4YY3E

30s ribosomal subunit- higb complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4yy3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yy3E02
1Z5CA 4KQVA 1HNZE 2LUPB 4DPXA 2ZBKB 2ZITA 2V2QA 1WHQA 4MYUA 1X48A 4WYQB 3B82A 4LF9E 4B3RI 3ADIA 1YYKA 4USMA 1QZRA 3QT6A 1HNXE 2XEXA 2A2CA 4DUYE 2UUBE 2L2MA 5A2QC 1B63A 2Q2EB 3T1YI 4DU8A 1ZM2A 1Z0WA 4DV0E 4LF5E 2UUAE 1Z0GA 5LMUE 3D4JA 2V8PA 2JY9A 1Z59A 1RQ0A 4DPTA 4R1FA 4PU9A 1Z5BA 4LFBE 1FI4A 4DV7I 2BM1A 4DV7E 3T1YE 4DR4E 4DV2I 3ADGA 5BR8E 1XNRE 4DV0I 3LLHA 1X49A 2DMYA 2HHHE 4LFCE 4DV3I 4DV6I 1ZM4A 4DR2I 2LRSA 1XMQE 1J5EE 2V34A 1XNQE 1OJ4A 1N34I 4JI1I 4YY3I 1B62A 4DV5E 1UILA 4JV5E 3QT5A 4DV5I 4JYAI 4LFAE 1ZBTA 1N32E 2HKJA 4P52A 4WUDA 4DR7E 4P7AA 3ZKDA 1BKNA 2YT4A 2F4VE 1YZ9A 4MYTA 3ZKBA 1HNWI 4DV3E 4LFCI 2VQFI 4Z7CA 4DR2E 1NHIA 3M6AA 1I94I 4USKA 3V2UC 4DUZI 4NXMI 4DU7A 3J80C 4LF6I 4DUZE 4NXME 2UXDE 4X62E 4GKJE 5GMDA 4KHPE 1T4LB 3QT8A 3B8HA 1Z0CA 4DV4E 4JI3E 4DV4I 1N36E 3WU6A 1NZ0A 2LBSB 2DEJA 1XMOI 2X36A 4ED4A 2E1RA 5FLXC 3HULA 2L2KB 4FN5A 1PVGA 1O0WA 1RC7A 4DPUA 2GS8A 4X64E 4DR1E 3GONA 4M2ZA 4X64I 1XMOE 4NXNI 2BV3A 4FWDA 1S16A 4OOGC 5IT9Q 1GQEA 1VISA 4JI8E 1N33E 1U2RA 2E5LI 4DPYA 3J80Q 4JI6I 3PYEA 4DV6E 1NHJA 1IBME 1FNMA 4PRXA 4WUBA 4Z7YA 3Q1QA 2LUQA 4X65I 3ZM7A 4DR1I 2UXCI 2L33A 1XNRI 3HTXA 2ZM6E 1N33I 2UUAI 2HFSA 2F4VI 1H7UA 4JI2E 2KHXA 4DR5E 5CFFE 1H7SA 3LNUA 4DR6I 4HXZA 2L2NA 4JV5I 1ZM3A 2HKEA 2RS6A 4YY3E 4LF7E 4HY1A 2UUCI 4LF7I 4DV1I 1UHZA 3P1XA 1ZXNA 2ZM6I 4WUCA 4LF4I 3JAMC 1A6FA 4JI7E 1FWKA 3ADJA 1MG7A 2B7VA 4LF6E 2VQEE 4DKKA 2RSMA 3K1JA 2HK2A 1DARA 2LJPA 4DXLA 1XHKA 4DV1E 1NHHA 1ELOA 4KHPI 2N3HA 1MX0A 4JI5I 4JI3I 4X66E 1H74A 2N3GA 5L3JA 4LF8E 1Z0EA 4ZVIA 3C4TA 2UU9E 4GKKE 4JI6E 3OTOE 2J7KA 1HNXI 1PKPA 3H4LA 1N36I 1HNZI 5LL6R 4K0KE 1ZXMA 4URLA 4GKKI 4JG4A 1FKAE 4LF5I 2EZ6A 4JI0I 4JI0E 5LMUI 5IWAI 1IBMI 1XNQI 4LFBI 2X7IA 2RS7A 4X65E 1N34E 2R3VA 2UUBI 1ZM9A 1FJGE 3WU4A 3ZZ0A 3T1HE 5BR8I 4M30A 1WHNA 3PYFA 1IBLE 2L3CA 1KTVA 4FWHA 2E5LE 1UEKA 4WFTA 2WW4A 5GMEA 4OX9E 2UXBI 3VYXA 4DR6E 1K47A 3J81Q 4AQYE 1YYOA 1J5EI 4JI1E 1MU5A 1EA6A 4XTJA 4LFAI 3ZZUA 4DR7I 2L3JA 4LF4E 1N32I 2DEIA 4B3SI 4FWGA 3PYDA 1STUA 1QU6A 4JI5E 1IBKE 2HFUA 4HACA 5LMNE 1XMQI 2NPFA 2NUFA 3B78A 5IT9C 1KVKA 2DIXA 4B3TE 2UUCE 1PIEA 3ADLA 2UXDI 4LF9I 3JAMQ 4M1KA 2LTRA 3C4BA 2LTSA 4X8WA 2HK3A 1IBKI 1I94E 1KIJA 4DPWA 1X47A 2B3TB 1HR0E 4JI4I 4LF8I 4YHHE 4FW9A 3J81C 4B3RE 4X62I 4GKJI 1RR9A 4UT4A 4B3MI 2CPNA 1T4OA 4B3ME 4PRVA 3WU5A 1Z0VA 4X66I 2A2DA 1S4EA 4JI4E 2DB2A 4K0KI 4YHHI 4DV2E 4JI8I 3LPSA 2IHR1 3LTOA 2MDRA 4RPFA 2BM0A 3QT7A 3OTOI 5IWAE 2UXBE 4OX9I 2V2VA 1WUUA 4HYMA 1N0VC 4DUYI 4I3HA 2LJHA 2NA2A 3T1HI 4NXNE 1N0UA 1IBLI 4UTGA 4DR3I 4DR4I 1T4NA 2NUEA 1FWLA 2EFGA 2JVAA 5FLXQ 4JI2I 4JI7I 3J7AG 1H72C 3V5RA 2HHHI 3K17A 3J7Yp 3PYGA 4AQYI 4HACB 2UXCE 1FJGI 1Z0BA 2NUGA 2CZ9A 2RTXA 3F0NA 1DI2A 4JYAE 4DR3E 3J7AM 1EKZA 1KKHA 1Z0TA 4B3SE 3CWVA 1HNWE 1H73A 3VYYA 4DR5I 2VF3A 3WU3A 2VQFE 5LMNI 2V2ZA 1HR0I 1EI1A 2AJ4A 4B3TI 2VQEI 1Z5AA 2UU9I 1RREA 2B7TA 1YYWA 3ZZTA 2R42A 1J26A 4EMDA 2OI2A 5A2QQ 1D6TA
chains in the Genus database with same CATH superfamily
2R76A 5KL7A 1Z5CA 2C37B 3C6KA 1HNZE 2LUPB 4KQVA 4DPXA 2ZBKB 2ZITA 2J7JA 2CTDA 2V2QA 1WHQA 2YPNA 1Y4SA 2K4VA 2YU8A 4MLQA 2E1MA 2EOQA 5ADZA 4MYUA 5DRPA 3U1KA 1X48A 1AH5A 2EN4A 4WYQB 5F3WA 3B82A 4LF9E 4B3RI 4BA1A 3ADIA 2VESA 3HPSA 3HJCA 2V86A 1YYKA 3P06A 3B4TA 2YRHA 4USMA 1QZRA 3QT6A 1HNXE 2XEXA 1PJSA 3CDJA 2A2CA 4DUYE 5A2QC 2L2MA 2EOEA 2UUBE 3QG5C 4WSPA 1B63A 3HPZA 5DNXA 2J65A 5DRRA 2Q2EB 2Z5BB 2EOXA 3T1YI 2Z5EA 2LVHA 4DU8A 4TUGA 2BR2B 1ZM2A 1Z0WA 2CVEA 4DV0E 4X9JA 4LF5E 3GCMA 2UUAE 1X6FA 1Z0GA 2IOPA 5LMUE 2L6MA 2KOUA 2PNLA 3D4JA 4ZYEA 1E3PA 2V8PA 2JY9A 2ENHA 1Z59A 1RQ0A 5AE2A 4DPTA 4R1FA 4PU9A 1Z5BA 4LFBE 1Y6ZA 2PNMA 2IOQA 4OO1A 1FI4A 1JK2A 4DV7I 2YZTA 2E72A 2BM1A 2JOBA 2EM8A 4LU9A 4DV7E 3T1YE 4DR4E 4DV2I 3ADGA 5BR8E 1XNRE 4DV0I 2VF1A 3LLHA 2GLIA 2WBTA 1A1FA 1X49A 5EL9A 3RMPA 3H09A 2DMYA 2HHHE 4LFCE 4AIMA 4IZJD 3DF6A 4DV3I 1ZM4A 4DV6I 4DR2I 2CGEA 2LRSA 1XMQE 1J5EE 3BIDA 2V34A 2VRDA 1XNQE 2EL6A 3UHMA 2V87A 1OJ4A 2JXPA 4R2SA 1N34I 2CT1A 4JI1I 4YY3I 1B62A 4DV5E 1UILA 4JV5E 3QT5A 4DV5I 4JYAI 4LFAE 1ZBTA 1N32E 2HKJA 2NN6E 2GO3A 4P52A 2M7QA 2EM7A 4WUDA 4DR7E 4P7AA 2EPLX 3ZOQB 4WPYA 1BKNA 3ZKDA 2YT4A 2F4VE 2LT7A 1YZ9A 4MYTA 2DLKA 3VHTB 4IS1C 1IQOA 1YHCA 4QNJA 3ZKBA 2M1SA 2H36X 4DV3E 2V83A 1G2DC 4LFCI 5JEAC 4Z7CA 4DR2E 4Q35B 1NHIA 2VQFI 3M6AA 2BR2A 5JEAF 1I94I 4I8OA 2EQ3A 4USKA 4BBYA 3V2UC 5T6JA 4DUZI 2HJJA 4NXMI 3J80C 4DU7A 4LF6I 4DUZE 4NXME 2UXDE 2EN3A 4GZNC 2WP8A 4WSGA 1JK1A 2EMIA 3BGHA 4X62E 4GKJE 5GMDA 1MEYC 2EQ0A 3JU0A 1YPNA 5KL6A 4KHPE 1RMDA 1R6LA 1WRJA 1T4LB 3QT8A 3B8HA 4LCHA 1Z0CA 4OO1B 4DV4E 4P78A 4BC7A 4JI3E 2GPIA 4DV4I 1N36E 3WU6A 1NZ0A 2LBSB 4R2CA 5C0XC 2PNZA 2EMGA 2DEJA 1XMOI 5A6KA 3MSWA 2I13A 1TF6A 2DSYA 2X36A 1BBOA 4ED4A 2E1RA 3PS2A 2G7HA 5FLXC 2JEBB 3HULA 4F6MA 2WP8B 2L2KB 1KJKA 1BBGA 4LOMA 4FN5A 4IS9A 1NCSA 5KL2A 1PVGA 4R2DA 4FW7A 1O0WA 3BBGA 1RC7A 4DPUA 2EL5A 2GS8A 2DLQA 1QNTA 4IZJB 2EOIA 3NZKA 4X64E 2DRPA 5JEAE 4BS9A 4DR1E 3GONA 4M2ZA 4X64I 2EM3A 4BC9A 4BCAA 3HKMA 1XMOE 4NXNI 2YTEA 2BV3A 4FWDA 5K36B 2EPRA 2EQ1A 3FIGA 1Z1BA 1S16A 2HC5A 2EORA 2EL4A 5A6AA 4OOGC 2NN6A 5K36F 1GQEA 2PO1A 1VISA 4JI8E 5KL4A 5IV8B 1N33E 1U2RA 2NN6C 2Q8UA 2E5LI 4MU1A 4DPYA 3J80Q 4JI6I 3PYEA 4DV6E 2EMXA 1NHJA 1IBME 1FNMA 1F2IG 4PRXA 2EOOA 2V8QB 5AE3A 2BA1D 4RHBB 2MDGA 1X5WA 1RHYA 4Z7YA 3M85G 3Q1QA 2WBUA 3CDIA 2LUQA 2WNRA 4X65I 3ZM7A 1YFHA 4DR1I 2UXCI 4R2QA 5A6JA 3P76A 2L33A 3LMLA 2O3ZA 4MU4A 5C0XD 1XXEA 3IWDA 1XNRI 3HTXA 2ZM6E 2EN6A 2WCC3 1KYQA 1OYSA 1N33I 2KONA 2UUAI 2HFSA 1OYRA 2F4VI 1Y5YA 1H7UA 4JI2E 4HTGA 2EOZA 2KHXA 4DR5E 5CFFE 1H7SA 2JE6A 3L7ZA 1T38A 4IFDA 3LNUA 2GHFA 4DR6I 4HXZA 3IWBA 5EKWA 2C39A 4MLVA 1WXRA 2L2NA 4JV5I 1ZM3A 2JPAA 2HKEA 2RS6A 5TSEA 2EN1A 3AUZA 4YY3E 4LF7E 4HY1A 2UUCI 4LF7I 4DV1I 2EOHA 3ECRA 1UHZA 3P1XA 1OYPA 1ZXNA 5KL3A 2ZM6I 5K36E 3MHHC 3GMEA 4WUCA 4LF4I 3JAMC 1A6FA 2FV4B 4JI7E 5AASA 2D9HA 4R2PA 3ADJA 1TN9A 1FWKA 2CSHA 1MG7A 2ADRA 2PRTA 2RQLA 4O4KA 2VE7C 2B7VA 2JE6B 2EMWA 3L7ZB 4LF6E 2LV2A 2VQEE 4ZYHA 4DKKA 2RSMA 3K1JA 5C0XE 2HK2A 1R6MA 1DARA 2LJPA 4DXLA 1XHKA 3PS1A 4DV1E 2WNRB 2EWLA 1NHHA 2Z5BA 3L00A 1ELOA 2M9AA 4KHPI 2EMAA 2N3HA 1MX0A 2IESA 4N3OA 4IJDA 4JI5I 4FK5C 4JI3I 4X66E 2O1UA 4OO1E 1H74A 2MC6A 1L4SA 2N3GA 2EPXA 2BBGA 4AIDA 5L3JA 4LF8E 2ODRD 5C0XF 3DJWA 1Z0EA 2ELYA 3C4TA 2UU9E 4ZVIA 5A69A 4LCFA 3M7NG 2EMKA 2YWQA 4GKKE 2ENCA 2O1TA 5FWKA 3MHSC 3F6GA 4L8NA 4LPFA 4JI6E 1ZR9A 2EOYA 3OTOE 3AV0A 2J7KA 3M7ND 1HNXI 3KWRA 2EPZA 3IWCA 4TUIA 2GQ0A 3KRNA 3DD6A 1UDNA 1PKPA 2BB8A 3H4LA 4FW6A 1N36I 4BHBA 1HNZI 4DMIA 5LL6R 3EPKA 4K0KE 4O5GA 2EM9A 1ZXMA 2AE8A 2EM0A 4GEQB 3P3EA 4URLA 2EN8A 1YUIA 1Y4UA 4GKKI 4OKGA 2PO0B 2YTQA 4JG4A 1FKAE 2EOSA 2BA0D 1X6HA 2DGCA 4LF5I 1WJPA 5JEAD 2EZ6A 5AC5A 1ZBQA 1PJTA 4JI0I 2M4IA 2Z5CB 2EMLA 2YTJA 3UK3C 4JI0E 5LMUI 5IWAI 2EPMX 3PRYA 1UN6B 2BA0G 1IBMI 2FTXB 1HNWI 1XNQI 4LFBI 2X7IA 2RS7A 4X65E 2YTPA 3EPLA 1N34E 1ZU1A 2R3VA 1ZM9A 2UUBI 4IZKA 1PJQA 1UDQA 4QNKA 2YTIA 1FJGE 2EM4A 3WU4A 3THNA 3ZZ0A 3T1HE 5BR8I 1D6TA 2EMFA 2YSOA 4M30A 5A6BA 1WHNA 3PYFA 1IBLE 4HEIA 2L3CA 1KTVA 1G2FC 4FWHA 2E5LE 1UEKA 5DRQA 4WFTA 2RPCA 4F9CB 2K7IA 2MKDA 2WW4A 5GMEA 4OX9E 2UXBI 4R03A 4WXDA 5C0XA 3VYXA 4DR6E 2N8XA 4NZVA 1K47A 2EN7A 4WXCA 5LLQA 4LCGA 4AQYE 3J81Q 2R1FA 1TF3A 3PS3A 1YYOA 1J5EI 4JI1E 1MU5A 4BA2A 2HGHA 4IFDB 5ELWA 1UDSA 4F9BB 4ZYGA 3BF2A 1IMUA 1EA6A 4XTJA 4LFAI 3JTZA 3ZZUA 4J8ZA 4DR7I 2L3JA 2BA1G 5K36C 4LF4E 1N32I 2DEIA 4B3SI 4FWGA 3PYDA 1STUA 5DNLA 1QU6A 4AM3A 4JI5E 1IBKE 1A1JA 1IQSA 2HFUA 2LMZA 4GQUA 4HACA 5LMNE 2JYAA 4OO1F 3EPJA 1XMQI 2NPFA 2I9IA 2NUFA 3K85A 2JEAA 3B78A 3K6QA 4IFDC 2Z5CA 3M85D 5IT9C 1UBDC 3HQ1A 4ISAA 1KVKA 4IFDE 4J3DA 2YTFA 2DIXA 4F54A 4B3TE 2WZOA 1MGTA 1A1GA 2UUCE 1PIEA 2C38B 3ADLA 2UXDI 4LF9I 2YTDA 2JT2A 3H1CA 3JAMQ 4P7DA 3Q6NA 4M1KA 2YTGA 4F6NA 2LTRA 3THOB 3C4BA 5DROA 1AAYA 2LTSA 4X8WA 2HK3A 1IBKI 2JOXA 5JEAB 4IZJA 2LE2A 2FGGA 2EPCA 1HK7A 1Y60A 1N3GA 3TQMA 1A1HA 1I94E 1KIJA 4DPWA 1X47A 4U3DA 2C38A 4WUBA 2B3TB 1HR0E 2EM5A 4JI4I 2PNZB 4LF8I 2WBSA 4YHHE 2EPUA 2EOJA 2EMYA 3J81C 1A1KA 4FW9A 4B3RE 2JEAB 2YSPA 4OO1D 4X62I 2ENAA 2V88A 4MU0A 4GKJI 1LLMC 1RR9A 2JEBA 1GTKA 4M9VC 4UT4A 2EJ4A 5K36D 2MC5A 2CPNA 4B3MI 1T4OA 5DNYA 1YH8A 4B3ME 4PRVA 3KZZA 1P42A 2YTOA 2EPPA 4KZSA 1Z0VA 4OZEA 3WU5A 1EH7A 1YSAC 3Q6MA 4X66I 1T39A 3VK6A 2EOFA 5JEAA 2A2DA 2EM2A 1S4EA 4R2RA 4JI4E 2NN6D 2DB2A 4IFDF 4K0KI 2NN6F 4IFDD 2C39B 4YHHI 4DV2E 1DQ3A 4JI8I 1ZAAC 2IHR1 3LPSA 3LTOA 1DGCA 2MDRA 4RPFA 2BM0A 4KWYA 4F2JC 4WX9A 2L8TA 1P47A 3QT7A 4FW4A 2IERA 5IWAE 2UXBE 3OTOI 1A1IA 4OX9I 3U1YA 4MDTA 3EPHA 2YTNA 4ZYDA 2JP9A 2V2VA 4U3BA 1WUUA 2V89A 3M99B 4HYMA 1N0VC 4DUYI 4RH8A 2V85A 4I3HA 2LJHA 2EN2A 2NA2A 3F6HA 2EM6A 4R2EA 3T1HI 5IT9Q 2EMCA 4NXNE 2ELZA 4MQYA 2YRMA 1N0UA 1IBLI 1NEIA 4FW3A 1E3HA 4UTGA 1VI7A 4DR3I 4DR4I 2LCEA 1T4NA 5IXMB 4BA2B 1USUA 2EPAA 2NUEA 1FWLA 2EFGA 2PO2A 2JVAA 4BHCA 5FLXQ 4JI2I 4OO1C 4NHRA 4JI7I 1PDAA 3J7AG 1H72C 2EOMA 4NBQA 3V5RA 2HHHI 1BB8A 1GZ6A 2YU5A 3K17A 3J7Yp 5C0XB 3PYGA 2B9DA 4AQYI 3GLLA 4R2AA 4HACB 5K36A 1SFEA 2A25A 3KZYA 2EP3A 2UXCE 2JR1A 4BMJA 1FJGI 2EPKX 4Q28A 3C6MA 5KL5A 2GO4A 2MKNA 1Z0BA 2O1VA 3P3GA 2NUGA 2CZ9A 2RTXA 3F0NA 2PO1B 1DI2A 4JYAE 2PO0A 4IZKB 4FW5A 4DR3E 3J7AM 2EPNA 2LO3A 1EKZA 1YUJA 1KKHA 1Z0TA 4B3SE 2L92A 1A1LA 1HNWE 3CWVA 4O24A 1USVA 1H73A 2NABA 3VYYA 4DR5I 2VF3A 3WU3A 2VQFE 4R8OA 2PO2B 5LMNI 2JWOA 2EMHA 5AC4A 1X3CA 2EPOA 2F8BA 2CG9A 3HXLA 2O1WA 2V2ZA 1HR0I 1EI1A 2AJ4A 2EMZA 4N4RB 4B3TI 2VQEI 1X6EA 1Z5AA 2UU9I 4L5NC 3P3CA 1B69A 4F9AB 4M0VA 4BA1B 1EH8A 5AE1A 2NN6B 2EE8A 1RREA 2C37A 2B7TA 2RSIA 2F1DA 1EH6A 2DMIA 1YYWA 2YRKA 4MU3A 3ZZTA 2R42A 2EMBA 4LTYA 1J26A 2LJUA 4EMDA 1UDOA 2OI2A 5A2QQ 5A6BD 2ODRC 3EQ1A 3OMLA 1SR9A 4O43A
chains in the Genus database with same CATH topology
1Z5CA 4KQVA 1HNZE 2LUPB 4DPXA 2ZBKB 2ZITA 2V2QA 1WHQA 1Y4SA 2K4VA 2E1MA 5ADZA 4MYUA 1X48A 4WYQB 5F3WA 3B82A 4LF9E 4B3RI 3ADIA 3HPSA 3HJCA 2V86A 1YYKA 3P06A 4USMA 1QZRA 3QT6A 1HNXE 2XEXA 2A2CA 4DUYE 5A2QC 2L2MA 2UUBE 4WSPA 1B63A 3HPZA 2Q2EB 2Z5BB 3T1YI 2Z5EA 4DU8A 4TUGA 1ZM2A 1Z0WA 4DV0E 4LF5E 2UUAE 1Z0GA 2IOPA 5LMUE 2L6MA 2KOUA 2PNLA 3D4JA 2V8PA 2JY9A 1Z59A 1RQ0A 5AE2A 4DPTA 4R1FA 4PU9A 1Z5BA 4LFBE 1Y6ZA 2PNMA 2IOQA 1FI4A 4DV7I 2YZTA 2BM1A 2JOBA 4DV7E 4LU9A 4DR4E 3T1YE 4DV2I 3ADGA 5BR8E 1XNRE 4DV0I 2VF1A 3LLHA 1X49A 3RMPA 3H09A 2DMYA 2HHHE 4LFCE 4DV3I 4IZJD 3DF6A 4DV6I 1ZM4A 4DR2I 2CGEA 2LRSA 1XMQE 1J5EE 2V34A 1XNQE 2V87A 1OJ4A 1N34I 4JI1I 4YY3I 1B62A 4DV5E 1UILA 4JV5E 3QT5A 4DV5I 4JYAI 4LFAE 1ZBTA 1N32E 2HKJA 4P52A 2M7QA 4WUDA 4DR7E 4P7AA 3ZOQB 4WPYA 1BKNA 3ZKDA 2YT4A 2F4VE 1YZ9A 4MYTA 3ZKBA 2M1SA 2H36X 4DV3E 2V83A 4LFCI 4Z7CA 2VQFI 1HNWI 4DR2E 1NHIA 3M6AA 1I94I 4I8OA 4USKA 4BBYA 3V2UC 5T6JA 4DUZI 4NXMI 3J80C 4DU7A 4LF6I 4DUZE 4NXME 2UXDE 4X62E 4GKJE 5GMDA 3JU0A 4KHPE 1T4LB 3QT8A 3B8HA 1Z0CA 4DV4E 4BC7A 4P78A 4JI3E 4DV4I 1N36E 3WU6A 1NZ0A 2LBSB 2DEJA 1XMOI 3MSWA 2DSYA 2X36A 4ED4A 2E1RA 2G7HA 5FLXC 3HULA 2L2KB 4FN5A 1PVGA 1O0WA 1RC7A 4DPUA 2GS8A 4IZJB 4X64E 4BS9A 4DR1E 3GONA 4M2ZA 4X64I 4BC9A 4BCAA 1XMOE 4NXNI 2BV3A 4FWDA 3FIGA 1S16A 4OOGC 5IT9Q 1GQEA 1VISA 4JI8E 1N33E 1U2RA 2E5LI 4DPYA 3J80Q 4JI6I 3PYEA 4DV6E 1NHJA 1IBME 1FNMA 4PRXA 4WUBA 2V8QB 5AE3A 4Z7YA 3Q1QA 2LUQA 4X65I 3ZM7A 4DR1I 2UXCI 2L33A 3LMLA 1XNRI 3IWDA 3HTXA 2ZM6E 1N33I 2KONA 2UUAI 2HFSA 2F4VI 1H7UA 4JI2E 2KHXA 4DR5E 5CFFE 1H7SA 3LNUA 4DR6I 4HXZA 3IWBA 1WXRA 2L2NA 4JV5I 1ZM3A 2HKEA 2RS6A 3AUZA 4YY3E 4LF7E 4HY1A 2UUCI 4LF7I 4DV1I 1UHZA 3P1XA 1ZXNA 2ZM6I 4WUCA 4LF4I 3JAMC 1A6FA 2FV4B 4JI7E 5AASA 1FWKA 3ADJA 1MG7A 2VE7C 2B7VA 4LF6E 2VQEE 4DKKA 2RSMA 3K1JA 2HK2A 1DARA 2LJPA 4DXLA 1XHKA 4DV1E 2EWLA 1NHHA 2Z5BA 1ELOA 4KHPI 2N3HA 1MX0A 4N3OA 4JI5I 4JI3I 4X66E 2O1UA 1H74A 2MC6A 2N3GA 5L3JA 4LF8E 2ODRD 3DJWA 1Z0EA 4ZVIA 3C4TA 2UU9E 4GKKE 2O1TA 5FWKA 3F6GA 4L8NA 4JI6E 3OTOE 3AV0A 2J7KA 1HNXI 3KWRA 3IWCA 4TUIA 2GQ0A 1PKPA 3H4LA 1N36I 1HNZI 4DMIA 5LL6R 4K0KE 1ZXMA 4GEQB 4URLA 1Y4UA 4GKKI 4JG4A 1FKAE 4LF5I 2EZ6A 4JI0I 1ZBQA 2M4IA 2Z5CB 4JI0E 5LMUI 5IWAI 3PRYA 1IBMI 2FTXB 1XNQI 4LFBI 2X7IA 2RS7A 4X65E 1N34E 2R3VA 2UUBI 1ZM9A 4IZKA 1FJGE 3WU4A 3ZZ0A 3T1HE 5BR8I 1D6TA 4M30A 1WHNA 3PYFA 1IBLE 2L3CA 1KTVA 4FWHA 2E5LE 1UEKA 4WFTA 2WW4A 4F9CB 5GMEA 4OX9E 2UXBI 4R03A 3VYXA 4DR6E 1K47A 3J81Q 4AQYE 1YYOA 1J5EI 4JI1E 1MU5A 4F9BB 1EA6A 4XTJA 4LFAI 3JTZA 3ZZUA 4J8ZA 4DR7I 2L3JA 4LF4E 1N32I 2DEIA 4B3SI 4FWGA 3PYDA 1STUA 1QU6A 4JI5E 1IBKE 2HFUA 2LMZA 4HACA 5LMNE 1XMQI 2NPFA 3K85A 2NUFA 3B78A 3K6QA 2Z5CA 5IT9C 3HQ1A 1KVKA 2DIXA 4F54A 4B3TE 2WZOA 2UUCE 1PIEA 3ADLA 2UXDI 4LF9I 3JAMQ 4P7DA 3Q6NA 4M1KA 2LTRA 3C4BA 2LTSA 4X8WA 2HK3A 1IBKI 2JOXA 4IZJA 1HK7A 2FGGA 2LE2A 1I94E 1KIJA 4DPWA 1X47A 2B3TB 1HR0E 4JI4I 4LF8I 4YHHE 4FW9A 3J81C 4B3RE 4X62I 4GKJI 2V88A 1RR9A 4UT4A 2MC5A 2CPNA 4B3MI 1T4OA 5DNYA 4B3ME 4PRVA 4KZSA 3WU5A 1Z0VA 3Q6MA 4X66I 3VK6A 2A2DA 1S4EA 4JI4E 2DB2A 4K0KI 4YHHI 4DV2E 1DQ3A 4JI8I 3LPSA 2IHR1 3LTOA 2MDRA 4RPFA 2BM0A 2L8TA 3QT7A 3OTOI 5IWAE 2UXBE 4OX9I 2V2VA 1WUUA 2V89A 4HYMA 1N0VC 4DUYI 2V85A 4I3HA 2LJHA 3F6HA 2NA2A 3T1HI 4NXNE 1N0UA 1IBLI 4UTGA 4DR3I 4DR4I 1T4NA 1USUA 2NUEA 1FWLA 2EFGA 2JVAA 5FLXQ 4JI2I 4JI7I 3J7AG 1H72C 3V5RA 2HHHI 1GZ6A 3K17A 3J7Yp 3PYGA 2B9DA 4AQYI 4HACB 2UXCE 2JR1A 4BMJA 1FJGI 4Q28A 1Z0BA 2O1VA 2NUGA 2CZ9A 2RTXA 3F0NA 1DI2A 4JYAE 4IZKB 4DR3E 3J7AM 1EKZA 1KKHA 1Z0TA 4B3SE 2L92A 3CWVA 1HNWE 1USVA 1H73A 3VYYA 4DR5I 2VF3A 3WU3A 2VQFE 4R8OA 5LMNI 2JWOA 2V2ZA 2CG9A 2F8BA 1HR0I 3HXLA 2O1WA 1EI1A 2AJ4A 4B3TI 2VQEI 1Z5AA 2UU9I 4L5NC 4F9AB 4M0VA 5AE1A 1RREA 2B7TA 1YYWA 3ZZTA 2R42A 1J26A 4LTYA 4EMDA 2OI2A 5A2QQ 2ODRC 3OMLA 1SR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5C A;  4KQV A;  1HNZ E;  2LUP B;  4DPX A;  2ZBK B;  2ZIT A;  2V2Q A;  1WHQ A;  4MYU A;  1X48 A;  4WYQ B;  3B82 A;  4LF9 E;  4B3R I;  3ADI A;  1YYK A;  4USM A;  1QZR A;  3QT6 A;  1HNX E;  2XEX A;  2A2C A;  4DUY E;  2UUB E;  2L2M A;  5A2Q C;  1B63 A;  2Q2E B;  3T1Y I;  4DU8 A;  1ZM2 A;  1Z0W A;  4DV0 E;  4LF5 E;  2UUA E;  1Z0G A;  5LMU E;  3D4J A;  2V8P A;  2JY9 A;  1Z59 A;  1RQ0 A;  4DPT A;  4R1F A;  4PU9 A;  1Z5B A;  4LFB E;  1FI4 A;  4DV7 I;  2BM1 A;  4DV7 E;  3T1Y E;  4DR4 E;  4DV2 I;  3ADG A;  5BR8 E;  1XNR E;  4DV0 I;  3LLH A;  1X49 A;  2DMY A;  2HHH E;  4LFC E;  4DV3 I;  4DV6 I;  1ZM4 A;  4DR2 I;  2LRS A;  1XMQ E;  1J5E E;  2V34 A;  1XNQ E;  1OJ4 A;  1N34 I;  4JI1 I;  4YY3 I;  1B62 A;  4DV5 E;  1UIL A;  4JV5 E;  3QT5 A;  4DV5 I;  4JYA I;  4LFA E;  1ZBT A;  1N32 E;  2HKJ A;  4P52 A;  4WUD A;  4DR7 E;  4P7A A;  3ZKD A;  1BKN A;  2YT4 A;  2F4V E;  1YZ9 A;  4MYT A;  3ZKB A;  1HNW I;  4DV3 E;  4LFC I;  2VQF I;  4Z7C A;  4DR2 E;  1NHI A;  3M6A A;  1I94 I;  4USK A;  3V2U C;  4DUZ I;  4NXM I;  4DU7 A;  3J80 C;  4LF6 I;  4DUZ E;  4NXM E;  2UXD E;  4X62 E;  4GKJ E;  5GMD A;  4KHP E;  1T4L B;  3QT8 A;  3B8H A;  1Z0C A;  4DV4 E;  4JI3 E;  4DV4 I;  1N36 E;  3WU6 A;  1NZ0 A;  2LBS B;  2DEJ A;  1XMO I;  2X36 A;  4ED4 A;  2E1R A;  5FLX C;  3HUL A;  2L2K B;  4FN5 A;  1PVG A;  1O0W A;  1RC7 A;  4DPU A;  2GS8 A;  4X64 E;  4DR1 E;  3GON A;  4M2Z A;  4X64 I;  1XMO E;  4NXN I;  2BV3 A;  4FWD A;  1S16 A;  4OOG C;  5IT9 Q;  1GQE A;  1VIS A;  4JI8 E;  1N33 E;  1U2R A;  2E5L I;  4DPY A;  3J80 Q;  4JI6 I;  3PYE A;  4DV6 E;  1NHJ A;  1IBM E;  1FNM A;  4PRX A;  4WUB A;  4Z7Y A;  3Q1Q A;  2LUQ A;  4X65 I;  3ZM7 A;  4DR1 I;  2UXC I;  2L33 A;  1XNR I;  3HTX A;  2ZM6 E;  1N33 I;  2UUA I;  2HFS A;  2F4V I;  1H7U A;  4JI2 E;  2KHX A;  4DR5 E;  5CFF E;  1H7S A;  3LNU A;  4DR6 I;  4HXZ A;  2L2N A;  4JV5 I;  1ZM3 A;  2HKE A;  2RS6 A;  4YY3 E;  4LF7 E;  4HY1 A;  2UUC I;  4LF7 I;  4DV1 I;  1UHZ A;  3P1X A;  1ZXN A;  2ZM6 I;  4WUC A;  4LF4 I;  3JAM C;  1A6F A;  4JI7 E;  1FWK A;  3ADJ A;  1MG7 A;  2B7V A;  4LF6 E;  2VQE E;  4DKK A;  2RSM A;  3K1J A;  2HK2 A;  1DAR A;  2LJP A;  4DXL A;  1XHK A;  4DV1 E;  1NHH A;  1ELO A;  4KHP I;  2N3H A;  1MX0 A;  4JI5 I;  4JI3 I;  4X66 E;  1H74 A;  2N3G A;  5L3J A;  4LF8 E;  1Z0E A;  4ZVI A;  3C4T A;  2UU9 E;  4GKK E;  4JI6 E;  3OTO E;  2J7K A;  1HNX I;  1PKP A;  3H4L A;  1N36 I;  1HNZ I;  5LL6 R;  4K0K E;  1ZXM A;  4URL A;  4GKK I;  4JG4 A;  1FKA E;  4LF5 I;  2EZ6 A;  4JI0 I;  4JI0 E;  5LMU I;  5IWA I;  1IBM I;  1XNQ I;  4LFB I;  2X7I A;  2RS7 A;  4X65 E;  1N34 E;  2R3V A;  2UUB I;  1ZM9 A;  1FJG E;  3WU4 A;  3ZZ0 A;  3T1H E;  5BR8 I;  4M30 A;  1WHN A;  3PYF A;  1IBL E;  2L3C A;  1KTV A;  4FWH A;  2E5L E;  1UEK A;  4WFT A;  2WW4 A;  5GME A;  4OX9 E;  2UXB I;  3VYX A;  4DR6 E;  1K47 A;  3J81 Q;  4AQY E;  1YYO A;  1J5E I;  4JI1 E;  1MU5 A;  1EA6 A;  4XTJ A;  4LFA I;  3ZZU A;  4DR7 I;  2L3J A;  4LF4 E;  1N32 I;  2DEI A;  4B3S I;  4FWG A;  3PYD A;  1STU A;  1QU6 A;  4JI5 E;  1IBK E;  2HFU A;  4HAC A;  5LMN E;  1XMQ I;  2NPF A;  2NUF A;  3B78 A;  5IT9 C;  1KVK A;  2DIX A;  4B3T E;  2UUC E;  1PIE A;  3ADL A;  2UXD I;  4LF9 I;  3JAM Q;  4M1K A;  2LTR A;  3C4B A;  2LTS A;  4X8W A;  2HK3 A;  1IBK I;  1I94 E;  1KIJ A;  4DPW A;  1X47 A;  2B3T B;  1HR0 E;  4JI4 I;  4LF8 I;  4YHH E;  4FW9 A;  3J81 C;  4B3R E;  4X62 I;  4GKJ I;  1RR9 A;  4UT4 A;  4B3M I;  2CPN A;  1T4O A;  4B3M E;  4PRV A;  3WU5 A;  1Z0V A;  4X66 I;  2A2D A;  1S4E A;  4JI4 E;  2DB2 A;  4K0K I;  4YHH I;  4DV2 E;  4JI8 I;  3LPS A;  2IHR 1;  3LTO A;  2MDR A;  4RPF A;  2BM0 A;  3QT7 A;  3OTO I;  5IWA E;  2UXB E;  4OX9 I;  2V2V A;  1WUU A;  4HYM A;  1N0V C;  4DUY I;  4I3H A;  2LJH A;  2NA2 A;  3T1H I;  4NXN E;  1N0U A;  1IBL I;  4UTG A;  4DR3 I;  4DR4 I;  1T4N A;  2NUE A;  1FWL A;  2EFG A;  2JVA A;  5FLX Q;  4JI2 I;  4JI7 I;  3J7A G;  1H72 C;  3V5R A;  2HHH I;  3K17 A;  3J7Y p;  3PYG A;  4AQY I;  4HAC B;  2UXC E;  1FJG I;  1Z0B A;  2NUG A;  2CZ9 A;  2RTX A;  3F0N A;  1DI2 A;  4JYA E;  4DR3 E;  3J7A M;  1EKZ A;  1KKH A;  1Z0T A;  4B3S E;  3CWV A;  1HNW E;  1H73 A;  3VYY A;  4DR5 I;  2VF3 A;  3WU3 A;  2VQF E;  5LMN I;  2V2Z A;  1HR0 I;  1EI1 A;  2AJ4 A;  4B3T I;  2VQE I;  1Z5A A;  2UU9 I;  1RRE A;  2B7T A;  1YYW A;  3ZZT A;  2R42 A;  1J26 A;  4EMD A;  2OI2 A;  5A2Q Q;  1D6T A; 
#chains in the Genus database with same CATH topology
 2R76 A;  5KL7 A;  1Z5C A;  2C37 B;  3C6K A;  1HNZ E;  2LUP B;  4KQV A;  4DPX A;  2ZBK B;  2ZIT A;  2J7J A;  2CTD A;  2V2Q A;  1WHQ A;  2YPN A;  1Y4S A;  2K4V A;  2YU8 A;  4MLQ A;  2E1M A;  2EOQ A;  5ADZ A;  4MYU A;  5DRP A;  3U1K A;  1X48 A;  1AH5 A;  2EN4 A;  4WYQ B;  5F3W A;  3B82 A;  4LF9 E;  4B3R I;  4BA1 A;  3ADI A;  2VES A;  3HPS A;  3HJC A;  2V86 A;  1YYK A;  3P06 A;  3B4T A;  2YRH A;  4USM A;  1QZR A;  3QT6 A;  1HNX E;  2XEX A;  1PJS A;  3CDJ A;  2A2C A;  4DUY E;  5A2Q C;  2L2M A;  2EOE A;  2UUB E;  3QG5 C;  4WSP A;  1B63 A;  3HPZ A;  5DNX A;  2J65 A;  5DRR A;  2Q2E B;  2Z5B B;  2EOX A;  3T1Y I;  2Z5E A;  2LVH A;  4DU8 A;  4TUG A;  2BR2 B;  1ZM2 A;  1Z0W A;  2CVE A;  4DV0 E;  4X9J A;  4LF5 E;  3GCM A;  2UUA E;  1X6F A;  1Z0G A;  2IOP A;  5LMU E;  2L6M A;  2KOU A;  2PNL A;  3D4J A;  4ZYE A;  1E3P A;  2V8P A;  2JY9 A;  2ENH A;  1Z59 A;  1RQ0 A;  5AE2 A;  4DPT A;  4R1F A;  4PU9 A;  1Z5B A;  4LFB E;  1Y6Z A;  2PNM A;  2IOQ A;  4OO1 A;  1FI4 A;  1JK2 A;  4DV7 I;  2YZT A;  2E72 A;  2BM1 A;  2JOB A;  2EM8 A;  4LU9 A;  4DV7 E;  3T1Y E;  4DR4 E;  4DV2 I;  3ADG A;  5BR8 E;  1XNR E;  4DV0 I;  2VF1 A;  3LLH A;  2GLI A;  2WBT A;  1A1F A;  1X49 A;  5EL9 A;  3RMP A;  3H09 A;  2DMY A;  2HHH E;  4LFC E;  4AIM A;  4IZJ D;  3DF6 A;  4DV3 I;  1ZM4 A;  4DV6 I;  4DR2 I;  2CGE A;  2LRS A;  1XMQ E;  1J5E E;  3BID A;  2V34 A;  2VRD A;  1XNQ E;  2EL6 A;  3UHM A;  2V87 A;  1OJ4 A;  2JXP A;  4R2S A;  1N34 I;  2CT1 A;  4JI1 I;  4YY3 I;  1B62 A;  4DV5 E;  1UIL A;  4JV5 E;  3QT5 A;  4DV5 I;  4JYA I;  4LFA E;  1ZBT A;  1N32 E;  2HKJ A;  2NN6 E;  2GO3 A;  4P52 A;  2M7Q A;  2EM7 A;  4WUD A;  4DR7 E;  4P7A A;  2EPL X;  3ZOQ B;  4WPY A;  1BKN A;  3ZKD A;  2YT4 A;  2F4V E;  2LT7 A;  1YZ9 A;  4MYT A;  2DLK A;  3VHT B;  4IS1 C;  1IQO A;  1YHC A;  4QNJ A;  3ZKB A;  2M1S A;  2H36 X;  4DV3 E;  2V83 A;  1G2D C;  4LFC I;  5JEA C;  4Z7C A;  4DR2 E;  4Q35 B;  1NHI A;  2VQF I;  3M6A A;  2BR2 A;  5JEA F;  1I94 I;  4I8O A;  2EQ3 A;  4USK A;  4BBY A;  3V2U C;  5T6J A;  4DUZ I;  2HJJ A;  4NXM I;  3J80 C;  4DU7 A;  4LF6 I;  4DUZ E;  4NXM E;  2UXD E;  2EN3 A;  4GZN C;  2WP8 A;  4WSG A;  1JK1 A;  2EMI A;  3BGH A;  4X62 E;  4GKJ E;  5GMD A;  1MEY C;  2EQ0 A;  3JU0 A;  1YPN A;  5KL6 A;  4KHP E;  1RMD A;  1R6L A;  1WRJ A;  1T4L B;  3QT8 A;  3B8H A;  4LCH A;  1Z0C A;  4OO1 B;  4DV4 E;  4P78 A;  4BC7 A;  4JI3 E;  2GPI A;  4DV4 I;  1N36 E;  3WU6 A;  1NZ0 A;  2LBS B;  4R2C A;  5C0X C;  2PNZ A;  2EMG A;  2DEJ A;  1XMO I;  5A6K A;  3MSW A;  2I13 A;  1TF6 A;  2DSY A;  2X36 A;  1BBO A;  4ED4 A;  2E1R A;  3PS2 A;  2G7H A;  5FLX C;  2JEB B;  3HUL A;  4F6M A;  2WP8 B;  2L2K B;  1KJK A;  1BBG A;  4LOM A;  4FN5 A;  4IS9 A;  1NCS A;  5KL2 A;  1PVG A;  4R2D A;  4FW7 A;  1O0W A;  3BBG A;  1RC7 A;  4DPU A;  2EL5 A;  2GS8 A;  2DLQ A;  1QNT A;  4IZJ B;  2EOI A;  3NZK A;  4X64 E;  2DRP A;  5JEA E;  4BS9 A;  4DR1 E;  3GON A;  4M2Z A;  4X64 I;  2EM3 A;  4BC9 A;  4BCA A;  3HKM A;  1XMO E;  4NXN I;  2YTE A;  2BV3 A;  4FWD A;  5K36 B;  2EPR A;  2EQ1 A;  3FIG A;  1Z1B A;  1S16 A;  2HC5 A;  2EOR A;  2EL4 A;  5A6A A;  4OOG C;  2NN6 A;  5K36 F;  1GQE A;  2PO1 A;  1VIS A;  4JI8 E;  5KL4 A;  5IV8 B;  1N33 E;  1U2R A;  2NN6 C;  2Q8U A;  2E5L I;  4MU1 A;  4DPY A;  3J80 Q;  4JI6 I;  3PYE A;  4DV6 E;  2EMX A;  1NHJ A;  1IBM E;  1FNM A;  1F2I G;  4PRX A;  2EOO A;  2V8Q B;  5AE3 A;  2BA1 D;  4RHB B;  2MDG A;  1X5W A;  1RHY A;  4Z7Y A;  3M85 G;  3Q1Q A;  2WBU A;  3CDI A;  2LUQ A;  2WNR A;  4X65 I;  3ZM7 A;  1YFH A;  4DR1 I;  2UXC I;  4R2Q A;  5A6J A;  3P76 A;  2L33 A;  3LML A;  2O3Z A;  4MU4 A;  5C0X D;  1XXE A;  3IWD A;  1XNR I;  3HTX A;  2ZM6 E;  2EN6 A;  2WCC 3;  1KYQ A;  1OYS A;  1N33 I;  2KON A;  2UUA I;  2HFS A;  1OYR A;  2F4V I;  1Y5Y A;  1H7U A;  4JI2 E;  4HTG A;  2EOZ A;  2KHX A;  4DR5 E;  5CFF E;  1H7S A;  2JE6 A;  3L7Z A;  1T38 A;  4IFD A;  3LNU A;  2GHF A;  4DR6 I;  4HXZ A;  3IWB A;  5EKW A;  2C39 A;  4MLV A;  1WXR A;  2L2N A;  4JV5 I;  1ZM3 A;  2JPA A;  2HKE A;  2RS6 A;  5TSE A;  2EN1 A;  3AUZ A;  4YY3 E;  4LF7 E;  4HY1 A;  2UUC I;  4LF7 I;  4DV1 I;  2EOH A;  3ECR A;  1UHZ A;  3P1X A;  1OYP A;  1ZXN A;  5KL3 A;  2ZM6 I;  5K36 E;  3MHH C;  3GME A;  4WUC A;  4LF4 I;  3JAM C;  1A6F A;  2FV4 B;  4JI7 E;  5AAS A;  2D9H A;  4R2P A;  3ADJ A;  1TN9 A;  1FWK A;  2CSH A;  1MG7 A;  2ADR A;  2PRT A;  2RQL A;  4O4K A;  2VE7 C;  2B7V A;  2JE6 B;  2EMW A;  3L7Z B;  4LF6 E;  2LV2 A;  2VQE E;  4ZYH A;  4DKK A;  2RSM A;  3K1J A;  5C0X E;  2HK2 A;  1R6M A;  1DAR A;  2LJP A;  4DXL A;  1XHK A;  3PS1 A;  4DV1 E;  2WNR B;  2EWL A;  1NHH A;  2Z5B A;  3L00 A;  1ELO A;  2M9A A;  4KHP I;  2EMA A;  2N3H A;  1MX0 A;  2IES A;  4N3O A;  4IJD A;  4JI5 I;  4FK5 C;  4JI3 I;  4X66 E;  2O1U A;  4OO1 E;  1H74 A;  2MC6 A;  1L4S A;  2N3G A;  2EPX A;  2BBG A;  4AID A;  5L3J A;  4LF8 E;  2ODR D;  5C0X F;  3DJW A;  1Z0E A;  2ELY A;  3C4T A;  2UU9 E;  4ZVI A;  5A69 A;  4LCF A;  3M7N G;  2EMK A;  2YWQ A;  4GKK E;  2ENC A;  2O1T A;  5FWK A;  3MHS C;  3F6G A;  4L8N A;  4LPF A;  4JI6 E;  1ZR9 A;  2EOY A;  3OTO E;  3AV0 A;  2J7K A;  3M7N D;  1HNX I;  3KWR A;  2EPZ A;  3IWC A;  4TUI A;  2GQ0 A;  3KRN A;  3DD6 A;  1UDN A;  1PKP A;  2BB8 A;  3H4L A;  4FW6 A;  1N36 I;  4BHB A;  1HNZ I;  4DMI A;  5LL6 R;  3EPK A;  4K0K E;  4O5G A;  2EM9 A;  1ZXM A;  2AE8 A;  2EM0 A;  4GEQ B;  3P3E A;  4URL A;  2EN8 A;  1YUI A;  1Y4U A;  4GKK I;  4OKG A;  2PO0 B;  2YTQ A;  4JG4 A;  1FKA E;  2EOS A;  2BA0 D;  1X6H A;  2DGC A;  4LF5 I;  1WJP A;  5JEA D;  2EZ6 A;  5AC5 A;  1ZBQ A;  1PJT A;  4JI0 I;  2M4I A;  2Z5C B;  2EML A;  2YTJ A;  3UK3 C;  4JI0 E;  5LMU I;  5IWA I;  2EPM X;  3PRY A;  1UN6 B;  2BA0 G;  1IBM I;  2FTX B;  1HNW I;  1XNQ I;  4LFB I;  2X7I A;  2RS7 A;  4X65 E;  2YTP A;  3EPL A;  1N34 E;  1ZU1 A;  2R3V A;  1ZM9 A;  2UUB I;  4IZK A;  1PJQ A;  1UDQ A;  4QNK A;  2YTI A;  1FJG E;  2EM4 A;  3WU4 A;  3THN A;  3ZZ0 A;  3T1H E;  5BR8 I;  1D6T A;  2EMF A;  2YSO A;  4M30 A;  5A6B A;  1WHN A;  3PYF A;  1IBL E;  4HEI A;  2L3C A;  1KTV A;  1G2F C;  4FWH A;  2E5L E;  1UEK A;  5DRQ A;  4WFT A;  2RPC A;  4F9C B;  2K7I A;  2MKD A;  2WW4 A;  5GME A;  4OX9 E;  2UXB I;  4R03 A;  4WXD A;  5C0X A;  3VYX A;  4DR6 E;  2N8X A;  4NZV A;  1K47 A;  2EN7 A;  4WXC A;  5LLQ A;  4LCG A;  4AQY E;  3J81 Q;  2R1F A;  1TF3 A;  3PS3 A;  1YYO A;  1J5E I;  4JI1 E;  1MU5 A;  4BA2 A;  2HGH A;  4IFD B;  5ELW A;  1UDS A;  4F9B B;  4ZYG A;  3BF2 A;  1IMU A;  1EA6 A;  4XTJ A;  4LFA I;  3JTZ A;  3ZZU A;  4J8Z A;  4DR7 I;  2L3J A;  2BA1 G;  5K36 C;  4LF4 E;  1N32 I;  2DEI A;  4B3S I;  4FWG A;  3PYD A;  1STU A;  5DNL A;  1QU6 A;  4AM3 A;  4JI5 E;  1IBK E;  1A1J A;  1IQS A;  2HFU A;  2LMZ A;  4GQU A;  4HAC A;  5LMN E;  2JYA A;  4OO1 F;  3EPJ A;  1XMQ I;  2NPF A;  2I9I A;  2NUF A;  3K85 A;  2JEA A;  3B78 A;  3K6Q A;  4IFD C;  2Z5C A;  3M85 D;  5IT9 C;  1UBD C;  3HQ1 A;  4ISA A;  1KVK A;  4IFD E;  4J3D A;  2YTF A;  2DIX A;  4F54 A;  4B3T E;  2WZO A;  1MGT A;  1A1G A;  2UUC E;  1PIE A;  2C38 B;  3ADL A;  2UXD I;  4LF9 I;  2YTD A;  2JT2 A;  3H1C A;  3JAM Q;  4P7D A;  3Q6N A;  4M1K A;  2YTG A;  4F6N A;  2LTR A;  3THO B;  3C4B A;  5DRO A;  1AAY A;  2LTS A;  4X8W A;  2HK3 A;  1IBK I;  2JOX A;  5JEA B;  4IZJ A;  2LE2 A;  2FGG A;  2EPC A;  1HK7 A;  1Y60 A;  1N3G A;  3TQM A;  1A1H A;  1I94 E;  1KIJ A;  4DPW A;  1X47 A;  4U3D A;  2C38 A;  4WUB A;  2B3T B;  1HR0 E;  2EM5 A;  4JI4 I;  2PNZ B;  4LF8 I;  2WBS A;  4YHH E;  2EPU A;  2EOJ A;  2EMY A;  3J81 C;  1A1K A;  4FW9 A;  4B3R E;  2JEA B;  2YSP A;  4OO1 D;  4X62 I;  2ENA A;  2V88 A;  4MU0 A;  4GKJ I;  1LLM C;  1RR9 A;  2JEB A;  1GTK A;  4M9V C;  4UT4 A;  2EJ4 A;  5K36 D;  2MC5 A;  2CPN A;  4B3M I;  1T4O A;  5DNY A;  1YH8 A;  4B3M E;  4PRV A;  3KZZ A;  1P42 A;  2YTO A;  2EPP A;  4KZS A;  1Z0V A;  4OZE A;  3WU5 A;  1EH7 A;  1YSA C;  3Q6M A;  4X66 I;  1T39 A;  3VK6 A;  2EOF A;  5JEA A;  2A2D A;  2EM2 A;  1S4E A;  4R2R A;  4JI4 E;  2NN6 D;  2DB2 A;  4IFD F;  4K0K I;  2NN6 F;  4IFD D;  2C39 B;  4YHH I;  4DV2 E;  1DQ3 A;  4JI8 I;  1ZAA C;  2IHR 1;  3LPS A;  3LTO A;  1DGC A;  2MDR A;  4RPF A;  2BM0 A;  4KWY A;  4F2J C;  4WX9 A;  2L8T A;  1P47 A;  3QT7 A;  4FW4 A;  2IER A;  5IWA E;  2UXB E;  3OTO I;  1A1I A;  4OX9 I;  3U1Y A;  4MDT A;  3EPH A;  2YTN A;  4ZYD A;  2JP9 A;  2V2V A;  4U3B A;  1WUU A;  2V89 A;  3M99 B;  4HYM A;  1N0V C;  4DUY I;  4RH8 A;  2V85 A;  4I3H A;  2LJH A;  2EN2 A;  2NA2 A;  3F6H A;  2EM6 A;  4R2E A;  3T1H I;  5IT9 Q;  2EMC A;  4NXN E;  2ELZ A;  4MQY A;  2YRM A;  1N0U A;  1IBL I;  1NEI A;  4FW3 A;  1E3H A;  4UTG A;  1VI7 A;  4DR3 I;  4DR4 I;  2LCE A;  1T4N A;  5IXM B;  4BA2 B;  1USU A;  2EPA A;  2NUE A;  1FWL A;  2EFG A;  2PO2 A;  2JVA A;  4BHC A;  5FLX Q;  4JI2 I;  4OO1 C;  4NHR A;  4JI7 I;  1PDA A;  3J7A G;  1H72 C;  2EOM A;  4NBQ A;  3V5R A;  2HHH I;  1BB8 A;  1GZ6 A;  2YU5 A;  3K17 A;  3J7Y p;  5C0X B;  3PYG A;  2B9D A;  4AQY I;  3GLL A;  4R2A A;  4HAC B;  5K36 A;  1SFE A;  2A25 A;  3KZY A;  2EP3 A;  2UXC E;  2JR1 A;  4BMJ A;  1FJG I;  2EPK X;  4Q28 A;  3C6M A;  5KL5 A;  2GO4 A;  2MKN A;  1Z0B A;  2O1V A;  3P3G A;  2NUG A;  2CZ9 A;  2RTX A;  3F0N A;  2PO1 B;  1DI2 A;  4JYA E;  2PO0 A;  4IZK B;  4FW5 A;  4DR3 E;  3J7A M;  2EPN A;  2LO3 A;  1EKZ A;  1YUJ A;  1KKH A;  1Z0T A;  4B3S E;  2L92 A;  1A1L A;  1HNW E;  3CWV A;  4O24 A;  1USV A;  1H73 A;  2NAB A;  3VYY A;  4DR5 I;  2VF3 A;  3WU3 A;  2VQF E;  4R8O A;  2PO2 B;  5LMN I;  2JWO A;  2EMH A;  5AC4 A;  1X3C A;  2EPO A;  2F8B A;  2CG9 A;  3HXL A;  2O1W A;  2V2Z A;  1HR0 I;  1EI1 A;  2AJ4 A;  2EMZ A;  4N4R B;  4B3T I;  2VQE I;  1X6E A;  1Z5A A;  2UU9 I;  4L5N C;  3P3C A;  1B69 A;  4F9A B;  4M0V A;  4BA1 B;  1EH8 A;  5AE1 A;  2NN6 B;  2EE8 A;  1RRE A;  2C37 A;  2B7T A;  2RSI A;  2F1D A;  1EH6 A;  2DMI A;  1YYW A;  2YRK A;  4MU3 A;  3ZZT A;  2R42 A;  2EMB A;  4LTY A;  1J26 A;  2LJU A;  4EMD A;  1UDO A;  2OI2 A;  5A2Q Q;  5A6B D;  2ODR C;  3EQ1 A;  3OML A;  1SR9 A;  4O43 A; 
#chains in the Genus database with same CATH homology
 1Z5C A;  4KQV A;  1HNZ E;  2LUP B;  4DPX A;  2ZBK B;  2ZIT A;  2V2Q A;  1WHQ A;  1Y4S A;  2K4V A;  2E1M A;  5ADZ A;  4MYU A;  1X48 A;  4WYQ B;  5F3W A;  3B82 A;  4LF9 E;  4B3R I;  3ADI A;  3HPS A;  3HJC A;  2V86 A;  1YYK A;  3P06 A;  4USM A;  1QZR A;  3QT6 A;  1HNX E;  2XEX A;  2A2C A;  4DUY E;  5A2Q C;  2L2M A;  2UUB E;  4WSP A;  1B63 A;  3HPZ A;  2Q2E B;  2Z5B B;  3T1Y I;  2Z5E A;  4DU8 A;  4TUG A;  1ZM2 A;  1Z0W A;  4DV0 E;  4LF5 E;  2UUA E;  1Z0G A;  2IOP A;  5LMU E;  2L6M A;  2KOU A;  2PNL A;  3D4J A;  2V8P A;  2JY9 A;  1Z59 A;  1RQ0 A;  5AE2 A;  4DPT A;  4R1F A;  4PU9 A;  1Z5B A;  4LFB E;  1Y6Z A;  2PNM A;  2IOQ A;  1FI4 A;  4DV7 I;  2YZT A;  2BM1 A;  2JOB A;  4DV7 E;  4LU9 A;  4DR4 E;  3T1Y E;  4DV2 I;  3ADG A;  5BR8 E;  1XNR E;  4DV0 I;  2VF1 A;  3LLH A;  1X49 A;  3RMP A;  3H09 A;  2DMY A;  2HHH E;  4LFC E;  4DV3 I;  4IZJ D;  3DF6 A;  4DV6 I;  1ZM4 A;  4DR2 I;  2CGE A;  2LRS A;  1XMQ E;  1J5E E;  2V34 A;  1XNQ E;  2V87 A;  1OJ4 A;  1N34 I;  4JI1 I;  4YY3 I;  1B62 A;  4DV5 E;  1UIL A;  4JV5 E;  3QT5 A;  4DV5 I;  4JYA I;  4LFA E;  1ZBT A;  1N32 E;  2HKJ A;  4P52 A;  2M7Q A;  4WUD A;  4DR7 E;  4P7A A;  3ZOQ B;  4WPY A;  1BKN A;  3ZKD A;  2YT4 A;  2F4V E;  1YZ9 A;  4MYT A;  3ZKB A;  2M1S A;  2H36 X;  4DV3 E;  2V83 A;  4LFC I;  4Z7C A;  2VQF I;  1HNW I;  4DR2 E;  1NHI A;  3M6A A;  1I94 I;  4I8O A;  4USK A;  4BBY A;  3V2U C;  5T6J A;  4DUZ I;  4NXM I;  3J80 C;  4DU7 A;  4LF6 I;  4DUZ E;  4NXM E;  2UXD E;  4X62 E;  4GKJ E;  5GMD A;  3JU0 A;  4KHP E;  1T4L B;  3QT8 A;  3B8H A;  1Z0C A;  4DV4 E;  4BC7 A;  4P78 A;  4JI3 E;  4DV4 I;  1N36 E;  3WU6 A;  1NZ0 A;  2LBS B;  2DEJ A;  1XMO I;  3MSW A;  2DSY A;  2X36 A;  4ED4 A;  2E1R A;  2G7H A;  5FLX C;  3HUL A;  2L2K B;  4FN5 A;  1PVG A;  1O0W A;  1RC7 A;  4DPU A;  2GS8 A;  4IZJ B;  4X64 E;  4BS9 A;  4DR1 E;  3GON A;  4M2Z A;  4X64 I;  4BC9 A;  4BCA A;  1XMO E;  4NXN I;  2BV3 A;  4FWD A;  3FIG A;  1S16 A;  4OOG C;  5IT9 Q;  1GQE A;  1VIS A;  4JI8 E;  1N33 E;  1U2R A;  2E5L I;  4DPY A;  3J80 Q;  4JI6 I;  3PYE A;  4DV6 E;  1NHJ A;  1IBM E;  1FNM A;  4PRX A;  4WUB A;  2V8Q B;  5AE3 A;  4Z7Y A;  3Q1Q A;  2LUQ A;  4X65 I;  3ZM7 A;  4DR1 I;  2UXC I;  2L33 A;  3LML A;  1XNR I;  3IWD A;  3HTX A;  2ZM6 E;  1N33 I;  2KON A;  2UUA I;  2HFS A;  2F4V I;  1H7U A;  4JI2 E;  2KHX A;  4DR5 E;  5CFF E;  1H7S A;  3LNU A;  4DR6 I;  4HXZ A;  3IWB A;  1WXR A;  2L2N A;  4JV5 I;  1ZM3 A;  2HKE A;  2RS6 A;  3AUZ A;  4YY3 E;  4LF7 E;  4HY1 A;  2UUC I;  4LF7 I;  4DV1 I;  1UHZ A;  3P1X A;  1ZXN A;  2ZM6 I;  4WUC A;  4LF4 I;  3JAM C;  1A6F A;  2FV4 B;  4JI7 E;  5AAS A;  1FWK A;  3ADJ A;  1MG7 A;  2VE7 C;  2B7V A;  4LF6 E;  2VQE E;  4DKK A;  2RSM A;  3K1J A;  2HK2 A;  1DAR A;  2LJP A;  4DXL A;  1XHK A;  4DV1 E;  2EWL A;  1NHH A;  2Z5B A;  1ELO A;  4KHP I;  2N3H A;  1MX0 A;  4N3O A;  4JI5 I;  4JI3 I;  4X66 E;  2O1U A;  1H74 A;  2MC6 A;  2N3G A;  5L3J A;  4LF8 E;  2ODR D;  3DJW A;  1Z0E A;  4ZVI A;  3C4T A;  2UU9 E;  4GKK E;  2O1T A;  5FWK A;  3F6G A;  4L8N A;  4JI6 E;  3OTO E;  3AV0 A;  2J7K A;  1HNX I;  3KWR A;  3IWC A;  4TUI A;  2GQ0 A;  1PKP A;  3H4L A;  1N36 I;  1HNZ I;  4DMI A;  5LL6 R;  4K0K E;  1ZXM A;  4GEQ B;  4URL A;  1Y4U A;  4GKK I;  4JG4 A;  1FKA E;  4LF5 I;  2EZ6 A;  4JI0 I;  1ZBQ A;  2M4I A;  2Z5C B;  4JI0 E;  5LMU I;  5IWA I;  3PRY A;  1IBM I;  2FTX B;  1XNQ I;  4LFB I;  2X7I A;  2RS7 A;  4X65 E;  1N34 E;  2R3V A;  2UUB I;  1ZM9 A;  4IZK A;  1FJG E;  3WU4 A;  3ZZ0 A;  3T1H E;  5BR8 I;  1D6T A;  4M30 A;  1WHN A;  3PYF A;  1IBL E;  2L3C A;  1KTV A;  4FWH A;  2E5L E;  1UEK A;  4WFT A;  2WW4 A;  4F9C B;  5GME A;  4OX9 E;  2UXB I;  4R03 A;  3VYX A;  4DR6 E;  1K47 A;  3J81 Q;  4AQY E;  1YYO A;  1J5E I;  4JI1 E;  1MU5 A;  4F9B B;  1EA6 A;  4XTJ A;  4LFA I;  3JTZ A;  3ZZU A;  4J8Z A;  4DR7 I;  2L3J A;  4LF4 E;  1N32 I;  2DEI A;  4B3S I;  4FWG A;  3PYD A;  1STU A;  1QU6 A;  4JI5 E;  1IBK E;  2HFU A;  2LMZ A;  4HAC A;  5LMN E;  1XMQ I;  2NPF A;  3K85 A;  2NUF A;  3B78 A;  3K6Q A;  2Z5C A;  5IT9 C;  3HQ1 A;  1KVK A;  2DIX A;  4F54 A;  4B3T E;  2WZO A;  2UUC E;  1PIE A;  3ADL A;  2UXD I;  4LF9 I;  3JAM Q;  4P7D A;  3Q6N A;  4M1K A;  2LTR A;  3C4B A;  2LTS A;  4X8W A;  2HK3 A;  1IBK I;  2JOX A;  4IZJ A;  1HK7 A;  2FGG A;  2LE2 A;  1I94 E;  1KIJ A;  4DPW A;  1X47 A;  2B3T B;  1HR0 E;  4JI4 I;  4LF8 I;  4YHH E;  4FW9 A;  3J81 C;  4B3R E;  4X62 I;  4GKJ I;  2V88 A;  1RR9 A;  4UT4 A;  2MC5 A;  2CPN A;  4B3M I;  1T4O A;  5DNY A;  4B3M E;  4PRV A;  4KZS A;  3WU5 A;  1Z0V A;  3Q6M A;  4X66 I;  3VK6 A;  2A2D A;  1S4E A;  4JI4 E;  2DB2 A;  4K0K I;  4YHH I;  4DV2 E;  1DQ3 A;  4JI8 I;  3LPS A;  2IHR 1;  3LTO A;  2MDR A;  4RPF A;  2BM0 A;  2L8T A;  3QT7 A;  3OTO I;  5IWA E;  2UXB E;  4OX9 I;  2V2V A;  1WUU A;  2V89 A;  4HYM A;  1N0V C;  4DUY I;  2V85 A;  4I3H A;  2LJH A;  3F6H A;  2NA2 A;  3T1H I;  4NXN E;  1N0U A;  1IBL I;  4UTG A;  4DR3 I;  4DR4 I;  1T4N A;  1USU A;  2NUE A;  1FWL A;  2EFG A;  2JVA A;  5FLX Q;  4JI2 I;  4JI7 I;  3J7A G;  1H72 C;  3V5R A;  2HHH I;  1GZ6 A;  3K17 A;  3J7Y p;  3PYG A;  2B9D A;  4AQY I;  4HAC B;  2UXC E;  2JR1 A;  4BMJ A;  1FJG I;  4Q28 A;  1Z0B A;  2O1V A;  2NUG A;  2CZ9 A;  2RTX A;  3F0N A;  1DI2 A;  4JYA E;  4IZK B;  4DR3 E;  3J7A M;  1EKZ A;  1KKH A;  1Z0T A;  4B3S E;  2L92 A;  3CWV A;  1HNW E;  1USV A;  1H73 A;  3VYY A;  4DR5 I;  2VF3 A;  3WU3 A;  2VQF E;  4R8O A;  5LMN I;  2JWO A;  2V2Z A;  2CG9 A;  2F8B A;  1HR0 I;  3HXL A;  2O1W A;  1EI1 A;  2AJ4 A;  4B3T I;  2VQE I;  1Z5A A;  2UU9 I;  4L5N C;  4F9A B;  4M0V A;  5AE1 A;  1RRE A;  2B7T A;  1YYW A;  3ZZT A;  2R42 A;  1J26 A;  4LTY A;  4EMD A;  2OI2 A;  5A2Q Q;  2ODR C;  3OML A;  1SR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...