4YY3E

30s ribosomal subunit- higb complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 38
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4yy3E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yy3E02
4DV5I 4UTGA 4DR5I 4HACB 4PRXA 4LF5I 3PYEA 2EFGA 4DV6E 3CWVA 2UXBI 1HR0I 4OX9I 4MYUA 1YZ9A 2AJ4A 4M2ZA 1Z5BA 3PYFA 1H73A 4LF8E 4B3SI 4DU8A 4DV3E 2NUFA 5GMDA 2V2ZA 2OI2A 2VQEE 4LF9I 1XNRI 4USMA 2UUBI 1BKNA 1ZM9A 2LBSB 4B3RE 5IT9Q 1N33E 2L3JA 3QT8A 2ZM6E 3ZZTA 1STUA 1YYKA 1T4OA 1RC7A 2NA2A 1NHIA 1ZM4A 1B63A 3B8HA 1X48A 3LTOA 4R1FA 4JI7I 2UUAE 1WHQA 1N0UA 3C4TA 4JYAI 4P52A 1ZM2A 4HACA 3WU5A 1T4LB 2NUEA 4DR3I 2HKJA 3T1YE 3HULA 1ZBTA 4USKA 3QT5A 5BR8E 2HK2A 4KQVA 4FWHA 2JVAA 5IWAE 1HNXE 5A2QC 4HY1A 1X49A 5CFFE 1N34E 1XMOE 4JI5E 3Q1QA 1IBME 3T1HE 1XMQI 2B3TB 2CZ9A 2DB2A 2NPFA 4JI6I 2RSMA 4DR6E 4MYTA 1N36I 1N32E 1I94I 4DPXA 4DV7I 2V2QA 4WUBA 2X36A 4JI1E 4X66I 3D4JA 3J80Q 1QZRA 4DU7A 4X62E 2X7IA 2BM1A 3QT6A 4OOGC 4DUYE 4DKKA 1IBLE 4FN5A 4YY3E 4LFBI 1HNZI 4DV5E 4X64I 1KVKA 4DR1I 2HFSA 4DR5E 4LF5E 4JI2I 3LLHA 2LUPB 1N32I 1MG7A 2UXBE 4X65I 1HR0E 4OX9E 1RR9A 1DI2A 4LF7I 4DV1I 3H4LA 1T4NA 3J7Yp 3C4BA 4URLA 4DV2I 1HNWI 1WUUA 5L3JA 1NHHA 4JI8I 1UEKA 4NXNI 4B3SE 2GS8A 2E1RA 5A2QQ 3VYYA 1PIEA 2N3GA 4HXZA 4YY3I 4LF4I 3P1XA 4LF9E 1XNRE 2UUBE 1Z5AA 5FLXC 4DV4I 4DR7I 3J81C 1FKAE 2V8PA 2BV3A 1Z0VA 3ADLA 1FJGI 1YYOA 4JV5I 4JI7E 3ADGA 4JYAE 3J7AM 4JI0I 4DR3E 4KHPI 4HYMA 4LF6I 3K1JA 1B62A 2LUQA 1GQEA 4B3MI 2HK3A 4DV0I 1FI4A 4DR2I 2E5LI 4DPUA 1RREA 1ELOA 4Z7CA 2DEJA 2VQFI 4NXMI 4JI3I 1XNQI 1XMQE 4PU9A 2ZITA 4JI6E 4B3TI 1N36E 1J5EI 1I94E 2LJPA 1NZ0A 4DV7E 2CPNA 1Z0GA 5FLXQ 4X66E 4ED4A 4M30A 2L2KB 1Z5CA 3ZZUA 2B7TA 2KHXA 4LFBE 1HNZE 5LMNE 4X64E 4ZVIA 1N0VC 4DR1E 2NUGA 4JI2E 3M6AA 4X65E 2UXCI 4LF7E 2Q2EB 1IBKI 4DV1E 3B78A 4DV2E 3LNUA 1HNWE 2EZ6A 4JI8E 2ZBKB 3ZKBA 2LTSA 4NXNE 2BM0A 1Z0CA 2HHHI 1H72C 3ADJA 4LF4E 3VYXA 5LMNI 1Z0BA 3QT7A 3K17A 4DV4E 3V2UC 1A6FA 4DR7E 3ZM7A 2N3HA 3OTOI 4LFAI 1PVGA 4P7AA 3JAMC 2DEIA 1D6TA 1FJGE 3ZKDA 1PKPA 4JV5E 2HKEA 3WU3A 4RPFA 2A2DA 4JI0E 3PYDA 4KHPE 1MU5A 1OJ4A 4LF6E 1ZXNA 3LPSA 4B3ME 4DV0E 1MX0A 1S16A 4DR2E 1S4EA 2E5LE 4JI4I 4DR4I 4GKKI 4K0KI 2UUCI 2VQFE 2R42A 5LMUI 5GMEA 1X47A 2F4VI 4UT4A 2DIXA 4NXME 4JI3E 1XNQE 3ADIA 2UXDI 2VF3A 1J26A 1KIJA 1K47A 4YHHI 4DXLA 4B3TE 1J5EE 4AQYI 3WU6A 1RQ0A 4DUZI 2V2VA 2HFUA 2IHR1 2LRSA 2J7KA 2L2MA 1FNMA 4DPYA 4XTJA 3JAMQ 4Z7YA 4GKJI 2UU9I 2LJHA 4WUDA 4LFCI 2MDRA 2L2NA 3J80C 2DMYA 4DV6I 2UXCE 2JY9A 1QU6A 1IBKE 2B7VA 1H7SA 4JG4A 1FWLA 3J81Q 4LF8I 3V5RA 1H7UA 4DV3I 2L3CA 1DARA 2HHHE 1H74A 1Z0WA 1KTVA 1Z59A 3B82A 2VQEI 1U2RA 1UHZA 3F0NA 2A2CA 4WFTA 4B3RI 1N33I 3OTOE 2ZM6I 4LFAE 3WU4A 4DPTA 1KKHA 4FWGA 2UUAI 2WW4A 2RTXA 4X8WA 1XHKA 5LL6R 4WYQB 1O0WA 3T1YI 2LTRA 3HTXA 1EI1A 3GONA 5BR8I 4JI4E 4DR4E 1ZM3A 2YT4A 4K0KE 4GKKE 2UUCE 3PYGA 5IWAI 1HNXI 2V34A 5LMUE 1WHNA 1N34I 2F4VE 4FW9A 1XMOI 4JI5I 4DPWA 2UXDE 1IBMI 4PRVA 3T1HI 2L33A 1YYWA 1ZXMA 2R3VA 4YHHE 3J7AG 1UILA 5IT9C 4DR6I 4AQYE 1NHJA 4FWDA 4DUZE 3ZZ0A 2RS7A 1Z0EA 2XEXA 4JI1I 1EKZA 1FWKA 4X62I 4EMDA 4DUYI 1VISA 2RS6A 1Z0TA 4M1KA 4GKJE 4I3HA 2UU9E 4WUCA 1IBLI 4LFCE 1EA6A
chains in the Genus database with same CATH superfamily
4DV5I 2EPUA 2EPNA 4UTGA 1IQOA 4F9AB 2GO4A 2EQ3A 5AASA 4WX9A 4DR5I 2JEAB 4HACB 4PRXA 4LF5I 3PYEA 4LPFA 4IFDA 2EFGA 4DV6E 2PNMA 4R2QA 3CWVA 5C0XB 1HR0I 2UXBI 4OX9I 2MC6A 4MYUA 3PS1A 4M9VC 1YZ9A 2EQ1A 3PRYA 2AJ4A 4M2ZA 1Z5BA 3PYFA 2PRTA 1H73A 3U1KA 5DRPA 5EL9A 4LF8E 4B3SI 4DU8A 2EORA 4DV3E 3M7ND 2O1UA 2ENAA 2YU5A 1AH5A 2NUFA 3CDJA 5IXMB 3DD6A 2EWLA 5GMDA 2V2ZA 2OI2A 1A1KA 2VQEE 2EMGA 1T38A 4LF9I 3Q6MA 1XNRI 4USMA 1EH7A 2M7QA 3EPJA 2UUBI 4TUGA 2L6MA 1BKNA 2EPPA 1ZM9A 2EPLX 2LBSB 1R6LA 4B3RE 5IT9Q 1N33E 2EPKX 2L3JA 1A1GA 1IMUA 3QT8A 1X3CA 4LCFA 4NBQA 2EMWA 2ZM6E 1STUA 5DNLA 3ZZTA 1YYKA 1T4OA 1RC7A 2JE6B 2EOJA 4IZJD 2NA2A 1NHIA 1ZM4A 1B63A 3B8HA 1X48A 3LTOA 2CGEA 4R1FA 4JI7I 2UUAE 2CT1A 1WHQA 2ELYA 1N0UA 2EM8A 3C4TA 2M4IA 1Y4SA 2LCEA 1X6EA 5FWKA 2JWOA 4JYAI 4P52A 1ZM2A 2JEAA 4J8ZA 4HACA 5DNYA 3WU5A 4L5NC 5T6JA 1WXRA 2YSOA 3BF2A 1T4LB 2NUEA 4LCGA 4DR3I 2EM6A 2B9DA 2F8BA 3T1YE 2CTDA 2HKJA 4IJDA 1YHCA 3THNA 2NN6C 2YPNA 4ZYHA 5ELWA 2F1DA 4OO1E 3HULA 5K36E 1ZBTA 4USKA 1MGTA 3CDIA 3QT5A 4DMIA 1ZR9A 2EOYA 1ZU1A 5BR8E 2WP8B 4IFDD 3GMEA 2EOZA 2HK2A 4BA2B 5A6BD 1UDQA 2CVEA 4KQVA 2ODRC 4FWHA 2EN2A 4OZEA 3P3CA 2JVAA 2WBTA 4HTGA 5IWAE 1HNXE 5A2QC 4R2CA 4HY1A 3RMPA 1X49A 3OMLA 5CFFE 1N34E 1XMOE 4JI5E 3KZYA 2EOSA 4F9CB 2EM4A 4IZJB 3Q1QA 4WSPA 1IBME 2YTPA 3T1HE 1A1LA 1XMQI 2B3TB 2CZ9A 2E72A 2DB2A 5A6KA 3MSWA 4I8OA 2JOBA 2JPAA 2NPFA 4JI6I 2RSMA 5AE1A 4ZYDA 3L00A 4R2AA 1TF3A 4DR6E 4MYTA 1Y6ZA 1N36I 1N32E 1I94I 1TF6A 2EMCA 4DPXA 2EN8A 4DV7I 4AIDA 2V2QA 2YSPA 4WUBA 3DF6A 2Z5BB 2X36A 4JI1E 4X66I 2GQ0A 4IFDB 3D4JA 5LLQA 3J80Q 1QZRA 2ENHA 4DU7A 4X62E 2X7IA 1Y4UA 3ZOQB 2VF1A 2BM1A 2V88A 4O5GA 3QT6A 3HPSA 3KZZA 4OOGC 4DUYE 4DKKA 2EPRA 2EOMA 2MKDA 2BR2B 1IBLE 2O1TA 2YU8A 4FN5A 2J7JA 2I9IA 1A1HA 4YY3E 4LFBI 1BBOA 1HNZI 2YTEA 2EPMX 1JK2A 2RQLA 4DV5E 4GZNC 4X64I 1P47A 1KVKA 4DR1I 3BBGA 4DR5E 1KJKA 2HFSA 4LF5E 2A25A 3LLHA 4JI2I 2LUPB 3HKMA 4TUIA 1N32I 3ECRA 1MG7A 2UXBE 4X65I 1HR0E 4OX9E 2PO1A 1RR9A 4KWYA 1DI2A 4LF7I 3JU0A 4DV1I 3H4LA 1T4NA 3C6MA 3VK6A 3J7Yp 5JEAE 2DMIA 2EMKA 2R76A 3C4BA 4ZYEA 2NN6E 4URLA 2VE7C 4DV2I 1HNWI 1WUUA 5L3JA 5KL5A 1NHHA 1MEYC 3HXLA 4JI8I 1UEKA 2Z5EA 2JP9A 1OYPA 5DROA 4NXNI 4B3SE 1USUA 4QNKA 1ZBQA 2H36X 4FW6A 2C38B 2GS8A 4Q28A 2E1RA 4OO1C 2EMIA 3UK3C 5A2QQ 3VYYA 1PIEA 2N3GA 2ENCA 4HXZA 4YY3I 4LF4I 2O1WA 3P1XA 1SR9A 4LF9E 1XNRE 1Z1BA 2JR1A 2LE2A 1NCSA 2KONA 3M99B 2Z5BA 2UUBE 5FLXC 1Z5AA 2ELZA 1OYSA 2C37B 2JXPA 2WNRA 4DV4I 2V86A 4DR7I 3J81C 4O24A 5A6BA 1FKAE 2WBUA 3KWRA 2V8PA 2BV3A 2LT7A 5KL6A 1Z0VA 2BR2A 4R2SA 1EH6A 1GTKA 3ADLA 2IOQA 4ISAA 1FJGI 5K36F 1YYOA 5KL3A 1RMDA 4JV5I 2YTIA 2LMZA 4JI7E 2Z5CA 1YUJA 2RSIA 3ADGA 2EM7A 4JYAE 3J7AM 2EL5A 3EQ1A 4FW3A 2YWQA 2EL4A 4JI0I 2FTXB 3BIDA 4KZSA 4DR3E 4KHPI 2RPCA 1ZAAC 4HYMA 5F3WA 2EPCA 4LF6I 3K1JA 2YTDA 1B62A 2O3ZA 4MLVA 2LUQA 1GQEA 5AE3A 2AE8A 4B3MI 2HK3A 4DV0I 1FI4A 4DR2I 2E5LI 1YH8A 4DPUA 1GZ6A 1RREA 4F6NA 2C38A 1ELOA 2VRDA 3Q6NA 2EMAA 2L8TA 4Z7CA 2BA1G 2YTGA 2DEJA 4F54A 2VQFI 1QNTA 4R2EA 2Q8UA 1NEIA 3VHTB 4NXMI 4JI3I 1XNQI 5AC4A 5DNXA 4F6MA 1XMQE 2EN1A 1E3HA 1TN9A 2HJJA 3IWDA 2C37A 1HK7A 4R2PA 4PU9A 2EMZA 4GEQB 4JI6E 2ZITA 5C0XE 4B3TI 1N36E 2EOOA 5JEAC 1J5EI 1T39A 1I94E 2LJPA 1NZ0A 4DV7E 2CPNA 2WZOA 1LLMC 3QG5C 4LOMA 2EPXA 1Z0GA 5FLXQ 4X66E 4ED4A 4QNJA 4FK5C 4NZVA 2IOPA 5IV8B 4M30A 2GO3A 2L2KB 2PO1B 1UDNA 1Z5CA 3ZZUA 2B7TA 2KHXA 2EMBA 3U1YA 4ZYGA 4IFDC 1BB8A 3THOB 4LFBE 1X6FA 5JEAF 1HNZE 2NN6F 1DQ3A 2CG9A 4F2JC 5LMNE 4X64E 5K36A 1WRJA 1A1JA 4ZVIA 1N0VC 4DR1E 2NUGA 4JI2E 3M6AA 2ADRA 1RHYA 4X65E 2UXCI 4BBYA 4MU3A 4LF7E 2Q2EB 1IBKI 4DV1E 2EMXA 3B78A 4O43A 2KOUA 1PJTA 2V85A 1USVA 2WCC3 2EN6A 3IWCA 1YFHA 1XXEA 1X6HA 4DV2E 2WNRB 1HNWE 3LNUA 2EN7A 2V83A 2EZ6A 4JI8E 2ZBKB 1G2FC 2LTSA 2YZTA 3ZKBA 5C0XC 4NXNE 2BM0A 1Z0CA 1BBGA 2PNLA 2HHHI 4RHBB 2EM3A 1H72C 3P06A 2YTFA 3ADJA 4LF4E 2EE8A 1YUIA 2Z5CB 3VYXA 5LMNI 1Z0BA 4MDTA 4P78A 1PJQA 2J65A 3QT7A 3K17A 4DV4E 2I13A 4N4RB 4DR7E 2MKNA 1A6FA 2N3HA 3V2UC 3ZM7A 3OTOI 2M9AA 2LJUA 4LFAI 3JAMC 4BCAA 1PVGA 4BHCA 2JT2A 4P7AA 2BB8A 4F9BB 2DEIA 1D6TA 2MDGA 5KL7A 1FJGE 3ZKDA 1PKPA 4JV5E 1YPNA 2BBGA 2L92A 4Q35B 4FW7A 1Y60A 2HKEA 3WU3A 4GQUA 4AIMA 4RPFA 1L4SA 2EP3A 1F2IG 2R1FA 2JYAA 4JI0E 2A2DA 4NHRA 3PYDA 2PNZB 4KHPE 2EMFA 2LV2A 1MU5A 1A1FA 1OJ4A 4LF6E 1ZXNA 3LPSA 4OO1D 1SFEA 2EOXA 3L7ZA 4LCHA 3HQ1A 2BA0D 5K36D 5DRQA 5A6AA 1R6MA 4WXDA 1EH8A 4BA2A 4IFDE 4B3ME 4DV0E 3MHHC 2V89A 1MX0A 1S16A 4DR2E 3TQMA 4X9JA 2FV4B 2E5LE 1S4EA 3P76A 2NN6A 4JI4I 4DR4I 2BA0G 5KL2A 5C0XF 4GKKI 4K0KI 4MQYA 4BHBA 2UUCI 5A69A 1UDOA 4OO1F 2VQFE 2EN4A 2R42A 5LMUI 5GMEA 1X47A 2F4VI 2IESA 4BC7A 4UT4A 2DIXA 3K6QA 4NXME 4JI3E 1XNQE 3ADIA 4FW5A 2UXDI 2VF3A 4R2RA 1J26A 1KIJA 2IERA 2EQ0A 3C6KA 1K47A 4IS9A 5EKWA 4YHHI 2EOQA 3M85G 4DXLA 4B3TE 4BS9A 1J5EE 4AQYI 3WU6A 1RQ0A 4DUZI 1DGCA 1OYRA 2V2VA 2HFUA 1UBDC 4OO1B 2BA1D 5K36B 1PJSA 2EN3A 2IHR1 2LRSA 2MC5A 2J7KA 2L2MA 1FNMA 4DPYA 2GPIA 4XTJA 2D9HA 3LMLA 2EM9A 3AUZA 1P42A 2PNZA 3JAMQ 4Z7YA 4GKJI 2YRHA 2UU9I 2LJHA 4WUDA 4WXCA 2PO0B 3EPKA 3PS2A 5DRRA 4LFCI 4RH8A 3F6HA 2M1SA 2MDRA 4IZKB 3EPHA 3BGHA 2G7HA 2L2NA 3M7NG 2VESA 2EPOA 4LU9A 3J80C 2DMYA 4DV6I 4HEIA 1UDSA 2UXCE 2JEBB 2JY9A 1PDAA 1QU6A 3B4TA 4U3DA 1IBKE 2B7VA 3UHMA 2EOEA 1B69A 1H7SA 4O4KA 2EMLA 4P7DA 3EPLA 5JEAD 3IWBA 2NN6D 4MLQA 4JG4A 3AV0A 5KL4A 1FWLA 2DLQA 4BA1B 4BC9A 2DRPA 3J81Q 4LF8I 4U3BA 1N3GA 4N3OA 3V5RA 2O1VA 2HGHA 1H7UA 4DV3I 2ODRD 2DSYA 5AC5A 2L3CA 1DARA 2HHHE 1H74A 1Z0WA 4MU1A 1KTVA 2EM0A 4LTYA 2LVHA 5C0XA 1Z59A 3H09A 2V87A 2YTOA 3B82A 2VQEI 1U2RA 1UHZA 2EM5A 2JOXA 4WSGA 3F0NA 2A2CA 2EOFA 2K7IA 4OO1A 2EMHA 4WFTA 1KYQA 2V8QB 1G2DC 1E3PA 4FW4A 3HJCA 3GLLA 4B3RI 4R2DA 1N33I 3OTOE 1UN6B 2EOHA 2ZM6I 4LFAE 3L7ZB 3WU4A 4DPTA 5AE2A 1WJPA 4L8NA 1KKHA 2PO0A 3JTZA 1YSAC 4FWGA 5JEAB 4IZKA 4IFDF 4BMJA 2NN6B 4J3DA 2UUAI 2WW4A 4OKGA 2WBSA 2RTXA 4X8WA 1XHKA 2C39B 2YRKA 5LL6R 5TSEA 4IS1C 4WYQB 1O0WA 2EMYA 3FIGA 4WPYA 2PO2B 2NABA 2JEBA 3KRNA 3T1YI 2LTRA 4M0VA 3HTXA 3F6GA 4R8OA 2EPAA 2EOIA 2JE6A 2GHFA 1EI1A 3GONA 2YTNA 3H1CA 5BR8I 4BA1A 4JI4E 4DR4E 2YTJA 1ZM3A 1IQSA 2YT4A 4K0KE 4GKKE 2UUCE 2EL6A 2LO3A 3PYGA 5IWAI 1HNXI 4AM3A 2V34A 3P3EA 5LMUE 1WHNA 1N34I 2DGCA 2E1MA 2F4VE 3GCMA 4FW9A 1VI7A 4MU0A 1XMOI 4JI5I 2EM2A 3DJWA 4DPWA 2UXDE 2K4VA 3MHSC 4PRVA 1IBMI 3T1HI 1JK1A 5ADZA 2L33A 1YYWA 2HC5A 1ZXMA 2WP8A 2R3VA 4YHHE 3J7AG 4R03A 1Y5YA 1UILA 2YTQA 5IT9C 2YRMA 5C0XD 4DR6I 4AQYE 1NHJA 2EPZA 4FWDA 4MU4A 4DUZE 3PS3A 3HPZA 3ZZ0A 2RS7A 1Z0EA 2GLIA 2XEXA 1X5WA 5JEAA 2N8XA 4JI1I 4IZJA 2CSHA 1EKZA 3P3GA 1FWKA 4X62I 1A1IA 3K85A 2C39A 2DLKA 5A6JA 4EMDA 4DUYI 1AAYA 1VISA 2RS6A 1Z0TA 4M1KA 4GKJE 2FGGA 2UU9E 2PO2A 4WUCA 4I3HA 3M85D 1IBLI 5K36C 2EJ4A 3NZKA 4LFCE 1EA6A
chains in the Genus database with same CATH topology
4DV5I 4UTGA 4F9AB 5AASA 4DR5I 4HACB 4PRXA 4LF5I 3PYEA 2EFGA 4DV6E 2PNMA 3CWVA 2UXBI 1HR0I 4OX9I 2MC6A 4MYUA 1YZ9A 3PRYA 2AJ4A 4M2ZA 1Z5BA 3PYFA 1H73A 4LF8E 4B3SI 4DU8A 4DV3E 2O1UA 2NUFA 5GMDA 2EWLA 2V2ZA 2OI2A 2VQEE 4LF9I 1XNRI 3Q6MA 4USMA 2M7QA 2UUBI 4TUGA 2L6MA 1BKNA 1ZM9A 2LBSB 4B3RE 5IT9Q 1N33E 2L3JA 3QT8A 2ZM6E 3ZZTA 1STUA 1YYKA 1T4OA 1RC7A 4IZJD 2NA2A 1NHIA 1ZM4A 1B63A 3B8HA 1X48A 3LTOA 2CGEA 4R1FA 4JI7I 2UUAE 1WHQA 1N0UA 1Y4SA 3C4TA 2M4IA 5FWKA 4JYAI 2JWOA 4P52A 1ZM2A 4J8ZA 4HACA 5DNYA 3WU5A 4L5NC 5T6JA 1WXRA 1T4LB 2NUEA 4DR3I 2B9DA 2F8BA 3T1YE 2HKJA 3HULA 1ZBTA 4USKA 3QT5A 4DMIA 5BR8E 2HK2A 4KQVA 2ODRC 4FWHA 2JVAA 5IWAE 1HNXE 5A2QC 4HY1A 3RMPA 1X49A 3OMLA 5CFFE 1N34E 1XMOE 4JI5E 4F9CB 4IZJB 3Q1QA 4WSPA 1IBME 3T1HE 1XMQI 2B3TB 2CZ9A 2DB2A 3MSWA 4I8OA 2JOBA 2NPFA 4JI6I 2RSMA 5AE1A 4DR6E 4MYTA 1N36I 1Y6ZA 1N32E 1I94I 4DPXA 4DV7I 2V2QA 4WUBA 3DF6A 2Z5BB 2X36A 4JI1E 4X66I 2GQ0A 3D4JA 3J80Q 1QZRA 4DU7A 4X62E 2X7IA 1Y4UA 3ZOQB 2VF1A 2BM1A 2V88A 3QT6A 3HPSA 4OOGC 4DUYE 4DKKA 2O1TA 1IBLE 4FN5A 4YY3E 4LFBI 1HNZI 4DV5E 4X64I 1KVKA 4DR1I 2HFSA 4DR5E 4LF5E 4JI2I 3LLHA 2LUPB 4TUIA 1N32I 1MG7A 2UXBE 4X65I 1HR0E 4OX9E 1RR9A 1DI2A 4LF7I 3JU0A 4DV1I 3H4LA 1T4NA 3VK6A 3J7Yp 3C4BA 4URLA 2VE7C 4DV2I 1HNWI 1WUUA 5L3JA 1NHHA 3HXLA 4JI8I 1UEKA 2Z5EA 4NXNI 4B3SE 1USUA 1ZBQA 2H36X 2GS8A 4Q28A 2E1RA 5A2QQ 3VYYA 1PIEA 2N3GA 4HXZA 4YY3I 4LF4I 2O1WA 3P1XA 1SR9A 4LF9E 1XNRE 2JR1A 2LE2A 2KONA 2Z5BA 2UUBE 5FLXC 1Z5AA 4DV4I 2V86A 4DR7I 3J81C 1FKAE 3KWRA 2V8PA 2BV3A 1Z0VA 3ADLA 2IOQA 1FJGI 1YYOA 4JV5I 2LMZA 4JI7E 2Z5CA 3ADGA 4JYAE 3J7AM 4JI0I 2FTXB 4KZSA 4DR3E 4KHPI 4HYMA 5F3WA 4LF6I 3K1JA 1B62A 2LUQA 1GQEA 5AE3A 4B3MI 2HK3A 4DV0I 1FI4A 4DR2I 2E5LI 4DPUA 1GZ6A 1RREA 1ELOA 3Q6NA 2L8TA 4Z7CA 2DEJA 4F54A 2VQFI 4NXMI 4JI3I 1XNQI 1XMQE 3IWDA 1HK7A 4PU9A 4GEQB 4JI6E 2ZITA 4B3TI 1N36E 1J5EI 1I94E 2LJPA 1NZ0A 4DV7E 2CPNA 2WZOA 1Z0GA 5FLXQ 4X66E 4ED4A 2IOPA 4M30A 2L2KB 1Z5CA 3ZZUA 2B7TA 2KHXA 4LFBE 1HNZE 1DQ3A 2CG9A 5LMNE 4X64E 4ZVIA 1N0VC 4DR1E 2NUGA 4JI2E 3M6AA 4X65E 2UXCI 4BBYA 4LF7E 2Q2EB 1IBKI 4DV1E 3B78A 2KOUA 2V85A 1USVA 3IWCA 4DV2E 3LNUA 1HNWE 2EZ6A 2V83A 4JI8E 2ZBKB 3ZKBA 2LTSA 2YZTA 4NXNE 2BM0A 1Z0CA 2PNLA 2HHHI 1H72C 3P06A 3ADJA 4LF4E 2Z5CB 3VYXA 5LMNI 1Z0BA 4P78A 3QT7A 3K17A 4DV4E 3V2UC 1A6FA 4DR7E 3ZM7A 2N3HA 3OTOI 4LFAI 3JAMC 4BCAA 1PVGA 4P7AA 4F9BB 2DEIA 1D6TA 1FJGE 3ZKDA 1PKPA 4JV5E 2L92A 2HKEA 3WU3A 4RPFA 2A2DA 4JI0E 3PYDA 4KHPE 1MU5A 1OJ4A 4LF6E 1ZXNA 3LPSA 3HQ1A 4B3ME 4DV0E 1MX0A 2V89A 1S16A 4DR2E 1S4EA 2E5LE 2FV4B 4JI4I 4DR4I 4GKKI 4K0KI 2UUCI 2VQFE 2R42A 5LMUI 5GMEA 1X47A 2F4VI 4BC7A 4UT4A 2DIXA 3K6QA 4NXME 4JI3E 1XNQE 3ADIA 2UXDI 2VF3A 1J26A 1KIJA 1K47A 4YHHI 4DXLA 4B3TE 4BS9A 1J5EE 4AQYI 3WU6A 1RQ0A 4DUZI 2V2VA 2HFUA 2IHR1 2LRSA 2MC5A 2J7KA 2L2MA 1FNMA 4DPYA 4XTJA 3LMLA 3AUZA 3JAMQ 4Z7YA 4GKJI 2UU9I 2LJHA 4WUDA 4LFCI 3F6HA 2M1SA 2MDRA 4IZKB 2G7HA 2L2NA 4LU9A 3J80C 2DMYA 4DV6I 2UXCE 2JY9A 1QU6A 1IBKE 2B7VA 1H7SA 4P7DA 3IWBA 4JG4A 3AV0A 1FWLA 4BC9A 3J81Q 4LF8I 4N3OA 3V5RA 2O1VA 1H7UA 4DV3I 2ODRD 2DSYA 2L3CA 1DARA 2HHHE 1H74A 1Z0WA 1KTVA 4LTYA 1Z59A 3H09A 2V87A 3B82A 2VQEI 1U2RA 1UHZA 2JOXA 3F0NA 2A2CA 4WFTA 2V8QB 3HJCA 4B3RI 1N33I 3OTOE 2ZM6I 4LFAE 3WU4A 4DPTA 5AE2A 4L8NA 1KKHA 3JTZA 4FWGA 4IZKA 4BMJA 2UUAI 2WW4A 2RTXA 4X8WA 1XHKA 5LL6R 4WYQB 1O0WA 3FIGA 4WPYA 3T1YI 2LTRA 4M0VA 3HTXA 3F6GA 4R8OA 1EI1A 3GONA 5BR8I 4JI4E 4DR4E 1ZM3A 2YT4A 4K0KE 4GKKE 2UUCE 3PYGA 5IWAI 1HNXI 2V34A 5LMUE 1WHNA 1N34I 2F4VE 2E1MA 4FW9A 1XMOI 4JI5I 3DJWA 4DPWA 2UXDE 2K4VA 1IBMI 4PRVA 3T1HI 5ADZA 2L33A 1YYWA 1ZXMA 2R3VA 4YHHE 3J7AG 4R03A 1UILA 5IT9C 4DR6I 4AQYE 1NHJA 4FWDA 4DUZE 3HPZA 3ZZ0A 2RS7A 1Z0EA 2XEXA 4JI1I 4IZJA 1EKZA 1FWKA 4X62I 3K85A 4EMDA 4DUYI 1VISA 2RS6A 1Z0TA 4M1KA 4GKJE 2FGGA 2UU9E 4WUCA 4I3HA 1IBLI 4LFCE 1EA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 I;  4UTG A;  4DR5 I;  4HAC B;  4PRX A;  4LF5 I;  3PYE A;  2EFG A;  4DV6 E;  3CWV A;  2UXB I;  1HR0 I;  4OX9 I;  4MYU A;  1YZ9 A;  2AJ4 A;  4M2Z A;  1Z5B A;  3PYF A;  1H73 A;  4LF8 E;  4B3S I;  4DU8 A;  4DV3 E;  2NUF A;  5GMD A;  2V2Z A;  2OI2 A;  2VQE E;  4LF9 I;  1XNR I;  4USM A;  2UUB I;  1BKN A;  1ZM9 A;  2LBS B;  4B3R E;  5IT9 Q;  1N33 E;  2L3J A;  3QT8 A;  2ZM6 E;  3ZZT A;  1STU A;  1YYK A;  1T4O A;  1RC7 A;  2NA2 A;  1NHI A;  1ZM4 A;  1B63 A;  3B8H A;  1X48 A;  3LTO A;  4R1F A;  4JI7 I;  2UUA E;  1WHQ A;  1N0U A;  3C4T A;  4JYA I;  4P52 A;  1ZM2 A;  4HAC A;  3WU5 A;  1T4L B;  2NUE A;  4DR3 I;  2HKJ A;  3T1Y E;  3HUL A;  1ZBT A;  4USK A;  3QT5 A;  5BR8 E;  2HK2 A;  4KQV A;  4FWH A;  2JVA A;  5IWA E;  1HNX E;  5A2Q C;  4HY1 A;  1X49 A;  5CFF E;  1N34 E;  1XMO E;  4JI5 E;  3Q1Q A;  1IBM E;  3T1H E;  1XMQ I;  2B3T B;  2CZ9 A;  2DB2 A;  2NPF A;  4JI6 I;  2RSM A;  4DR6 E;  4MYT A;  1N36 I;  1N32 E;  1I94 I;  4DPX A;  4DV7 I;  2V2Q A;  4WUB A;  2X36 A;  4JI1 E;  4X66 I;  3D4J A;  3J80 Q;  1QZR A;  4DU7 A;  4X62 E;  2X7I A;  2BM1 A;  3QT6 A;  4OOG C;  4DUY E;  4DKK A;  1IBL E;  4FN5 A;  4YY3 E;  4LFB I;  1HNZ I;  4DV5 E;  4X64 I;  1KVK A;  4DR1 I;  2HFS A;  4DR5 E;  4LF5 E;  4JI2 I;  3LLH A;  2LUP B;  1N32 I;  1MG7 A;  2UXB E;  4X65 I;  1HR0 E;  4OX9 E;  1RR9 A;  1DI2 A;  4LF7 I;  4DV1 I;  3H4L A;  1T4N A;  3J7Y p;  3C4B A;  4URL A;  4DV2 I;  1HNW I;  1WUU A;  5L3J A;  1NHH A;  4JI8 I;  1UEK A;  4NXN I;  4B3S E;  2GS8 A;  2E1R A;  5A2Q Q;  3VYY A;  1PIE A;  2N3G A;  4HXZ A;  4YY3 I;  4LF4 I;  3P1X A;  4LF9 E;  1XNR E;  2UUB E;  1Z5A A;  5FLX C;  4DV4 I;  4DR7 I;  3J81 C;  1FKA E;  2V8P A;  2BV3 A;  1Z0V A;  3ADL A;  1FJG I;  1YYO A;  4JV5 I;  4JI7 E;  3ADG A;  4JYA E;  3J7A M;  4JI0 I;  4DR3 E;  4KHP I;  4HYM A;  4LF6 I;  3K1J A;  1B62 A;  2LUQ A;  1GQE A;  4B3M I;  2HK3 A;  4DV0 I;  1FI4 A;  4DR2 I;  2E5L I;  4DPU A;  1RRE A;  1ELO A;  4Z7C A;  2DEJ A;  2VQF I;  4NXM I;  4JI3 I;  1XNQ I;  1XMQ E;  4PU9 A;  2ZIT A;  4JI6 E;  4B3T I;  1N36 E;  1J5E I;  1I94 E;  2LJP A;  1NZ0 A;  4DV7 E;  2CPN A;  1Z0G A;  5FLX Q;  4X66 E;  4ED4 A;  4M30 A;  2L2K B;  1Z5C A;  3ZZU A;  2B7T A;  2KHX A;  4LFB E;  1HNZ E;  5LMN E;  4X64 E;  4ZVI A;  1N0V C;  4DR1 E;  2NUG A;  4JI2 E;  3M6A A;  4X65 E;  2UXC I;  4LF7 E;  2Q2E B;  1IBK I;  4DV1 E;  3B78 A;  4DV2 E;  3LNU A;  1HNW E;  2EZ6 A;  4JI8 E;  2ZBK B;  3ZKB A;  2LTS A;  4NXN E;  2BM0 A;  1Z0C A;  2HHH I;  1H72 C;  3ADJ A;  4LF4 E;  3VYX A;  5LMN I;  1Z0B A;  3QT7 A;  3K17 A;  4DV4 E;  3V2U C;  1A6F A;  4DR7 E;  3ZM7 A;  2N3H A;  3OTO I;  4LFA I;  1PVG A;  4P7A A;  3JAM C;  2DEI A;  1D6T A;  1FJG E;  3ZKD A;  1PKP A;  4JV5 E;  2HKE A;  3WU3 A;  4RPF A;  2A2D A;  4JI0 E;  3PYD A;  4KHP E;  1MU5 A;  1OJ4 A;  4LF6 E;  1ZXN A;  3LPS A;  4B3M E;  4DV0 E;  1MX0 A;  1S16 A;  4DR2 E;  1S4E A;  2E5L E;  4JI4 I;  4DR4 I;  4GKK I;  4K0K I;  2UUC I;  2VQF E;  2R42 A;  5LMU I;  5GME A;  1X47 A;  2F4V I;  4UT4 A;  2DIX A;  4NXM E;  4JI3 E;  1XNQ E;  3ADI A;  2UXD I;  2VF3 A;  1J26 A;  1KIJ A;  1K47 A;  4YHH I;  4DXL A;  4B3T E;  1J5E E;  4AQY I;  3WU6 A;  1RQ0 A;  4DUZ I;  2V2V A;  2HFU A;  2IHR 1;  2LRS A;  2J7K A;  2L2M A;  1FNM A;  4DPY A;  4XTJ A;  3JAM Q;  4Z7Y A;  4GKJ I;  2UU9 I;  2LJH A;  4WUD A;  4LFC I;  2MDR A;  2L2N A;  3J80 C;  2DMY A;  4DV6 I;  2UXC E;  2JY9 A;  1QU6 A;  1IBK E;  2B7V A;  1H7S A;  4JG4 A;  1FWL A;  3J81 Q;  4LF8 I;  3V5R A;  1H7U A;  4DV3 I;  2L3C A;  1DAR A;  2HHH E;  1H74 A;  1Z0W A;  1KTV A;  1Z59 A;  3B82 A;  2VQE I;  1U2R A;  1UHZ A;  3F0N A;  2A2C A;  4WFT A;  4B3R I;  1N33 I;  3OTO E;  2ZM6 I;  4LFA E;  3WU4 A;  4DPT A;  1KKH A;  4FWG A;  2UUA I;  2WW4 A;  2RTX A;  4X8W A;  1XHK A;  5LL6 R;  4WYQ B;  1O0W A;  3T1Y I;  2LTR A;  3HTX A;  1EI1 A;  3GON A;  5BR8 I;  4JI4 E;  4DR4 E;  1ZM3 A;  2YT4 A;  4K0K E;  4GKK E;  2UUC E;  3PYG A;  5IWA I;  1HNX I;  2V34 A;  5LMU E;  1WHN A;  1N34 I;  2F4V E;  4FW9 A;  1XMO I;  4JI5 I;  4DPW A;  2UXD E;  1IBM I;  4PRV A;  3T1H I;  2L33 A;  1YYW A;  1ZXM A;  2R3V A;  4YHH E;  3J7A G;  1UIL A;  5IT9 C;  4DR6 I;  4AQY E;  1NHJ A;  4FWD A;  4DUZ E;  3ZZ0 A;  2RS7 A;  1Z0E A;  2XEX A;  4JI1 I;  1EKZ A;  1FWK A;  4X62 I;  4EMD A;  4DUY I;  1VIS A;  2RS6 A;  1Z0T A;  4M1K A;  4GKJ E;  4I3H A;  2UU9 E;  4WUC A;  1IBL I;  4LFC E;  1EA6 A; 
#chains in the Genus database with same CATH topology
 4DV5 I;  2EPU A;  2EPN A;  4UTG A;  1IQO A;  4F9A B;  2GO4 A;  2EQ3 A;  5AAS A;  4WX9 A;  4DR5 I;  2JEA B;  4HAC B;  4PRX A;  4LF5 I;  3PYE A;  4LPF A;  4IFD A;  2EFG A;  4DV6 E;  2PNM A;  4R2Q A;  3CWV A;  5C0X B;  1HR0 I;  2UXB I;  4OX9 I;  2MC6 A;  4MYU A;  3PS1 A;  4M9V C;  1YZ9 A;  2EQ1 A;  3PRY A;  2AJ4 A;  4M2Z A;  1Z5B A;  3PYF A;  2PRT A;  1H73 A;  3U1K A;  5DRP A;  5EL9 A;  4LF8 E;  4B3S I;  4DU8 A;  2EOR A;  4DV3 E;  3M7N D;  2O1U A;  2ENA A;  2YU5 A;  1AH5 A;  2NUF A;  3CDJ A;  5IXM B;  3DD6 A;  2EWL A;  5GMD A;  2V2Z A;  2OI2 A;  1A1K A;  2VQE E;  2EMG A;  1T38 A;  4LF9 I;  3Q6M A;  1XNR I;  4USM A;  1EH7 A;  2M7Q A;  3EPJ A;  2UUB I;  4TUG A;  2L6M A;  1BKN A;  2EPP A;  1ZM9 A;  2EPL X;  2LBS B;  1R6L A;  4B3R E;  5IT9 Q;  1N33 E;  2EPK X;  2L3J A;  1A1G A;  1IMU A;  3QT8 A;  1X3C A;  4LCF A;  4NBQ A;  2EMW A;  2ZM6 E;  1STU A;  5DNL A;  3ZZT A;  1YYK A;  1T4O A;  1RC7 A;  2JE6 B;  2EOJ A;  4IZJ D;  2NA2 A;  1NHI A;  1ZM4 A;  1B63 A;  3B8H A;  1X48 A;  3LTO A;  2CGE A;  4R1F A;  4JI7 I;  2UUA E;  2CT1 A;  1WHQ A;  2ELY A;  1N0U A;  2EM8 A;  3C4T A;  2M4I A;  1Y4S A;  2LCE A;  1X6E A;  5FWK A;  2JWO A;  4JYA I;  4P52 A;  1ZM2 A;  2JEA A;  4J8Z A;  4HAC A;  5DNY A;  3WU5 A;  4L5N C;  5T6J A;  1WXR A;  2YSO A;  3BF2 A;  1T4L B;  2NUE A;  4LCG A;  4DR3 I;  2EM6 A;  2B9D A;  2F8B A;  3T1Y E;  2CTD A;  2HKJ A;  4IJD A;  1YHC A;  3THN A;  2NN6 C;  2YPN A;  4ZYH A;  5ELW A;  2F1D A;  4OO1 E;  3HUL A;  5K36 E;  1ZBT A;  4USK A;  1MGT A;  3CDI A;  3QT5 A;  4DMI A;  1ZR9 A;  2EOY A;  1ZU1 A;  5BR8 E;  2WP8 B;  4IFD D;  3GME A;  2EOZ A;  2HK2 A;  4BA2 B;  5A6B D;  1UDQ A;  2CVE A;  4KQV A;  2ODR C;  4FWH A;  2EN2 A;  4OZE A;  3P3C A;  2JVA A;  2WBT A;  4HTG A;  5IWA E;  1HNX E;  5A2Q C;  4R2C A;  4HY1 A;  3RMP A;  1X49 A;  3OML A;  5CFF E;  1N34 E;  1XMO E;  4JI5 E;  3KZY A;  2EOS A;  4F9C B;  2EM4 A;  4IZJ B;  3Q1Q A;  4WSP A;  1IBM E;  2YTP A;  3T1H E;  1A1L A;  1XMQ I;  2B3T B;  2CZ9 A;  2E72 A;  2DB2 A;  5A6K A;  3MSW A;  4I8O A;  2JOB A;  2JPA A;  2NPF A;  4JI6 I;  2RSM A;  5AE1 A;  4ZYD A;  3L00 A;  4R2A A;  1TF3 A;  4DR6 E;  4MYT A;  1Y6Z A;  1N36 I;  1N32 E;  1I94 I;  1TF6 A;  2EMC A;  4DPX A;  2EN8 A;  4DV7 I;  4AID A;  2V2Q A;  2YSP A;  4WUB A;  3DF6 A;  2Z5B B;  2X36 A;  4JI1 E;  4X66 I;  2GQ0 A;  4IFD B;  3D4J A;  5LLQ A;  3J80 Q;  1QZR A;  2ENH A;  4DU7 A;  4X62 E;  2X7I A;  1Y4U A;  3ZOQ B;  2VF1 A;  2BM1 A;  2V88 A;  4O5G A;  3QT6 A;  3HPS A;  3KZZ A;  4OOG C;  4DUY E;  4DKK A;  2EPR A;  2EOM A;  2MKD A;  2BR2 B;  1IBL E;  2O1T A;  2YU8 A;  4FN5 A;  2J7J A;  2I9I A;  1A1H A;  4YY3 E;  4LFB I;  1BBO A;  1HNZ I;  2YTE A;  2EPM X;  1JK2 A;  2RQL A;  4DV5 E;  4GZN C;  4X64 I;  1P47 A;  1KVK A;  4DR1 I;  3BBG A;  4DR5 E;  1KJK A;  2HFS A;  4LF5 E;  2A25 A;  3LLH A;  4JI2 I;  2LUP B;  3HKM A;  4TUI A;  1N32 I;  3ECR A;  1MG7 A;  2UXB E;  4X65 I;  1HR0 E;  4OX9 E;  2PO1 A;  1RR9 A;  4KWY A;  1DI2 A;  4LF7 I;  3JU0 A;  4DV1 I;  3H4L A;  1T4N A;  3C6M A;  3VK6 A;  3J7Y p;  5JEA E;  2DMI A;  2EMK A;  2R76 A;  3C4B A;  4ZYE A;  2NN6 E;  4URL A;  2VE7 C;  4DV2 I;  1HNW I;  1WUU A;  5L3J A;  5KL5 A;  1NHH A;  1MEY C;  3HXL A;  4JI8 I;  1UEK A;  2Z5E A;  2JP9 A;  1OYP A;  5DRO A;  4NXN I;  4B3S E;  1USU A;  4QNK A;  1ZBQ A;  2H36 X;  4FW6 A;  2C38 B;  2GS8 A;  4Q28 A;  2E1R A;  4OO1 C;  2EMI A;  3UK3 C;  5A2Q Q;  3VYY A;  1PIE A;  2N3G A;  2ENC A;  4HXZ A;  4YY3 I;  4LF4 I;  2O1W A;  3P1X A;  1SR9 A;  4LF9 E;  1XNR E;  1Z1B A;  2JR1 A;  2LE2 A;  1NCS A;  2KON A;  3M99 B;  2Z5B A;  2UUB E;  5FLX C;  1Z5A A;  2ELZ A;  1OYS A;  2C37 B;  2JXP A;  2WNR A;  4DV4 I;  2V86 A;  4DR7 I;  3J81 C;  4O24 A;  5A6B A;  1FKA E;  2WBU A;  3KWR A;  2V8P A;  2BV3 A;  2LT7 A;  5KL6 A;  1Z0V A;  2BR2 A;  4R2S A;  1EH6 A;  1GTK A;  3ADL A;  2IOQ A;  4ISA A;  1FJG I;  5K36 F;  1YYO A;  5KL3 A;  1RMD A;  4JV5 I;  2YTI A;  2LMZ A;  4JI7 E;  2Z5C A;  1YUJ A;  2RSI A;  3ADG A;  2EM7 A;  4JYA E;  3J7A M;  2EL5 A;  3EQ1 A;  4FW3 A;  2YWQ A;  2EL4 A;  4JI0 I;  2FTX B;  3BID A;  4KZS A;  4DR3 E;  4KHP I;  2RPC A;  1ZAA C;  4HYM A;  5F3W A;  2EPC A;  4LF6 I;  3K1J A;  2YTD A;  1B62 A;  2O3Z A;  4MLV A;  2LUQ A;  1GQE A;  5AE3 A;  2AE8 A;  4B3M I;  2HK3 A;  4DV0 I;  1FI4 A;  4DR2 I;  2E5L I;  1YH8 A;  4DPU A;  1GZ6 A;  1RRE A;  4F6N A;  2C38 A;  1ELO A;  2VRD A;  3Q6N A;  2EMA A;  2L8T A;  4Z7C A;  2BA1 G;  2YTG A;  2DEJ A;  4F54 A;  2VQF I;  1QNT A;  4R2E A;  2Q8U A;  1NEI A;  3VHT B;  4NXM I;  4JI3 I;  1XNQ I;  5AC4 A;  5DNX A;  4F6M A;  1XMQ E;  2EN1 A;  1E3H A;  1TN9 A;  2HJJ A;  3IWD A;  2C37 A;  1HK7 A;  4R2P A;  4PU9 A;  2EMZ A;  4GEQ B;  4JI6 E;  2ZIT A;  5C0X E;  4B3T I;  1N36 E;  2EOO A;  5JEA C;  1J5E I;  1T39 A;  1I94 E;  2LJP A;  1NZ0 A;  4DV7 E;  2CPN A;  2WZO A;  1LLM C;  3QG5 C;  4LOM A;  2EPX A;  1Z0G A;  5FLX Q;  4X66 E;  4ED4 A;  4QNJ A;  4FK5 C;  4NZV A;  2IOP A;  5IV8 B;  4M30 A;  2GO3 A;  2L2K B;  2PO1 B;  1UDN A;  1Z5C A;  3ZZU A;  2B7T A;  2KHX A;  2EMB A;  3U1Y A;  4ZYG A;  4IFD C;  1BB8 A;  3THO B;  4LFB E;  1X6F A;  5JEA F;  1HNZ E;  2NN6 F;  1DQ3 A;  2CG9 A;  4F2J C;  5LMN E;  4X64 E;  5K36 A;  1WRJ A;  1A1J A;  4ZVI A;  1N0V C;  4DR1 E;  2NUG A;  4JI2 E;  3M6A A;  2ADR A;  1RHY A;  4X65 E;  2UXC I;  4BBY A;  4MU3 A;  4LF7 E;  2Q2E B;  1IBK I;  4DV1 E;  2EMX A;  3B78 A;  4O43 A;  2KOU A;  1PJT A;  2V85 A;  1USV A;  2WCC 3;  2EN6 A;  3IWC A;  1YFH A;  1XXE A;  1X6H A;  4DV2 E;  2WNR B;  1HNW E;  3LNU A;  2EN7 A;  2V83 A;  2EZ6 A;  4JI8 E;  2ZBK B;  1G2F C;  2LTS A;  2YZT A;  3ZKB A;  5C0X C;  4NXN E;  2BM0 A;  1Z0C A;  1BBG A;  2PNL A;  2HHH I;  4RHB B;  2EM3 A;  1H72 C;  3P06 A;  2YTF A;  3ADJ A;  4LF4 E;  2EE8 A;  1YUI A;  2Z5C B;  3VYX A;  5LMN I;  1Z0B A;  4MDT A;  4P78 A;  1PJQ A;  2J65 A;  3QT7 A;  3K17 A;  4DV4 E;  2I13 A;  4N4R B;  4DR7 E;  2MKN A;  1A6F A;  2N3H A;  3V2U C;  3ZM7 A;  3OTO I;  2M9A A;  2LJU A;  4LFA I;  3JAM C;  4BCA A;  1PVG A;  4BHC A;  2JT2 A;  4P7A A;  2BB8 A;  4F9B B;  2DEI A;  1D6T A;  2MDG A;  5KL7 A;  1FJG E;  3ZKD A;  1PKP A;  4JV5 E;  1YPN A;  2BBG A;  2L92 A;  4Q35 B;  4FW7 A;  1Y60 A;  2HKE A;  3WU3 A;  4GQU A;  4AIM A;  4RPF A;  1L4S A;  2EP3 A;  1F2I G;  2R1F A;  2JYA A;  4JI0 E;  2A2D A;  4NHR A;  3PYD A;  2PNZ B;  4KHP E;  2EMF A;  2LV2 A;  1MU5 A;  1A1F A;  1OJ4 A;  4LF6 E;  1ZXN A;  3LPS A;  4OO1 D;  1SFE A;  2EOX A;  3L7Z A;  4LCH A;  3HQ1 A;  2BA0 D;  5K36 D;  5DRQ A;  5A6A A;  1R6M A;  4WXD A;  1EH8 A;  4BA2 A;  4IFD E;  4B3M E;  4DV0 E;  3MHH C;  2V89 A;  1MX0 A;  1S16 A;  4DR2 E;  3TQM A;  4X9J A;  2FV4 B;  2E5L E;  1S4E A;  3P76 A;  2NN6 A;  4JI4 I;  4DR4 I;  2BA0 G;  5KL2 A;  5C0X F;  4GKK I;  4K0K I;  4MQY A;  4BHB A;  2UUC I;  5A69 A;  1UDO A;  4OO1 F;  2VQF E;  2EN4 A;  2R42 A;  5LMU I;  5GME A;  1X47 A;  2F4V I;  2IES A;  4BC7 A;  4UT4 A;  2DIX A;  3K6Q A;  4NXM E;  4JI3 E;  1XNQ E;  3ADI A;  4FW5 A;  2UXD I;  2VF3 A;  4R2R A;  1J26 A;  1KIJ A;  2IER A;  2EQ0 A;  3C6K A;  1K47 A;  4IS9 A;  5EKW A;  4YHH I;  2EOQ A;  3M85 G;  4DXL A;  4B3T E;  4BS9 A;  1J5E E;  4AQY I;  3WU6 A;  1RQ0 A;  4DUZ I;  1DGC A;  1OYR A;  2V2V A;  2HFU A;  1UBD C;  4OO1 B;  2BA1 D;  5K36 B;  1PJS A;  2EN3 A;  2IHR 1;  2LRS A;  2MC5 A;  2J7K A;  2L2M A;  1FNM A;  4DPY A;  2GPI A;  4XTJ A;  2D9H A;  3LML A;  2EM9 A;  3AUZ A;  1P42 A;  2PNZ A;  3JAM Q;  4Z7Y A;  4GKJ I;  2YRH A;  2UU9 I;  2LJH A;  4WUD A;  4WXC A;  2PO0 B;  3EPK A;  3PS2 A;  5DRR A;  4LFC I;  4RH8 A;  3F6H A;  2M1S A;  2MDR A;  4IZK B;  3EPH A;  3BGH A;  2G7H A;  2L2N A;  3M7N G;  2VES A;  2EPO A;  4LU9 A;  3J80 C;  2DMY A;  4DV6 I;  4HEI A;  1UDS A;  2UXC E;  2JEB B;  2JY9 A;  1PDA A;  1QU6 A;  3B4T A;  4U3D A;  1IBK E;  2B7V A;  3UHM A;  2EOE A;  1B69 A;  1H7S A;  4O4K A;  2EML A;  4P7D A;  3EPL A;  5JEA D;  3IWB A;  2NN6 D;  4MLQ A;  4JG4 A;  3AV0 A;  5KL4 A;  1FWL A;  2DLQ A;  4BA1 B;  4BC9 A;  2DRP A;  3J81 Q;  4LF8 I;  4U3B A;  1N3G A;  4N3O A;  3V5R A;  2O1V A;  2HGH A;  1H7U A;  4DV3 I;  2ODR D;  2DSY A;  5AC5 A;  2L3C A;  1DAR A;  2HHH E;  1H74 A;  1Z0W A;  4MU1 A;  1KTV A;  2EM0 A;  4LTY A;  2LVH A;  5C0X A;  1Z59 A;  3H09 A;  2V87 A;  2YTO A;  3B82 A;  2VQE I;  1U2R A;  1UHZ A;  2EM5 A;  2JOX A;  4WSG A;  3F0N A;  2A2C A;  2EOF A;  2K7I A;  4OO1 A;  2EMH A;  4WFT A;  1KYQ A;  2V8Q B;  1G2D C;  1E3P A;  4FW4 A;  3HJC A;  3GLL A;  4B3R I;  4R2D A;  1N33 I;  3OTO E;  1UN6 B;  2EOH A;  2ZM6 I;  4LFA E;  3L7Z B;  3WU4 A;  4DPT A;  5AE2 A;  1WJP A;  4L8N A;  1KKH A;  2PO0 A;  3JTZ A;  1YSA C;  4FWG A;  5JEA B;  4IZK A;  4IFD F;  4BMJ A;  2NN6 B;  4J3D A;  2UUA I;  2WW4 A;  4OKG A;  2WBS A;  2RTX A;  4X8W A;  1XHK A;  2C39 B;  2YRK A;  5LL6 R;  5TSE A;  4IS1 C;  4WYQ B;  1O0W A;  2EMY A;  3FIG A;  4WPY A;  2PO2 B;  2NAB A;  2JEB A;  3KRN A;  3T1Y I;  2LTR A;  4M0V A;  3HTX A;  3F6G A;  4R8O A;  2EPA A;  2EOI A;  2JE6 A;  2GHF A;  1EI1 A;  3GON A;  2YTN A;  3H1C A;  5BR8 I;  4BA1 A;  4JI4 E;  4DR4 E;  2YTJ A;  1ZM3 A;  1IQS A;  2YT4 A;  4K0K E;  4GKK E;  2UUC E;  2EL6 A;  2LO3 A;  3PYG A;  5IWA I;  1HNX I;  4AM3 A;  2V34 A;  3P3E A;  5LMU E;  1WHN A;  1N34 I;  2DGC A;  2E1M A;  2F4V E;  3GCM A;  4FW9 A;  1VI7 A;  4MU0 A;  1XMO I;  4JI5 I;  2EM2 A;  3DJW A;  4DPW A;  2UXD E;  2K4V A;  3MHS C;  4PRV A;  1IBM I;  3T1H I;  1JK1 A;  5ADZ A;  2L33 A;  1YYW A;  2HC5 A;  1ZXM A;  2WP8 A;  2R3V A;  4YHH E;  3J7A G;  4R03 A;  1Y5Y A;  1UIL A;  2YTQ A;  5IT9 C;  2YRM A;  5C0X D;  4DR6 I;  4AQY E;  1NHJ A;  2EPZ A;  4FWD A;  4MU4 A;  4DUZ E;  3PS3 A;  3HPZ A;  3ZZ0 A;  2RS7 A;  1Z0E A;  2GLI A;  2XEX A;  1X5W A;  5JEA A;  2N8X A;  4JI1 I;  4IZJ A;  2CSH A;  1EKZ A;  3P3G A;  1FWK A;  4X62 I;  1A1I A;  3K85 A;  2C39 A;  2DLK A;  5A6J A;  4EMD A;  4DUY I;  1AAY A;  1VIS A;  2RS6 A;  1Z0T A;  4M1K A;  4GKJ E;  2FGG A;  2UU9 E;  2PO2 A;  4WUC A;  4I3H A;  3M85 D;  1IBL I;  5K36 C;  2EJ4 A;  3NZK A;  4LFC E;  1EA6 A; 
#chains in the Genus database with same CATH homology
 4DV5 I;  4UTG A;  4F9A B;  5AAS A;  4DR5 I;  4HAC B;  4PRX A;  4LF5 I;  3PYE A;  2EFG A;  4DV6 E;  2PNM A;  3CWV A;  2UXB I;  1HR0 I;  4OX9 I;  2MC6 A;  4MYU A;  1YZ9 A;  3PRY A;  2AJ4 A;  4M2Z A;  1Z5B A;  3PYF A;  1H73 A;  4LF8 E;  4B3S I;  4DU8 A;  4DV3 E;  2O1U A;  2NUF A;  5GMD A;  2EWL A;  2V2Z A;  2OI2 A;  2VQE E;  4LF9 I;  1XNR I;  3Q6M A;  4USM A;  2M7Q A;  2UUB I;  4TUG A;  2L6M A;  1BKN A;  1ZM9 A;  2LBS B;  4B3R E;  5IT9 Q;  1N33 E;  2L3J A;  3QT8 A;  2ZM6 E;  3ZZT A;  1STU A;  1YYK A;  1T4O A;  1RC7 A;  4IZJ D;  2NA2 A;  1NHI A;  1ZM4 A;  1B63 A;  3B8H A;  1X48 A;  3LTO A;  2CGE A;  4R1F A;  4JI7 I;  2UUA E;  1WHQ A;  1N0U A;  1Y4S A;  3C4T A;  2M4I A;  5FWK A;  4JYA I;  2JWO A;  4P52 A;  1ZM2 A;  4J8Z A;  4HAC A;  5DNY A;  3WU5 A;  4L5N C;  5T6J A;  1WXR A;  1T4L B;  2NUE A;  4DR3 I;  2B9D A;  2F8B A;  3T1Y E;  2HKJ A;  3HUL A;  1ZBT A;  4USK A;  3QT5 A;  4DMI A;  5BR8 E;  2HK2 A;  4KQV A;  2ODR C;  4FWH A;  2JVA A;  5IWA E;  1HNX E;  5A2Q C;  4HY1 A;  3RMP A;  1X49 A;  3OML A;  5CFF E;  1N34 E;  1XMO E;  4JI5 E;  4F9C B;  4IZJ B;  3Q1Q A;  4WSP A;  1IBM E;  3T1H E;  1XMQ I;  2B3T B;  2CZ9 A;  2DB2 A;  3MSW A;  4I8O A;  2JOB A;  2NPF A;  4JI6 I;  2RSM A;  5AE1 A;  4DR6 E;  4MYT A;  1N36 I;  1Y6Z A;  1N32 E;  1I94 I;  4DPX A;  4DV7 I;  2V2Q A;  4WUB A;  3DF6 A;  2Z5B B;  2X36 A;  4JI1 E;  4X66 I;  2GQ0 A;  3D4J A;  3J80 Q;  1QZR A;  4DU7 A;  4X62 E;  2X7I A;  1Y4U A;  3ZOQ B;  2VF1 A;  2BM1 A;  2V88 A;  3QT6 A;  3HPS A;  4OOG C;  4DUY E;  4DKK A;  2O1T A;  1IBL E;  4FN5 A;  4YY3 E;  4LFB I;  1HNZ I;  4DV5 E;  4X64 I;  1KVK A;  4DR1 I;  2HFS A;  4DR5 E;  4LF5 E;  4JI2 I;  3LLH A;  2LUP B;  4TUI A;  1N32 I;  1MG7 A;  2UXB E;  4X65 I;  1HR0 E;  4OX9 E;  1RR9 A;  1DI2 A;  4LF7 I;  3JU0 A;  4DV1 I;  3H4L A;  1T4N A;  3VK6 A;  3J7Y p;  3C4B A;  4URL A;  2VE7 C;  4DV2 I;  1HNW I;  1WUU A;  5L3J A;  1NHH A;  3HXL A;  4JI8 I;  1UEK A;  2Z5E A;  4NXN I;  4B3S E;  1USU A;  1ZBQ A;  2H36 X;  2GS8 A;  4Q28 A;  2E1R A;  5A2Q Q;  3VYY A;  1PIE A;  2N3G A;  4HXZ A;  4YY3 I;  4LF4 I;  2O1W A;  3P1X A;  1SR9 A;  4LF9 E;  1XNR E;  2JR1 A;  2LE2 A;  2KON A;  2Z5B A;  2UUB E;  5FLX C;  1Z5A A;  4DV4 I;  2V86 A;  4DR7 I;  3J81 C;  1FKA E;  3KWR A;  2V8P A;  2BV3 A;  1Z0V A;  3ADL A;  2IOQ A;  1FJG I;  1YYO A;  4JV5 I;  2LMZ A;  4JI7 E;  2Z5C A;  3ADG A;  4JYA E;  3J7A M;  4JI0 I;  2FTX B;  4KZS A;  4DR3 E;  4KHP I;  4HYM A;  5F3W A;  4LF6 I;  3K1J A;  1B62 A;  2LUQ A;  1GQE A;  5AE3 A;  4B3M I;  2HK3 A;  4DV0 I;  1FI4 A;  4DR2 I;  2E5L I;  4DPU A;  1GZ6 A;  1RRE A;  1ELO A;  3Q6N A;  2L8T A;  4Z7C A;  2DEJ A;  4F54 A;  2VQF I;  4NXM I;  4JI3 I;  1XNQ I;  1XMQ E;  3IWD A;  1HK7 A;  4PU9 A;  4GEQ B;  4JI6 E;  2ZIT A;  4B3T I;  1N36 E;  1J5E I;  1I94 E;  2LJP A;  1NZ0 A;  4DV7 E;  2CPN A;  2WZO A;  1Z0G A;  5FLX Q;  4X66 E;  4ED4 A;  2IOP A;  4M30 A;  2L2K B;  1Z5C A;  3ZZU A;  2B7T A;  2KHX A;  4LFB E;  1HNZ E;  1DQ3 A;  2CG9 A;  5LMN E;  4X64 E;  4ZVI A;  1N0V C;  4DR1 E;  2NUG A;  4JI2 E;  3M6A A;  4X65 E;  2UXC I;  4BBY A;  4LF7 E;  2Q2E B;  1IBK I;  4DV1 E;  3B78 A;  2KOU A;  2V85 A;  1USV A;  3IWC A;  4DV2 E;  3LNU A;  1HNW E;  2EZ6 A;  2V83 A;  4JI8 E;  2ZBK B;  3ZKB A;  2LTS A;  2YZT A;  4NXN E;  2BM0 A;  1Z0C A;  2PNL A;  2HHH I;  1H72 C;  3P06 A;  3ADJ A;  4LF4 E;  2Z5C B;  3VYX A;  5LMN I;  1Z0B A;  4P78 A;  3QT7 A;  3K17 A;  4DV4 E;  3V2U C;  1A6F A;  4DR7 E;  3ZM7 A;  2N3H A;  3OTO I;  4LFA I;  3JAM C;  4BCA A;  1PVG A;  4P7A A;  4F9B B;  2DEI A;  1D6T A;  1FJG E;  3ZKD A;  1PKP A;  4JV5 E;  2L92 A;  2HKE A;  3WU3 A;  4RPF A;  2A2D A;  4JI0 E;  3PYD A;  4KHP E;  1MU5 A;  1OJ4 A;  4LF6 E;  1ZXN A;  3LPS A;  3HQ1 A;  4B3M E;  4DV0 E;  1MX0 A;  2V89 A;  1S16 A;  4DR2 E;  1S4E A;  2E5L E;  2FV4 B;  4JI4 I;  4DR4 I;  4GKK I;  4K0K I;  2UUC I;  2VQF E;  2R42 A;  5LMU I;  5GME A;  1X47 A;  2F4V I;  4BC7 A;  4UT4 A;  2DIX A;  3K6Q A;  4NXM E;  4JI3 E;  1XNQ E;  3ADI A;  2UXD I;  2VF3 A;  1J26 A;  1KIJ A;  1K47 A;  4YHH I;  4DXL A;  4B3T E;  4BS9 A;  1J5E E;  4AQY I;  3WU6 A;  1RQ0 A;  4DUZ I;  2V2V A;  2HFU A;  2IHR 1;  2LRS A;  2MC5 A;  2J7K A;  2L2M A;  1FNM A;  4DPY A;  4XTJ A;  3LML A;  3AUZ A;  3JAM Q;  4Z7Y A;  4GKJ I;  2UU9 I;  2LJH A;  4WUD A;  4LFC I;  3F6H A;  2M1S A;  2MDR A;  4IZK B;  2G7H A;  2L2N A;  4LU9 A;  3J80 C;  2DMY A;  4DV6 I;  2UXC E;  2JY9 A;  1QU6 A;  1IBK E;  2B7V A;  1H7S A;  4P7D A;  3IWB A;  4JG4 A;  3AV0 A;  1FWL A;  4BC9 A;  3J81 Q;  4LF8 I;  4N3O A;  3V5R A;  2O1V A;  1H7U A;  4DV3 I;  2ODR D;  2DSY A;  2L3C A;  1DAR A;  2HHH E;  1H74 A;  1Z0W A;  1KTV A;  4LTY A;  1Z59 A;  3H09 A;  2V87 A;  3B82 A;  2VQE I;  1U2R A;  1UHZ A;  2JOX A;  3F0N A;  2A2C A;  4WFT A;  2V8Q B;  3HJC A;  4B3R I;  1N33 I;  3OTO E;  2ZM6 I;  4LFA E;  3WU4 A;  4DPT A;  5AE2 A;  4L8N A;  1KKH A;  3JTZ A;  4FWG A;  4IZK A;  4BMJ A;  2UUA I;  2WW4 A;  2RTX A;  4X8W A;  1XHK A;  5LL6 R;  4WYQ B;  1O0W A;  3FIG A;  4WPY A;  3T1Y I;  2LTR A;  4M0V A;  3HTX A;  3F6G A;  4R8O A;  1EI1 A;  3GON A;  5BR8 I;  4JI4 E;  4DR4 E;  1ZM3 A;  2YT4 A;  4K0K E;  4GKK E;  2UUC E;  3PYG A;  5IWA I;  1HNX I;  2V34 A;  5LMU E;  1WHN A;  1N34 I;  2F4V E;  2E1M A;  4FW9 A;  1XMO I;  4JI5 I;  3DJW A;  4DPW A;  2UXD E;  2K4V A;  1IBM I;  4PRV A;  3T1H I;  5ADZ A;  2L33 A;  1YYW A;  1ZXM A;  2R3V A;  4YHH E;  3J7A G;  4R03 A;  1UIL A;  5IT9 C;  4DR6 I;  4AQY E;  1NHJ A;  4FWD A;  4DUZ E;  3HPZ A;  3ZZ0 A;  2RS7 A;  1Z0E A;  2XEX A;  4JI1 I;  4IZJ A;  1EKZ A;  1FWK A;  4X62 I;  3K85 A;  4EMD A;  4DUY I;  1VIS A;  2RS6 A;  1Z0T A;  4M1K A;  4GKJ E;  2FGG A;  2UU9 E;  4WUC A;  4I3H A;  1IBL I;  4LFC E;  1EA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...