4YY3E

30s ribosomal subunit- higb complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4yy3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yy3E02
3LNUA 1B63A 4DV7I 4JV5I 4UT4A 1PKPA 1IBKI 4OOGC 1XMQE 2LJHA 4LF4E 4DR5I 5IT9Q 4DV1I 3M6AA 1HNXE 1S4EA 2JVAA 1MX0A 1HR0E 4B3TE 4KHPI 4KQVA 5LMNI 2UUAE 1WUUA 4DUYE 1ZXMA 3K1JA 1IBLE 3ZM7A 4DR4I 4B3ME 1XNRI 4NXNE 3ZKBA 4RPFA 4LFAE 1NZ0A 2F4VI 2LTSA 4DR1I 3J7AG 1EA6A 2OI2A 3ADJA 4ZVIA 2N3HA 1S16A 2HK2A 1Z0BA 1XNQE 4WUDA 2X36A 1PIEA 2B3TB 5BR8I 4JI2E 1N32E 1N36I 4LFCE 4JI7I 1IBKE 2LUPB 4Z7YA 4AQYE 3V2UC 2VQFE 1YYOA 1KTVA 4DR2I 1KVKA 4DV1E 2V8PA 3ADLA 4JI4I 1Z5CA 4DU8A 2J7KA 1KIJA 4LF8I 4NXMI 1T4OA 5LMNE 1HNWI 3VYXA 4DR4E 4GKJI 1ZM3A 4DV4I 5GMEA 4LFBI 2R3VA 3JAMQ 4JI1E 4JI5E 4WFTA 2F4VE 1D6TA 2LJPA 2E5LE 2A2CA 3LPSA 2VQEI 1H7SA 4B3SE 2DMYA 2L2NA 5LMUE 1ZM2A 3B78A 4DV5I 4LF6I 4M1KA 4DPUA 2NA2A 1ZBTA 2V34A 4JI3I 2JY9A 2L2MA 2A2DA 3WU3A 2YT4A 2LTRA 2L33A 4FWDA 2B7TA 4LF7I 4JI4E 3C4BA 1Z0CA 4FWHA 1N34I 2UXDE 2UUBI 4NXME 1NHJA 2NUEA 4LF9E 5A2QQ 1HNWE 4WUBA 4B3RE 4DPTA 4LF5I 1VISA 4DUZE 3WU6A 1Z5BA 2UXCI 2HK3A 3C4TA 1XMOE 1UHZA 1NHIA 1O0WA 1X48A 1HNZI 2WW4A 4YHHE 1FKAE 2ZM6I 1FI4A 2VQEE 3LTOA 5CFFE 3CWVA 3B8HA 2UXBI 3PYFA 4LF6E 4JYAI 3PYGA 4DV6I 4DR3I 1I94I 1MG7A 1A6FA 1IBME 5FLXC 1Z0VA 2HHHI 2EFGA 4JI0I 3J81C 1N0UA 2V2ZA 1X49A 3HTXA 3OTOI 3T1HI 2CPNA 4DV0I 1OJ4A 3PYDA 4DV3I 4OX9E 4DV2E 1UEKA 4JI8E 1FJGE 1NHHA 4K0KI 4X66E 1J5EI 2RSMA 2Q2EB 3VYYA 4DV7E 4JV5E 2LBSB 2AJ4A 1N33I 1QU6A 2VF3A 1UILA 4YY3I 4DR5E 4GKKI 2UU9I 4M30A 4JI6I 4DR3E 1KKHA 5IWAI 3WU5A 1N0VC 3GONA 4KHPE 4PRXA 3P1XA 2V2VA 3LLHA 1XNRE 1X47A 4XTJA 3WU4A 3J80Q 4DKKA 4X65I 2RS7A 2EZ6A 4DR1E 4X62I 4DR6I 2HKJA 4DPXA 2NUGA 3V5RA 2N3GA 4Z7CA 3QT7A 2CZ9A 3B82A 3ADGA 5BR8E 1N36E 4DR7I 4JI7E 4UTGA 1ELOA 2XEXA 4EMDA 2HFSA 1H74A 4DR2E 2BM0A 4FW9A 1XMQI 4LF4I 2RS6A 4HYMA 4HACA 4URLA 4X64I 4LF8E 4MYUA 1HNXI 5FLXQ 1YYWA 1RR9A 1HR0I 1K47A 2BV3A 4P7AA 4B3TI 1XHKA 4P52A 3J81Q 4GKJE 4DV4E 1PVGA 4LFBE 2HKEA 4FN5A 2UUAI 4DUYI 1IBLI 4B3MI 3JAMC 4USMA 4NXNI 3ADIA 4HXZA 4LFAI 2MDRA 3J7AM 2IHR1 1Z0TA 4DV5E 1GQEA 1H72C 1T4LB 2L3JA 4PRVA 1WHNA 4JI3E 2UUCI 1XNQI 4ED4A 4JI2I 1N32I 4LFCI 3ZZTA 2L2KB 4AQYI 4LF7E 1YZ9A 3QT6A 1ZXNA 2VQFI 1ZM9A 3PYEA 1N34E 5GMDA 2UUBE 1FWLA 4X64E 4HY1A 3T1YI 4LF5E 2DIXA 1EI1A 5A2QC 2DB2A 4M2ZA 2UXCE 3ZZUA 4MYTA 1U2RA 2RTXA 2E1RA 2KHXA 1HNZE 2ZM6E 1RC7A 4JI1I 2NPFA 4JI5I 3D4JA 3QT8A 4I3HA 2UXBE 2E5LI 2DEJA 4DXLA 4JYAE 4DV6E 5IT9C 4B3SI 5LMUI 1STUA 4DU7A 1I94E 1RQ0A 1J26A 2UUCE 1H73A 2HHHE 1Z0EA 4PU9A 1BKNA 3H4LA 1MU5A 3F0NA 3HULA 4JI0E 1T4NA 1Z0GA 1H7UA 2R42A 2V2QA 1Z0WA 3OTOE 4FWGA 4X8WA 3T1HE 4DV0E 4DV3E 4HACB 4JG4A 3Q1QA 2ZITA 2LUQA 2UXDI 3T1YE 1QZRA 4LF9I 4K0KE 4R1FA 3J7Yp 4B3RI 1J5EE 4WYQB 4DUZI 4WUCA 1B62A 2ZBKB 1N33E 1RREA 1XMOI 4YY3E 5LL6R 4GKKE 2UU9E 4YHHI 5L3JA 4JI6E 5IWAE 2X7IA 2L3CA 1DARA 2NUFA 1FNMA 1IBMI 1Z5AA 2DEIA 2GS8A 1EKZA 4USKA 4DPWA 1FWKA 4X65E 1WHQA 1ZM4A 1Z59A 3J80C 2BM1A 4X62E 3ZZ0A 3QT5A 4DR6E 2B7VA 4OX9I 4DPYA 4DV2I 2LRSA 4JI8I 1FJGI 2HFUA 3ZKDA 1DI2A 3K17A 4X66I 4DR7E 1YYKA
chains in the Genus database with same CATH superfamily
1X6FA 3UK3C 4BS9A 5AC5A 3LNUA 2ELYA 2C39B 1B63A 1X6HA 4DV7I 4JV5I 4UT4A 1PKPA 2EN6A 4LU9A 5JEAC 1IBKI 4OOGC 1VI7A 2EPOA 1XMQE 2LJHA 2VESA 4LF4E 2IESA 4DR5I 2J7JA 2MC6A 5IT9Q 4DV1I 1Z1BA 4O43A 3L7ZA 3M6AA 4BA2A 1HNXE 2YRKA 2JR1A 1S4EA 2JVAA 4FW5A 1MX0A 1HR0E 1Y4UA 2YZTA 2O3ZA 4B3TE 4KHPI 4KQVA 2JWOA 2YWQA 1Y60A 2J65A 2UUAE 4R2QA 1WUUA 4DUYE 1ZXMA 3K6QA 3K1JA 1IBLE 3ZM7A 4LOMA 5K36A 4U3BA 4DR4I 4B3ME 3Q6MA 1XNRI 4IFDC 4GQUA 1WJPA 4NXNE 4O24A 3ZKBA 4RPFA 2EMGA 4LFAE 1NZ0A 1A1IA 2F4VI 3B4TA 4ZYDA 2LTSA 2LO3A 5AE3A 4DR1I 2WP8A 4F9CB 3J7AG 5K36E 2KOUA 2Z5BB 1EA6A 5TSEA 3ADJA 2OI2A 4ZVIA 4RH8A 4F2JC 2N3HA 2DGCA 1RHYA 1S16A 2PO0B 2HK2A 5K36D 1BB8A 4BC9A 1Z0BA 2BA0G 1EH6A 4AM3A 3DF6A 5JEAB 2Q8UA 1XNQE 2EMYA 4WUDA 4LPFA 2X36A 2EMWA 4OO1A 1PIEA 2GPIA 2B3TB 5BR8I 2JPAA 4JI2E 1N32E 1N36I 4LFCE 2EPZA 3BIDA 3EPKA 3P76A 4JI7I 1IBKE 2LUPB 2C37B 4Z7YA 4AQYE 4N4RB 4LTYA 3V2UC 2VQFE 1YYOA 5A6BA 1KTVA 2BA1G 4DR2I 1KVKA 4Q28A 4DV1E 2V8PA 2EN3A 1PJSA 4OO1E 2EN4A 2EOYA 4MQYA 3ADLA 4JI4I 3M7NG 2JP9A 1Z5CA 1WXRA 2O1UA 5ADZA 2YSOA 2EQ3A 2V86A 2J7KA 4DU8A 1OYSA 1KIJA 4LF8I 1PDAA 2EOIA 2RPCA 4NXMI 4IFDB 1T4OA 3H1CA 5LMNE 2DRPA 1HNWI 2EQ0A 3VYXA 4DR4E 2O1WA 4F6MA 1ZM3A 4GKJI 2EMHA 4DV4I 5GMEA 4LFBI 1A1LA 2V89A 2GQ0A 4OZEA 2R3VA 3JAMQ 2RSIA 2EPRA 4JI1E 4JI5E 4WFTA 5DROA 2F4VE 4FW3A 1D6TA 2EOZA 1JK1A 5K36C 4R2EA 2LJPA 2E5LE 1UDSA 2IOQA 2A2CA 4BA1B 2MKDA 3LPSA 2VQEI 1H7SA 2JEAA 1T38A 4B3SE 4FW7A 2DMYA 2L2NA 5LMUE 1UDQA 4WSPA 4AIDA 1ZM2A 1N3GA 4WXDA 1F2IG 1UDNA 2CSHA 3B78A 4AIMA 2V88A 4DV5I 2MKNA 4LF6I 5AC4A 4MU3A 2L92A 5IV8B 2Z5CA 4FK5C 3GLLA 4M1KA 1NCSA 4DPUA 2IERA 1X3CA 5KL6A 2NA2A 1ZBTA 1P42A 2V34A 4JI3I 2CT1A 2JY9A 2EMAA 4BHCA 2EM6A 2F8BA 2L2MA 2A2DA 3WU3A 2YT4A 1R6MA 2ENHA 3MSWA 2IOPA 2VRDA 2LTRA 2LE2A 1B69A 2L33A 3EPLA 4OO1C 4FWDA 1OYPA 1SR9A 2B7TA 4MLVA 2PO2A 2EQ1A 3JTZA 1XXEA 4LF7I 4JI4E 1A1HA 2EOOA 3C4BA 1Z0CA 4NBQA 2NN6F 4FWHA 1N34I 2UXDE 4BA2B 2EPLX 2UUBI 2WBSA 4IFDD 4NXME 1UN6B 1NHJA 2NUEA 4LF9E 2EM5A 5A2QQ 3IWDA 1HNWE 4WUBA 3F6HA 4B3RE 1GTKA 4DPTA 4LF5I 2JT2A 1VISA 4DUZE 5K36B 3WU6A 1Z5BA 1Y6ZA 4ZYGA 2UXCI 4ZYHA 5KL5A 2GO3A 2HK3A 3C4TA 4IJDA 1XMOE 1UBDC 1UHZA 4RHBB 1USUA 4LCHA 1NHIA 2CG9A 1O0WA 1IQSA 4GZNC 3L00A 5A6JA 4TUIA 1X48A 1T39A 5DRRA 2WW4A 4YHHE 4F6NA 1FKAE 2ZM6I 1FI4A 2VQEE 3LTOA 2WP8B 5CFFE 4R2SA 3CWVA 2HJJA 3B8HA 1L4SA 2UXBI 4Q35B 3PYFA 1DGCA 5AE1A 3U1YA 2EL4A 4LF6E 4JYAI 3PYGA 4DV6I 3Q6NA 2DMIA 4DR3I 2V85A 2C38A 2EPMX 3AV0A 5EL9A 1MG7A 5A69A 1I94I 1A6FA 1IBME 3ECRA 4FW6A 2MC5A 5FLXC 1Z0VA 2HHHI 1QNTA 4OO1B 2EFGA 4JI0I 3J81C 4IZJA 1N0UA 2V2ZA 3C6MA 2YTGA 1X49A 4R8OA 1G2FC 2O1VA 2WNRB 3HTXA 1Y5YA 3OTOI 4J3DA 3T1HI 2YPNA 5C0XA 3P3EA 2CPNA 3JU0A 4DV0I 1OJ4A 3PYDA 4DV3I 1Y4SA 2BA0D 3KWRA 4OX9E 2YTIA 4DV2E 1UEKA 1AAYA 4JI8E 3EPJA 1FJGE 2YTOA 4F9BB 5C0XE 2I13A 3F6GA 1NHHA 4K0KI 4X66E 1TF6A 4IZKA 3H09A 4M9VC 1J5EI 2RSMA 2FV4B 2Q2EB 2BA1D 2L8TA 1BBOA 3VYYA 4DV7E 1P47A 4JV5E 1KYQA 2YTPA 2LBSB 2GLIA 2AJ4A 2BR2B 1QU6A 4DMIA 1N33I 2CVEA 2VF3A 1UILA 2V83A 3BF2A 2EN8A 3M7ND 1NEIA 3HJCA 4DR5E 5DRQA 2EM4A 4YY3I 3PS1A 2JEAB 4GKKI 2UU9I 4M30A 3K85A 2K4VA 4WX9A 4MLQA 4DR3E 1KKHA 2JEBA 3QG5C 5IWAI 4JI6I 3WU5A 1PJTA 3VK6A 2EOJA 1N0VC 1YPNA 5AE2A 2Z5CB 4MDTA 3IWCA 4KHPE 2NN6A 3GONA 4OO1D 2YTDA 1YH8A 4PRXA 1A1KA 5ELWA 3P1XA 2EOXA 1YSAC 2EOFA 4WPYA 2V2VA 1R6LA 1MGTA 2PO1A 3LLHA 4NHRA 2BB8A 5A6BD 4LCGA 1MEYC 1XNRE 5DNYA 1X47A 4XTJA 3WU4A 2F1DA 2NN6E 5C0XF 4B3SI 4L5NC 1LLMC 3J80Q 4DKKA 4X65I 5LMNI 2JE6B 2RS7A 5F3WA 2EZ6A 2M7QA 4F9AB 4BC7A 4DR1E 4FW4A 2EM2A 4MU0A 4X62I 2EJ4A 2ADRA 4DR6I 2HKJA 4DPXA 2NUGA 3V5RA 2EM8A 2N3GA 4N3OA 3KZZA 4Z7CA 2DSYA 3QT7A 2PO0A 2M1SA 2CZ9A 3B82A 4J8ZA 3RMPA 5A6KA 1A1FA 2EOEA 4P78A 2E1MA 2FGGA 5JEAA 1ZR9A 2FTXB 4M0VA 3ADGA 5FWKA 5BR8E 2EPNA 1N36E 2GO4A 2PNZA 2EPUA 4JI7E 4UTGA 4DR7I 1EH8A 1ELOA 2XEXA 2EOQA 2HFSA 1H74A 3MHHC 4EMDA 4DR2E 2BM0A 4FW9A 5JEAE 4IS9A 1XMQI 1BBGA 4BCAA 4LF4I 2RS6A 2DLKA 2LCEA 4HYMA 3L7ZB 4HACA 2DLQA 5KL2A 4I8OA 4ISAA 2EWLA 4URLA 1DQ3A 4X64I 4O4KA 4LF8E 4MYUA 2YRHA 3P06A 1HNXI 5FLXQ 1YYWA 1RR9A 1SFEA 1K47A 1HR0I 3HPZA 1X5WA 2BV3A 2A25A 3THOB 4P7AA 1XHKA 4B3TI 4P52A 3J81Q 4GKJE 4IZJB 4DV4E 1PVGA 4LFBE 2HKEA 4FN5A 2NN6C 2UUAI 4DUYI 2HC5A 1IBLI 2EMCA 2EE8A 2EMZA 4B3MI 3KRNA 3GMEA 2JOXA 2EM9A 3M85G 3JAMC 4USMA 4NXNI 3ADIA 3PRYA 4WSGA 1YFHA 4HXZA 4LFAI 3DJWA 2EOSA 3P3GA 5LLQA 1KJKA 4QNKA 4BA1A 2KONA 2MDRA 3J7AM 2IHR1 2EP3A 2E72A 4R2CA 1USVA 4DV5E 1Z0TA 1GQEA 2EM0A 2YTQA 4X9JA 1YUIA 1H72C 3IWBA 2WBUA 1T4LB 2L3JA 3DD6A 4WXCA 4PRVA 5JEAF 1WHNA 3P3CA 4GEQB 2PRTA 4JI3E 2UUCI 4TUGA 2NABA 3HXLA 1XNQI 3HQ1A 2EPXA 2EPKX 2YU8A 2CTDA 1TF3A 4OKGA 4HEIA 4ED4A 4JI2I 3ZOQB 4LFCI 2JXPA 3ZZTA 2LVHA 1N32I 2L2KB 4AQYI 3AUZA 2JYAA 4LF7E 1YZ9A 1TN9A 1ZXNA 3HPSA 3QT6A 2VQFI 1OYRA 1ZM9A 4ZYEA 4KZSA 3PYEA 2JEBB 1N34E 5GMDA 3HKMA 2ENAA 2UUBE 1FWLA 4X64E 3TQMA 2YTEA 2NN6B 4IFDF 2EOMA 1JK2A 2YTNA 2EMFA 1HK7A 2PNMA 4HY1A 3T1YI 4LF5E 2DIXA 5A2QC 1EI1A 4IZJD 1RMDA 5DRPA 2DB2A 4M2ZA 1WRJA 2EPAA 2HGHA 2PO1B 2UXCE 2LT7A 4L8NA 2LMZA 4LCFA 4MYTA 1U2RA 2RTXA 2E1RA 3CDJA 3ZZUA 5C0XD 2KHXA 1IMUA 4QNJA 1GZ6A 3THNA 2C39A 1HNZE 2ZM6E 1RC7A 4JI1I 2NPFA 4JI5I 2Z5EA 2JOBA 3D4JA 1A1JA 3QT8A 4I3HA 2LV2A 3C6KA 5AASA 2UXBE 2ODRD 2E5LI 4NZVA 5DNXA 2V87A 3KZYA 5IT9C 4DV6E 3EPHA 4JYAE 2DEJA 4DXLA 2G7HA 1STUA 2VF1A 4R2RA 4DU7A 1I94E 5LMUI 2K7IA 1RQ0A 1J26A 4F54A 2UUCE 1H73A 4BBYA 2HHHE 5KL7A 1Z0EA 2EMIA 4PU9A 1E3PA 1BKNA 3U1KA 2VE7C 3H4LA 1MU5A 3F0NA 3HULA 4R03A 2EPPA 2V8QB 4JI0E 2PNZB 1T4NA 1Z0GA 2L6MA 2YTFA 2EORA 1AH5A 3FIGA 2MDGA 1H7UA 2R42A 2V2QA 2B9DA 1Z0WA 3OTOE 4FWGA 1HNZI 4X8WA 3T1HE 2EOHA 2WNRA 2M9AA 2PO2B 2O1TA 2GHFA 5IXMB 1X6EA 4DV0E 3VHTB 2AE8A 4DV3E 2WZOA 1YYKA 4R2AA 2NN6D 4HACB 4JG4A 3Q1QA 3EQ1A 4R2DA 2ZITA 4MU4A 2LUQA 2Z5BA 2UXDI 3T1YE 2EMBA 5C0XC 3LMLA 1QZRA 3OMLA 1YHCA 4LF9I 4K0KE 4O5GA 4U3DA 5K36F 2EMLA 1G2DC 2EM7A 4R1FA 3J7Yp 4B3RI 1J5EE 4WYQB 4DUZI 1YUJA 1ZBQA 4WUCA 2ODRC 1B62A 4KWYA 2LJUA 2ZBKB 1N33E 3CDIA 1RREA 1XMOI 2BR2A 1ZU1A 2EL5A 3PS3A 2C37A 4YY3E 2R1FA 5LL6R 2WCC3 4GKKE 4P7DA 3UHMA 2UU9E 2YSPA 2BBGA 4IS1C 4YHHI 5L3JA 4JI6E 2N8XA 5IWAE 3M99B 2X7IA 4MU1A 2L3CA 1DARA 1E3HA 2H36X 2WBTA 4HTGA 2NUFA 3NZKA 2C38B 5EKWA 5JEAD 2YTJA 1FNMA 4OO1F 3BGHA 2EMKA 2M4IA 4BMJA 2EPCA 1IBMI 4IFDA 1Z5AA 5DNLA 2DEIA 3M85D 4BHBA 5KL3A 2GS8A 2ENCA 1ZAAC 1EKZA 4USKA 4R2PA 4DPWA 1FWKA 2YU5A 2EN1A 4X65E 1WHQA 1ZM4A 1Z59A 1PJQA 3BBGA 3J80C 5C0XB 4IFDE 2YRMA 2JE6A 2PNLA 2RQLA 3GCMA 5A6AA 1EH7A 5KL4A 1IQOA 4X62E 2BM1A 3ZZ0A 2EN2A 3MHSC 4DR6E 5T6JA 2EMXA 2B7VA 2D9HA 2CGEA 3PS2A 3QT5A 1A1GA 4DPYA 4OX9I 4DV2I 2LRSA 2R76A 2EL6A 4JI8I 1FJGI 2HFUA 3ZKDA 4IZKB 1DI2A 3K17A 2EN7A 2I9IA 4X66I 2ELZA 4DR7E 1UDOA 2EM3A
chains in the Genus database with same CATH topology
4BS9A 3LNUA 1B63A 4DV7I 4JV5I 4UT4A 1PKPA 4LU9A 1IBKI 4OOGC 1XMQE 2LJHA 4LF4E 4DR5I 5IT9Q 2MC6A 4DV1I 3M6AA 1HNXE 2JR1A 1S4EA 2JVAA 1MX0A 1HR0E 1Y4UA 2YZTA 4B3TE 4KHPI 4KQVA 2JWOA 5LMNI 2UUAE 1WUUA 4DUYE 1ZXMA 3K6QA 3K1JA 1IBLE 3ZM7A 4DR4I 4B3ME 3Q6MA 1XNRI 4NXNE 3ZKBA 4RPFA 4LFAE 1NZ0A 2F4VI 2LTSA 5AE3A 4DR1I 4F9CB 3J7AG 2KOUA 2Z5BB 1EA6A 2OI2A 3ADJA 4ZVIA 2N3HA 1S16A 2HK2A 4BC9A 1Z0BA 3DF6A 1XNQE 4WUDA 2X36A 1PIEA 2B3TB 5BR8I 4JI2E 1N32E 1N36I 4LFCE 4JI7I 1IBKE 2LUPB 4Z7YA 4AQYE 4LTYA 3V2UC 2VQFE 1YYOA 1KTVA 4DR2I 1KVKA 4Q28A 4DV1E 2V8PA 3ADLA 4JI4I 1Z5CA 1WXRA 2O1UA 5ADZA 2J7KA 4DU8A 2V86A 1KIJA 4LF8I 4NXMI 1T4OA 5LMNE 1HNWI 3VYXA 4DR4E 2O1WA 1ZM3A 4GKJI 4DV4I 5GMEA 4LFBI 2V89A 2GQ0A 2R3VA 3JAMQ 4JI1E 4JI5E 4WFTA 2F4VE 1D6TA 2LJPA 2E5LE 2IOQA 2A2CA 3LPSA 2VQEI 1H7SA 4B3SE 2DMYA 2L2NA 5LMUE 4WSPA 1ZM2A 3B78A 2V88A 4DV5I 4LF6I 2L92A 2Z5CA 4M1KA 4DPUA 2NA2A 1ZBTA 2V34A 4JI3I 2JY9A 2F8BA 2L2MA 2A2DA 3WU3A 2YT4A 2IOPA 3MSWA 2LTRA 2LE2A 2L33A 4FWDA 1SR9A 2B7TA 3JTZA 4LF7I 4JI4E 3C4BA 1Z0CA 4FWHA 1N34I 2UXDE 2UUBI 4NXME 1NHJA 2NUEA 4LF9E 5A2QQ 3IWDA 1HNWE 4WUBA 3F6HA 4B3RE 4DPTA 4LF5I 1VISA 4DUZE 3WU6A 1Z5BA 1Y6ZA 2UXCI 2HK3A 3C4TA 1XMOE 1UHZA 1USUA 1NHIA 2CG9A 1O0WA 4TUIA 1X48A 1HNZI 2WW4A 4YHHE 1FKAE 2ZM6I 1FI4A 2VQEE 3LTOA 5CFFE 3CWVA 3B8HA 2UXBI 3PYFA 5AE1A 4LF6E 4JYAI 3PYGA 4DV6I 3Q6NA 4DR3I 2V85A 1I94I 3AV0A 1MG7A 1A6FA 1IBME 2MC5A 5FLXC 1Z0VA 2HHHI 2EFGA 4JI0I 3J81C 4IZJA 1N0UA 2V2ZA 1X49A 4R8OA 2O1VA 3HTXA 3OTOI 3T1HI 2CPNA 3JU0A 4DV0I 1OJ4A 3PYDA 4DV3I 1Y4SA 3KWRA 4OX9E 4DV2E 1UEKA 4JI8E 1FJGE 4F9BB 3F6GA 1NHHA 4K0KI 4X66E 4IZKA 3H09A 1J5EI 2RSMA 2FV4B 2Q2EB 2L8TA 3VYYA 4DV7E 4JV5E 2LBSB 2AJ4A 1N33I 1QU6A 4DMIA 2VF3A 1UILA 2V83A 3HJCA 4YY3I 4DR5E 4GKKI 2UU9I 4M30A 3K85A 2K4VA 4DR3E 1KKHA 4JI6I 5IWAI 3WU5A 3VK6A 2Z5CB 1N0VC 5AE2A 3IWCA 4KHPE 3GONA 4PRXA 3P1XA 2V2VA 4WPYA 3LLHA 1XNRE 5DNYA 1X47A 4XTJA 3WU4A 4L5NC 3J80Q 4DKKA 4X65I 2RS7A 5F3WA 2EZ6A 2M7QA 4F9AB 4BC7A 4DR1E 4X62I 4DR6I 2HKJA 4DPXA 2NUGA 3V5RA 2N3GA 4N3OA 4Z7CA 2DSYA 3QT7A 2M1SA 2CZ9A 3B82A 4J8ZA 3RMPA 4P78A 2E1MA 2FGGA 2FTXB 4M0VA 3ADGA 5FWKA 5BR8E 1N36E 4DR7I 4JI7E 4UTGA 1ELOA 2XEXA 4EMDA 2HFSA 1H74A 4DR2E 2BM0A 4FW9A 1XMQI 4BCAA 4LF4I 2RS6A 4HYMA 4HACA 4I8OA 4URLA 2EWLA 1DQ3A 4X64I 4LF8E 4MYUA 3P06A 1HNXI 5FLXQ 1YYWA 1RR9A 1HR0I 1K47A 3HPZA 2BV3A 4P7AA 4B3TI 1XHKA 4P52A 3J81Q 4GKJE 4IZJB 4DV4E 1PVGA 4LFBE 2HKEA 4FN5A 2UUAI 4DUYI 1IBLI 4B3MI 2JOXA 3JAMC 4USMA 4NXNI 3ADIA 3PRYA 4HXZA 4LFAI 3DJWA 2KONA 2MDRA 3J7AM 2IHR1 1USVA 1Z0TA 4DV5E 1GQEA 1H72C 3IWBA 1T4LB 2L3JA 4PRVA 1WHNA 4GEQB 4JI3E 2UUCI 4TUGA 3HXLA 1XNQI 3HQ1A 4ED4A 4JI2I 1N32I 3ZOQB 4LFCI 3ZZTA 2L2KB 4AQYI 3AUZA 4LF7E 1YZ9A 3QT6A 1ZXNA 3HPSA 2VQFI 1ZM9A 4KZSA 3PYEA 1N34E 5GMDA 2UUBE 1FWLA 4X64E 1HK7A 2PNMA 4HY1A 3T1YI 4LF5E 2DIXA 5A2QC 1EI1A 4IZJD 2DB2A 4M2ZA 2UXCE 4L8NA 2LMZA 3ZZUA 4MYTA 1U2RA 2RTXA 2E1RA 2KHXA 1GZ6A 1HNZE 2ZM6E 1RC7A 4JI1I 2NPFA 4JI5I 2Z5EA 2JOBA 3D4JA 3QT8A 4I3HA 5AASA 2UXBE 2ODRD 2E5LI 2V87A 2DEJA 5IT9C 4DV6E 4JYAE 4DXLA 4B3SI 2G7HA 1STUA 2VF1A 4DU7A 5LMUI 1I94E 1RQ0A 1J26A 4F54A 2UUCE 1H73A 4BBYA 2HHHE 1Z0EA 4PU9A 1BKNA 2VE7C 3H4LA 1MU5A 3F0NA 3HULA 4R03A 4JI0E 2V8QB 1T4NA 1Z0GA 2L6MA 3FIGA 1H7UA 2R42A 2V2QA 2B9DA 1Z0WA 3OTOE 4FWGA 4X8WA 3T1HE 2O1TA 4DV0E 4DV3E 2WZOA 4HACB 4JG4A 3Q1QA 2ZITA 2LUQA 2Z5BA 2UXDI 3T1YE 3LMLA 1QZRA 3OMLA 4LF9I 4K0KE 4R1FA 3J7Yp 4B3RI 1J5EE 4WYQB 4DUZI 1ZBQA 4WUCA 2ODRC 1B62A 2ZBKB 1N33E 1RREA 1XMOI 4YY3E 5LL6R 4GKKE 4P7DA 2UU9E 4YHHI 5L3JA 4JI6E 5IWAE 2X7IA 2L3CA 1DARA 2H36X 2NUFA 1FNMA 1IBMI 2M4IA 4BMJA 1Z5AA 2DEIA 2GS8A 1EKZA 4USKA 4DPWA 1FWKA 4X65E 1WHQA 1ZM4A 1Z59A 3J80C 2PNLA 2BM1A 4X62E 3ZZ0A 3QT5A 4DR6E 5T6JA 2B7VA 2CGEA 4OX9I 4DPYA 4DV2I 2LRSA 4JI8I 1FJGI 2HFUA 3ZKDA 4IZKB 1DI2A 3K17A 4X66I 4DR7E 1YYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNU A;  1B63 A;  4DV7 I;  4JV5 I;  4UT4 A;  1PKP A;  1IBK I;  4OOG C;  1XMQ E;  2LJH A;  4LF4 E;  4DR5 I;  5IT9 Q;  4DV1 I;  3M6A A;  1HNX E;  1S4E A;  2JVA A;  1MX0 A;  1HR0 E;  4B3T E;  4KHP I;  4KQV A;  5LMN I;  2UUA E;  1WUU A;  4DUY E;  1ZXM A;  3K1J A;  1IBL E;  3ZM7 A;  4DR4 I;  4B3M E;  1XNR I;  4NXN E;  3ZKB A;  4RPF A;  4LFA E;  1NZ0 A;  2F4V I;  2LTS A;  4DR1 I;  3J7A G;  1EA6 A;  2OI2 A;  3ADJ A;  4ZVI A;  2N3H A;  1S16 A;  2HK2 A;  1Z0B A;  1XNQ E;  4WUD A;  2X36 A;  1PIE A;  2B3T B;  5BR8 I;  4JI2 E;  1N32 E;  1N36 I;  4LFC E;  4JI7 I;  1IBK E;  2LUP B;  4Z7Y A;  4AQY E;  3V2U C;  2VQF E;  1YYO A;  1KTV A;  4DR2 I;  1KVK A;  4DV1 E;  2V8P A;  3ADL A;  4JI4 I;  1Z5C A;  4DU8 A;  2J7K A;  1KIJ A;  4LF8 I;  4NXM I;  1T4O A;  5LMN E;  1HNW I;  3VYX A;  4DR4 E;  4GKJ I;  1ZM3 A;  4DV4 I;  5GME A;  4LFB I;  2R3V A;  3JAM Q;  4JI1 E;  4JI5 E;  4WFT A;  2F4V E;  1D6T A;  2LJP A;  2E5L E;  2A2C A;  3LPS A;  2VQE I;  1H7S A;  4B3S E;  2DMY A;  2L2N A;  5LMU E;  1ZM2 A;  3B78 A;  4DV5 I;  4LF6 I;  4M1K A;  4DPU A;  2NA2 A;  1ZBT A;  2V34 A;  4JI3 I;  2JY9 A;  2L2M A;  2A2D A;  3WU3 A;  2YT4 A;  2LTR A;  2L33 A;  4FWD A;  2B7T A;  4LF7 I;  4JI4 E;  3C4B A;  1Z0C A;  4FWH A;  1N34 I;  2UXD E;  2UUB I;  4NXM E;  1NHJ A;  2NUE A;  4LF9 E;  5A2Q Q;  1HNW E;  4WUB A;  4B3R E;  4DPT A;  4LF5 I;  1VIS A;  4DUZ E;  3WU6 A;  1Z5B A;  2UXC I;  2HK3 A;  3C4T A;  1XMO E;  1UHZ A;  1NHI A;  1O0W A;  1X48 A;  1HNZ I;  2WW4 A;  4YHH E;  1FKA E;  2ZM6 I;  1FI4 A;  2VQE E;  3LTO A;  5CFF E;  3CWV A;  3B8H A;  2UXB I;  3PYF A;  4LF6 E;  4JYA I;  3PYG A;  4DV6 I;  4DR3 I;  1I94 I;  1MG7 A;  1A6F A;  1IBM E;  5FLX C;  1Z0V A;  2HHH I;  2EFG A;  4JI0 I;  3J81 C;  1N0U A;  2V2Z A;  1X49 A;  3HTX A;  3OTO I;  3T1H I;  2CPN A;  4DV0 I;  1OJ4 A;  3PYD A;  4DV3 I;  4OX9 E;  4DV2 E;  1UEK A;  4JI8 E;  1FJG E;  1NHH A;  4K0K I;  4X66 E;  1J5E I;  2RSM A;  2Q2E B;  3VYY A;  4DV7 E;  4JV5 E;  2LBS B;  2AJ4 A;  1N33 I;  1QU6 A;  2VF3 A;  1UIL A;  4YY3 I;  4DR5 E;  4GKK I;  2UU9 I;  4M30 A;  4JI6 I;  4DR3 E;  1KKH A;  5IWA I;  3WU5 A;  1N0V C;  3GON A;  4KHP E;  4PRX A;  3P1X A;  2V2V A;  3LLH A;  1XNR E;  1X47 A;  4XTJ A;  3WU4 A;  3J80 Q;  4DKK A;  4X65 I;  2RS7 A;  2EZ6 A;  4DR1 E;  4X62 I;  4DR6 I;  2HKJ A;  4DPX A;  2NUG A;  3V5R A;  2N3G A;  4Z7C A;  3QT7 A;  2CZ9 A;  3B82 A;  3ADG A;  5BR8 E;  1N36 E;  4DR7 I;  4JI7 E;  4UTG A;  1ELO A;  2XEX A;  4EMD A;  2HFS A;  1H74 A;  4DR2 E;  2BM0 A;  4FW9 A;  1XMQ I;  4LF4 I;  2RS6 A;  4HYM A;  4HAC A;  4URL A;  4X64 I;  4LF8 E;  4MYU A;  1HNX I;  5FLX Q;  1YYW A;  1RR9 A;  1HR0 I;  1K47 A;  2BV3 A;  4P7A A;  4B3T I;  1XHK A;  4P52 A;  3J81 Q;  4GKJ E;  4DV4 E;  1PVG A;  4LFB E;  2HKE A;  4FN5 A;  2UUA I;  4DUY I;  1IBL I;  4B3M I;  3JAM C;  4USM A;  4NXN I;  3ADI A;  4HXZ A;  4LFA I;  2MDR A;  3J7A M;  2IHR 1;  1Z0T A;  4DV5 E;  1GQE A;  1H72 C;  1T4L B;  2L3J A;  4PRV A;  1WHN A;  4JI3 E;  2UUC I;  1XNQ I;  4ED4 A;  4JI2 I;  1N32 I;  4LFC I;  3ZZT A;  2L2K B;  4AQY I;  4LF7 E;  1YZ9 A;  3QT6 A;  1ZXN A;  2VQF I;  1ZM9 A;  3PYE A;  1N34 E;  5GMD A;  2UUB E;  1FWL A;  4X64 E;  4HY1 A;  3T1Y I;  4LF5 E;  2DIX A;  1EI1 A;  5A2Q C;  2DB2 A;  4M2Z A;  2UXC E;  3ZZU A;  4MYT A;  1U2R A;  2RTX A;  2E1R A;  2KHX A;  1HNZ E;  2ZM6 E;  1RC7 A;  4JI1 I;  2NPF A;  4JI5 I;  3D4J A;  3QT8 A;  4I3H A;  2UXB E;  2E5L I;  2DEJ A;  4DXL A;  4JYA E;  4DV6 E;  5IT9 C;  4B3S I;  5LMU I;  1STU A;  4DU7 A;  1I94 E;  1RQ0 A;  1J26 A;  2UUC E;  1H73 A;  2HHH E;  1Z0E A;  4PU9 A;  1BKN A;  3H4L A;  1MU5 A;  3F0N A;  3HUL A;  4JI0 E;  1T4N A;  1Z0G A;  1H7U A;  2R42 A;  2V2Q A;  1Z0W A;  3OTO E;  4FWG A;  4X8W A;  3T1H E;  4DV0 E;  4DV3 E;  4HAC B;  4JG4 A;  3Q1Q A;  2ZIT A;  2LUQ A;  2UXD I;  3T1Y E;  1QZR A;  4LF9 I;  4K0K E;  4R1F A;  3J7Y p;  4B3R I;  1J5E E;  4WYQ B;  4DUZ I;  4WUC A;  1B62 A;  2ZBK B;  1N33 E;  1RRE A;  1XMO I;  4YY3 E;  5LL6 R;  4GKK E;  2UU9 E;  4YHH I;  5L3J A;  4JI6 E;  5IWA E;  2X7I A;  2L3C A;  1DAR A;  2NUF A;  1FNM A;  1IBM I;  1Z5A A;  2DEI A;  2GS8 A;  1EKZ A;  4USK A;  4DPW A;  1FWK A;  4X65 E;  1WHQ A;  1ZM4 A;  1Z59 A;  3J80 C;  2BM1 A;  4X62 E;  3ZZ0 A;  3QT5 A;  4DR6 E;  2B7V A;  4OX9 I;  4DPY A;  4DV2 I;  2LRS A;  4JI8 I;  1FJG I;  2HFU A;  3ZKD A;  1DI2 A;  3K17 A;  4X66 I;  4DR7 E;  1YYK A; 
#chains in the Genus database with same CATH topology
 1X6F A;  3UK3 C;  4BS9 A;  5AC5 A;  3LNU A;  2ELY A;  2C39 B;  1B63 A;  1X6H A;  4DV7 I;  4JV5 I;  4UT4 A;  1PKP A;  2EN6 A;  4LU9 A;  5JEA C;  1IBK I;  4OOG C;  1VI7 A;  2EPO A;  1XMQ E;  2LJH A;  2VES A;  4LF4 E;  2IES A;  4DR5 I;  2J7J A;  2MC6 A;  5IT9 Q;  4DV1 I;  1Z1B A;  4O43 A;  3L7Z A;  3M6A A;  4BA2 A;  1HNX E;  2YRK A;  2JR1 A;  1S4E A;  2JVA A;  4FW5 A;  1MX0 A;  1HR0 E;  1Y4U A;  2YZT A;  2O3Z A;  4B3T E;  4KHP I;  4KQV A;  2JWO A;  2YWQ A;  1Y60 A;  2J65 A;  2UUA E;  4R2Q A;  1WUU A;  4DUY E;  1ZXM A;  3K6Q A;  3K1J A;  1IBL E;  3ZM7 A;  4LOM A;  5K36 A;  4U3B A;  4DR4 I;  4B3M E;  3Q6M A;  1XNR I;  4IFD C;  4GQU A;  1WJP A;  4NXN E;  4O24 A;  3ZKB A;  4RPF A;  2EMG A;  4LFA E;  1NZ0 A;  1A1I A;  2F4V I;  3B4T A;  4ZYD A;  2LTS A;  2LO3 A;  5AE3 A;  4DR1 I;  2WP8 A;  4F9C B;  3J7A G;  5K36 E;  2KOU A;  2Z5B B;  1EA6 A;  5TSE A;  3ADJ A;  2OI2 A;  4ZVI A;  4RH8 A;  4F2J C;  2N3H A;  2DGC A;  1RHY A;  1S16 A;  2PO0 B;  2HK2 A;  5K36 D;  1BB8 A;  4BC9 A;  1Z0B A;  2BA0 G;  1EH6 A;  4AM3 A;  3DF6 A;  5JEA B;  2Q8U A;  1XNQ E;  2EMY A;  4WUD A;  4LPF A;  2X36 A;  2EMW A;  4OO1 A;  1PIE A;  2GPI A;  2B3T B;  5BR8 I;  2JPA A;  4JI2 E;  1N32 E;  1N36 I;  4LFC E;  2EPZ A;  3BID A;  3EPK A;  3P76 A;  4JI7 I;  1IBK E;  2LUP B;  2C37 B;  4Z7Y A;  4AQY E;  4N4R B;  4LTY A;  3V2U C;  2VQF E;  1YYO A;  5A6B A;  1KTV A;  2BA1 G;  4DR2 I;  1KVK A;  4Q28 A;  4DV1 E;  2V8P A;  2EN3 A;  1PJS A;  4OO1 E;  2EN4 A;  2EOY A;  4MQY A;  3ADL A;  4JI4 I;  3M7N G;  2JP9 A;  1Z5C A;  1WXR A;  2O1U A;  5ADZ A;  2YSO A;  2EQ3 A;  2V86 A;  2J7K A;  4DU8 A;  1OYS A;  1KIJ A;  4LF8 I;  1PDA A;  2EOI A;  2RPC A;  4NXM I;  4IFD B;  1T4O A;  3H1C A;  5LMN E;  2DRP A;  1HNW I;  2EQ0 A;  3VYX A;  4DR4 E;  2O1W A;  4F6M A;  1ZM3 A;  4GKJ I;  2EMH A;  4DV4 I;  5GME A;  4LFB I;  1A1L A;  2V89 A;  2GQ0 A;  4OZE A;  2R3V A;  3JAM Q;  2RSI A;  2EPR A;  4JI1 E;  4JI5 E;  4WFT A;  5DRO A;  2F4V E;  4FW3 A;  1D6T A;  2EOZ A;  1JK1 A;  5K36 C;  4R2E A;  2LJP A;  2E5L E;  1UDS A;  2IOQ A;  2A2C A;  4BA1 B;  2MKD A;  3LPS A;  2VQE I;  1H7S A;  2JEA A;  1T38 A;  4B3S E;  4FW7 A;  2DMY A;  2L2N A;  5LMU E;  1UDQ A;  4WSP A;  4AID A;  1ZM2 A;  1N3G A;  4WXD A;  1F2I G;  1UDN A;  2CSH A;  3B78 A;  4AIM A;  2V88 A;  4DV5 I;  2MKN A;  4LF6 I;  5AC4 A;  4MU3 A;  2L92 A;  5IV8 B;  2Z5C A;  4FK5 C;  3GLL A;  4M1K A;  1NCS A;  4DPU A;  2IER A;  1X3C A;  5KL6 A;  2NA2 A;  1ZBT A;  1P42 A;  2V34 A;  4JI3 I;  2CT1 A;  2JY9 A;  2EMA A;  4BHC A;  2EM6 A;  2F8B A;  2L2M A;  2A2D A;  3WU3 A;  2YT4 A;  1R6M A;  2ENH A;  3MSW A;  2IOP A;  2VRD A;  2LTR A;  2LE2 A;  1B69 A;  2L33 A;  3EPL A;  4OO1 C;  4FWD A;  1OYP A;  1SR9 A;  2B7T A;  4MLV A;  2PO2 A;  2EQ1 A;  3JTZ A;  1XXE A;  4LF7 I;  4JI4 E;  1A1H A;  2EOO A;  3C4B A;  1Z0C A;  4NBQ A;  2NN6 F;  4FWH A;  1N34 I;  2UXD E;  4BA2 B;  2EPL X;  2UUB I;  2WBS A;  4IFD D;  4NXM E;  1UN6 B;  1NHJ A;  2NUE A;  4LF9 E;  2EM5 A;  5A2Q Q;  3IWD A;  1HNW E;  4WUB A;  3F6H A;  4B3R E;  1GTK A;  4DPT A;  4LF5 I;  2JT2 A;  1VIS A;  4DUZ E;  5K36 B;  3WU6 A;  1Z5B A;  1Y6Z A;  4ZYG A;  2UXC I;  4ZYH A;  5KL5 A;  2GO3 A;  2HK3 A;  3C4T A;  4IJD A;  1XMO E;  1UBD C;  1UHZ A;  4RHB B;  1USU A;  4LCH A;  1NHI A;  2CG9 A;  1O0W A;  1IQS A;  4GZN C;  3L00 A;  5A6J A;  4TUI A;  1X48 A;  1T39 A;  5DRR A;  2WW4 A;  4YHH E;  4F6N A;  1FKA E;  2ZM6 I;  1FI4 A;  2VQE E;  3LTO A;  2WP8 B;  5CFF E;  4R2S A;  3CWV A;  2HJJ A;  3B8H A;  1L4S A;  2UXB I;  4Q35 B;  3PYF A;  1DGC A;  5AE1 A;  3U1Y A;  2EL4 A;  4LF6 E;  4JYA I;  3PYG A;  4DV6 I;  3Q6N A;  2DMI A;  4DR3 I;  2V85 A;  2C38 A;  2EPM X;  3AV0 A;  5EL9 A;  1MG7 A;  5A69 A;  1I94 I;  1A6F A;  1IBM E;  3ECR A;  4FW6 A;  2MC5 A;  5FLX C;  1Z0V A;  2HHH I;  1QNT A;  4OO1 B;  2EFG A;  4JI0 I;  3J81 C;  4IZJ A;  1N0U A;  2V2Z A;  3C6M A;  2YTG A;  1X49 A;  4R8O A;  1G2F C;  2O1V A;  2WNR B;  3HTX A;  1Y5Y A;  3OTO I;  4J3D A;  3T1H I;  2YPN A;  5C0X A;  3P3E A;  2CPN A;  3JU0 A;  4DV0 I;  1OJ4 A;  3PYD A;  4DV3 I;  1Y4S A;  2BA0 D;  3KWR A;  4OX9 E;  2YTI A;  4DV2 E;  1UEK A;  1AAY A;  4JI8 E;  3EPJ A;  1FJG E;  2YTO A;  4F9B B;  5C0X E;  2I13 A;  3F6G A;  1NHH A;  4K0K I;  4X66 E;  1TF6 A;  4IZK A;  3H09 A;  4M9V C;  1J5E I;  2RSM A;  2FV4 B;  2Q2E B;  2BA1 D;  2L8T A;  1BBO A;  3VYY A;  4DV7 E;  1P47 A;  4JV5 E;  1KYQ A;  2YTP A;  2LBS B;  2GLI A;  2AJ4 A;  2BR2 B;  1QU6 A;  4DMI A;  1N33 I;  2CVE A;  2VF3 A;  1UIL A;  2V83 A;  3BF2 A;  2EN8 A;  3M7N D;  1NEI A;  3HJC A;  4DR5 E;  5DRQ A;  2EM4 A;  4YY3 I;  3PS1 A;  2JEA B;  4GKK I;  2UU9 I;  4M30 A;  3K85 A;  2K4V A;  4WX9 A;  4MLQ A;  4DR3 E;  1KKH A;  2JEB A;  3QG5 C;  5IWA I;  4JI6 I;  3WU5 A;  1PJT A;  3VK6 A;  2EOJ A;  1N0V C;  1YPN A;  5AE2 A;  2Z5C B;  4MDT A;  3IWC A;  4KHP E;  2NN6 A;  3GON A;  4OO1 D;  2YTD A;  1YH8 A;  4PRX A;  1A1K A;  5ELW A;  3P1X A;  2EOX A;  1YSA C;  2EOF A;  4WPY A;  2V2V A;  1R6L A;  1MGT A;  2PO1 A;  3LLH A;  4NHR A;  2BB8 A;  5A6B D;  4LCG A;  1MEY C;  1XNR E;  5DNY A;  1X47 A;  4XTJ A;  3WU4 A;  2F1D A;  2NN6 E;  5C0X F;  4B3S I;  4L5N C;  1LLM C;  3J80 Q;  4DKK A;  4X65 I;  5LMN I;  2JE6 B;  2RS7 A;  5F3W A;  2EZ6 A;  2M7Q A;  4F9A B;  4BC7 A;  4DR1 E;  4FW4 A;  2EM2 A;  4MU0 A;  4X62 I;  2EJ4 A;  2ADR A;  4DR6 I;  2HKJ A;  4DPX A;  2NUG A;  3V5R A;  2EM8 A;  2N3G A;  4N3O A;  3KZZ A;  4Z7C A;  2DSY A;  3QT7 A;  2PO0 A;  2M1S A;  2CZ9 A;  3B82 A;  4J8Z A;  3RMP A;  5A6K A;  1A1F A;  2EOE A;  4P78 A;  2E1M A;  2FGG A;  5JEA A;  1ZR9 A;  2FTX B;  4M0V A;  3ADG A;  5FWK A;  5BR8 E;  2EPN A;  1N36 E;  2GO4 A;  2PNZ A;  2EPU A;  4JI7 E;  4UTG A;  4DR7 I;  1EH8 A;  1ELO A;  2XEX A;  2EOQ A;  2HFS A;  1H74 A;  3MHH C;  4EMD A;  4DR2 E;  2BM0 A;  4FW9 A;  5JEA E;  4IS9 A;  1XMQ I;  1BBG A;  4BCA A;  4LF4 I;  2RS6 A;  2DLK A;  2LCE A;  4HYM A;  3L7Z B;  4HAC A;  2DLQ A;  5KL2 A;  4I8O A;  4ISA A;  2EWL A;  4URL A;  1DQ3 A;  4X64 I;  4O4K A;  4LF8 E;  4MYU A;  2YRH A;  3P06 A;  1HNX I;  5FLX Q;  1YYW A;  1RR9 A;  1SFE A;  1K47 A;  1HR0 I;  3HPZ A;  1X5W A;  2BV3 A;  2A25 A;  3THO B;  4P7A A;  1XHK A;  4B3T I;  4P52 A;  3J81 Q;  4GKJ E;  4IZJ B;  4DV4 E;  1PVG A;  4LFB E;  2HKE A;  4FN5 A;  2NN6 C;  2UUA I;  4DUY I;  2HC5 A;  1IBL I;  2EMC A;  2EE8 A;  2EMZ A;  4B3M I;  3KRN A;  3GME A;  2JOX A;  2EM9 A;  3M85 G;  3JAM C;  4USM A;  4NXN I;  3ADI A;  3PRY A;  4WSG A;  1YFH A;  4HXZ A;  4LFA I;  3DJW A;  2EOS A;  3P3G A;  5LLQ A;  1KJK A;  4QNK A;  4BA1 A;  2KON A;  2MDR A;  3J7A M;  2IHR 1;  2EP3 A;  2E72 A;  4R2C A;  1USV A;  4DV5 E;  1Z0T A;  1GQE A;  2EM0 A;  2YTQ A;  4X9J A;  1YUI A;  1H72 C;  3IWB A;  2WBU A;  1T4L B;  2L3J A;  3DD6 A;  4WXC A;  4PRV A;  5JEA F;  1WHN A;  3P3C A;  4GEQ B;  2PRT A;  4JI3 E;  2UUC I;  4TUG A;  2NAB A;  3HXL A;  1XNQ I;  3HQ1 A;  2EPX A;  2EPK X;  2YU8 A;  2CTD A;  1TF3 A;  4OKG A;  4HEI A;  4ED4 A;  4JI2 I;  3ZOQ B;  4LFC I;  2JXP A;  3ZZT A;  2LVH A;  1N32 I;  2L2K B;  4AQY I;  3AUZ A;  2JYA A;  4LF7 E;  1YZ9 A;  1TN9 A;  1ZXN A;  3HPS A;  3QT6 A;  2VQF I;  1OYR A;  1ZM9 A;  4ZYE A;  4KZS A;  3PYE A;  2JEB B;  1N34 E;  5GMD A;  3HKM A;  2ENA A;  2UUB E;  1FWL A;  4X64 E;  3TQM A;  2YTE A;  2NN6 B;  4IFD F;  2EOM A;  1JK2 A;  2YTN A;  2EMF A;  1HK7 A;  2PNM A;  4HY1 A;  3T1Y I;  4LF5 E;  2DIX A;  5A2Q C;  1EI1 A;  4IZJ D;  1RMD A;  5DRP A;  2DB2 A;  4M2Z A;  1WRJ A;  2EPA A;  2HGH A;  2PO1 B;  2UXC E;  2LT7 A;  4L8N A;  2LMZ A;  4LCF A;  4MYT A;  1U2R A;  2RTX A;  2E1R A;  3CDJ A;  3ZZU A;  5C0X D;  2KHX A;  1IMU A;  4QNJ A;  1GZ6 A;  3THN A;  2C39 A;  1HNZ E;  2ZM6 E;  1RC7 A;  4JI1 I;  2NPF A;  4JI5 I;  2Z5E A;  2JOB A;  3D4J A;  1A1J A;  3QT8 A;  4I3H A;  2LV2 A;  3C6K A;  5AAS A;  2UXB E;  2ODR D;  2E5L I;  4NZV A;  5DNX A;  2V87 A;  3KZY A;  5IT9 C;  4DV6 E;  3EPH A;  4JYA E;  2DEJ A;  4DXL A;  2G7H A;  1STU A;  2VF1 A;  4R2R A;  4DU7 A;  1I94 E;  5LMU I;  2K7I A;  1RQ0 A;  1J26 A;  4F54 A;  2UUC E;  1H73 A;  4BBY A;  2HHH E;  5KL7 A;  1Z0E A;  2EMI A;  4PU9 A;  1E3P A;  1BKN A;  3U1K A;  2VE7 C;  3H4L A;  1MU5 A;  3F0N A;  3HUL A;  4R03 A;  2EPP A;  2V8Q B;  4JI0 E;  2PNZ B;  1T4N A;  1Z0G A;  2L6M A;  2YTF A;  2EOR A;  1AH5 A;  3FIG A;  2MDG A;  1H7U A;  2R42 A;  2V2Q A;  2B9D A;  1Z0W A;  3OTO E;  4FWG A;  1HNZ I;  4X8W A;  3T1H E;  2EOH A;  2WNR A;  2M9A A;  2PO2 B;  2O1T A;  2GHF A;  5IXM B;  1X6E A;  4DV0 E;  3VHT B;  2AE8 A;  4DV3 E;  2WZO A;  1YYK A;  4R2A A;  2NN6 D;  4HAC B;  4JG4 A;  3Q1Q A;  3EQ1 A;  4R2D A;  2ZIT A;  4MU4 A;  2LUQ A;  2Z5B A;  2UXD I;  3T1Y E;  2EMB A;  5C0X C;  3LML A;  1QZR A;  3OML A;  1YHC A;  4LF9 I;  4K0K E;  4O5G A;  4U3D A;  5K36 F;  2EML A;  1G2D C;  2EM7 A;  4R1F A;  3J7Y p;  4B3R I;  1J5E E;  4WYQ B;  4DUZ I;  1YUJ A;  1ZBQ A;  4WUC A;  2ODR C;  1B62 A;  4KWY A;  2LJU A;  2ZBK B;  1N33 E;  3CDI A;  1RRE A;  1XMO I;  2BR2 A;  1ZU1 A;  2EL5 A;  3PS3 A;  2C37 A;  4YY3 E;  2R1F A;  5LL6 R;  2WCC 3;  4GKK E;  4P7D A;  3UHM A;  2UU9 E;  2YSP A;  2BBG A;  4IS1 C;  4YHH I;  5L3J A;  4JI6 E;  2N8X A;  5IWA E;  3M99 B;  2X7I A;  4MU1 A;  2L3C A;  1DAR A;  1E3H A;  2H36 X;  2WBT A;  4HTG A;  2NUF A;  3NZK A;  2C38 B;  5EKW A;  5JEA D;  2YTJ A;  1FNM A;  4OO1 F;  3BGH A;  2EMK A;  2M4I A;  4BMJ A;  2EPC A;  1IBM I;  4IFD A;  1Z5A A;  5DNL A;  2DEI A;  3M85 D;  4BHB A;  5KL3 A;  2GS8 A;  2ENC A;  1ZAA C;  1EKZ A;  4USK A;  4R2P A;  4DPW A;  1FWK A;  2YU5 A;  2EN1 A;  4X65 E;  1WHQ A;  1ZM4 A;  1Z59 A;  1PJQ A;  3BBG A;  3J80 C;  5C0X B;  4IFD E;  2YRM A;  2JE6 A;  2PNL A;  2RQL A;  3GCM A;  5A6A A;  1EH7 A;  5KL4 A;  1IQO A;  4X62 E;  2BM1 A;  3ZZ0 A;  2EN2 A;  3MHS C;  4DR6 E;  5T6J A;  2EMX A;  2B7V A;  2D9H A;  2CGE A;  3PS2 A;  3QT5 A;  1A1G A;  4DPY A;  4OX9 I;  4DV2 I;  2LRS A;  2R76 A;  2EL6 A;  4JI8 I;  1FJG I;  2HFU A;  3ZKD A;  4IZK B;  1DI2 A;  3K17 A;  2EN7 A;  2I9I A;  4X66 I;  2ELZ A;  4DR7 E;  1UDO A;  2EM3 A; 
#chains in the Genus database with same CATH homology
 4BS9 A;  3LNU A;  1B63 A;  4DV7 I;  4JV5 I;  4UT4 A;  1PKP A;  4LU9 A;  1IBK I;  4OOG C;  1XMQ E;  2LJH A;  4LF4 E;  4DR5 I;  5IT9 Q;  2MC6 A;  4DV1 I;  3M6A A;  1HNX E;  2JR1 A;  1S4E A;  2JVA A;  1MX0 A;  1HR0 E;  1Y4U A;  2YZT A;  4B3T E;  4KHP I;  4KQV A;  2JWO A;  5LMN I;  2UUA E;  1WUU A;  4DUY E;  1ZXM A;  3K6Q A;  3K1J A;  1IBL E;  3ZM7 A;  4DR4 I;  4B3M E;  3Q6M A;  1XNR I;  4NXN E;  3ZKB A;  4RPF A;  4LFA E;  1NZ0 A;  2F4V I;  2LTS A;  5AE3 A;  4DR1 I;  4F9C B;  3J7A G;  2KOU A;  2Z5B B;  1EA6 A;  2OI2 A;  3ADJ A;  4ZVI A;  2N3H A;  1S16 A;  2HK2 A;  4BC9 A;  1Z0B A;  3DF6 A;  1XNQ E;  4WUD A;  2X36 A;  1PIE A;  2B3T B;  5BR8 I;  4JI2 E;  1N32 E;  1N36 I;  4LFC E;  4JI7 I;  1IBK E;  2LUP B;  4Z7Y A;  4AQY E;  4LTY A;  3V2U C;  2VQF E;  1YYO A;  1KTV A;  4DR2 I;  1KVK A;  4Q28 A;  4DV1 E;  2V8P A;  3ADL A;  4JI4 I;  1Z5C A;  1WXR A;  2O1U A;  5ADZ A;  2J7K A;  4DU8 A;  2V86 A;  1KIJ A;  4LF8 I;  4NXM I;  1T4O A;  5LMN E;  1HNW I;  3VYX A;  4DR4 E;  2O1W A;  1ZM3 A;  4GKJ I;  4DV4 I;  5GME A;  4LFB I;  2V89 A;  2GQ0 A;  2R3V A;  3JAM Q;  4JI1 E;  4JI5 E;  4WFT A;  2F4V E;  1D6T A;  2LJP A;  2E5L E;  2IOQ A;  2A2C A;  3LPS A;  2VQE I;  1H7S A;  4B3S E;  2DMY A;  2L2N A;  5LMU E;  4WSP A;  1ZM2 A;  3B78 A;  2V88 A;  4DV5 I;  4LF6 I;  2L92 A;  2Z5C A;  4M1K A;  4DPU A;  2NA2 A;  1ZBT A;  2V34 A;  4JI3 I;  2JY9 A;  2F8B A;  2L2M A;  2A2D A;  3WU3 A;  2YT4 A;  2IOP A;  3MSW A;  2LTR A;  2LE2 A;  2L33 A;  4FWD A;  1SR9 A;  2B7T A;  3JTZ A;  4LF7 I;  4JI4 E;  3C4B A;  1Z0C A;  4FWH A;  1N34 I;  2UXD E;  2UUB I;  4NXM E;  1NHJ A;  2NUE A;  4LF9 E;  5A2Q Q;  3IWD A;  1HNW E;  4WUB A;  3F6H A;  4B3R E;  4DPT A;  4LF5 I;  1VIS A;  4DUZ E;  3WU6 A;  1Z5B A;  1Y6Z A;  2UXC I;  2HK3 A;  3C4T A;  1XMO E;  1UHZ A;  1USU A;  1NHI A;  2CG9 A;  1O0W A;  4TUI A;  1X48 A;  1HNZ I;  2WW4 A;  4YHH E;  1FKA E;  2ZM6 I;  1FI4 A;  2VQE E;  3LTO A;  5CFF E;  3CWV A;  3B8H A;  2UXB I;  3PYF A;  5AE1 A;  4LF6 E;  4JYA I;  3PYG A;  4DV6 I;  3Q6N A;  4DR3 I;  2V85 A;  1I94 I;  3AV0 A;  1MG7 A;  1A6F A;  1IBM E;  2MC5 A;  5FLX C;  1Z0V A;  2HHH I;  2EFG A;  4JI0 I;  3J81 C;  4IZJ A;  1N0U A;  2V2Z A;  1X49 A;  4R8O A;  2O1V A;  3HTX A;  3OTO I;  3T1H I;  2CPN A;  3JU0 A;  4DV0 I;  1OJ4 A;  3PYD A;  4DV3 I;  1Y4S A;  3KWR A;  4OX9 E;  4DV2 E;  1UEK A;  4JI8 E;  1FJG E;  4F9B B;  3F6G A;  1NHH A;  4K0K I;  4X66 E;  4IZK A;  3H09 A;  1J5E I;  2RSM A;  2FV4 B;  2Q2E B;  2L8T A;  3VYY A;  4DV7 E;  4JV5 E;  2LBS B;  2AJ4 A;  1N33 I;  1QU6 A;  4DMI A;  2VF3 A;  1UIL A;  2V83 A;  3HJC A;  4YY3 I;  4DR5 E;  4GKK I;  2UU9 I;  4M30 A;  3K85 A;  2K4V A;  4DR3 E;  1KKH A;  4JI6 I;  5IWA I;  3WU5 A;  3VK6 A;  2Z5C B;  1N0V C;  5AE2 A;  3IWC A;  4KHP E;  3GON A;  4PRX A;  3P1X A;  2V2V A;  4WPY A;  3LLH A;  1XNR E;  5DNY A;  1X47 A;  4XTJ A;  3WU4 A;  4L5N C;  3J80 Q;  4DKK A;  4X65 I;  2RS7 A;  5F3W A;  2EZ6 A;  2M7Q A;  4F9A B;  4BC7 A;  4DR1 E;  4X62 I;  4DR6 I;  2HKJ A;  4DPX A;  2NUG A;  3V5R A;  2N3G A;  4N3O A;  4Z7C A;  2DSY A;  3QT7 A;  2M1S A;  2CZ9 A;  3B82 A;  4J8Z A;  3RMP A;  4P78 A;  2E1M A;  2FGG A;  2FTX B;  4M0V A;  3ADG A;  5FWK A;  5BR8 E;  1N36 E;  4DR7 I;  4JI7 E;  4UTG A;  1ELO A;  2XEX A;  4EMD A;  2HFS A;  1H74 A;  4DR2 E;  2BM0 A;  4FW9 A;  1XMQ I;  4BCA A;  4LF4 I;  2RS6 A;  4HYM A;  4HAC A;  4I8O A;  4URL A;  2EWL A;  1DQ3 A;  4X64 I;  4LF8 E;  4MYU A;  3P06 A;  1HNX I;  5FLX Q;  1YYW A;  1RR9 A;  1HR0 I;  1K47 A;  3HPZ A;  2BV3 A;  4P7A A;  4B3T I;  1XHK A;  4P52 A;  3J81 Q;  4GKJ E;  4IZJ B;  4DV4 E;  1PVG A;  4LFB E;  2HKE A;  4FN5 A;  2UUA I;  4DUY I;  1IBL I;  4B3M I;  2JOX A;  3JAM C;  4USM A;  4NXN I;  3ADI A;  3PRY A;  4HXZ A;  4LFA I;  3DJW A;  2KON A;  2MDR A;  3J7A M;  2IHR 1;  1USV A;  1Z0T A;  4DV5 E;  1GQE A;  1H72 C;  3IWB A;  1T4L B;  2L3J A;  4PRV A;  1WHN A;  4GEQ B;  4JI3 E;  2UUC I;  4TUG A;  3HXL A;  1XNQ I;  3HQ1 A;  4ED4 A;  4JI2 I;  1N32 I;  3ZOQ B;  4LFC I;  3ZZT A;  2L2K B;  4AQY I;  3AUZ A;  4LF7 E;  1YZ9 A;  3QT6 A;  1ZXN A;  3HPS A;  2VQF I;  1ZM9 A;  4KZS A;  3PYE A;  1N34 E;  5GMD A;  2UUB E;  1FWL A;  4X64 E;  1HK7 A;  2PNM A;  4HY1 A;  3T1Y I;  4LF5 E;  2DIX A;  5A2Q C;  1EI1 A;  4IZJ D;  2DB2 A;  4M2Z A;  2UXC E;  4L8N A;  2LMZ A;  3ZZU A;  4MYT A;  1U2R A;  2RTX A;  2E1R A;  2KHX A;  1GZ6 A;  1HNZ E;  2ZM6 E;  1RC7 A;  4JI1 I;  2NPF A;  4JI5 I;  2Z5E A;  2JOB A;  3D4J A;  3QT8 A;  4I3H A;  5AAS A;  2UXB E;  2ODR D;  2E5L I;  2V87 A;  2DEJ A;  5IT9 C;  4DV6 E;  4JYA E;  4DXL A;  4B3S I;  2G7H A;  1STU A;  2VF1 A;  4DU7 A;  5LMU I;  1I94 E;  1RQ0 A;  1J26 A;  4F54 A;  2UUC E;  1H73 A;  4BBY A;  2HHH E;  1Z0E A;  4PU9 A;  1BKN A;  2VE7 C;  3H4L A;  1MU5 A;  3F0N A;  3HUL A;  4R03 A;  4JI0 E;  2V8Q B;  1T4N A;  1Z0G A;  2L6M A;  3FIG A;  1H7U A;  2R42 A;  2V2Q A;  2B9D A;  1Z0W A;  3OTO E;  4FWG A;  4X8W A;  3T1H E;  2O1T A;  4DV0 E;  4DV3 E;  2WZO A;  4HAC B;  4JG4 A;  3Q1Q A;  2ZIT A;  2LUQ A;  2Z5B A;  2UXD I;  3T1Y E;  3LML A;  1QZR A;  3OML A;  4LF9 I;  4K0K E;  4R1F A;  3J7Y p;  4B3R I;  1J5E E;  4WYQ B;  4DUZ I;  1ZBQ A;  4WUC A;  2ODR C;  1B62 A;  2ZBK B;  1N33 E;  1RRE A;  1XMO I;  4YY3 E;  5LL6 R;  4GKK E;  4P7D A;  2UU9 E;  4YHH I;  5L3J A;  4JI6 E;  5IWA E;  2X7I A;  2L3C A;  1DAR A;  2H36 X;  2NUF A;  1FNM A;  1IBM I;  2M4I A;  4BMJ A;  1Z5A A;  2DEI A;  2GS8 A;  1EKZ A;  4USK A;  4DPW A;  1FWK A;  4X65 E;  1WHQ A;  1ZM4 A;  1Z59 A;  3J80 C;  2PNL A;  2BM1 A;  4X62 E;  3ZZ0 A;  3QT5 A;  4DR6 E;  5T6J A;  2B7V A;  2CGE A;  4OX9 I;  4DPY A;  4DV2 I;  2LRS A;  4JI8 I;  1FJG I;  2HFU A;  3ZKD A;  4IZK B;  1DI2 A;  3K17 A;  4X66 I;  4DR7 E;  1YYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...