB 3R8BB 1H0DA 1JNNL 1OAZH 4HMDA 4UTBL 4BFEA 1QBBA 1ZA3B 3D18A 4FQCH 2WWMC 3MJ8A 2OZ4H 2AQ1A 4EZMA 5E5MA 4U1KB 3BD3A 2BNQD 1TNMA 3HC4H 1NCTA 1MWAB 1LD9A 2EYTA 2A9NH 3M8OL 2FEEL 1H3VA 4JZJB 1A14H 3AAZB 4RMQA 5C0BE 4UIKH 1KCRL 3VU2A 2RB8A 3LCYA 2JJTC 3LQAH 5DJXA 5DJ6A 4ISVB 4QRRA 1QP1A 2JTDA 3RUGF 3U9PH 3HS0B 2J6EL 2B5IB 2GJJA 4U7MA 4CNIA 3VFVA 3DSNA 4YO0A 5T5FL 3TA3C 4XP1H 3FB6A 1JK8A 1S8DB 1W72A 3BQUB 3L3OB 3EIFA 2DM7A 4UU9A 5K59E 1NFDE 5C9JA 5ICZA 4JFFD 3QNXB 3D2UD 2OZ4L 1LHZA 5E2UL 4G6ML 2EDFA 3HPLB 3GJFH 5LGHH 3SN6N 2VDMH 3I3BA 3BVNB 4OZHF 1KGCD 3X3GH 4F7TB 4P4KB 2ORBL 2APXA 3KPQB 5AYUL 5T1DL 1D5XB 1JPFA 3ZTNL 1P4LA 4Y7MA 3VFRB 2XWTA 4NYLB 1MCOL 5FV1L 5EZLB 5KSVA 2AK4D 4MNHA 4WUKH 1GGYA 3STZB 3VGDA 3GHEL 3QFJE 2NW3A 1KEGL 2ARJB 2CLZA 4NGHL 4KTEH 2DTMH 2AABH 4GW4A 4JM2C 4PJHB 2V2WA 4ZFZA 1AQDB 2X10A 5FO7B 1KFAL 1YQVL 5EBWA 1K2DB 4OLEA 3WFCL 2O5XH 2EXYD 3DO7B 5GS2D 1GXEA 1OGTB 3MRPB 1F6FB 2AJYL 4HX1A 2ZCKL 2P46B 3QIUB 4GO6B 3TH2T 3VW3L 5MHSD 3L3KB 5DURD 1CLZH 2JCCA 5EA0H 2NY6D 2BJML 3MROB 3QNZB 4HX1B 1RFDL 3NCMA 4XX1E 4I3RL 4LQFL 3RVWD 1HHKB 2YZ1A 5C8JB 2OTWA 1SVZA 5C9KA 1CFVH 4DGYH 3GIVB 3ARXA 1EGJL 3W9EA 4HJJH 1SY6A 4NN5C 5IHBA 1CK0H 1OSZB 5K9QG 3FN0H 5D7JA 4CMHC 1HH6A 1P4LB 2V2TB 1RAMA 3UO1L 2HJLA 3MV7E 1YEKL 4ODSH 4JLRB 3F7YB 1S78C 3D3VD 1ODAA 4FFVC 3OKDB 5TGBB 5K9QI 2XYCA 3HPLA 5L6YL 4HHAA 4HIIA 4I8DA 3V95A 4N8CL 3VXSD 5JHDA 4G6AD 1QKZL 4K3HA 1FZMB 4I0PC 1MELA 2COQA 1WWCA 4X6BB 2VDOL 3EAKA 3O4LB 4GXVH 1ZS8B 1NFKA 4L4VB 1CFVL 3WLWC 3KJ4B 4R4BB 5C7XL 4F57L 2JJUA 1BZQK 1A1OA 3MLZH 3VI4F 3MCKA 3MRIA 1ZHLA 5CCKH 4WU7A 3QDMA 1TXKA 4IEFB 3WD5L 4PRHB 3KVQA 1EO7A 4X7TA 4CUCA 4P2OA 4BK5A 4JO3H 1R6VA 2EKSA 2Y23A 4Y4HC 3HAEB 4J23A 5IMOA 3TT1L 3EOBA 4DKAA 4NCC2 3WUWG 4PD4J 3BSZL 1WVZA 3ARQA 3ARZA 4E41B 2UVEA 3DURB 2XRAH 1XZ0B 3NCCB 2QKIB 2DQIH 3U4BL 4KZEH 4FFZL 1HHGA 4UOJA 4PLNC 1VSCA 4RNRA 4H25A 4X6CA 5FECB 5DD5L 1OTUC 1B6DA 1PKQB 1R24A 4XAWL 1SQ2N 5DUBA 1JTTA 1KACB 3QHTC 1RK0B 3TA3B 4DZ8B 3O8XC 1X5GA 1B88A 1KXTB 2OQJA 3UYRL 1PG7X 2EDOA 5DJDA 3V52L 5DMJB 1DEEA 2BP3A 5E94B 1N0XL 2AXFA 4PGCB 4KVCL 4NBXB 2F74A 4FQXB 5BRZD 3BPLC 1CXEA 4YO0B 4YNYA 3KAAA 4G9FA 1G0XA 3K3QA 3MRHA 1IM9A 3CSYB 4CBPA 3WNMA 1NJ9A 2P8MB 5DUPH 3S34L 1RHFA 2UUDK 2YA2A 2IPKB 4LLDA 3UC0L 4W6XB 3VG0L 5BS0B 2NXZD 4YGVB 3VRJA 3WMSA 2A73B 12E8H 4H5SA 2NY1D 4OCRH 1U9KA 2ERJB 3HNVH 1KIQA 4XP9H 5IESL 1XCQA 3B9AA 2X4RA 5D1ZC 1BBDL 4WTWA 1M6OA 3ULVD 3EOAB 4WHDA 1KB5A 4HEPG 3HPJB 5BMFL 3PHSA 5JW3L 2QQQA 4FP8L 1VENA 2FB4H 4ZO7A 4XH2A 4LLMA 5DFVC 4LKXB 2X4UB 1YEIL 2EDEA 1EV2E 3M1BA 1OAXL 2EDLA 2J88L 1JPGA 1U8NA 4LEOB 5CSZA 1U3YA 4ZMAT 2VDLH 3UTTA 1MRFH 3GK8L 3QFJD 4JFOA 3OKLA 4LPCA 3TVMB 4C83B 3CZFA 5D5MF 3MREA 2IANE 1R3HB 4ODUB 1T83C 2WINB 3MGTB 3VDCA 5DGRA 5EU6D 1QOKA 1MHCB 2C1PB 1MPAH 5DEFB 2PXYB 1KTDA 1MHPH 5IJVB 3MV9E 4QHLA 4U1LB 4PJAF 1CDBA 3SDXB 1LGVA 3UTSE 3GFUA 3OAZK 1CS6A 3RP1A 1RZ8B 5FGBC 1CVRA 1UZ8A 2P47B 4HUVB 2VDLL 5C0GB 5DUMH 5ELIA 2XXCB 4LFHD 2XV6B 3U46B 5J6HA 5EU7E 5HDOA 3RVTC 3QXAA 3BKYH 1QZ1A 3E6FA 1XGPA 4KDTC 1GAFH 1ZAGA 5H2BB 1IGYB 4EBQH 3ZSSA 1I1CA 4BA8A 4UILL 4YXHH 3ZLQC 5I74C 2EYRA 1G9MH 1I1AA 3ARGA 2O5ZL 4FXKA 1KIPA 4JKPL 5HGHB 3F5WA 1QQDA 2ZJSH 3QFJA 1EGJH 4P9HC 4WFEE 1JV5A 3VXME 4I77L 1P53A 5E5MB 1OAUL 3PHOB 3ALPA 4P4RB 3ZMRA 5F9WC 1ACYL 4W4OA 3MJ8B 1MHHA 1WT5A 3V4UH 1MY7A 4JKWA 2Z93A 3U7YL 3SE4C 4QXUL 5ITBL 4JRXE 1UM5L 1LEGA 4LU5L 5SX4H 2DICA 3HI6H 5D1XC 2OZ4A 1NCDH 3QUZD 4XT1C 5F1NA 3E0GA 1AQKH 5C0NC 1GH7A 1MJ7L 2WUBL 1QFPA 1MAKA 1QFHA 4IMLA 4Z77B 3PWUA 1A1NB 1P4BL 1RZIB 3TBSB 5INDB 1ZHNA 5BO1H 4YHMH 5E24E 1BM3H 2P5ED 3CVHL 2HKHL 1Z6JT 1AKJA 4LEXH 5DYOA 1QFWM 3LKSB 4ZUVA 1JZ5A 3I75A 4I77H 1QBLL 3QEQD 4LHUG 2HN7A 3MFFB 1LK3H 3OJ2C 3BI9X 3BDXA 3NIFE 2HFFB 3QQ4B 5JUEH 2XZCL 3BPLB 2C3WA 4ZNEA 3TCLB 5IW6A 1Z9LA 1S7WA 4LNRA 1ITBB 2WBJD 4DQOL 4JN2A 2NXZC 4EI5D 1FFNB 3RWHB 4DFIA 4PJAB 4QEGA 3QIBA 3TGXA 3TF7C 2Y25A 3FONA 2HJKA 3T0EE 3V4PH 3ZTJG 2A2QT 1JTOA 1G7QA 5DHVA 2BRQA 1BQLH 1A6PA 1LDSA 1VGKA 2ESVE 4WTZG 4Q6IB 1SBBA 2HKHH 4LPWA 1C5DA 2QHLA 2APTA 3FOMA 1FBIL 3VXSA 1QFOA 5JHDD 1K8DB 3MRJA 4FRWA 4AEHL 4JY4A 3MRMB 2B4CC 4OLXH 1AGFB 1IQWL 2QEJA 3B9EA 3KLHC 5JOFB 4HWEL 1U3ZA 5J9PB 4KPHL 4XPAL 4WY7L 5J3HD 4CN6A 2YR3A 5KVMC 4EN3A 3VFPB 2ZSVB 2XZAH 3NCYP 3LKPA 3MZTA 1OARL 3MGOB 4XWOC 2Z31A 3BN9C 3QUMA 5F96H 3D87B 3GB7B 2XZQH 4MLIA 5MI0B 4CNIB 3PDDA 4WWKD 1G6RB 5CIPA 1YMHB 3D69B 4QRRB 2JB6A 5HYIA 3QEQE 4JPKL 4H88L 4RGOH 4M7JH 1VCAA 3K4ZA 4EUPH 1QYGH 4Y5XC 3ZYJA 4QYOA 5I30L 3FT4A 2YWYA 3QCUL 1CLOL 5CZXC 1PKQA 5F7FA 2D7TL 4HKBA 1T0NA 4YE4L 4RAUB 3RVVD 1MIMH 4OCNC 4HK0B 1KBGL 1CLYL 3QWOB 3MRBA 2KPNA 4JFHE 4M1CC 4JM2D 5TDNA 2GJ6B 1TCRA 1C16A 4D0DB 3ROOA 5KSAD 3LD8C 2HKFH 4OF8A 1T66C 2YEZA 2ICCA 5D2NC 1MH5A 4CRPA 2YUXA 1UB5B 3HE6B 3QXAB 2VUYA 1RJLA 2DLFH 2X44D 1I9JH 5E6ID 1KPVB 4QXWA 2P7TA 4O9HL 2PW2B 3H9YA 3R06B 3BISA 3HR6A 2F19L 1CDUA 4G9DB 4YHOL 4YHNA 4U2YA 3OXRA 4ZDHB 1NFDB 1S9YA 1FYTD 2XWBB 4QHUA 4U0QB 3PJSA 3QXDA 3QXWA 4Y4KB 3V6ZB 2FDBP 2G75B 1QD0A 4P23D 5F1KC 3VD4A 3CU7A 1CXHA 4J1UA 5ERWA 4XNYL 4JZJA 2NXYB 1MHCA 1S9VA 5E99L 4NN5B 2VLRE 4NNYB 2PF6A 4NUGL 4X5WB 3CFJA 4NQCA 3L3DB 3QDHA 4HC1H 3H3KA 4F58H 1ZT4B 4WTZA 1JWMB 3X3GL 2NY4C 4PJDB 4WUUE 5TE7L 3MRJB 1U8OA 4FMKA 3IJYA 4R8WL 1QO3A 3VRIB 4WI9A 5IMKB 4PREA 5IW1A 4LP5A 5I8EB 1JVKA 4HKJB 2FLBT 4P2CG 2A83A 5KVFL 4KZDL 4NCC1 5IQ9A 4CGTA 3IFOA 3WFDL 3G5VA 4FOMA 1HCVA 3DHMA 3VD5A 3ARUA 4S2SA 4K71B 4FQIL 3HB3D 2AJVH 4HWZA 4BQ6A 4XNUL 1HI6A 4WHCA 2HVJA 5J7CC 4I0PD 3IGAB 4PJ7A 3U6RB 5A2LH 1YPZB 3ZE0E 1G0DA 2UWEF 4RRPG 3IS0X 4D8PA 3FQXB 4X6FB 1FYTA 1IGML 2ZKHH 3H6JA 3RX7A 4GUPA 3R0NA 5D7SL 4ZQKA 1CVSC 4OT1L 3VFSA 2Q8AL 1UEYA 5GGQH 4RFEB 1D6VH 5DA4A 3WN5B 3MROA 1T7ZA 1MFCL 4OF0A 2CUIA 4P9HH 3A6BL 3RL2B 2JK5A 2WIMA 3JVGC 3QISA 5HI3C 1JIBA 4C57C 1AD9A 1U8HA 1KELL 4XNXH 3UX9B 1NCAL 3PWPA 4BK4A 4F7MA 1AQKL 3AGVA 3MFGB 2DJUA 5IESH 4PJFE 4TOYL 1KXQE 3LVEA 4LFHG 1UENA 3N85H 5D8JH 3HC3L 3TNMA 2NLJB 1V3LA 2HT4D 4POZD 1IAMA 4XVTL 2VZUA 4WFHD 2A1WL 5BJTA 3INUH 3QUZB 5ISZE 1YPZF 3L3IB 2GJ6E 5D2NE 4APQC 4R7DA 5DRZB 4AG4H 1WIPA 4XHQA 4OFIA 3JV4A 3FONB 3HE7A 2YRZA 5KS9F 3S88H 5I8OH 1P7KB 1I3VA 5E08L 2XWTB 4NYLA 3QIUD 4OQ1A 5IFJA 2R0KL 5I1KH 1M1SA 2VXSL 4PRID 1RMFH 4YWGL 1QQDB 3OF6D 2LFGA 4UV4L 1A9EA 1FG9C 3QEQB 4FMFA 1GC1L 1IFHL 2OSLB 3STBA 1GGIH 3AS2A 3KPSD 4YHKL 3ARDD 2QADB 3LB6D 5ISZA 3G9AB 4ONHA 5CZXD 4MHHG 5FKAA 4UU9B 5C7XH 5DMGC 4WEBH 3LKOB 3RZCA 2DQIL 5C0AE 2ZPKH 1XF1A 5JHLL 2IH3B 4NQEE 1PKQE 1T83A 2R0WL 2IAND 2WLYA 1T66D 4MJ5A 3FO1B 4TNVF 5DJ6B 4LEXL 3MV7B 5EORL 5IG7A 5D1ZD 1MRDH 4IRJB 1KN4H 5ESVB 4LIQE 5B22A 2VDQL 1R0AL 1ZS8A 2PTTB 3I6KA 4FFVD 4WU5A 2EIZB 1TQCC 3S8WA 3D2UA 2N1KA 3C08H 1WAAF 4TNWK 4OZ4A 3VFSB 1J88A 3DROA 4OJFL 4RISL 4HIIB 2X2YA 4GUPB 5GGVL 2RFXA 4IIQC 3RWGA 1NANH 3F6LA 2B0SL 1W0WA 3V7AE 5LCVH 5IFHH 5DUPL 5I1HL 1OAUH 1PFCA 1YYLH 4K7PY 4MCZA 3SDYL 5GGTH 2GSIA 3MRGB 5K9KB 4XB7A 3ISWA 2HTKC 3NIDF 1DLFL 5IW3A 4PV8B 5D7LE 4HIXL 3HRZA 3L95B 3W0WE 2DQTL 1GZQB 1CFBA 2ITCA 1HXYB 4KK9D 4NZTH 5MENA 4L8SA 2ID5A 7FABL 4X98A 5MP6L 5FUCE 5E5RB 5FO9B 1CIDA 1HXYA 1MJJB 1INEH 1ZXQA 5EBGA 4YEEA 1I7TA 3AS3A 4OF3A 2NY3C 2WP3O 1FNEA 4HCRH 3OKOB 4XC3H 3OJDB 2DQHL 1NLDH 4XHJC 5I1JH 1MRFL 5DK2B 5F8RC 4GJTB 3O9WC 5BQ7A 3EDKA 5EO0A 4J3XA 2AXGB 4Y5VC 4ZQKB 1P84K 3B9KB 3MGAA 4OGXH 1FFNA 3QHFH 3AREC 1QLRA 3GSNL 4QRPB 5KS9A 2OM5A 4TN9A 2R1WB 4S0TD 2G60H 3AB0C 2YRLA 4X4XB 3PQYA 5HI3D 4AEFA 1CI5A 1I1AD 3ARGD 4QHKI 5EPMA 4LEOA 4KHTL 4L4TB 2OQJB 1ZHBA 2GCYB 1DE4A 3DRTA 1DQLL 4DZ8A 4Y16C 1FHGA 1T7XA 2ZSWA 4GOSA 2YPLE 4X6EA 2Q1EA 4Y2OA 2XWJA 4MXVE 2VRAA 3DUUA 3QZWG 2PTTA 2APFA 4JR9H 5IW1B 5DDHA 4F7CA 3U7AA 4ACPA 5BRZB 1W0VA 3QUZC 2VZSA 1KLGB 2FD6H 5EUKB 2CUMA 1IM9D 4LKCA 5BS0A 1LDPH 3U79A 1OAKL 3TO2B 2FX9H 4PV9A 1MWAH 3TT3H 1X5AA 4UI2A 5L2KB 2IBGA 2FATH 4YDKH 5IM7B 3FOLA 2BXZA 4NCDA 4QXTA 4FQ1H 1QPPA 1TLKA 4M6MH 3UO1H 5JIPA 3GKWL 3MUY1 5C07A 2GSIB 3MRGA 4FA8A 3VFVB 1MFCH 2XA3A 4QXGH 2AAVA 5CGMA 2CO6B 3SGEI 4MMZC 3O3AA 1RUML 2E8ZA 4NO3B 4U7KA 3BE1H 1JYWA 5CGTA 4AEIH 1RIUH 5T5FH 1HYRC 3TN0C 3VXNA 3BPCB 2CJUH 3WO4B 3MMEA 5C08B 3ZKMC 2PYEA 3X13A 3QUYA 1X7QB 5D7LB 2JELL 2Z35B 5EZIH 1KBGH 3LN4B 3RGVD 1C5DB 1HHHB 1T5XB 1G7IB 5CD3B 3T0ED 3IKCB 4JFDE 1F4YH 1AC0A 3QRGH 2ZCHH 1JHLH 3L3JA 4C56B 3IDNB 5IVXF 4GRWH 4DUVA 5ADPL 4HMEA 3WN5C 1H8OA 2DQDL 3W9EB 5IVXA 1ZGLB 4DFHA 5C0IB 3G6JE 1IGMH 3IJSB 4XVUC 3D85A 1YECH 2C1PA 5FUZH 1DJSA 4PRNB 3OGCA 5GGQL 3KXFD 2VITA 4C58B 4TSCH 2E9IA 5IOPA 4KKNA 5AD0B 4MA1B 1ORSA 1M71A 5KOVC 4U6VL 2EE2A 4YXKL 5C07D 4ZYKA 1NAKH 3I75B 1B4JL 2R23B 3KR3L 5C92A 5JR1H 3A67H 5L8LB 1J11A 1WFOA 1FFPB 4TOYH 3NZHL 1RU9L 2RQ8A 4LRNH 3CFEA 3C6LA 1RD6A 1M05A 2KBGA 5FYJE 4F7EB 2FRGP 5TQ2H 4XCFH 3BWAB 4F33A 1BQLL 1A3RL 1N2RB 2R0WH 3T3ME 4GMTH 3PABB 4OSUH 4KROD 2XIDA 1Q94A 3SKJL 2NY7L 3LDBB 4L8SB 4PJEF 2D7MA 2JIXB 3H42L 3G6JA 1HZHH 2RCSH 5BCAA 1OB1A 4B7LA 2R1XA 3DO3A 4G3YH 4ODXB 2DWEA 2R2HB 4XP5L 1CFTB 4JPVL 2VABA 1KJVA 4PJCB 4FQXD 5DVKA 4ZUTB 3NFNA 1IEHA 1MVUB 3U1SH 3QG7L 2P44B 3OXSB 3P2TA 3ZE1E 2NY0B 3ETBF 1G6RL 3ARRA 5E6ZA 1NMBL 4M00A 3ULUC 5E6IC 1NBVL 4RZCB 5LXGL 1BECA 2R56H 3LEXB 3MLWH 5SWSD 4IM8A 4U7SA 3ARTA 4JM2F 5FDWB 2Q8AH 1FORL 1D6VL 4LOUC 4NFDA 4E42B 3P4OA 2X41A 1WBXB 3NCJL 4J6RL 5J6HB 4AH2A 3ULVL 1CG9B 1L4IA 5DJDB 2IFFH 3HR5A 4JFPB 4YE4H 5C07E 4WUKL 1CGVA 4N1CA 5D1ZA 5EU5B 1R0AH 4EQ2A 4PRPB 3SGDI 1P1ZA 4KI5E 3GSRB 3WHE1 2BRRH 2ED7A 2P8PB 4NZRL 5FF6A 1ZHKB 3QDGB 1J0YA 4PJHA 2X89D 1C8PA 3TN0B 1BBJB 1VFOA 4XNZB 2I60H 5JXED 1P84J 3T3MF 3VG0H 3S88L 1G7JA 5T5NF 1D9KC 3QIBD 2B2XH 1FAIL 2H2PC 2FJFA 5AUMB 1WK0A 3VFMB 1T80A 3GJFA 5E2TL 3C8KA 1WZ1H 5AWNL 2WP3T 1MUJB 1SEQH 3P4MA 1FO0B 2M8XA 4XXCC 2R39A 5TE6L 4LMQE 4HKXB 3GBMH 5DUML 1NBQA 1T21B 3OR7A 1B0WA 3DVNA 4WWKC 2BNRB 5HVFB 3IFOB 2Q7YB 5C09B 2R2HA 2HYMA 1RIVL 4N1HB 2R1XB 1PBYA 2VQ1B 2VXQH 3MRFB 2FR4B 1GVIA 1DR9A 2IAMA 2XG4A 4H0GA 3GMOB 1J1XL 4XTRD 1OAQH 1RFDH 3LZFH 3NAAH 3MJ9H 3D39A 3GGWB 3SY0A 2DQHH 2E7HA 1TZGL 4N9OB 5E99H 1KTDB 2IC2A 4D0BA 3I6GA 4HAFA 5HVGB 1F2QA 5GS1B 2GYSA 3BO8A 3GIZL 4R2GD 4LCCA 1I1YB 1CGSH 3HTLX 5GS1C 1QLFB 3O6FD 5CJQL 1CXFA 4IRSA 4P4KD 3WKML 3OXRB 3U0PA 3GEWB 4LSUL 2EYSA 4GMSL 4MS8D 4Z0BL 1YEKH 3HFMH 3UBXA 1JNLH 1AGEA 1JGDB 2V5RA 4WEMB 3NABH 4CVUA 4MZ2A 2N4IA 3CC5B 5CFHA 3C8KB 3L5JA 3ZHKA 1AHWB 1T2JA 3F12B 5ENWA 2FX7H 4LGRB 5HY9A 3ZKND 5CJOH 3CMGA 2AJXL 3O6KL 2FB4L 1MCKA 1GIGL 3BX7C 1MNUL 4JANB 3TH4T 1IGTA 3O41B 4FG6D 4EN3B 2FL5B 3HA0A 3HC3H 2FH6A 5C0RH 3V79C 4O58L 5IVOA 3QT2A 4YZFE 4OM1H 1XZ0A 4MNQA 5F93C 4PTTB 2GTWA 4UNUA 1TQBC 1D5ZB 1DUZB 2IQAA 3GMOA 4M9PA 1BD2D 4XBPB 4D94A 3CFJB 5JXAL 3PNWB 5JZ7C 4DKDC 4TSCL 3UBXG 4PJBF 5I1JL 2G2RB 1QLEH 4I3SL 3UAJD 2D31A 2BNRA 5F1IB 4MJ2A 3FO9A 5FA3A 2EEAA 3DVNB 4K8RC 5JPNA 2VO5A 5IK3A 5JOPE 2DQFB 4KQ3L 3QO1B 2NQCA 3SKUD 2FO4A 2GY7B 4P2RE 1MAML 2XA8H 4OIBA 2Z31C 1A7RL 4M7ZC 1C5BL 1CR9L 5L9DL 3TPUA 4AY0A 2BVEA 1DEEB 3O45A 4N90E 3UTPD 3O3EA 4TSBL 1QEWA 5IHLB 2WBJA 1AR1C 4ODTH 1MVUA 3WS6A 1QSVA 1M7XA 2ORBH 2R29H 1F4WH 2C1OB 2HLFC 1Q9OB 4N0UE 4W6YB 1OM3L 1QEWB 1XR8B 4OGYL 3VXUD 3DMMA 5CP7A 5F7LB 3VFTB 2VR9A 5D70H 4P2OC 5EDXA 4NNXB 4KRPC 4X9HA 4M48L 4OLWH 4HLZH 4M1DL 5DLML 2CKBA 4KK9C 2E7LA 3JV6B 4Y16A 5GJTH 3GI9L 1J9CT 3BIKB 1FO0L 2Z9TA 2VE6B 1X5FA 4IS6B 2PW1B 2C3XA 4Z7VB 5IMOB 4F7MB 2PR4H 1XGTA 4JFPA 2X7LA 3UPCA 4EN3D 4HULB 3Q5OA 1QA9A 2BVYA 3CXHJ 3MJ7A 1HOCA 3CFCL 1A3LL 2D7TH 1MHHB 3WFHB 4YZFF 1PQZB 4LSPL 3VFWA 4EUPG 2OSLA 5TFSL 4PJ5D 5KJRH 3ULVF 4NWUL 3D0VA 3GMQA 2IBZY 4J4PA 3RWJB 4UINL 1U8LB 3DECA 3BZFB 3MYJB 2XQYK 4X80H 4MJ4A 1MFNA 4LP4A 3VFPA 5KS9E 1BAFL 4CDGC 1ZVSA 4IOFC 3MOBH 5E8DH 4ELME 4WWKB 3AU1B 8FABB 4IMLB 3P9LA 2W65A 1RI8A 4AENA 5EFIB 4MJIA 2H9GA 4RX4D 2ADGA 2VISA 1EEYA 3ULUE 5HVHC 1IGCL 3PGCB 4QCIB 3AY4C 3HPJA 4LMQI 1NGXA 3UCRA 4JFEA 4XVSL 4WHYG 1X4XA 2DTSA 4GG6E 1WIOA 1LO2L 3RGVA 3BZEA 4NDMB 1CD9B 2CRMA 4RGMC 4U1IB 2VDRH 1T1WB 1JZ3A 1RZJL 4WI3A 1KPUA 3KPSB 3RRQA 3RWHA 5I8CA 4JKMA 1KIUA 2ARJQ 2VXVL 4YGVA 4MA7H 5FA4B 5GGRY 2NX5D 2VLJD 3U36B 5I71B 1AGBB 3ZTJH 5JXEA 2CDFB 4PY8I 2NY6C 3FQUA 5TE7H 2GIYA 4JFDD 3V4PL 3QDMD 4WI8A 2BSTA 1IGYA 4JZNA 1EA9C 2O93L 2VQTA 1WTGT 1Y6NR 4U6VH 1BQHA 1A21A 3WBDA 4NKOB 1KGCE 1NAMA 3DBXA 3V6OC 5J1AA 1Z5LA 5DQ9B 4LLUB 4R4FL 2EIZA 3QQ9C 3WO4C 2F53E 1KENL 1GGTA 2BNUB 3D85B 3DX8A 1U8NB 1JPGB 1D9KB 5LVEA 3CSBA 4K23L 4L29B 5K59F 3OKKA 3D25B 5C09D 4IS6A 1CF8L 1FZKB 3G6JF 1QBML 5DJXB 1IBGL 4UILH 5TDOA 1QFUL 3TBWB 4G8EB 4OCMC 1CDGA 5TH2B 1ZLUK 2YUWA 4H26A 2EYTB 4D9LL 1UWEH 4A6YB 2FATL 1PG7W 2XTJB 5IROC 3HMWL 5DVMA 1MCRA 4RFOL 3IRPX 3VI3E 3EOTL 1ND0A 3B6SB 4NRZB 3VH8B 4M5YH 4MNQD 4FQQB 4GS7B 4GXVL 3V0VB 2FD6L 2XZCH 1CTOA 3VD9A 1XIWA 3QDJA 4MA3A 4OV5A 4JRYA 4I0PB 1X6LA 4LIQL 1S7RA 4JPIA 4QT5A 3BHBB 2DQEH 4G7YL 4Z7UA 3DUSB 1OP5H 4Q9CA 3G08A 3GKWH 1AKJD 3TJHC 4JFFE 2D4DA 1BVKB 2I24N 4P2OD 4KMTH 1CBVL 3X11B 1NAMB 3DBXB 3T2QA 5BV7C 3HZYB 4ELMB 3BHBA 5EZIL 1FNGA 1UKQA 2BFVL 2CXGA 1QVOA 4TTGA 4PGDB 4OFPA 2FECL 3AB0B 4R90H 3ZKSD 4N8PA 1I8KB 1VEOA 3AREB 1J05B 2MKWA 1XF5A 5MEND 4I18C 3KGRA 3V0VA 3VRJB 3VXSB 4JPWL 2DMBA 4OFYA 3U4AA 4LSTL 3QWOA 5FFLA 4WW2C 1VGKB 3KPLB 3Q5YA 2EE3A 5AZ2H 2IQ9H 5I76B 1UEMA 4XPFL 2IGFL 5FGCE 5DJ8B 3REVB 5IMMB 4HIEB 5IF0B 1KOAA 3W81A 3SE9H 1E4KC 1VGEL 4TYUA 1VA9A 4OZFG 4NT6B 1BWMA 3TBYA 4TSBH 3VGAC 2G5BB 3I6LE 3O11A 1H8NA 1QRKA 2DQCL 5JR1L 3DARA 4HIHA 4L8CB 3QYCA 2CO7B 3QEHA 4X4MA 4M7JL 5B4MD 1D5IH 3MRDB 1RMFL 4K9EH 5L7XH 3JBG7 4PUBH 1R24B 5B3JF 3RWDB 2DB8A 4W6WB 5JLZB 4PJ7E 3UDWC 1Q1JH 2HVKB 5BS0E 3GSUB 4O51B 5E8NA 2CDGB 5E2VH 2ZUSA 2NY1C 1J1PH 4GAFB 5D7LD 3GJEA 2E8YA 5DEGB 4OI8A 1G6VK 4KK8C 2E27H 1LILA 4NPYB 3NTCH 4ZFGL 2GK2A 1HH9B 2DLEA 4PRNA 5HYJB 3RZCB 4H0HB 3NZ8B 4QWWD 5EZOH 3HMXL 4XZUA 4WFED 3HNTL 4Y4KA 3V6ZA 1NDMB 1EEZB 4LCWE 2KKQA 3RWIA 3ARDA 5ISZD 3QUXC 2MMXA 2ZOLB 4KKCD 1T0PB 1KUMA 1JF6A 4IRJC 1A2YA 2Y06H 3ELAT 5F9AC 1JNLL 1T5XA 1FO0A 1S9WA 1XFPA 1KIPB 4I5BA 1QSEB 3DV4B 4ONOA 1S7WB 4LNRB 1J1OH 4H8WL 5CP7B 5DC4B 5KSAA 3AREA 1G9ML 5H2BA 4OUUA 1RULH 4MQTB 5GRZA 1DBJL 4PRIE 5I8KH 5F7NC 4RISH 1P7KA 4WI5A 4GKNB 3MLWL 5I6XB 1RZFH 1U41A 5GRJL 2W0FB 5DRZA 4MAUH 1U36A 2OJZL 4OCWL 3N1GC 4U1GB 4GG6F 3DGCR 4K94C 4NKDB 3DO7A 4BFBD 5ITFB 5HHXH 1OT2A 3KXFE 1RZJH 3DOSA 1OSZA 5GGTL 3K74B 2FIKA 3P9MB 1P7QB 5FYKL 5FHAL 1V7ML 1QA9B 3KYKL 1RVFH 1LO5A 2X9WA 1T89C 4GRWE 4DEPC 5SV4A 4YPJA 2XY1A 5I19H 1LEKB 5DS8A 1HH9A 5C8JA 2Y1VA 4R2GC 3FO2B 3NN8A 3HC0B 3O6FA 4FQXC 2XQYG 1N8ZA 5FGBA 4MQ7B 5SV3A 2QBWA 2NY2C 3P9WB 3PGFL 3LS4L 1C5BH 1CR9H 4YXHL 5L9DH 4HAGA 5MEPA 3ARBA 1CU4L 1QACA 5JUEL 1EH9A 1OTTC 2R4SL 1V3KA 1R5WB 4TVPL 1PZ5B 2IJ0C 3O9WB 3EJZD 4LARL 3DSFH 1MRDL 2VXQL 1OY3B 3WIIL 1P2CB 2BMKB 1FFRA 4QOKE 3KYKH 1QKZH 1DUYB 2HFEA 3IAQA 5B38G 4OLVL 2AK4A 2YPKB 1ZA6A 2X05A 1AGEB 4X7SH 5I16B 1G7HB 4HFWB 4JHWL 5FYJH 1FGNH 2AXJA 4UQ3B 4I18B 1NCDL 2ITDA 3BSZH 5D1XD 5SWSB 2VXUL 4CN4A 2EH7H 4RDQF 1Z2KA 2GI7A 3QI9B 3REVA 3PGFH 5K33A 5I76A 1TQCB 3QAZB 4X6CF 1WF5A 3L3DA 3V7AG 1DFBH 1F6AB 4PR5B 5JZ7D 1QNZH 4HV8A 3HI1A 4Y19D 2J2ZA 1E4JA 1IMHC 1IM9B 3CSYA 1NGWA 2E6PA 5F1OB 1TJGH 3HE7D 4S1SH 4F3FA 4MNQB 1PY4A 3QUYD 4JRWA 5IT2H 4X8JA 4BZ2H 4YHZH 2Z31D 3NPSC 2MJWA 3EYFA 2UYLA 2A1WH 3WKMH 4F15B 2DQDH 4LQ1A 5MP6H 4NN6C 1U91A 2HVJB 3FB6B 3I84A 1N59A 1H15B 3BZ4B 4JZOA 5INDA 3U9PL 5K9KA 2VQUA 2Z92A 2YSSB 4M9OA 4P23B 1L7TH 4LLVA 1XGYH 3T3PF 2W07A 4JO2H 1SBSH 4NJAH 3U30C 1Q9WA 3CUPB 2DLIA 2W60B 2Y07H 5HYJE 1AHWC 1JE6A 1B0GB 4OZGB 5CEYB 3T0XA 4X6DE 5H35B 4NO2A 1K4CB 3IJYB 4DN4L 4U1KA 2W9LA 3KXFB 5SX5H 5IEHA 1YDPA 1U93B 1S7SB 5A2JH 1X3DA 4ZTPL 3SJVD 1VHPA 4G7VH 1D5XA 2R0LL 5J3HC 4XCYA 5BMFH 1EAJA 4U3CA 3FB7A 4U1GC 2P8MA 2OI9C 4UT9H 3QFDA 1MCBA 1NLBH 2OX5A 3JV6A 4ONFL 1JL8A 2CKBB 1EUUA 3PIQB 5DD1L 1TJHH 4LPVA 1F58L 2BSRB 1G0YR 1JI1A 4HIJA 5IMLA 4XC1L 5BVPH 2VDQH 4JGUA 2ATKA 2WWKO 1DUYA 2HFEB 5F3BA 2GEEA 4K9EC 4L4VE 4Y4FD 3T0DA 1JZ4A 1BQHG 4X5LA 4Q7DA 2CMRH 5IB2A 3U82B 2C3VB 4LPTA 2VSDA 1WSST 4QRRD 5DUBB 2J5LB 3WJJA 1E28B 2Z4QA 3RVVC 1FNLA 4K3JL 5JHDE 2BERA 1MWAA 3D39D 4RAUA 1P6AB 3O8XB 3TWCL 3CJJA 2H1PL 3KYNB 5KSAC 4KJYB 5DSCA 4V1DD 1G7JB 5HYJD 1U2HA 3KXFA 4Y1AE 4UDUA 3V2AR 1ED3A 3MRKA 2OXGA 5BZWA 4JHZA 5K9JH 3G6JB 2F54E 1U58A 4KKLC 1MLBA 1SYVB 3TYGL 1P1ZB 1UT9A 2FHCA 3GO1H 4JFFA 1FE8H 4DTGL 3SJVB 3HG1E 2ZKHL 4A2LA 4UQ2A 5T5NG 4Z7UE 4ORGB 3CX5K 2JK5B 2PYED 3CFIC 2E6JA 5C0EB 4Z7WF 2ICWB 3MLUL 1YY9D 2BNQB 1HINL 3MQIA 4PG9A 3PXHA 3F12A 1YEEL 3MO1A 4K94H 4RGNC 4UBDC 3BYYA 5BVJA 2G9HB 1K8DA 4F15C 5T33H 3VXPB 4GSDL 2VDPL 1N5YL 5DEZA 1ZT1B 3FKUS 2ZNWA 3CSPA 3STZA 4ENEC 5B3NA 4G9FD 2FSEB 1RJYA 2WM0A 4KJPD 2DAVA 3AMKA 5KSVB 4GS7C 3C5SB 4J3UA 2FYYA 5E6YA 4Y16B 5D6CA 3BZEB 1ZWIA 2VR5A 3V5HB 4KVNH 43CAB 1FL5B 3B4NA 4Z6AT 1DVFB 1F11B 2OTWB 1KJ2H 3QHZL 3S4SG 4HWNA 5ILTH 3IDUA 1TZIB 5GRUH 1N7MH 4K3DH 3FCTA 4AIZA 4L9LC 1JGLL 4LGPB 4HW6A 4KQ4L 3NVQA 5L7XL 4LLYB 5DVOA 1A6UL 1KLUA 4QO1A 4P5KA 3MSPA 4KUCF 5FYLE 3SCMD 2QTEA 2ZUQC 2NMSA 4IOFD 2F15A 1MFBH 4HPOL 1T2QH 3GBLA 3FO1A 1PX3A 1MSPA 5DJ2B 3O6FB 3QDJB 3T4AB 1SYVA 4MNGE 2FNBA 3V6BR 1T04A 3EOBB 1DFBL 1NCUA 1WISA 1IJ9A 3QUML 1FV1A 5E9DD 4PLJC 1NGZA 1MCLA 3LKRB 3WEXB 3MRKB 4TUOA 1FLRH 3PWJB 3V5DA 1UB5A 4R97C 1ZGLA 1MNUH 1JGVH 1EPFA 3MRIB 2CKBH 1AY1L 4JFHD 5GS0L 1NCNA 1W0YT 3CFKB 4F7CB 2XTJE 4C59B 4FTVB 2HT2C 5CEYA 4CL7A 1A6UH 1TTUA 2DKSA 3EYVB 4M02A 2W0FA 2ZCHL 3LOWA 3QRGL 3VJ6A 3QDME 1A02N 1IAOA 1YNTA 1HKFA 2GK0A 1UH2A 3RJQB 2AJ3A 2NCMA 1RPQA 1OWRM 4P46C 1I1RA 4DKFH 3MPCA 4TUKH 4PJ5A 4R7DB 4P5TD 3QQ9D 2P5EE 2X40A 4ZUWA 5J1AB 3TVMC 1E4XI 5J1TC 4M7LH 4U1MB 4PJCF 1WEJH 4JQXA 5I30H 1EVTC 1IILE 3QO1A 4O5LL 1HZHL 3T65A 4RGNE 3TYFB 2AQ2A 4Y4FA 4RGMB 4MJ6A 3SPVA 1X5KA 1RZKH 3IFLH 4EUPB 1NKOA 1IAIH 2NY5C 2WNGA 3H9HA 5GS2H 3DJ9A 2OCFD 3PL6A 4BUGA 1JGEA 3UZVB 1CIUA 1BD2B 1D5ZA 4PJ9C 3ULUL 3B8SA 3FT3A 5IBUB 4JPWH 1BIIA 2IF7A 3QUXD 1YEJL 5E95B 4IRJD 3MLTA 4JB9H 3EDFA 4XP4L 2CDGA 2UY7A 5DJCA 5GHWL 4OFDA 4JFDA 4X6FA 2Q76A 2K9UA 3MODL 4JQVC 5J0BA 2QADD 4OZIE 4JM4H 4OGXL 3S35L 5DMKB 3AM8A 4WNQA 3VXUB 1JCKA 1NC4A 5F72S 5FO8B 1O5DT 4I3SH 3OTTA 1A6ZA 1N2RA 2ZUXA 4PPTA 4NRYA 4N0FA 2VZ1A 3L3HB 4RMSA 5IKCB 3CVIL 4P2RB 3ROLB 3T08A 3WCYA 2PTVA 4NWTH 1A0QL 1DQLH 2V2WB 1TETH 1ZLVH 1CFSB 5KJRL 2YD3A 2AEIT 4OLZH 4QLRA 2AW2A 4LDOB 3QQ4A 3UTQA 1LE5B 1RK1A 1DSFL 5IF0A 1YYML 2YXFA 3GSQB 1OHQA 2XPGB 1FNSL 3OZ9L 3NCJH 4OZFH 2PTUA 5DS8B 4UOW1 1EHLL 2B4CL 3I6GB 1F6AA 4KI5F 5FA4A 4P2OB 5EULV 2NY1B 2ZJSL 3HNSL 5D5MA 2DQUH 2A6JA 2XWBA 1AGDB 1V8HA 4PRDB 2ZZUT 4CVXB 4KGJA 4E41E 5CZVL 4QHMB 5JW5B 1ONQB 1ACYH 1S3KL 3CX5J 2OK0H 2V6HA 4EDWH 1LP9B 1SJVA 3AFLA 4HUXB 4KRLB 2I9LA 4MD0B 4OZFA 4Z9KB 1I1AC 3ARGC 4O02H 3SCMC 1J7VR 1P5VA 4PJ5B 5I1DB 2YPLA 2R15A 4ODSL 1DSFH 1HINH 5K93A 3WKNA 4Y16D 3TA3A 1ZMYA 3OZ9H 3JWNC 3MRLB 5T3ZD 3BEVA 1HYSD 3GSNB 4D0DA 3EYQC 1XIWB 1WV7T 4KTDH 5I17B 3QB7C 3GSXB 3HUJA 3MV8A 35C8H 3GSNA 4NOFA 3UYOD 4YHLH 4HWBL 4HFUH 5ADOH 2DTML 3I6LD 3NH7L 1JNHA 4WCYL 2D0FA 2PO6A 1KTRL 3TYGH 4JKPH 1UADC 3P0VH 1ZA3A 1NBZB 3QEUB 4OZFB 3D0LA 5CEXA 2LU3A 1NMAH 5EO9A 4XVJL 5CILH 3WFZA 3FB8A 5FF6B 2P8PA 3VW3H 3MXWL 5EO1A 4MAYD 5D7IF 1ORQB 3L3GB 3V6OA 4WI4A 2ERJC 3PP4H 1J0JA 3HLAA 2NZIA 3PHQB 5BV7B 4PJIF 2A6JB 2BJMH 2AXHA 2J12B 1E6JH 4AIXA 4MNGA 4JAMB 1RUMH 2W91A 4S0SD 1Q9LA 2JCCB 1OPGH 4ZFFB 1PVHA 4WEUD 1OW0A 4OTXH 5EZJB 2FO1A 1TZHA 2NTFB 2CMRL 2GUOA 5A3ID 4LCIL 3WS3A 5HYSA 3CIQA 1P7HL 4JZNB 4KV5E 2VAAB 4U6HB 5HYEA 4P3CL 4GMSH 5FEBA 3IS1X 1NBYA 3DSFL 3MJ7B 5KSBA 3HCVB 3B83A 4L3CA 2AQ3A 1P69B 3N0PB 1I3UA 2DQEL 3MA9H 4G7YH 5DTFB 1ZWIB 5IB5B 5IFAH 4ZPTB 4PJ9D 3W0WD 5JOPD 3OB8A 2VE6A 4IIQA 5JORB 4UUJA 1KLFA 2FH8A 5EOCJ 2FHFA 4WDIA 1LVEA 4MA8L 1KC5H 1KT2B 3A6OA 1EHXA 1GSMA 4F7TA 3O0RL 4OD3L 1OPGL 1F3JA 1MJJA 1HNGA 2DJSA 3DX9A 3EFFB 1R3JB 2WWMD 2XOTA 3WHXA 5HPOA 3I50H 4ZS7L 3BGAA 3GMRA 5ICZB 1GRWA 2ICWA 3OWEA 3A67L 5C6WH 1MRCH 3Q1SL 5DYOB 1HXMA 2FZ3A 4JANA 4ORGA 4PLKC 1FCCA 1TITA 1XGYL 2R23A 1U2CA 1BBDH 1IAKB 1FVDA 4PJCE 4F8QA 3QIUA 3RIFF 2VLLA 3V0WH 4M48H 4I0PA 1I8MB 3HS0A 3FQXA 3WFHA 3CC5A 4JVUA 1RURH 4UT6H 5DT1L 3P73B 5T3XL 3BKJL 1YEIH 2B0SH 1A7PH 3OJVC 1TVBA 4QRUB 2VXTL 4Y2DC 1IL1A 1RZKC 2A77L 4Z7VA 5IVXB 1MCCA 3PV6B 2O5YL 2BY3A 4RMRA 1KB5H 4M93C 4R4FH 1YNTB 4JQIH 3DYPA 3KWWB 4M7LT 1F4WL 4XAKE 3ZL4L 4FXLA 3PHOA 5GSVB 2CRIA 5I9QB 3VCLA 15C8H 2GJ6A 3MODH 1DCLA 4Y4KC 2H3NA 2X1PA 1NMBH 5D72H 4M6OL 2A6DA 5EWIL 1DDHA 1CLOH 4M1DH 5DLMH 5GIRB 4JFYA 5GJSH 1QTYT 1WZ1L 1RUQH 3NGBB 5AWNH 3BWUC 2X1XR 5TPWH 1FFOA 3L9RA 4P23A 4PB0L 1BAFH 1R5IB 3BKCH 5C0CE 4J6RH 1WEJL 4XCNB 3BP5A 1RURL 1AHWA 4UT6L 2P5EA 4RFNC 5D4QA 2WLZA 1CZ8H 1ZTXL 5T1KB 3VI4E 3LQMA 3EYFB 4IRZH 4N9GA 2HA1A 3ZSTA 3P77B 4KMQA 4KRNA 4HUVA 1A2YB 3B2UC 1EHNA 4W81A 3ZT7A 3CFBA 1MF2L 3ZTNH 1B90A 1KXVC 2Y7QA 5ANME 5GS1A 4PJXE 3I9GH 4TRPL 3MUGA 3EW3B 5H94B 3MNZA 4ENED 1GGCH 3ECBB 5E8DL 4JO1L 5E1AA 4XPGH 4YUEL 3NFNB 3QIBC 3MLRL 3G6AA 5GGUA 1J1PL 4R0LA 4YDJB 5IEHB 8CGTA 1H3PH 2MNUA 3VXMD 3B43A 3U4BH 4KZEL 1YNKH 3PXJA 1XIWD 5EOCH 1SEBB 2JB5H 2FR4A 3CZJA 1OAXH 3F62A 4KAQH 2HMID 3TNMB 4PV8A 3ROLA 4X6EB 4H1LA 3SDXF 1V05A 5EA0L 1HDMB 2UWEE 3FQWA 1UM5H 3C5SA 4JG1H 1XH3B 3L5XH 3SHSA 5A3IC 1RZJC 2GT9A 3UYRH 3N9GH 1F8TL 2FSEA 2R1YB 1MFAL 1X5YA 5EOQL 3KPRB 1Z5LB 1DP0A 3U0TB 4XXCA 3RUGA 3MV11 4OD1L 4KXZH 3FJTA 4Q2ZA 1RULL 5HGBA 2RIKA 4F3FB 1MHPL 1IC5L 4DGYL 4OD2A 5MI0C 1BJ1H 5DXWA 1AGBA 3I2CL 3O2WL 3SDAC 3KLSA 5FK9A 1JZ2A 3T8XA 2FIKB 3P9MA 3WHXB 5F3HB 4RIRB 1R3JA 3VWKD 1B6UA 3QO0B 3WUWA 1QVOB 3CDGB 1IC7H 2MFNA 5KN5A 4HFWA 1G7HA 1KV3A 2XNAA 4KQ3H 5BZDB 5BZWB 4R2GB 2Z35A 1FG2A 3RL1B 5CD5D 4DKEH 1Q94B 4PJGF 3L1OH 3JUZA 1G1YA 5GGRB 5EFIA 1YUHA 3VFGH 3P9LB 4JPIB 2EDNA 4NC1C 5CINH 3DXAE 2DI7A 4V1DB 5H94A 1QFWL 5HGDA 3CFDA 1EMTL 5JQHC 3NCBB 4FXKB 4K3DL 1NBYB 2OR9H 3T4YB 3PWLB 1UCBH 3TVMD 2VL5A 4FTVA 1IGFH 5DRWB 4Y2DD 4O2FB 3OXSA 1VADA 3BXNA 5CJXC 5IK3B 2FHBA 2NPLX 3MBXL 1CD1B 4HXBH 3MXWH 1RUKH 2VITB 2F8VA 4OFKA 5EBMA 4Y4KD 2XTLA 1YN6A 4KK6C 4MNGB 1CFQA 2IG2L 4PV9B 4QRPD 25C8L 4MD0A 1QLEL 3SE9L 5EU7C 2PKDA 2DRUA 3LEVL 2H32H 3BH8B 4WU7B 3KYMB 2NX5B 2VLJB 4ISVA 1MCWM 3RY4A 1UVQA 3IDIB 3NIFF 4QHLB 4U1LA 3QJFA 4RA3A 5TFSH 4N0CC 4LVEA 1JGVL 1JWUB 1WFUA 1ZV5A 1OF2B 2A6IB 5LAXA 1VFBA 2NNAA 3V52H 2EDHA 1JF1A 3W9DB 4U1SB 5EU3B 2VERN 3MMEB 3WL9B 1NL0H 4X7DC 4ONGL 2AJSH 4PGEA 3HUJB 4BZ2L 3PWVA 1J8HB 3THMH 1FVEA 3H7LA 3GHBL 3CMOH 1DVFD 2JB6B 3EHBC 4CN1A 2ADIA 1QLRB 3H3PH 5EG6C 4ZXBB 4MD4A 3L5WA 5EH1A 2YSSA 4N5ED 3LRGA 2DM4A 3NH7H 1HH6B 4P49A 2AXGA 2VKXA 4K7FB 1Q0XH 3QDAA 1N59B 3QEGL 1X6NA 4HIEA 1EIBA 3DXAA 1I1YA 4P5TA 3JV0A 2VLKB 2X4PB 3VXRB 4EQ3A 5FB8A 2IFFL 4CU6A 1I8LA 4XAWH 5C0AD 2HMIC 2GKIA 2NY2B 3RKPA 4M43L 2E7LC 1ZANH 2N56A 4FZ8L 3LV3A 5B21A 1I7UB 2X4QB 4F33B 2WV3A 2CRZA 4UV7L 1I3RA 4PR5A 3X3FL 1UQSB 3UTPE 1FL6A 1HHJA 3MJGX 4AQOA 3RFZC 4PY8J 4KKBC 1I9IH 1FFPA 4NBZB 5D7IE 3CCHB 3ZKQD 4Z7UB 2BVPA 3IFPB 4S1DC 4P2QA 3UTZB 1FAKT 5FYJD 3SDCA 1WBZA 5ENWB 3TZVB 4L1HA 4EIZC 1VACB 3ARSA 1A5FL 5JTWA 4R7NA 3GJFB 4N0UB 3L7FB 1HWHB 1KCLA 3RU8L 3WFEL 4YHZL 1BFOA 2AJ3B 3R1GL 2WZPD 1OGAA 1CT8B 1AFVL 1PZ5A 3O9WA 1SY6H 3DMMD 4OCYL 4Y5XB 1YEFH 5GIRA 5LAXB 4L8DA 4X6DB 5DHYA 5DMKA 3JSSA 2MCPL 4RBPH 1VERA 3IKKA 1I9IL 4Y5YC 1GPOL 1XT5A 4P9HL 2A0LC 4F80A 2FBJH 3DHJA 3FAXA 3VXMB 3PWPE 4X9BA 1T20B 3JTTB 4YEFA 3LD8B 4ODHH 1GL4B 1U92A 4MDIB 3U4EB 1BP3B 5D1ZB 1ADQL 2ADJA 3ALWA 2WBJB 1JTPA 4POYA 4WW2F 5CEXB 1XGRA 4OAWB 2QHRH 4NQDE 5J11C 1SHMA 4NKOA 5SX4I 2CSPA 3CVHA 3MRHB 2R0LH 1JPSL 2AJXH 2VLLB 4MJIE 3EYOA 1A14L 3LSOA 3IFPA 5HGHA 5F7EH 2D31B 5AZEH 1YECL 4XCEA 3ZYOA 2Q6WA 5FYLH 2R0KH 5I1KL 2F5BH 1NH6A 1JGLH 2G5RA 4DAGL 3TCXA 4WHYH 1DBBH 1N64L 3KPSA 2YN5A 5CMAA 3HI6L 1W0VB 2YKLL 4OCRL 4HS8L 1IC7L 1B4JH 3KR3H 2J3SA 4UDTA 4KI5C 2WBJC 3OR6B 4LVHC 3IDIA 5DHYB 1FIGL 1FGNL 4JJ5A 3V6FA 4EI5C 2AS5M 1DQQB 3WFBL 1F4AA 3P30L 1NCCH 4BQ8A 2GQHA 1NUNB 1XCTA 4DW2L 1OGAE 1SMOA 4QTIL 1A7QL 2AV7A 1NC2D 5EC1A 4Q9RH 4K7PX 2H8PA 4OD1H 4TUJB 3L7FA 3CDFA 5KANI 4O9HH 1T0MA 3TJHD 1L0QA 1IC5H 5E7BA 4PLKD 4OD2B 5E9DB 3S37L 2EDYA 2EDRA 3KPMB 4TVSa 3MGTA 4FN0A 4HF5H 4J3SA 1R3LB 3KLHD 4AQ1B 5D6DA 3MBXH 4LF3B 1MF2H 5E8NB 5EO0B 4Z0XA 3AY4A 3B9DA 2BNRD 2A6KB 1TZHB 1CGWA 5D7JC 3LIZL 3D2UB 1YEDB 2YA0A 3EO1B 3C08L 4CDHA 2NY5L 3NCEB 2GITA 3BN9D 3ZDXF 2PO6D 4HLZG 2PN5A 2IQ9L 3BD5A 1I7UA 1LNUA 4U6TA 1O7VA 3LDBC 4L8SC 4DZBA 1J8HE 2AV7B 2YZ8A 2BK8A 5FO7A 2H32A 1IZJA 3T2NH 4H0IA 4KJQD 1FG2B 4ZSOE 3UPAA 1UACL 4NZUL 1P4IL 2ITDB 3FOMB 4I18A 5FV2A 5SWSA 3STLA 5IFAL 4WW2A 1ZLWH 1U3HA 3MJ9A 5EO9B 3TESA 1WFTA 1X5JA 2ATPB 2NX5E 2VLJE 1PLGL 5CSBA 1UCBL 2FJGB 1BFSA 1FJ1A 3KPQA 4DOHE 5DRWA 4M7ZB 1WIUA 3F5WB 3ZHDA 5KSBB 3W11D 4J1UB 3QIWC 4EJ1C 3D9AH 3V0AC 2APVA 1Q0XL 1FAIH 5JOEA 1J8HD 4NKMA 3F7RA 3KPMA 3T2NL 1PQZA 5J56B 4TTDD 5DGQA 4JO4H 2V9TA 3R0MA 5HHXL 2YC1B 4Z5RB 1F58H 3TJEL 2OTUB 4YFDB 2ZWLT 1Z9SA 3SDCD 4MSWA 4N8CH 1TVHA 2BZDA 3QXTA 3HNTH 5IROA 5KN5B 1OGTA 3QUKA 2DYPA 4KRMB 3P4NA 3UPRA 5C0FB 2L0DA 2YD6A 3ARBC 3G5VB 5EWIH 1IC4H 5JW4Q 3S37X 2DYPB 5F89A 3OPZL 4XB8A 4Z8FL 3FN9A 3MJ6A 5KSBF 2APWA 1K9TA 2DQGH 4OV6F 1FE8L 5T3ZE 3FQRB 4M8QA 3K80A 1NC2A 2AGJL 4MCYA 2PO6B 2XWJB 5DFWH 2B4CH 4Z7VE 1WC7A 2R2BB 3EZ8A 4PRIB 1JPFB 1VADB 3FFDA 4YDIL 1YY8B 1OT1A 3LKRA 3WEXA 5A16A 2PUQT 2AEQL 1YEGH 4OCWH 2VDNH 2EDJA 3CUPA 4GAYB 2DKMA 4G42B 4HBCH 2HLAB 4ZDHA 4QRTB 4R96A 3GRWL 4L29A 4JRYE 2DQTH 3OKNB 3U0PB 2P8LB 1VKXA 1YQ2A 4O4YL 3LN9A 2VXUH 5F3BB 4H1LB 3VWJD 3PL6D 5IM7A 1I7ZA 4OLUH 3VXOA 4J8RA 3WLBA 5FOBB 1RJLB 4LSVH 1PYWA 3SDAD 3P11H 1KENH 5D2LE 1FZMA 1BVZA 1KCVH 1FNFA 2C7UA 1JWSA 1FFOB 3UBXI 3OKEB 2VAJA 3BH9A 4JRXD 5D7KD 4EDXB 1K85A 5BRZA 3O2VH 5J13B 1YEEH 3C6SB 1N6QH 3IFNL 3BDBA 3P0YL 3PWNA 2H6PA 1FVCA 3SBWC 3QPQC 4UAOB 2VQ1A 4OUOA 1MCOH 2XG5A 1WFNA 2Q3AA 1B0RB 3L5HA 5IB4B 1BFOB 4AT6A 3GIVA 3TA3D 4F7PB 2R9HD 4EDWL 3OV6A 3RUGE 5DF0A 2XZQL 2YHGA 1MY5A 5IFHL 4URTB 5F9OL 4HLJA 3ZDZE 5I1CL 2P43B 1E6JL 2PO6C 4BH8A 4JFQB 4GKSB 4Z0BH 4K07A 5DRNA 1NAMH 4HZLA 5JW3H 2YKLH 1UXSA 4LDEB 1SJHA 4KQ4H 5LBSH 3KG5A 1CICD 2MPAH 3LKPB 2UYLB 4OM0L 1J18A 4UDTB 1JJUA 4AM0B 3LQZA 1CBVH 1EUTA 3DV6B 4KZDH 3RIAK 1OAKH 3CDCA 3RNKA 4KUZL 4F57H 1MCPH 5B8CC 4ZO8A 3OX8A 3VE0B 5ADOL 4EEEA 1S7UA 1JWSB 2Z8SA 4S1QH 3FT2A 1F3RB 3QDGD 4YH6A 1VFAA 4FXGA 3RTQD 1T3FA 4LLDB 3IDYC 1JPSH 3VFGL 1A3RH 3MRRA 4XNMB 5CGYC 3D0LB 1I8LC 1RJZA 4HUMB 4Y19B 2Q6WB 3SKJH 4IIQB 4MA8H 5BVPL 4E0RA 3H9SE 3QIBB 3BIKA 1D3CA 4HT1H 1PY9A 5CWSA 1ZLSH 3UTTE 3QQNA 3KPTA 5IQ7H 4HDIA 3O4LA 1KTLB 5GGSA 4KUCD 2P42B 2ZNXA 3N06B 1XR9A 4I13B 4HZAA 1KFAH 1MH5B 1YQVH 1IAIL 3L9RB 4LCIH 2CLRB 2Y9RT 5JHLH 2HH0L 5D71L 4WJ5A 5J12C 4KHXH 1BFTA 4JR9L 3QDGE 2ENYA 2HWZL 3VGHA 5C6TH 3S36H 3TN0A 3WXWH 2BDNH 3PWUB 4NNPH 3MA7A 1FH5L 5TDOB 3X12A 3VFUA 3MV7A 2P49B 4N1EA 1KJMB 3UJIL 4E41A 4QHMA 5JW5A 2HTKD 3ZE0F 3WS6C 4JHAH 1FQ9C 1FRGH 2X70A 4L4TD 2AJVL 3UROR 1NEZA 1VFAB 4FXGB 1CN4A 2D0HA 3EO1A 4NPYA 2FEEI 1P7QA 5I75C 3B5HA 1QRNB 3P0VL 3B9VA 4NN7C 4RFEA 3WN5A 4E42A 3FQNB 1PZUB 1H3UA 2A38A 5F1SA 3B9KD 3KDMB 5IB1B 2LTQC 5C0EA 2WBWB 5I1HH 2XFXB 2V7NB 1YYLL 1X5XA 1KJ2B 5CZKA 1NKRA 2CDFA 1HXMB 3L3KA 5GGTA 4NQVB 3LQAC 4S1RL 4V1DA 3D85D 4KY1H 4U3HA 5IP4A 5DC0A 4QF1A 2R1YA 4U6XA 1YUHB 1IC4L 3MCG1 2K7QA 5HY9B 2WUCH 1BIHA 4AZ8A 3LMJH 4Q6YA 3IDXH 4MVBD 2IH1A 3NPZB 3RGVB 3L3IA 1X5LA 5GRJH 3B2VL 4LASL 5C1MB 1SJEB 5C71A 4PJIE 3Q6GL 4PJAE 2ARJA 2CLZB 2P24A 5IMKA 3H9ZA 4P5TB 4MNHB 3FQTB 3G6DL 1MJ8L 4Y2DB 4DW2H 2LABA 1NUGA 5JORA 3PP3H 3S34H 3UTSD 1T03L 4PJDF 3D9AL 4Y1AB 2EDWA 3PL6B 4CAGA 4N0CD 3X14B 3BEWB 1FORH 3OQ3B 4TVPH 3V9FA 5L2KD 5C08D 1U8LA 5J6GB 3SY0B 1T5WA 4PY7B 1DBML 3RY5A 1RK1B 4KDTA 4C4KO 4XBEL 1RUPL 2J7LA 3O8XD 3S35X 4U1SA 4JEGB 5GZOD 5IR1B 3OKLB 4XMPL 5CKAA 4FZEL 1MLCB 4JFOB 5T1KA 4M6NL 3VGBA 1CWVA 4IOSD 1E4XL 1CZ8L 3SBWA 3GI8L 2CRYA 3L3HA 1C7TA 2QL1A 1A1NA 1RZIA 4N5EC 3VXQB 5ESAB 4DK3A 4DVBB 5HYQB 2NY4B 2F5AL 5EOTA 4EXKA 3H42H 1MCEA 3RU8H 3WFEH 3OR6A 3TBYB 1JN6B 5IVXE 4Y0GA 3VFTA 1ADQH 3C60D 5HI5D 3P3YA 4GRLA 5IWLC 2X4RB 5ISZB 3VFRA 4R90L 2VH5L 2HT3C 3O3DB 1N4XL 4HBCL 2YBRB 3V4UL 4GRLB 4N8VG 1OD9A 1CXLA 1TVBB 2P5WE 1Z9MA 5I17A 3QCVH 1XF5B 4OCSL 1UG9A 2BC4B 2E7MA 3CFDB 1YMHA 5JXAH 1MFBL 4U1JB 3WJLA 4PRPA 2JIXD 3ME0A 2VN7A 3G04A 3P4NB 4L9LB 1MJ7H 4UB0H 5ACLA 4P2QB 3UTZA 5L2KE 1UM6H 2ED8A 5JW4M 4LKXA 4IHOA 4UTBH 2OTUA 4HK3J 3BQUA 2V7HA 1WCBA 1MAMH 1E6OH 2XA8L 4JE4B 4OF7A 1MCPL 5CLTA 5D1QB 3SO5A 5IIEB 3ZKXC 4X8JB 5I9QC 3FFCE 4HH9A 4PRPD 3RKDC 5FDWA 4JDTH 2GJZB 1F45A 1CFNA 3NFPA 1AGDA 2AERT 4BSWA 5FYJU 5AG8A 4GG8B 1TCRB 4Y5VA 1Q38A 3BT2L 3EFFA 4MNQE 1BGXL 5E8PA 4NRZA 4XP6H 3MBEB 5H8DA 1HIML 4ZXBC 3HFML 4PJIA 2R8SL 4HBQA 4GBXD 2D4FA 4ZG1A 3VMOA 4XP1L 4ZFOB 1T7WA 4PJEE 2PXYC 1B0GA 5D2LA 4RWYL 1T4KB 3FTGB 3GMNA 5DVLA 1ZA6B 2B8OT 1AXTL 1QR1A 1J8HA 3LIZH 3RVXC 2E3VA 4GQPH 1MVFA 2H2SC 4UT9L 1TETL 5DJ2A 1I8MA 4LRIA 1ZSDB 1Q0YH 1IQWH 3VFNA 4HWEH 4P46A 3WIHA 1AIFA 1RZKL 3IFLL 2W38A 3C6LB 1BZ9B 2O5YH 3VJ6B 2N7BA 2K3TA 5MERB 1OF2A 1QBLH 3BP7A 4K7PH 1HHJB 2CXKA 4OZGF 3RI5F 5GS3A 4HKJA 4OZIA 2A6KA 2H6PB 5HGAB 2YD9A 3D0VB 3GMQB 4NQCD 4MQ7A 1UM4L 3CXDL 3IU4L 4DQOH 2A73A 3FB8B 1RZFL 4KI5D 1S9VB 4JM4L 4Q6IA 3SGEH 5GISL 1VFMA 2XZZA 3V5HA 1H5BA 4Y1AA 4G6KH 5SWQB 1OLZA 3WFCH 3LRSB 2PNDA 5DFTA 5BV7H 5ACZB 3RHWK 5ICXB 5BW7C 4MXWL 1NCAH 5I1IL 1A0QH 1ZLUH 1IEAB 3K46A 1MI5E 1EGJA 1UWXK 1U6AL 5ALBH 3IXTA 4FQPA 4P9MH 2CLRA 4U6HA 1U95A 3C5ZD 4WO4A 4XPBL 3QNXA 4QF1B 4U6XB 1JF1B 2OLDA 1XGPB 4WRLA 3W9DA 4OJFH 5LBSL 1R5WA 4XPGL 3RNQA 4NRXA 1FYTE 5F96L 3BPNB 1CU4H 1FO0H 5C0RL 1HKLH 3MUZ1 1QSEA 2Z0BA 2Q86A 4PJ9B 3C60C 5HI5C 5KVDL 3AMLA 4HKBB 5D5ME 5EOCL 3DXAD 3G5ZB 4HWBA 1SYSA 4JPKH 3UPRB 1DLFH 1IL1B 4I3GA 5L2JA 3SKOB 3SGKC 3TM6A 4WFFE 3TO2A 2ADJB 4WHTA 5I66B 5J06A 2YBRA 5C0BB 1N7ML 4OCYH 5FGCB 1KB9K 1CD1A 4RDQG 4Z8FH 1GAFL 3L6FB 4V1DE 5FAAA 3F58L 3KPOB 3GRWH 4XPTH 2Z31B 2FGZA 3RUGB 2HJFA 4P5KB 4DVRH 2JB5L 3WE6A 2DD8H 3QIWD 4KAQL 4GW5A 4ZS6D 5TE4L 3RVTD 3SGJA 3DYMA 2FJHB 2CPCA 5F9WB 2ADFH 1NUFA 4OLXL 4S1SL 2GY5A 1YEHL 4X7EC 5ESAA 2X4UA 1I8IA 3FB5B 2E9JA 1K2DA 4BELD 5ETUB 3QH3A 3JVGA 4F2MA 4FQHA 32C2B 4M7KL 4ZOAA 4ODXA 1QUNA 7CGTA 1GOFA 5GGSY 4OFYD 1RIHL 4LSRH 1F97A 1KNOB 2GAZA 2W9EL 3MX0A 5HHNA 3MR9A 4U3XA 4O00A 3J8F7 3GBNH 4U49A 1JHKL 4K3EH 4XP5H 5HDQH 3UMTA 3SO3C 1L7TL 2G2RA 3O8XA 3ECBA 3RTQC 3FFCB 3U36A 4L3CB 5CGYD 1X4YA 3BVNA 5D1QD 1QFWH 2CUHA 3ILQD 2O26U 1J05A 1T1WA 2EEDA 1LK3L 1YDPB 3G5XA 3K4AA 3IDMB 2QSCL 2BNQA 4PJHF 1OSPH 1S5IH 3GI8H 2NTFA 2OP4L 3LKSA 4M3JA 2HG5A 5KTEL 1DEDA 3FMGL 3WLBB 1TJGL 4M4RA 5MERA 5ABDE 3DUSA 2QHRL 4UQ2B 3CK0L 4YK4C 1MQKL 1NLBL 3KLAA 5GQBA 3LMJL 4HH8A 5IEKA 2EIBA 4K3EL 1PJ9A 5E8OB 3VWJC 3C2SA 1A6VH 1AE6H 3MLSL 4UIMB 4X4ME 4GRLD 4NHUB 3I3DA 4UV4H 4NQDA 3DGGA 4HPYL 1AR1D 1NMCC 5I15H 3EO0A 1EFXD 1J8KA 1U8OB 4DAGH 5IB4A 5IMMA 3VA6A 4R26H 4KK5D 1X9QA 4QYOB 4HGWA 3EO0B 2FWOA 3RWCB 3I6KB 4LHJB 4RRPA 4WU5B 4RGNB 5IHZB 4PB0H 2BSSB 3PWNB 2VJXA 4X7TB 4EUPA 1F4XL 3N85L 5D8JL 2MQCA 2DBJA 1AP2B 3GSRA 5E8OA 4EI6A 3VG9B 3D25A 2D03H 3CLEL 1YEJH 1H15A 3BZ4A 4NWTL 3MRFA 5I18L 1I1FB 3BKJH 5E94A 1YN6B 4OAWA 2Q87A 3MLXH 1I85A 1HK6A 5F71A 2YC1A 3I02A 4Z5RA 3D3VE 2VDKH 1BGXH 4DUWA 2W1NA 4X0KB 1T5WB 3PWLA 2DN7A 4GAYA 3IXTB 5EU6A 4W70A 3DX9B 1M7DB 3FZUC 4P3WA 3F7YA 3NZHH 1WZKA 3GMMA 3RBSA 3B6SA 3VH8A 3CD4A 5DJAB 1UWEL 4LCWA 3MOQA 1BFVL 4NQEA 4ZOEA 5GGRA 3HC0A 1KEMH 1AXTH 2WQRA 3UTQB 4NNPL 4X9FA 1RJYB 3A6BH 4E5XA 4X9IA 1NGZB 2IFGA 4WFFD 2O5XL 5A40E 4M1CD 2CK2A 4PRHA 3MBEC 1D5IL 2IH1B 4APQD 4K9EL 3G5ZA 3BJ91 2DQUL 3OPZH 3ARFA 4OKVB 3M1BB 1Q1JL 2IPUK 5GZOC 4YFLI 3DX8B 1JUFA 1TJIH 1WLHA 4HWUA 3HG1A 5IUSA 3R1GH 1AKJB 1CQKA 2X4TB 3MXVH 1NBVH 3SE4A 4YAQA 1CL7H 2B5IC 1F13A 1N3NA 2MQ3A 4Q0XL 3UJJH 5C0CD 1V3MA 5FCUH 3M17B 3O4OC 4LPUA 1MQ8A 3EDDA 5E03A 4XX1G 5CEZL 5E00A 5DMYA 5ICYB 5LWYL 5SWZE 1AI1L 2BVUA 2R2EA 5MENB 4DCQB 2B20A 1NEZB 1GZQA 2BSED 4KRPB 1MEXL 1UWGH 1GCFA 2ZUUA 5LG1A 4P5MB 3VXTA 1HSAA 4YHLL 2YMXH 2BY0A 4OB5H 3OB0K 2C3GA 3FO0L 3H7BB 3LN5A 2A83B 3O3BA 1JV5B 5TQ2L 4ERSH 3NZ8A 4FQ2L 3IKCA 5CJ8A 2X4NB 1RUPH 3KPSE 5DJ0B 5H37H 3SKMA 1FFQA 1NMAL 4MX7B 3MOAH 3FN0L 1J0ZA 1NSNH 5GRXG 1X7QA 2H32B 3IFNH 1WWAX 4OGAC 3P0YH 3IDJA 1Q9OA 3T0WA 1C1EH 4OT1H 5HYSB 3B9KC 3GSUA 4G3YL 3NPSB 4ETYA 3FFCD 2X5PA 5J89A 3QA3B 3QCTH 3OAUH 1KJ2A 3UJTL 4XMKH 5IMLB 3QZWA 1AC6A 5IVZB 3C87A 3QJHB 3WIHH 5CWSB 4FZEH 3AUVA 4KTYA 4EVNB 1NEUA 2NX5A 2VLJA 5JIIA 5LXGH 4JRYB 4PRDA 4L3EB 1RZGB 1E4XH 3LRSA 1UCTA 4FNLL 3VWKC 3W2DL 5BOPA 4KHTH 4TUKL 4RBPK 4KDVA 4JN1L 2V2XA 1FZJA 4HPOH 5C0AB 1UGNA 2C3HA 5GSRA 1YMMD 4Y5YA 1R5IA 3RX8A 1K5NB 43C9B 3ULVH 2LU7A 3GNML 4ZD3L 2GFBA 5DR5H 3MCKB 3MV01 3MREB 2YPVL 4POZC 2FECI 3QFJB 2XY2A 4C56E 1HQRB 3NBNA 1XGQA 5E56A 2NY3D 4U2ZA 1JZ6A 4GG8A 1P5UA 1G7MA 4S1QL 5DD3L 4K23H 4TSAL 4X0KA 1CT8A 2H2SD 5INCB 2OL3H 5DO2C 1GJIA 5HYQA 2Z92B 4NZDA 1E27B 4TQEH 3SJVE 4JZOB 3IDJB 1L9NA 1AD0A 2JJSA 4N0UA 5FKPA 1ZE3C 3RL1A 4NO3A 3QEGH 4NKQB 5IBTH 4WNQB 4HT1L 5D7IA 1A6WH 5M7QA 2KZWA 3O3BB 3QWRA 2V2TA 5JPNB 1B2WH 3S3JA 4CVWA 3V7MA 2KQNA 4LCYB 2FGWH 1NUDA 4OV5B 1KIQB 1KPRA 5B4MC 2LTQB 1RIUL 3GSVA 1LO0H 3CVIH 5L8JB 1JGEB 1XGRB 4GXUN 3KPLA 2CKNA 1H5BB 4HUUA 1MAJA 5IT2L 3BFOA 2PETA 5JO5B 4MDIA 5D71H 3RX5A 4ZUTA 4KUZH 3BH9B 4EDXA 3GSQA 2ZOKA 1CL7I 3GMLB 3FQTA 4F37F 4ZAKB 3CK0H 4G6FD 4PD4K 1MQKH 4L3ED 2VKWA 2AEPH 4U4BA 1L0XA 1N3NB 4U33A 1NGXB 3HC4L 3VXRA 2J88H 2JIXA 4RAHA 4F2MB 2UZIH 3CX2A 4P99A 3K0WA 1CQYA 4FQJL 4JPVH 4NFCA 1FZKA 4F37K 5C3LD 1BQSA 5CEZE 2DKUA 2XT1B 4BM7A 3AXLB 1M05B 4FFWD 1DL7L 4EKXA 4PP1D 5JIHA 2HP4A 1DQTA 2R1WA 1HHIB 4LSUH 3VH8G 1C08A 4M43H 3RWJA 1G9MC 4FQ1L 3VRIA 3ARWA 5TQ0L 1BFVH 3GMLA 1CLYH 2NW2B 5C0JA 4ETQB 4LRNL 3GSOB 4XGZB 4D9LH 2E9WA 2YD8A 1XGUB 4WUUA 4LCCB 3C09B 3GSWA 2BCKA 3L5IA 4PGZA 3ARYA 3O2DL 2VLRA 4YDIH 2DLFL 2CIIA 3IDYB 1YMMA 2GJZA 3ES6B 4GSDH 3RY6C 3Q6GH 1KJMA 4WCYH 3CH8A 5EOQH 5FB8B 1BX2A 3X11A 2YRPA 2P7TB 3QA3A 1SMAA 1KLUB 3LKQB 4ZS6C 3Q5TA 4G9FE 1D6EB 4MAUL 3VXRD 3O9WD 1OP5K 3NIGE 4HGMA 4KVNL 1I8IB 2OMNA 5EBLA 4BSVB 2ZUTA 2NY2D 2GK0B 1DQJA 5JW4R 3KPNA 2Z8RA 3T2PA 1IAII 2QQNH 2LQRA 3C60A 4G6FB 4LNVA 5KAQG 5EB9A 5HHPA 2YD5A 3DV4A 2Q8BH 1ZVHA 5GRWA 4AYFA 3FB7B 4X80L 3T2OA 1W8OA 1U8QB 2HJLB 4TPRL 3ULSB 4OBRA 5E1HB 2HTLC 3WIFA 5I19L 2ESVD 2VDOH 3W0WB 4PJ7F 3HE6C 3JV4B 2A6IA 5IWLA 1K4CA 3SQBA 2F8XC 1PD6A 2P24B 3MRRB 3LPGA 4Z7OF 1TENA 3LS4H 4HUXA 3TFKC 5CJXA 4NC0B 5D1QC 3PGDB 4L3EA 2ADGB 5I73B 5KVGH 1I4FB 3RAJH 4IRSC 4FS0A 5CKGA 4AL8L 1CL7L 2VUOA 3RNKB 3F65A 1MCJA 2NY7H 3BGFB 4LBEB 2WANA 3AU1A 4R4BA 5EN2A 5E70A 5HHVH 1U91B 1KIRA 4WI2A 1H5BC 5E9DE 3DMMB 5T1KD 1BF2A 5FKAB 1OVZA 2OR8A 4XGZA 2IALB 1A7BA 2E7CA 4TPRH 4CKVX 1UXSB 2I5YL 5HDBE 1D5BB 4LSQL 2GCYA 1IARB 4OCSH 4OCLC 2DOCA 4BQ9A 2AJZA 3RIAF 1FDLL 4GRLC 1G6RH 3PQYB 1T0MB 4JGJA 3FTGA 2X4NA 4JCLA 2HFGL 3WNNA 3CLFL 2OR9L 1UM6L 2DDQL 4FQ2H 4M3KB 2H1PH 5F7KC 5KG9B 2YXMA 5J13C 2LAAA 4NQEB 4G43A 4PJIB 1MCDA 1KN4L 5B39B 1Q72H 1LMKA 4NQUA 3ULVC 1IBGH 3QUZA 5BJTB 2J6EA 1JPTL 4XBGB 4A6YH 5I16A 4LHUA 3HCVA 3LZFL 2YPKA 1YA5A 4YXLL