4YY3E

30s ribosomal subunit- higb complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4yy3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yy3E02
4DKKA 4MYTA 1U2RA 3ZM7A 1H7UA 4X8WA 4ZVIA 5A2QC 3C4TA 2LBSB 4JG4A 4FN5A 5BR8I 4HACB 4LF8I 3OTOI 1UILA 2VQFE 2AJ4A 4LFBI 1HNXE 2GS8A 4WFTA 2HFUA 4JI4E 2EZ6A 2LRSA 1KIJA 4MYUA 4M2ZA 3WU6A 3ZZ0A 3Q1QA 2CZ9A 3H4LA 3LNUA 2L2NA 3J81C 4ED4A 2B7TA 4B3TI 1PIEA 2UUAE 3VYXA 2V2VA 4DUZI 1EA6A 2UU9I 4LF7I 4X64E 1RQ0A 2E5LI 3PYGA 1HR0I 2CPNA 1NZ0A 4LFAE 4GKKE 4DPXA 4LFCE 1ZM2A 3PYFA 1Z59A 4HYMA 2DIXA 3JAMQ 4DUYI 4X66I 1H7SA 3J7AM 2HHHE 1RR9A 4NXNE 4DV0I 4DR7E 1NHIA 3ZZUA 3ZKDA 4B3RE 4LFCI 5L3JA 4PU9A 3V2UC 1D6TA 1IBLE 1MX0A 3OTOE 4DV6E 4WUCA 2L3JA 5GMEA 1YYOA 4X65I 4FW9A 1OJ4A 2EFGA 5GMDA 5IT9C 4JI6I 3V5RA 4DU7A 2V2ZA 4B3TE 1EI1A 2HK2A 2HKEA 1GQEA 4Z7YA 4OX9I 4YY3E 3QT7A 1A6FA 4LF5E 4M1KA 4DV6I 4JI5E 4USMA 1H73A 4X62I 2IHR1 2UUBI 5IWAE 4K0KI 4LF4E 2HK3A 1XNQI 2XEXA 1WHQA 4YHHE 3F0NA 5LMNE 4WUBA 4P7AA 1UEKA 2LJPA 1Z5CA 4B3RI 2NUGA 4USKA 4PRXA 3VYYA 1N36E 4JYAE 1MG7A 4DR2E 4OOGC 4JV5I 2UUBE 1UHZA 3ADGA 4B3MI 1Z0EA 2UXDI 1J5EI 2ZM6I 1XMQI 2B3TB 4HY1A 4GKJE 4DR2I 5FLXC 1PKPA 4DPUA 3QT6A 1Z0GA 4LF9I 1O0WA 3B78A 3LTOA 1NHJA 1IBKE 4DV1I 4DR5E 2BM1A 4NXME 4X66E 1PVGA 4R1FA 2ZITA 1FWLA 4DXLA 5IT9Q 1FKAE 3M6AA 2VQFI 1J26A 1FJGE 4RPFA 3J80C 4GKJI 1Z0WA 4JI8I 4K0KE 1Z0BA 1N32E 4JI5I 1EKZA 2L2MA 4HACA 1N34I 4UTGA 4JI6E 2HHHI 1ZBTA 2X7IA 2UXCI 4HXZA 4PRVA 2RSMA 4X65E 2ZBKB 4DR6E 1Z5AA 4DR4E 2YT4A 4LF9E 1HNXI 2A2DA 3T1YI 3LLHA 2VQEE 1X49A 4DV7I 2WW4A 5IWAI 4M30A 2LTSA 1ZM3A 4KHPI 3B82A 2UUAI 2V34A 4JI2I 2VF3A 3P1XA 3WU4A 4P52A 3PYDA 1HNZI 2BV3A 4DR5I 5LMUE 3J7AG 2MDRA 4JI2E 4GKKI 3T1YE 2LJHA 3ZKBA 1FI4A 4DUYE 1Z0VA 5LMNI 2LUPB 4LFBE 2E5LE 4JV5E 1RC7A 4LF7E 5BR8E 2J7KA 4LFAI 3T1HE 4JYAI 2UXBE 1HNWE 1HR0E 1NHHA 4JI3I 4JI7E 1N36I 1I94E 1XMOE 2RS7A 1IBME 4YY3I 1MU5A 4AQYE 2N3GA 3QT5A 2NUEA 1K47A 3J80Q 1XNQE 2NUFA 4LF4I 2UUCI 1Z0TA 1I94I 4X62E 4KHPE 1T4LB 3QT8A 3WU5A 4JI8E 3HTXA 1KTVA 4XTJA 2VQEI 3J7Yp 3WU3A 3ADJA 4WYQB 1X47A 4B3SE 4UT4A 2R42A 2DB2A 4NXMI 2DEJA 1XNRE 3J81Q 1ZM9A 5LMUI 2B7VA 1ZM4A 1Z0CA 1HNZE 1FWKA 1B62A 2HFSA 4JI1E 1RREA 1X48A 3GONA 1T4NA 2V8PA 1IBMI 3K17A 1WUUA 1N33E 1ZXMA 4JI4I 2LTRA 1VISA 4FWGA 1FJGI 4LF6I 1IBLI 4JI3E 1N0UA 1HNWI 4DR6I 2V2QA 1S16A 3CWVA 2KHXA 2R3VA 2L33A 2NA2A 4EMDA 2E1RA 5FLXQ 2A2CA 4WUDA 1WHNA 3HULA 4JI1I 4DR1I 1KKHA 3PYEA 4DPTA 1N32I 1QZRA 4X64I 3K1JA 3LPSA 1XMQE 2UXDE 1H74A 1S4EA 4DV5E 4DPYA 4DPWA 4DV3E 4DR3I 5A2QQ 1QU6A 4JI0I 2DMYA 4DR4I 3C4BA 2UXCE 4FWHA 1YYKA 3ADLA 4DR1E 4URLA 2F4VE 1BKNA 1FNMA 1B63A 5CFFE 5LL6R 2L3CA 2RS6A 2DEIA 4JI0E 3B8HA 4LF6E 2LUQA 4LF8E 1ELOA 1N0VC 1DI2A 1Z5BA 1J5EE 1H72C 3ADIA 4FWDA 2X36A 2UUCE 2UXBI 4I3HA 4LF5I 2NPFA 4DU8A 4OX9E 4DV4I 2L2KB 4DV1E 4AQYI 1DARA 1T4OA 1XHKA 4DR7I 4DV2I 2HKJA 3JAMC 1XNRI 1XMOI 2BM0A 4JI7I 4B3SI 4YHHI 4DV7E 1IBKI 1YZ9A 4DV4E 3T1HI 2UU9E 2RTXA 2Q2EB 4Z7CA 1YYWA 4DR3E 1STUA 3D4JA 3ZZTA 4DV3I 4DV5I 1N33I 4DV2E 2ZM6E 4DUZE 2JY9A 4KQVA 4B3ME 2JVAA 1N34E 1KVKA 2F4VI 2N3HA 4DV0E 4NXNI 2OI2A 1ZXNA
chains in the Genus database with same CATH superfamily
4DKKA 4MYTA 1U2RA 2PNZB 3ZM7A 5AC4A 1H7UA 4X8WA 5A2QC 1UDQA 4ZVIA 3C4TA 2YRKA 2LBSB 4JG4A 1DGCA 2EOJA 4FN5A 3DJWA 5BR8I 2FGGA 4O4KA 4HACB 4LF8I 3OTOI 1UILA 2VQFE 2AJ4A 2JEBA 4TUGA 1HNXE 2DLKA 2EMZA 5A69A 2GO4A 2GS8A 1R6MA 1KYQA 2EMCA 4MU0A 4WFTA 2EMKA 1YUJA 4JI4E 2HFUA 2AE8A 5C0XE 2EZ6A 4TUIA 2LRSA 1KIJA 4MYUA 3P06A 4M2ZA 4MU4A 4ZYDA 4BA1B 1OYRA 3WU6A 3ZZ0A 3Q1QA 2CZ9A 1IMUA 4GQUA 3H4LA 4R03A 3LNUA 2JT2A 1Y4UA 2PO0A 2VESA 3MSWA 1F2IG 2L2NA 2DRPA 3F6GA 2EORA 2R1FA 2LV2A 3J81C 3EPKA 2JPAA 2NN6F 4ED4A 2EPPA 2B7TA 5C0XB 2EQ0A 1BB8A 1PIEA 4B3TI 2UUAE 2IOQA 2JR1A 4LU9A 3VYXA 4MU1A 1NEIA 4BA1A 2V2VA 4KWYA 2NN6C 5JEAE 4DUZI 2EOYA 1EA6A 3HPSA 4BCAA 4LPFA 2UU9I 4LF7I 4X64E 1RQ0A 5KL5A 2E5LI 2BA0D 3PYGA 1HR0I 4LCGA 2CPNA 3CDIA 1NZ0A 2BA0G 3IWBA 4IFDD 2YTIA 4LFAE 4GKKE 4DPXA 1AAYA 2MDGA 4LFCE 1ZM2A 2EOOA 4ISAA 3PRYA 2EN7A 2ENCA 2EMXA 5A6KA 1Z59A 3L7ZB 2DIXA 3PYFA 4HYMA 3JAMQ 4X66I 4DUYI 4QNJA 2ENAA 1A1GA 1H7SA 3J7AM 3M7NG 2EPMX 5A6BA 2HHHE 1HK7A 1RR9A 1JK1A 1MGTA 4NXNE 4DR7E 3EPLA 2YRHA 4DV0I 4BA2B 1Y5YA 2VRDA 2YTQA 1WRJA 2JEBB 2GO3A 2EMIA 3HXLA 1NHIA 4WSPA 4R2DA 3ZZUA 2WP8A 3ZKDA 4B3RE 2K4VA 2YPNA 3M85G 4LFCI 5L3JA 2BR2B 4PU9A 3V2UC 1D6TA 4WX9A 2Z5CB 1A1KA 4OO1C 2EOFA 1USVA 1IBLE 1MX0A 1BBOA 5K36C 3OTOE 4DV6E 4WUCA 2L3JA 2EOZA 4M0VA 1T39A 4R2EA 2C38A 1YPNA 5DRQA 1IQSA 4BHCA 3PS3A 5GMEA 5C0XD 5K36F 2YTEA 1YYOA 4X65I 4IFDF 2EM0A 4FW9A 2EN2A 1OJ4A 2EFGA 2EMHA 5GMDA 5IT9C 2O1VA 1QNTA 1LLMC 3GLLA 4JI6I 3V5RA 2YU8A 4DU7A 3P3GA 1E3PA 2RPCA 2EN3A 2V2ZA 4R2QA 4B3TE 1EI1A 2HK2A 2E72A 2HKEA 1GQEA 4Z7YA 4GEQB 4OX9I 1A1FA 1UN6B 1EH6A 4YY3E 1UDOA 3QT7A 3VHTB 1A6FA 4LF5E 1PJTA 2EWLA 4M1KA 4DV6I 1YHCA 5AE2A 4JI5E 4OO1B 4LTYA 2IOPA 2JEAB 4USMA 1H73A 4X62I 2IHR1 2JYAA 5IWAE 4IZKB 2UUBI 2EE8A 3P3CA 5ELWA 4LF4E 4K0KI 3LMLA 4QNKA 4LOMA 2DGCA 2HK3A 4R8OA 1XNQI 2XEXA 1WHQA 4P78A 4YHHE 2EM8A 3F0NA 5LMNE 4WUBA 2EMFA 3JTZA 1G2FC 1B69A 4FW6A 4P7AA 3HKMA 4F9AB 2WNRA 1SR9A 1WXRA 1UEKA 2LJPA 1Z5CA 4B3RI 2CSHA 2NUGA 4F2JC 4USKA 4PRXA 1SFEA 3VYYA 1N36E 2M7QA 2JWOA 2L92A 4WSGA 2MKDA 4JYAE 3HPZA 2J65A 3Q6MA 1MG7A 4DR2E 4OOGC 2L8TA 1GTKA 2YWQA 4IZJD 4JV5I 2UUBE 5K36E 1UHZA 4IZJA 3ADGA 2GPIA 4B3MI 4IS1C 1MEYC 2LE2A 1Z0EA 4BBYA 3M85D 2UXDI 4P7DA 2BA1D 2F8BA 4FW4A 1J5EI 2Q8UA 2ZM6I 1XMQI 1AH5A 2B3TB 2C39A 4HY1A 4GKJE 4M9VC 2YTFA 4DR2I 5FLXC 1PKPA 1G2DC 2ELZA 3BBGA 2LT7A 3UHMA 2BR2A 1TN9A 2MKNA 1Z0GA 3QT6A 4DPUA 4LF9I 4OO1F 3H1CA 2WP8B 2EJ4A 1O0WA 2O1UA 3B78A 3LTOA 1NHJA 1IBKE 4RH8A 2MC5A 2RQLA 2N8XA 2EMYA 4DV1I 4DR5E 2BM1A 4FK5C 4NXME 4ZYEA 2O1WA 2EPNA 4X66E 1PVGA 1JK2A 4R2SA 4R2PA 2PNMA 4R1FA 3L00A 2ZITA 1FWLA 1UBDC 4DXLA 4F9CB 2EOMA 2EOEA 5EKWA 2EOSA 5IT9Q 1XXEA 3L7ZA 1FKAE 5IV8B 3M6AA 2VQFI 2EL5A 1A1IA 5AASA 1J26A 4DV4I 1FJGE 1X6HA 3J80C 4RPFA 5KL7A 3P76A 4GKJI 1Z0WA 4JI8I 4K0KE 2CVEA 1Z0BA 2EOXA 1N32E 1X6FA 4JI5I 1A1LA 2EN4A 1EKZA 2L2MA 4HACA 2H36X 2V86A 1ZR9A 3GMEA 1T38A 1BBGA 3THOB 4IZJB 4NBQA 4UTGA 4JI6E 1N34I 2HHHI 1ZBTA 5AE1A 2X7IA 2NN6E 2UXCI 2EPCA 4HXZA 4PRVA 3TQMA 3BGHA 2RSMA 4X65E 1ZAAC 2ZBKB 5DNXA 2EOHA 2B9DA 4DR6E 1Z5AA 4AIMA 4DR4E 2YT4A 4LF9E 1HNXI 2HC5A 5C0XF 2A2DA 3T1YI 2V8QB 3LLHA 2VQEE 3K85A 1X49A 3KZYA 4DV7I 2WW4A 5IWAI 1A1HA 4M30A 5F3WA 4IFDA 2LTSA 4L5NC 2V89A 1ZM3A 4KZSA 5IXMB 3B82A 5DROA 2UUAI 4KHPI 2V34A 2ENHA 4JI2I 5KL3A 1YUIA 2GHFA 1Y60A 2VF3A 3P1XA 3WU4A 1E3HA 4OO1D 5K36A 2KOUA 5DNYA 4J3DA 3PYDA 4P52A 4OO1A 3ZOQB 1HNZI 5K36D 2BV3A 2DLQA 2EN8A 2YTDA 4DR5I 2C38B 5LMUE 2YTJA 1P47A 3J7AG 2MDRA 2YTNA 4JI2E 3IWCA 2L6MA 4GKKI 3T1YE 4WXDA 1Y4SA 2LJHA 4WXCA 1FI4A 4DUYE 1Z0VA 3B4TA 2LUPB 4LFBE 5KL6A 3K6QA 2E5LE 5LMNI 2WZOA 4JV5E 2Z5EA 1RC7A 2EPXA 4LF7E 5BR8E 2J7KA 4LFAI 2EPAA 3T1HE 3PS2A 4JYAI 2UXBE 1HNWE 4U3BA 1HR0E 5A6AA 1NHHA 4JI3I 3H09A 2NN6B 4JI7E 1N36I 1I94E 1XMOE 2RS7A 3P3EA 1TF3A 1Z1BA 1IBME 4YY3I 1USUA 2EN1A 1MU5A 4AQYE 3IWDA 2N3GA 4R2AA 4NHRA 4Q28A 3QT5A 2EPRA 2NUEA 1K47A 3MHHC 3J80Q 4OZEA 1XNQE 4F54A 4IFDB 2ODRD 4O5GA 2NUFA 4IFDE 4LF4I 2EMGA 2M1SA 5FWKA 2UUCI 5JEAB 2PRTA 1Z0TA 1OYSA 2EL4A 4X62E 2WNRB 1I94I 4KHPE 2JP9A 4FW3A 1T4LB 2Z5BA 3QT8A 4L8NA 3WU5A 1UDNA 2YSOA 4JI8E 4BHBA 3EPHA 3HTXA 1KTVA 3HJCA 4XTJA 2VQEI 5KL2A 2LO3A 3J7Yp 3WU3A 3ADJA 2PO0B 4WYQB 5DRRA 4HTGA 2EQ1A 1X47A 4B3SE 4FW7A 4UT4A 5C0XA 2EN6A 2DB2A 2IERA 2R42A 4NXMI 2DEJA 3BF2A 1XNRE 2PO2A 3JU0A 3F6HA 3J81Q 2D9HA 1ZM9A 4RHBB 2V83A 5LMUI 2CGEA 2B7VA 1GZ6A 1L4SA 1ZM4A 2V88A 2DMIA 4GZNC 2C39B 1Z0CA 5A6JA 1HNZE 1B62A 1FWKA 3M7ND 4R2CA 5AC5A 2HFSA 2FV4B 3DF6A 4MU3A 2PO1B 4JI1E 1RREA 1X48A 3GONA 2A25A 4OKGA 2CG9A 2PO2B 5K36B 1X3CA 2EM5A 1T4NA 2V8PA 2EMWA 1IBMI 4OO1E 3K17A 1WUUA 4BC9A 1N33E 2WBSA 3AV0A 1ZXMA 4MQYA 2EPZA 4JI4I 4HEIA 3ZKBA 2LTRA 1VISA 1PJSA 4FWGA 1FJGI 2WBTA 4LF6I 2YTPA 2EM4A 5JEAF 2EQ3A 4JI3E 1N0UA 1IBLI 2MC6A 2WBUA 1YH8A 1HNWI 4DR6I 2V2QA 3BIDA 3VK6A 2I13A 1S16A 4ZYHA 3CWVA 2KHXA 1YFHA 4IJDA 2L33A 2BB8A 2R3VA 2EM9A 1OYPA 5DRPA 2NA2A 2LJUA 2JXPA 2EMAA 3RMPA 2E1RA 4F9BB 4EMDA 2A2CA 2YRMA 4I8OA 2EL6A 1YSAC 2JE6B 5FLXQ 2DSYA 4WUDA 1WHNA 2J7JA 2E1MA 2EMLA 4IZKA 2VF1A 3HULA 4JI1I 3CDJA 2O3ZA 4DR1I 1KKHA 3PYEA 1ZBQA 4O43A 4DPTA 4FW5A 2VE7C 1N32I 3M99B 4Q35B 1EH7A 1QZRA 3KWRA 2BA1G 4X64I 3ECRA 2LMZA 3MHSC 2EM6A 3K1JA 3LPSA 4BA2A 1XMQE 4O24A 1TF6A 2UXDE 3EQ1A 1N3GA 1H74A 4DV5E 1S4EA 1ZU1A 2C37B 5JEAC 4DPYA 4DPWA 4MLVA 1PJQA 3HQ1A 1RMDA 4DV3E 3PS1A 4DR3I 2M9AA 5A2QQ 3C6MA 2PNZA 2YTGA 1UDSA 1QU6A 1NCSA 2PNLA 4JI0I 1PDAA 2DMYA 2Z5BB 4DR4I 3C4BA 2UXCE 4FWHA 4X9JA 4U3DA 1YYKA 3ADLA 4IFDC 4DR1E 2NN6A 3AUZA 4URLA 2F4VE 1BKNA 1FNMA 5AE3A 1B63A 2EPKX 5T6JA 5CFFE 5LL6R 3KRNA 2L3CA 2LVHA 2NABA 2RS6A 3C6KA 5C0XC 2DEIA 4JI0E 1R6LA 3B8HA 4LF6E 3GCMA 2LUQA 2HGHA 4LF8E 1ELOA 1N0VC 2EPOA 1DI2A 1Z5BA 3QG5C 2JOBA 1X6EA 1J5EE 4J8ZA 1H72C 2LCEA 2EM2A 1VI7A 3OMLA 2JE6A 4WPYA 3ADIA 1RHYA 2GQ0A 2EP3A 2X36A 4FWDA 5DNLA 2UUCE 2EPLX 4ZYGA 4I3HA 4LF5I 5EL9A 2UXBI 2V85A 1X5WA 2EM7A 2NPFA 4DU8A 4OX9E 2CT1A 2HJJA 2ODRC 2V87A 2YTOA 2ADRA 5JEAD 5JEAA 2ELYA 2K7IA 4MDTA 4LCHA 3KZZA 2I9IA 4BC7A 2L2KB 3U1KA 2BBGA 2C37A 4LFBI 4DV1E 2WCC3 4F6MA 4AQYI 1DARA 2YZTA 1Y6ZA 1T4OA 4BS9A 1XHKA 3Q6NA 4DR7I 4LCFA 2EOIA 2YSPA 4BMJA 5KL4A 4DV2I 2M4IA 3JAMC 2HKJA 1XNRI 1EH8A 2R76A 4N4RB 5TSEA 1DQ3A 1XMOI 1KJKA 2BM0A 4JI7I 1IQOA 4B3SI 2FTXB 4YHHI 4DV7E 3UK3C 4R2RA 1IBKI 1YZ9A 4DV4E 3T1HI 2UU9E 4IS9A 5LLQA 4MLQA 2RTXA 2Q2EB 2EOQA 4F6NA 4Z7CA 1YYWA 4DR3E 2EMBA 1STUA 3D4JA 2EM3A 3ZZTA 4DV3I 2KONA 4AM3A 4NZVA 4DV5I 1A1JA 1N33I 2EPUA 2JOXA 4DV2E 2ZM6E 4DUZE 2JY9A 4KQVA 2G7HA 2PO1A 4N3OA 2IESA 2O1TA 2JEAA 5A6BD 3NZKA 4B3ME 4AIDA 2JVAA 1N34E 2CTDA 1P42A 2RSIA 3U1YA 2F1DA 1WJPA 2Z5CA 1KVKA 3THNA 2F4VI 2YU5A 2GLIA 5ADZA 2N3HA 4DMIA 4DV0E 3EPJA 2NN6D 2OI2A 4NXNI 1ZXNA 3FIGA 3DD6A
chains in the Genus database with same CATH topology
4DKKA 4MYTA 1U2RA 3ZM7A 1H7UA 4X8WA 5A2QC 4ZVIA 3C4TA 2LBSB 4JG4A 4FN5A 3DJWA 5BR8I 2FGGA 4HACB 4LF8I 3OTOI 1UILA 2VQFE 2AJ4A 4LFBI 4TUGA 1HNXE 2GS8A 4WFTA 2HFUA 4JI4E 2EZ6A 4TUIA 2LRSA 1KIJA 4MYUA 3P06A 4M2ZA 3WU6A 3ZZ0A 3Q1QA 2CZ9A 3H4LA 4R03A 3LNUA 1Y4UA 3MSWA 2L2NA 3F6GA 3J81C 4ED4A 2B7TA 4B3TI 1PIEA 2UUAE 2IOQA 2JR1A 4LU9A 3VYXA 2V2VA 4DUZI 1EA6A 3HPSA 4BCAA 2UU9I 4LF7I 4X64E 1RQ0A 2E5LI 3PYGA 1HR0I 2CPNA 1NZ0A 3IWBA 4LFAE 4GKKE 4DPXA 4LFCE 1ZM2A 3PRYA 3PYFA 1Z59A 4HYMA 2DIXA 3JAMQ 4DUYI 4X66I 1H7SA 3J7AM 2HHHE 1RR9A 1HK7A 4NXNE 4DV0I 4DR7E 3HXLA 1NHIA 4WSPA 3ZZUA 3ZKDA 4B3RE 2K4VA 4LFCI 5L3JA 4PU9A 3V2UC 1D6TA 2Z5CB 1USVA 1IBLE 1MX0A 3OTOE 4DV6E 4WUCA 2L3JA 4M0VA 5GMEA 1YYOA 4X65I 4FW9A 1OJ4A 2EFGA 5GMDA 5IT9C 2O1VA 4JI6I 3V5RA 4DU7A 2V2ZA 4B3TE 1EI1A 2HK2A 2HKEA 1GQEA 4Z7YA 4GEQB 4OX9I 4YY3E 3QT7A 1A6FA 4LF5E 2EWLA 4M1KA 4DV6I 4JI5E 5AE2A 4LTYA 2IOPA 4USMA 1H73A 4X62I 2IHR1 4IZKB 5IWAE 2UUBI 4K0KI 4LF4E 3LMLA 2HK3A 4R8OA 1XNQI 2XEXA 1WHQA 4P78A 4YHHE 3F0NA 5LMNE 4WUBA 3JTZA 4P7AA 4F9AB 1SR9A 1WXRA 1UEKA 2LJPA 1Z5CA 4B3RI 2NUGA 4USKA 4PRXA 3VYYA 1N36E 2M7QA 2JWOA 2L92A 4JYAE 3HPZA 3Q6MA 1MG7A 4DR2E 4OOGC 2L8TA 4IZJD 4JV5I 2UUBE 1UHZA 4IZJA 3ADGA 4B3MI 2LE2A 1Z0EA 4BBYA 2UXDI 4P7DA 2F8BA 1J5EI 2ZM6I 1XMQI 2B3TB 4HY1A 4GKJE 4DR2I 5FLXC 1PKPA 4DPUA 3QT6A 1Z0GA 4LF9I 1O0WA 2O1UA 3B78A 3LTOA 1NHJA 1IBKE 2MC5A 4DV1I 4DR5E 2BM1A 4NXME 2O1WA 4X66E 1PVGA 2PNMA 4R1FA 2ZITA 1FWLA 4DXLA 4F9CB 5IT9Q 1FKAE 3M6AA 2VQFI 1J26A 5AASA 1FJGE 4RPFA 3J80C 4GKJI 1Z0WA 4JI8I 4K0KE 1Z0BA 1N32E 4JI5I 1EKZA 2L2MA 4HACA 2H36X 2V86A 1N34I 4IZJB 4UTGA 4JI6E 2HHHI 1ZBTA 5AE1A 2X7IA 2UXCI 4HXZA 4PRVA 2RSMA 4X65E 2ZBKB 2B9DA 4DR6E 1Z5AA 4DR4E 2YT4A 4LF9E 1HNXI 2A2DA 3T1YI 2V8QB 3LLHA 2VQEE 3K85A 1X49A 4DV7I 2WW4A 5IWAI 4M30A 5F3WA 2LTSA 4L5NC 2V89A 1ZM3A 4KZSA 3B82A 4KHPI 2UUAI 2V34A 4JI2I 2VF3A 3P1XA 3WU4A 2KOUA 5DNYA 4P52A 3PYDA 3ZOQB 1HNZI 2BV3A 4DR5I 5LMUE 3J7AG 2MDRA 4JI2E 3IWCA 2L6MA 4GKKI 3T1YE 1Y4SA 2LJHA 3ZKBA 1FI4A 4DUYE 1Z0VA 5LMNI 2LUPB 4LFBE 3K6QA 2E5LE 2WZOA 4JV5E 2Z5EA 1RC7A 4LF7E 5BR8E 2J7KA 4LFAI 3T1HE 4JYAI 2UXBE 1HNWE 1HR0E 1NHHA 4JI3I 3H09A 4JI7E 1N36I 1I94E 1XMOE 2RS7A 1IBME 4YY3I 1USUA 1MU5A 4AQYE 3IWDA 2N3GA 4Q28A 3QT5A 2NUEA 1K47A 3J80Q 1XNQE 4F54A 2ODRD 2NUFA 4LF4I 2M1SA 5FWKA 2UUCI 1Z0TA 1I94I 4X62E 4KHPE 1T4LB 2Z5BA 3QT8A 4L8NA 3WU5A 3HJCA 4JI8E 3HTXA 1KTVA 4XTJA 2VQEI 3J7Yp 3WU3A 3ADJA 4WYQB 1X47A 4B3SE 4UT4A 2R42A 2DB2A 4NXMI 2DEJA 1XNRE 3JU0A 3F6HA 3J81Q 1ZM9A 2V83A 5LMUI 2CGEA 2B7VA 1GZ6A 1ZM4A 2V88A 1Z0CA 1HNZE 1FWKA 1B62A 2HFSA 2FV4B 3DF6A 4JI1E 1RREA 1X48A 3GONA 2CG9A 1T4NA 2V8PA 1IBMI 3K17A 1WUUA 4BC9A 1N33E 3AV0A 1ZXMA 4JI4I 2LTRA 1VISA 4FWGA 1FJGI 4LF6I 1IBLI 4JI3E 1N0UA 2MC6A 1HNWI 4DR6I 2V2QA 3VK6A 1S16A 3CWVA 2KHXA 2R3VA 2L33A 2NA2A 3RMPA 4EMDA 2E1RA 4F9BB 5FLXQ 2A2CA 4I8OA 2DSYA 4WUDA 1WHNA 2E1MA 4IZKA 2VF1A 3HULA 4JI1I 4DR1I 1KKHA 3PYEA 1ZBQA 4DPTA 2VE7C 1N32I 1QZRA 4X64I 3KWRA 3K1JA 2LMZA 3LPSA 1XMQE 2UXDE 1H74A 1S4EA 4DV5E 4DPYA 4DPWA 4DV3E 3HQ1A 4DR3I 5A2QQ 1QU6A 2PNLA 4JI0I 2DMYA 2Z5BB 4DR4I 3C4BA 2UXCE 4FWHA 1YYKA 3ADLA 4DR1E 3AUZA 4URLA 2F4VE 1BKNA 1FNMA 5AE3A 1B63A 5T6JA 5CFFE 5LL6R 2L3CA 2RS6A 2DEIA 4JI0E 3B8HA 4LF6E 2LUQA 4LF8E 1ELOA 1N0VC 1DI2A 1Z5BA 2JOBA 1J5EE 4J8ZA 1H72C 3OMLA 4WPYA 3ADIA 2GQ0A 2X36A 4FWDA 2UUCE 2UXBI 4I3HA 4LF5I 2V85A 2NPFA 4DU8A 4OX9E 4DV4I 2ODRC 2V87A 4BC7A 2L2KB 4DV1E 4AQYI 1DARA 2YZTA 1Y6ZA 1T4OA 4BS9A 1XHKA 3Q6NA 4DR7I 4BMJA 4DV2I 2M4IA 3JAMC 2HKJA 1XNRI 1XMOI 1DQ3A 2BM0A 4JI7I 4B3SI 2FTXB 4YHHI 4DV7E 1IBKI 1YZ9A 4DV4E 3T1HI 2UU9E 2RTXA 2Q2EB 4Z7CA 1YYWA 4DR3E 1STUA 3D4JA 3ZZTA 4DV3I 2KONA 4DV5I 1N33I 2JOXA 4DV2E 2ZM6E 4DUZE 2JY9A 4KQVA 2G7HA 4N3OA 2O1TA 4B3ME 2JVAA 1N34E 2Z5CA 1KVKA 2F4VI 5ADZA 2N3HA 4DMIA 4DV0E 4NXNI 2OI2A 1ZXNA 3FIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DKK A;  4MYT A;  1U2R A;  3ZM7 A;  1H7U A;  4X8W A;  4ZVI A;  5A2Q C;  3C4T A;  2LBS B;  4JG4 A;  4FN5 A;  5BR8 I;  4HAC B;  4LF8 I;  3OTO I;  1UIL A;  2VQF E;  2AJ4 A;  4LFB I;  1HNX E;  2GS8 A;  4WFT A;  2HFU A;  4JI4 E;  2EZ6 A;  2LRS A;  1KIJ A;  4MYU A;  4M2Z A;  3WU6 A;  3ZZ0 A;  3Q1Q A;  2CZ9 A;  3H4L A;  3LNU A;  2L2N A;  3J81 C;  4ED4 A;  2B7T A;  4B3T I;  1PIE A;  2UUA E;  3VYX A;  2V2V A;  4DUZ I;  1EA6 A;  2UU9 I;  4LF7 I;  4X64 E;  1RQ0 A;  2E5L I;  3PYG A;  1HR0 I;  2CPN A;  1NZ0 A;  4LFA E;  4GKK E;  4DPX A;  4LFC E;  1ZM2 A;  3PYF A;  1Z59 A;  4HYM A;  2DIX A;  3JAM Q;  4DUY I;  4X66 I;  1H7S A;  3J7A M;  2HHH E;  1RR9 A;  4NXN E;  4DV0 I;  4DR7 E;  1NHI A;  3ZZU A;  3ZKD A;  4B3R E;  4LFC I;  5L3J A;  4PU9 A;  3V2U C;  1D6T A;  1IBL E;  1MX0 A;  3OTO E;  4DV6 E;  4WUC A;  2L3J A;  5GME A;  1YYO A;  4X65 I;  4FW9 A;  1OJ4 A;  2EFG A;  5GMD A;  5IT9 C;  4JI6 I;  3V5R A;  4DU7 A;  2V2Z A;  4B3T E;  1EI1 A;  2HK2 A;  2HKE A;  1GQE A;  4Z7Y A;  4OX9 I;  4YY3 E;  3QT7 A;  1A6F A;  4LF5 E;  4M1K A;  4DV6 I;  4JI5 E;  4USM A;  1H73 A;  4X62 I;  2IHR 1;  2UUB I;  5IWA E;  4K0K I;  4LF4 E;  2HK3 A;  1XNQ I;  2XEX A;  1WHQ A;  4YHH E;  3F0N A;  5LMN E;  4WUB A;  4P7A A;  1UEK A;  2LJP A;  1Z5C A;  4B3R I;  2NUG A;  4USK A;  4PRX A;  3VYY A;  1N36 E;  4JYA E;  1MG7 A;  4DR2 E;  4OOG C;  4JV5 I;  2UUB E;  1UHZ A;  3ADG A;  4B3M I;  1Z0E A;  2UXD I;  1J5E I;  2ZM6 I;  1XMQ I;  2B3T B;  4HY1 A;  4GKJ E;  4DR2 I;  5FLX C;  1PKP A;  4DPU A;  3QT6 A;  1Z0G A;  4LF9 I;  1O0W A;  3B78 A;  3LTO A;  1NHJ A;  1IBK E;  4DV1 I;  4DR5 E;  2BM1 A;  4NXM E;  4X66 E;  1PVG A;  4R1F A;  2ZIT A;  1FWL A;  4DXL A;  5IT9 Q;  1FKA E;  3M6A A;  2VQF I;  1J26 A;  1FJG E;  4RPF A;  3J80 C;  4GKJ I;  1Z0W A;  4JI8 I;  4K0K E;  1Z0B A;  1N32 E;  4JI5 I;  1EKZ A;  2L2M A;  4HAC A;  1N34 I;  4UTG A;  4JI6 E;  2HHH I;  1ZBT A;  2X7I A;  2UXC I;  4HXZ A;  4PRV A;  2RSM A;  4X65 E;  2ZBK B;  4DR6 E;  1Z5A A;  4DR4 E;  2YT4 A;  4LF9 E;  1HNX I;  2A2D A;  3T1Y I;  3LLH A;  2VQE E;  1X49 A;  4DV7 I;  2WW4 A;  5IWA I;  4M30 A;  2LTS A;  1ZM3 A;  4KHP I;  3B82 A;  2UUA I;  2V34 A;  4JI2 I;  2VF3 A;  3P1X A;  3WU4 A;  4P52 A;  3PYD A;  1HNZ I;  2BV3 A;  4DR5 I;  5LMU E;  3J7A G;  2MDR A;  4JI2 E;  4GKK I;  3T1Y E;  2LJH A;  3ZKB A;  1FI4 A;  4DUY E;  1Z0V A;  5LMN I;  2LUP B;  4LFB E;  2E5L E;  4JV5 E;  1RC7 A;  4LF7 E;  5BR8 E;  2J7K A;  4LFA I;  3T1H E;  4JYA I;  2UXB E;  1HNW E;  1HR0 E;  1NHH A;  4JI3 I;  4JI7 E;  1N36 I;  1I94 E;  1XMO E;  2RS7 A;  1IBM E;  4YY3 I;  1MU5 A;  4AQY E;  2N3G A;  3QT5 A;  2NUE A;  1K47 A;  3J80 Q;  1XNQ E;  2NUF A;  4LF4 I;  2UUC I;  1Z0T A;  1I94 I;  4X62 E;  4KHP E;  1T4L B;  3QT8 A;  3WU5 A;  4JI8 E;  3HTX A;  1KTV A;  4XTJ A;  2VQE I;  3J7Y p;  3WU3 A;  3ADJ A;  4WYQ B;  1X47 A;  4B3S E;  4UT4 A;  2R42 A;  2DB2 A;  4NXM I;  2DEJ A;  1XNR E;  3J81 Q;  1ZM9 A;  5LMU I;  2B7V A;  1ZM4 A;  1Z0C A;  1HNZ E;  1FWK A;  1B62 A;  2HFS A;  4JI1 E;  1RRE A;  1X48 A;  3GON A;  1T4N A;  2V8P A;  1IBM I;  3K17 A;  1WUU A;  1N33 E;  1ZXM A;  4JI4 I;  2LTR A;  1VIS A;  4FWG A;  1FJG I;  4LF6 I;  1IBL I;  4JI3 E;  1N0U A;  1HNW I;  4DR6 I;  2V2Q A;  1S16 A;  3CWV A;  2KHX A;  2R3V A;  2L33 A;  2NA2 A;  4EMD A;  2E1R A;  5FLX Q;  2A2C A;  4WUD A;  1WHN A;  3HUL A;  4JI1 I;  4DR1 I;  1KKH A;  3PYE A;  4DPT A;  1N32 I;  1QZR A;  4X64 I;  3K1J A;  3LPS A;  1XMQ E;  2UXD E;  1H74 A;  1S4E A;  4DV5 E;  4DPY A;  4DPW A;  4DV3 E;  4DR3 I;  5A2Q Q;  1QU6 A;  4JI0 I;  2DMY A;  4DR4 I;  3C4B A;  2UXC E;  4FWH A;  1YYK A;  3ADL A;  4DR1 E;  4URL A;  2F4V E;  1BKN A;  1FNM A;  1B63 A;  5CFF E;  5LL6 R;  2L3C A;  2RS6 A;  2DEI A;  4JI0 E;  3B8H A;  4LF6 E;  2LUQ A;  4LF8 E;  1ELO A;  1N0V C;  1DI2 A;  1Z5B A;  1J5E E;  1H72 C;  3ADI A;  4FWD A;  2X36 A;  2UUC E;  2UXB I;  4I3H A;  4LF5 I;  2NPF A;  4DU8 A;  4OX9 E;  4DV4 I;  2L2K B;  4DV1 E;  4AQY I;  1DAR A;  1T4O A;  1XHK A;  4DR7 I;  4DV2 I;  2HKJ A;  3JAM C;  1XNR I;  1XMO I;  2BM0 A;  4JI7 I;  4B3S I;  4YHH I;  4DV7 E;  1IBK I;  1YZ9 A;  4DV4 E;  3T1H I;  2UU9 E;  2RTX A;  2Q2E B;  4Z7C A;  1YYW A;  4DR3 E;  1STU A;  3D4J A;  3ZZT A;  4DV3 I;  4DV5 I;  1N33 I;  4DV2 E;  2ZM6 E;  4DUZ E;  2JY9 A;  4KQV A;  4B3M E;  2JVA A;  1N34 E;  1KVK A;  2F4V I;  2N3H A;  4DV0 E;  4NXN I;  2OI2 A;  1ZXN A; 
#chains in the Genus database with same CATH topology
 4DKK A;  4MYT A;  1U2R A;  2PNZ B;  3ZM7 A;  5AC4 A;  1H7U A;  4X8W A;  5A2Q C;  1UDQ A;  4ZVI A;  3C4T A;  2YRK A;  2LBS B;  4JG4 A;  1DGC A;  2EOJ A;  4FN5 A;  3DJW A;  5BR8 I;  2FGG A;  4O4K A;  4HAC B;  4LF8 I;  3OTO I;  1UIL A;  2VQF E;  2AJ4 A;  2JEB A;  4TUG A;  1HNX E;  2DLK A;  2EMZ A;  5A69 A;  2GO4 A;  2GS8 A;  1R6M A;  1KYQ A;  2EMC A;  4MU0 A;  4WFT A;  2EMK A;  1YUJ A;  4JI4 E;  2HFU A;  2AE8 A;  5C0X E;  2EZ6 A;  4TUI A;  2LRS A;  1KIJ A;  4MYU A;  3P06 A;  4M2Z A;  4MU4 A;  4ZYD A;  4BA1 B;  1OYR A;  3WU6 A;  3ZZ0 A;  3Q1Q A;  2CZ9 A;  1IMU A;  4GQU A;  3H4L A;  4R03 A;  3LNU A;  2JT2 A;  1Y4U A;  2PO0 A;  2VES A;  3MSW A;  1F2I G;  2L2N A;  2DRP A;  3F6G A;  2EOR A;  2R1F A;  2LV2 A;  3J81 C;  3EPK A;  2JPA A;  2NN6 F;  4ED4 A;  2EPP A;  2B7T A;  5C0X B;  2EQ0 A;  1BB8 A;  1PIE A;  4B3T I;  2UUA E;  2IOQ A;  2JR1 A;  4LU9 A;  3VYX A;  4MU1 A;  1NEI A;  4BA1 A;  2V2V A;  4KWY A;  2NN6 C;  5JEA E;  4DUZ I;  2EOY A;  1EA6 A;  3HPS A;  4BCA A;  4LPF A;  2UU9 I;  4LF7 I;  4X64 E;  1RQ0 A;  5KL5 A;  2E5L I;  2BA0 D;  3PYG A;  1HR0 I;  4LCG A;  2CPN A;  3CDI A;  1NZ0 A;  2BA0 G;  3IWB A;  4IFD D;  2YTI A;  4LFA E;  4GKK E;  4DPX A;  1AAY A;  2MDG A;  4LFC E;  1ZM2 A;  2EOO A;  4ISA A;  3PRY A;  2EN7 A;  2ENC A;  2EMX A;  5A6K A;  1Z59 A;  3L7Z B;  2DIX A;  3PYF A;  4HYM A;  3JAM Q;  4X66 I;  4DUY I;  4QNJ A;  2ENA A;  1A1G A;  1H7S A;  3J7A M;  3M7N G;  2EPM X;  5A6B A;  2HHH E;  1HK7 A;  1RR9 A;  1JK1 A;  1MGT A;  4NXN E;  4DR7 E;  3EPL A;  2YRH A;  4DV0 I;  4BA2 B;  1Y5Y A;  2VRD A;  2YTQ A;  1WRJ A;  2JEB B;  2GO3 A;  2EMI A;  3HXL A;  1NHI A;  4WSP A;  4R2D A;  3ZZU A;  2WP8 A;  3ZKD A;  4B3R E;  2K4V A;  2YPN A;  3M85 G;  4LFC I;  5L3J A;  2BR2 B;  4PU9 A;  3V2U C;  1D6T A;  4WX9 A;  2Z5C B;  1A1K A;  4OO1 C;  2EOF A;  1USV A;  1IBL E;  1MX0 A;  1BBO A;  5K36 C;  3OTO E;  4DV6 E;  4WUC A;  2L3J A;  2EOZ A;  4M0V A;  1T39 A;  4R2E A;  2C38 A;  1YPN A;  5DRQ A;  1IQS A;  4BHC A;  3PS3 A;  5GME A;  5C0X D;  5K36 F;  2YTE A;  1YYO A;  4X65 I;  4IFD F;  2EM0 A;  4FW9 A;  2EN2 A;  1OJ4 A;  2EFG A;  2EMH A;  5GMD A;  5IT9 C;  2O1V A;  1QNT A;  1LLM C;  3GLL A;  4JI6 I;  3V5R A;  2YU8 A;  4DU7 A;  3P3G A;  1E3P A;  2RPC A;  2EN3 A;  2V2Z A;  4R2Q A;  4B3T E;  1EI1 A;  2HK2 A;  2E72 A;  2HKE A;  1GQE A;  4Z7Y A;  4GEQ B;  4OX9 I;  1A1F A;  1UN6 B;  1EH6 A;  4YY3 E;  1UDO A;  3QT7 A;  3VHT B;  1A6F A;  4LF5 E;  1PJT A;  2EWL A;  4M1K A;  4DV6 I;  1YHC A;  5AE2 A;  4JI5 E;  4OO1 B;  4LTY A;  2IOP A;  2JEA B;  4USM A;  1H73 A;  4X62 I;  2IHR 1;  2JYA A;  5IWA E;  4IZK B;  2UUB I;  2EE8 A;  3P3C A;  5ELW A;  4LF4 E;  4K0K I;  3LML A;  4QNK A;  4LOM A;  2DGC A;  2HK3 A;  4R8O A;  1XNQ I;  2XEX A;  1WHQ A;  4P78 A;  4YHH E;  2EM8 A;  3F0N A;  5LMN E;  4WUB A;  2EMF A;  3JTZ A;  1G2F C;  1B69 A;  4FW6 A;  4P7A A;  3HKM A;  4F9A B;  2WNR A;  1SR9 A;  1WXR A;  1UEK A;  2LJP A;  1Z5C A;  4B3R I;  2CSH A;  2NUG A;  4F2J C;  4USK A;  4PRX A;  1SFE A;  3VYY A;  1N36 E;  2M7Q A;  2JWO A;  2L92 A;  4WSG A;  2MKD A;  4JYA E;  3HPZ A;  2J65 A;  3Q6M A;  1MG7 A;  4DR2 E;  4OOG C;  2L8T A;  1GTK A;  2YWQ A;  4IZJ D;  4JV5 I;  2UUB E;  5K36 E;  1UHZ A;  4IZJ A;  3ADG A;  2GPI A;  4B3M I;  4IS1 C;  1MEY C;  2LE2 A;  1Z0E A;  4BBY A;  3M85 D;  2UXD I;  4P7D A;  2BA1 D;  2F8B A;  4FW4 A;  1J5E I;  2Q8U A;  2ZM6 I;  1XMQ I;  1AH5 A;  2B3T B;  2C39 A;  4HY1 A;  4GKJ E;  4M9V C;  2YTF A;  4DR2 I;  5FLX C;  1PKP A;  1G2D C;  2ELZ A;  3BBG A;  2LT7 A;  3UHM A;  2BR2 A;  1TN9 A;  2MKN A;  1Z0G A;  3QT6 A;  4DPU A;  4LF9 I;  4OO1 F;  3H1C A;  2WP8 B;  2EJ4 A;  1O0W A;  2O1U A;  3B78 A;  3LTO A;  1NHJ A;  1IBK E;  4RH8 A;  2MC5 A;  2RQL A;  2N8X A;  2EMY A;  4DV1 I;  4DR5 E;  2BM1 A;  4FK5 C;  4NXM E;  4ZYE A;  2O1W A;  2EPN A;  4X66 E;  1PVG A;  1JK2 A;  4R2S A;  4R2P A;  2PNM A;  4R1F A;  3L00 A;  2ZIT A;  1FWL A;  1UBD C;  4DXL A;  4F9C B;  2EOM A;  2EOE A;  5EKW A;  2EOS A;  5IT9 Q;  1XXE A;  3L7Z A;  1FKA E;  5IV8 B;  3M6A A;  2VQF I;  2EL5 A;  1A1I A;  5AAS A;  1J26 A;  4DV4 I;  1FJG E;  1X6H A;  3J80 C;  4RPF A;  5KL7 A;  3P76 A;  4GKJ I;  1Z0W A;  4JI8 I;  4K0K E;  2CVE A;  1Z0B A;  2EOX A;  1N32 E;  1X6F A;  4JI5 I;  1A1L A;  2EN4 A;  1EKZ A;  2L2M A;  4HAC A;  2H36 X;  2V86 A;  1ZR9 A;  3GME A;  1T38 A;  1BBG A;  3THO B;  4IZJ B;  4NBQ A;  4UTG A;  4JI6 E;  1N34 I;  2HHH I;  1ZBT A;  5AE1 A;  2X7I A;  2NN6 E;  2UXC I;  2EPC A;  4HXZ A;  4PRV A;  3TQM A;  3BGH A;  2RSM A;  4X65 E;  1ZAA C;  2ZBK B;  5DNX A;  2EOH A;  2B9D A;  4DR6 E;  1Z5A A;  4AIM A;  4DR4 E;  2YT4 A;  4LF9 E;  1HNX I;  2HC5 A;  5C0X F;  2A2D A;  3T1Y I;  2V8Q B;  3LLH A;  2VQE E;  3K85 A;  1X49 A;  3KZY A;  4DV7 I;  2WW4 A;  5IWA I;  1A1H A;  4M30 A;  5F3W A;  4IFD A;  2LTS A;  4L5N C;  2V89 A;  1ZM3 A;  4KZS A;  5IXM B;  3B82 A;  5DRO A;  2UUA I;  4KHP I;  2V34 A;  2ENH A;  4JI2 I;  5KL3 A;  1YUI A;  2GHF A;  1Y60 A;  2VF3 A;  3P1X A;  3WU4 A;  1E3H A;  4OO1 D;  5K36 A;  2KOU A;  5DNY A;  4J3D A;  3PYD A;  4P52 A;  4OO1 A;  3ZOQ B;  1HNZ I;  5K36 D;  2BV3 A;  2DLQ A;  2EN8 A;  2YTD A;  4DR5 I;  2C38 B;  5LMU E;  2YTJ A;  1P47 A;  3J7A G;  2MDR A;  2YTN A;  4JI2 E;  3IWC A;  2L6M A;  4GKK I;  3T1Y E;  4WXD A;  1Y4S A;  2LJH A;  4WXC A;  1FI4 A;  4DUY E;  1Z0V A;  3B4T A;  2LUP B;  4LFB E;  5KL6 A;  3K6Q A;  2E5L E;  5LMN I;  2WZO A;  4JV5 E;  2Z5E A;  1RC7 A;  2EPX A;  4LF7 E;  5BR8 E;  2J7K A;  4LFA I;  2EPA A;  3T1H E;  3PS2 A;  4JYA I;  2UXB E;  1HNW E;  4U3B A;  1HR0 E;  5A6A A;  1NHH A;  4JI3 I;  3H09 A;  2NN6 B;  4JI7 E;  1N36 I;  1I94 E;  1XMO E;  2RS7 A;  3P3E A;  1TF3 A;  1Z1B A;  1IBM E;  4YY3 I;  1USU A;  2EN1 A;  1MU5 A;  4AQY E;  3IWD A;  2N3G A;  4R2A A;  4NHR A;  4Q28 A;  3QT5 A;  2EPR A;  2NUE A;  1K47 A;  3MHH C;  3J80 Q;  4OZE A;  1XNQ E;  4F54 A;  4IFD B;  2ODR D;  4O5G A;  2NUF A;  4IFD E;  4LF4 I;  2EMG A;  2M1S A;  5FWK A;  2UUC I;  5JEA B;  2PRT A;  1Z0T A;  1OYS A;  2EL4 A;  4X62 E;  2WNR B;  1I94 I;  4KHP E;  2JP9 A;  4FW3 A;  1T4L B;  2Z5B A;  3QT8 A;  4L8N A;  3WU5 A;  1UDN A;  2YSO A;  4JI8 E;  4BHB A;  3EPH A;  3HTX A;  1KTV A;  3HJC A;  4XTJ A;  2VQE I;  5KL2 A;  2LO3 A;  3J7Y p;  3WU3 A;  3ADJ A;  2PO0 B;  4WYQ B;  5DRR A;  4HTG A;  2EQ1 A;  1X47 A;  4B3S E;  4FW7 A;  4UT4 A;  5C0X A;  2EN6 A;  2DB2 A;  2IER A;  2R42 A;  4NXM I;  2DEJ A;  3BF2 A;  1XNR E;  2PO2 A;  3JU0 A;  3F6H A;  3J81 Q;  2D9H A;  1ZM9 A;  4RHB B;  2V83 A;  5LMU I;  2CGE A;  2B7V A;  1GZ6 A;  1L4S A;  1ZM4 A;  2V88 A;  2DMI A;  4GZN C;  2C39 B;  1Z0C A;  5A6J A;  1HNZ E;  1B62 A;  1FWK A;  3M7N D;  4R2C A;  5AC5 A;  2HFS A;  2FV4 B;  3DF6 A;  4MU3 A;  2PO1 B;  4JI1 E;  1RRE A;  1X48 A;  3GON A;  2A25 A;  4OKG A;  2CG9 A;  2PO2 B;  5K36 B;  1X3C A;  2EM5 A;  1T4N A;  2V8P A;  2EMW A;  1IBM I;  4OO1 E;  3K17 A;  1WUU A;  4BC9 A;  1N33 E;  2WBS A;  3AV0 A;  1ZXM A;  4MQY A;  2EPZ A;  4JI4 I;  4HEI A;  3ZKB A;  2LTR A;  1VIS A;  1PJS A;  4FWG A;  1FJG I;  2WBT A;  4LF6 I;  2YTP A;  2EM4 A;  5JEA F;  2EQ3 A;  4JI3 E;  1N0U A;  1IBL I;  2MC6 A;  2WBU A;  1YH8 A;  1HNW I;  4DR6 I;  2V2Q A;  3BID A;  3VK6 A;  2I13 A;  1S16 A;  4ZYH A;  3CWV A;  2KHX A;  1YFH A;  4IJD A;  2L33 A;  2BB8 A;  2R3V A;  2EM9 A;  1OYP A;  5DRP A;  2NA2 A;  2LJU A;  2JXP A;  2EMA A;  3RMP A;  2E1R A;  4F9B B;  4EMD A;  2A2C A;  2YRM A;  4I8O A;  2EL6 A;  1YSA C;  2JE6 B;  5FLX Q;  2DSY A;  4WUD A;  1WHN A;  2J7J A;  2E1M A;  2EML A;  4IZK A;  2VF1 A;  3HUL A;  4JI1 I;  3CDJ A;  2O3Z A;  4DR1 I;  1KKH A;  3PYE A;  1ZBQ A;  4O43 A;  4DPT A;  4FW5 A;  2VE7 C;  1N32 I;  3M99 B;  4Q35 B;  1EH7 A;  1QZR A;  3KWR A;  2BA1 G;  4X64 I;  3ECR A;  2LMZ A;  3MHS C;  2EM6 A;  3K1J A;  3LPS A;  4BA2 A;  1XMQ E;  4O24 A;  1TF6 A;  2UXD E;  3EQ1 A;  1N3G A;  1H74 A;  4DV5 E;  1S4E A;  1ZU1 A;  2C37 B;  5JEA C;  4DPY A;  4DPW A;  4MLV A;  1PJQ A;  3HQ1 A;  1RMD A;  4DV3 E;  3PS1 A;  4DR3 I;  2M9A A;  5A2Q Q;  3C6M A;  2PNZ A;  2YTG A;  1UDS A;  1QU6 A;  1NCS A;  2PNL A;  4JI0 I;  1PDA A;  2DMY A;  2Z5B B;  4DR4 I;  3C4B A;  2UXC E;  4FWH A;  4X9J A;  4U3D A;  1YYK A;  3ADL A;  4IFD C;  4DR1 E;  2NN6 A;  3AUZ A;  4URL A;  2F4V E;  1BKN A;  1FNM A;  5AE3 A;  1B63 A;  2EPK X;  5T6J A;  5CFF E;  5LL6 R;  3KRN A;  2L3C A;  2LVH A;  2NAB A;  2RS6 A;  3C6K A;  5C0X C;  2DEI A;  4JI0 E;  1R6L A;  3B8H A;  4LF6 E;  3GCM A;  2LUQ A;  2HGH A;  4LF8 E;  1ELO A;  1N0V C;  2EPO A;  1DI2 A;  1Z5B A;  3QG5 C;  2JOB A;  1X6E A;  1J5E E;  4J8Z A;  1H72 C;  2LCE A;  2EM2 A;  1VI7 A;  3OML A;  2JE6 A;  4WPY A;  3ADI A;  1RHY A;  2GQ0 A;  2EP3 A;  2X36 A;  4FWD A;  5DNL A;  2UUC E;  2EPL X;  4ZYG A;  4I3H A;  4LF5 I;  5EL9 A;  2UXB I;  2V85 A;  1X5W A;  2EM7 A;  2NPF A;  4DU8 A;  4OX9 E;  2CT1 A;  2HJJ A;  2ODR C;  2V87 A;  2YTO A;  2ADR A;  5JEA D;  5JEA A;  2ELY A;  2K7I A;  4MDT A;  4LCH A;  3KZZ A;  2I9I A;  4BC7 A;  2L2K B;  3U1K A;  2BBG A;  2C37 A;  4LFB I;  4DV1 E;  2WCC 3;  4F6M A;  4AQY I;  1DAR A;  2YZT A;  1Y6Z A;  1T4O A;  4BS9 A;  1XHK A;  3Q6N A;  4DR7 I;  4LCF A;  2EOI A;  2YSP A;  4BMJ A;  5KL4 A;  4DV2 I;  2M4I A;  3JAM C;  2HKJ A;  1XNR I;  1EH8 A;  2R76 A;  4N4R B;  5TSE A;  1DQ3 A;  1XMO I;  1KJK A;  2BM0 A;  4JI7 I;  1IQO A;  4B3S I;  2FTX B;  4YHH I;  4DV7 E;  3UK3 C;  4R2R A;  1IBK I;  1YZ9 A;  4DV4 E;  3T1H I;  2UU9 E;  4IS9 A;  5LLQ A;  4MLQ A;  2RTX A;  2Q2E B;  2EOQ A;  4F6N A;  4Z7C A;  1YYW A;  4DR3 E;  2EMB A;  1STU A;  3D4J A;  2EM3 A;  3ZZT A;  4DV3 I;  2KON A;  4AM3 A;  4NZV A;  4DV5 I;  1A1J A;  1N33 I;  2EPU A;  2JOX A;  4DV2 E;  2ZM6 E;  4DUZ E;  2JY9 A;  4KQV A;  2G7H A;  2PO1 A;  4N3O A;  2IES A;  2O1T A;  2JEA A;  5A6B D;  3NZK A;  4B3M E;  4AID A;  2JVA A;  1N34 E;  2CTD A;  1P42 A;  2RSI A;  3U1Y A;  2F1D A;  1WJP A;  2Z5C A;  1KVK A;  3THN A;  2F4V I;  2YU5 A;  2GLI A;  5ADZ A;  2N3H A;  4DMI A;  4DV0 E;  3EPJ A;  2NN6 D;  2OI2 A;  4NXN I;  1ZXN A;  3FIG A;  3DD6 A; 
#chains in the Genus database with same CATH homology
 4DKK A;  4MYT A;  1U2R A;  3ZM7 A;  1H7U A;  4X8W A;  5A2Q C;  4ZVI A;  3C4T A;  2LBS B;  4JG4 A;  4FN5 A;  3DJW A;  5BR8 I;  2FGG A;  4HAC B;  4LF8 I;  3OTO I;  1UIL A;  2VQF E;  2AJ4 A;  4LFB I;  4TUG A;  1HNX E;  2GS8 A;  4WFT A;  2HFU A;  4JI4 E;  2EZ6 A;  4TUI A;  2LRS A;  1KIJ A;  4MYU A;  3P06 A;  4M2Z A;  3WU6 A;  3ZZ0 A;  3Q1Q A;  2CZ9 A;  3H4L A;  4R03 A;  3LNU A;  1Y4U A;  3MSW A;  2L2N A;  3F6G A;  3J81 C;  4ED4 A;  2B7T A;  4B3T I;  1PIE A;  2UUA E;  2IOQ A;  2JR1 A;  4LU9 A;  3VYX A;  2V2V A;  4DUZ I;  1EA6 A;  3HPS A;  4BCA A;  2UU9 I;  4LF7 I;  4X64 E;  1RQ0 A;  2E5L I;  3PYG A;  1HR0 I;  2CPN A;  1NZ0 A;  3IWB A;  4LFA E;  4GKK E;  4DPX A;  4LFC E;  1ZM2 A;  3PRY A;  3PYF A;  1Z59 A;  4HYM A;  2DIX A;  3JAM Q;  4DUY I;  4X66 I;  1H7S A;  3J7A M;  2HHH E;  1RR9 A;  1HK7 A;  4NXN E;  4DV0 I;  4DR7 E;  3HXL A;  1NHI A;  4WSP A;  3ZZU A;  3ZKD A;  4B3R E;  2K4V A;  4LFC I;  5L3J A;  4PU9 A;  3V2U C;  1D6T A;  2Z5C B;  1USV A;  1IBL E;  1MX0 A;  3OTO E;  4DV6 E;  4WUC A;  2L3J A;  4M0V A;  5GME A;  1YYO A;  4X65 I;  4FW9 A;  1OJ4 A;  2EFG A;  5GMD A;  5IT9 C;  2O1V A;  4JI6 I;  3V5R A;  4DU7 A;  2V2Z A;  4B3T E;  1EI1 A;  2HK2 A;  2HKE A;  1GQE A;  4Z7Y A;  4GEQ B;  4OX9 I;  4YY3 E;  3QT7 A;  1A6F A;  4LF5 E;  2EWL A;  4M1K A;  4DV6 I;  4JI5 E;  5AE2 A;  4LTY A;  2IOP A;  4USM A;  1H73 A;  4X62 I;  2IHR 1;  4IZK B;  5IWA E;  2UUB I;  4K0K I;  4LF4 E;  3LML A;  2HK3 A;  4R8O A;  1XNQ I;  2XEX A;  1WHQ A;  4P78 A;  4YHH E;  3F0N A;  5LMN E;  4WUB A;  3JTZ A;  4P7A A;  4F9A B;  1SR9 A;  1WXR A;  1UEK A;  2LJP A;  1Z5C A;  4B3R I;  2NUG A;  4USK A;  4PRX A;  3VYY A;  1N36 E;  2M7Q A;  2JWO A;  2L92 A;  4JYA E;  3HPZ A;  3Q6M A;  1MG7 A;  4DR2 E;  4OOG C;  2L8T A;  4IZJ D;  4JV5 I;  2UUB E;  1UHZ A;  4IZJ A;  3ADG A;  4B3M I;  2LE2 A;  1Z0E A;  4BBY A;  2UXD I;  4P7D A;  2F8B A;  1J5E I;  2ZM6 I;  1XMQ I;  2B3T B;  4HY1 A;  4GKJ E;  4DR2 I;  5FLX C;  1PKP A;  4DPU A;  3QT6 A;  1Z0G A;  4LF9 I;  1O0W A;  2O1U A;  3B78 A;  3LTO A;  1NHJ A;  1IBK E;  2MC5 A;  4DV1 I;  4DR5 E;  2BM1 A;  4NXM E;  2O1W A;  4X66 E;  1PVG A;  2PNM A;  4R1F A;  2ZIT A;  1FWL A;  4DXL A;  4F9C B;  5IT9 Q;  1FKA E;  3M6A A;  2VQF I;  1J26 A;  5AAS A;  1FJG E;  4RPF A;  3J80 C;  4GKJ I;  1Z0W A;  4JI8 I;  4K0K E;  1Z0B A;  1N32 E;  4JI5 I;  1EKZ A;  2L2M A;  4HAC A;  2H36 X;  2V86 A;  1N34 I;  4IZJ B;  4UTG A;  4JI6 E;  2HHH I;  1ZBT A;  5AE1 A;  2X7I A;  2UXC I;  4HXZ A;  4PRV A;  2RSM A;  4X65 E;  2ZBK B;  2B9D A;  4DR6 E;  1Z5A A;  4DR4 E;  2YT4 A;  4LF9 E;  1HNX I;  2A2D A;  3T1Y I;  2V8Q B;  3LLH A;  2VQE E;  3K85 A;  1X49 A;  4DV7 I;  2WW4 A;  5IWA I;  4M30 A;  5F3W A;  2LTS A;  4L5N C;  2V89 A;  1ZM3 A;  4KZS A;  3B82 A;  4KHP I;  2UUA I;  2V34 A;  4JI2 I;  2VF3 A;  3P1X A;  3WU4 A;  2KOU A;  5DNY A;  4P52 A;  3PYD A;  3ZOQ B;  1HNZ I;  2BV3 A;  4DR5 I;  5LMU E;  3J7A G;  2MDR A;  4JI2 E;  3IWC A;  2L6M A;  4GKK I;  3T1Y E;  1Y4S A;  2LJH A;  3ZKB A;  1FI4 A;  4DUY E;  1Z0V A;  5LMN I;  2LUP B;  4LFB E;  3K6Q A;  2E5L E;  2WZO A;  4JV5 E;  2Z5E A;  1RC7 A;  4LF7 E;  5BR8 E;  2J7K A;  4LFA I;  3T1H E;  4JYA I;  2UXB E;  1HNW E;  1HR0 E;  1NHH A;  4JI3 I;  3H09 A;  4JI7 E;  1N36 I;  1I94 E;  1XMO E;  2RS7 A;  1IBM E;  4YY3 I;  1USU A;  1MU5 A;  4AQY E;  3IWD A;  2N3G A;  4Q28 A;  3QT5 A;  2NUE A;  1K47 A;  3J80 Q;  1XNQ E;  4F54 A;  2ODR D;  2NUF A;  4LF4 I;  2M1S A;  5FWK A;  2UUC I;  1Z0T A;  1I94 I;  4X62 E;  4KHP E;  1T4L B;  2Z5B A;  3QT8 A;  4L8N A;  3WU5 A;  3HJC A;  4JI8 E;  3HTX A;  1KTV A;  4XTJ A;  2VQE I;  3J7Y p;  3WU3 A;  3ADJ A;  4WYQ B;  1X47 A;  4B3S E;  4UT4 A;  2R42 A;  2DB2 A;  4NXM I;  2DEJ A;  1XNR E;  3JU0 A;  3F6H A;  3J81 Q;  1ZM9 A;  2V83 A;  5LMU I;  2CGE A;  2B7V A;  1GZ6 A;  1ZM4 A;  2V88 A;  1Z0C A;  1HNZ E;  1FWK A;  1B62 A;  2HFS A;  2FV4 B;  3DF6 A;  4JI1 E;  1RRE A;  1X48 A;  3GON A;  2CG9 A;  1T4N A;  2V8P A;  1IBM I;  3K17 A;  1WUU A;  4BC9 A;  1N33 E;  3AV0 A;  1ZXM A;  4JI4 I;  2LTR A;  1VIS A;  4FWG A;  1FJG I;  4LF6 I;  1IBL I;  4JI3 E;  1N0U A;  2MC6 A;  1HNW I;  4DR6 I;  2V2Q A;  3VK6 A;  1S16 A;  3CWV A;  2KHX A;  2R3V A;  2L33 A;  2NA2 A;  3RMP A;  4EMD A;  2E1R A;  4F9B B;  5FLX Q;  2A2C A;  4I8O A;  2DSY A;  4WUD A;  1WHN A;  2E1M A;  4IZK A;  2VF1 A;  3HUL A;  4JI1 I;  4DR1 I;  1KKH A;  3PYE A;  1ZBQ A;  4DPT A;  2VE7 C;  1N32 I;  1QZR A;  4X64 I;  3KWR A;  3K1J A;  2LMZ A;  3LPS A;  1XMQ E;  2UXD E;  1H74 A;  1S4E A;  4DV5 E;  4DPY A;  4DPW A;  4DV3 E;  3HQ1 A;  4DR3 I;  5A2Q Q;  1QU6 A;  2PNL A;  4JI0 I;  2DMY A;  2Z5B B;  4DR4 I;  3C4B A;  2UXC E;  4FWH A;  1YYK A;  3ADL A;  4DR1 E;  3AUZ A;  4URL A;  2F4V E;  1BKN A;  1FNM A;  5AE3 A;  1B63 A;  5T6J A;  5CFF E;  5LL6 R;  2L3C A;  2RS6 A;  2DEI A;  4JI0 E;  3B8H A;  4LF6 E;  2LUQ A;  4LF8 E;  1ELO A;  1N0V C;  1DI2 A;  1Z5B A;  2JOB A;  1J5E E;  4J8Z A;  1H72 C;  3OML A;  4WPY A;  3ADI A;  2GQ0 A;  2X36 A;  4FWD A;  2UUC E;  2UXB I;  4I3H A;  4LF5 I;  2V85 A;  2NPF A;  4DU8 A;  4OX9 E;  4DV4 I;  2ODR C;  2V87 A;  4BC7 A;  2L2K B;  4DV1 E;  4AQY I;  1DAR A;  2YZT A;  1Y6Z A;  1T4O A;  4BS9 A;  1XHK A;  3Q6N A;  4DR7 I;  4BMJ A;  4DV2 I;  2M4I A;  3JAM C;  2HKJ A;  1XNR I;  1XMO I;  1DQ3 A;  2BM0 A;  4JI7 I;  4B3S I;  2FTX B;  4YHH I;  4DV7 E;  1IBK I;  1YZ9 A;  4DV4 E;  3T1H I;  2UU9 E;  2RTX A;  2Q2E B;  4Z7C A;  1YYW A;  4DR3 E;  1STU A;  3D4J A;  3ZZT A;  4DV3 I;  2KON A;  4DV5 I;  1N33 I;  2JOX A;  4DV2 E;  2ZM6 E;  4DUZ E;  2JY9 A;  4KQV A;  2G7H A;  4N3O A;  2O1T A;  4B3M E;  2JVA A;  1N34 E;  2Z5C A;  1KVK A;  2F4V I;  5ADZ A;  2N3H A;  4DMI A;  4DV0 E;  4NXN I;  2OI2 A;  1ZXN A;  3FIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...