4YY3J

30s ribosomal subunit- higb complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4yy3J00
4NXMJ 4DR7J 5A2QU 2UUAJ 4DR2J 2E5LJ 1HNZJ 4DR5J 4JI0J 5IT9U 1N32J 4GKKJ 4LF5J 3D3BJ 4LFAJ 3R2DJ 4NEYA 1N36J 1XMOJ 5BR8J 4DV4J 2MQ8A 4LF9J 1J5EJ 4JI5J 4HHUA 2VQFJ 2HHHJ 2KVQE 4JV5J 1N33J 4LF6J 4X66J 2UU9J 4JI6J 3R2CJ 4JI3J 5AJ3J 4LFBJ 4DUYJ 5LMUJ 2VQEJ 4RJVA 5LM7E 1XMQJ 4NXNJ 4KHPJ 1XNQJ 2UXBJ 4X64J 1N34J 4K0KJ 4DUZJ 4V1Ak 4PWWA 2ZM6J 4LF7J 3T1YJ 4NEZA 5LMNJ 4GKJJ 1FJGJ 4YY3J 4JI2J 2UUBJ 2UXDJ 2F4VJ 2UXCJ 3JAMU 4DV1J 1IBKJ 1I94J 1IBMJ 4B3TJ 4AQYJ 4DV2J 4DV6J 2MTLA 4DR4J 3T1HJ 3J81U 4X62J 4JI1J 3OTOJ 4OX9J 4JYAJ 4DR6J 1HR0J 4DV7J 2KL8A 4LFCJ 3J7AN 4B3RJ 1HNXJ 4LF8J 4B3MJ 4JI8J 3J80U 4KY3A 4KYZA 5IWAJ 3D3CJ 2MEWA 5FLXU 3W1YC 4B3SJ 2UUCJ 4DV5J 4YHHJ 1IBLJ 4DV3J 4DR3J 4X65J 4JI4J 1XNRJ 4LF4J 1HNWJ 3IMQJ 4JI7J 4DV0J 4DR1J
chains in the Genus database with same CATH superfamily
5AXLA 2G0IA 5EGYA 3OHAA 4AQYF 2UUBF 1URRA 2MLYA 2HHSA 3H4DA 4ES1A 1HW9A 4I64A 4USTA 2XO7A 2IVMA 2WHOA 2MMYA 3NOGA 1JB0C 1QD1A 1YRXA 4R0EA 1XWLA 1VC5A 4WE1B 3R2CJ 2IAJB 2N82B 2IBKA 4NEYA 1N36J 2DGVA 2YX1A 3FGVA 4RW9B 1L3KA 4ZVPB 4JI5J 2CQBA 4HHUA 2V94A 3IAS9 5LMNF 2I9SA 3LF0A 1T03A 4ED1A 1H98A 2GHWA 2X1FA 2VU5A 3LP2B 3J7Z5 3SCJE 1TL3A 2DXDA 1UKUA 3VAKA 1ZPVA 1UMJA 3DM2A 3GYNA 2AEJA 3GLJA 3HVWA 1OY8A 5KG4A 5J1PA 1YJTA 1IWAA 2RS8A 5E5NA 4WIIA 6AT1B 5LMUJ 5KFAA 2M7SA 1RQ0A 5J2QA 5DQGA 3NY0A 4IRCA 2IIHA 2Z0GA 4JI1F 4DQPA 1LOUA 2MJNA 1HHQA 3BZQA 4O4RA 3MR5A 1XN9A 3FVYA 3TA0A 2B9WA 3NCQA 4GVBB 5KFRA 2HSEB 3W66A 3VAGA 4AL5A 4EBEA 1HWLA 1UZHA 3FZ2A 3P45B 3R6GB 3LTOA 2MQNA 4Q8FA 4LF7J 2NZ4A 4ECWA 1XIQA 4MFBA 5K8PA 2BE2A 5KFCA 2HHHF 3QATA 3DRSB 4L73A 4K4XA 1M5OC 1EAYC 3MOZA 2UVVA 2OO4A 2M70A 3IC1A 3PO4A 2KYXA 1ZOTA 2QYCA 2W2QP 5CYMB 1SL1A 3WIVA 5DDPC 4OJ1A 1NZAA 2BV3A 1R89A 1HBNB 1WACA 2QSFA 1Q1KA 7AT1B 3ILLA 1EP4A 5CHCB 5D0HA 5E3QA 2XC9A 2B9XA 4ECVA 1S72S 4LF6F 4C8ZA 5AXNA 1S76D 4YY3F 2HHTA 5KG0A 1GX6A 2LMIA 3CJKB 1GXTA 2HQFA 4DR4J 4ZK7M 1T9TA 3CC2S 4FP9A 2AGPA 2PN6A 2DHGA 4WYLA 3TX0A 1VHFA 1JK9B 3M2VA 4YHHF 4M8LA 3OTCA 4LSNA 1RT5B 3CD6S 3KK1B 1UEKA 1UW4A 1QAXA 3ZZZA 4YUDA 2QA4G 1FDDA 3B4MA 3F44A 4JV2A 2GIFA 4F3MA 3BSCA 5GAEU 1RA6A 2KRBA 1VRUA 4OYAA 2DNYA 1N8RT 1N88A 2NXJA 3I55S 3KK3B 3CUNA 4DFJA 2XNRA 4NYOA 1DTTB 2G0CA 3ENQA 1TL1A 3J7YU 3EZOA 4PXCA 1IJEB 1DURA 1TMMA 3IS9A 2ZOFA 4I6YA 3S1TA 2ROPA 2QA2A 2ERRA 4O3NA 1WEXA 2EC2A 1BQNB 4DXLA 4U8YA 3H90A 2DNKA 4AXJA 1X60A 5FLXU 2UUAF 4CLTA 1VQ7S 1DTQA 3W1YC 4ZOSA 4CH0S 1DHMA 2DO0A 1MWYA 1XMBA 1VIOA 4ES3A 1SC6A 1Q0NA 5LMUF 2UUCJ 4X4NA 2V5HG 3GWCA 2ROEA 2QLFB 4ZMMA 4I6AA 3CO9A 2C2EA 1M90T 2R8IA 1S1WB 1VJQA 1S1UA 3MGJA 3I5BA 2DNNA 3VAFA 2ASYA 1H2TZ 1U24A 2HRUA 4ZVOB 1NK9A 4ZIWA 4LF7F 1JJ4A 1U25A 1PSDA 1EP4B 2J5AA 3HT0A 3NWRA 4UF4A 3U27A 3SQOP 2C3MA 4NLDA 3HZGA 1F5CA 3GCWP 6FD1A 3UE2A 4C8MA 1OSCA 5KT3A 5KFUA 4YB7A 4O0NA 3JQKA 4DZDA 1HYSA 3TVZA 2G2ZA 4OYWA 4DSFA 2J8SA 2VJUA 2GGPA 3IM8A 2Z8QA 3M32A 5DGAA 2M8HA 4WP3A 4DCPB 3DLLQ 2BJ8A 1QY7A 4I2QB 4EYIB 4JI0J 2MPUA 2ZH3A 4DQSA 3ZZ0A 4J9RA 3VVTA 5BYQA 4J37A 1NPPA 4LF9J 4PYAA 3DOMA 4ZP8A 3WX8A 4F0KA 7FDRA 5KFOA 3US5A 2EFOA 2H5IB 1FXRA 2BE9B 1EKRA 2E1RA 4LSNB 2HIQA 3UN3A 4J9LA 3PEHA 3KNAA 1Q82T 2C2MB 3BKFA 5DO2A 4Y3CA 2Y8YA 2BM0A 3KLHA 4OYPA 1AZSB 1MU2A 1PBUA 5SZTA 4A8MP 5L1JA 1OSDA 2ZH5A 5LSOA 3O3LA 2VZ9A 5J2MA 3DNCA 4F8RA 3GCXP 1FX2A 3BR8A 5HATA 1KKHA 4PXDA 3PJWA 1VBZA 2HNZB 1U6FA 2DRDA 1EIYB 4B3OB 3MR2A 1NDCA 2MLXA 1RU1A 3I0SB 4AFFA 3Q8VA 3MD1A 1RWUA 1X4HA 4NX9A 2XULA 5HP1A 2FJWA 3PW5A 4KGVB 2B4PA 4ZPBA 3W2WA 3KLFB 3W9JA 2O66A 2JDJA 2AYMA 2RE1A 2RF2B 4GO7X 4WWSA 4YY3J 4L75A 3DOLA 2IRXA 2YPZA 2L48A 1RWWB 3B78A 4H4OA 3QLHB 2DIUA 4P10A 2CQIA 3CCTA 4ZVEA 2VG7B 2KU7A 1VBXA 4A48A 2KHDA 1RT7B 4W90B 4J9OA 1NDPA 1U02A 1WSVA 2ZE2B 4TU8A 1RT2B 2B5JA 4YR2A 5K14A 1NJZA 1HQUB 2FD2A 4YS2A 2DCUB 3A13A 3KG4A 1T9UA 1JLFA 1VQSA 1SJQA 4DV3F 2PGCA 3C14A 3DU6A 2FVCA 4IH5A 4K8RA 5C25B 4DV7J 1S0VA 1AUSL 2M88A 4ILLA 3J7AN 4DHVA 5HAOA 2C2RA 4MIBA 2JVRA 3TJAA 4WFNQ 1M5SA 5DGBA 2G13A 2VPYB 3A12A 4N5SA 1U6BA 3U1NA 4V19J 3SI8A 2EC0A 1SBRA 3ULHA 2XMUA 4U7UK 4Q7AA 5A6PA 4ZLNA 4ECQA 4ILMA 2CJAA 3HMJG 4CP5A 4LR8A 5ETNA 4RNMA 1VFJA 2EVZA 1AZSA 2FHOB 2ILZA 2RT3A 2YKNA 4JI8F 1NKBA 4IRDA 2R2RA 1FA0A 2OEJA 4JB8B 4YB6A 3IRXA 3ENVA 3SDEB 2BDPA 3NG8A 1RHJB 2C3OA 2YNFB 1VRQC 4OLPA 1A0OB 1VLYA 1S49A 1PCAA 3MCSA 4ZJLA 2HRTA 2WB4A 2Y1RI 5H9EK 4NXMF 1VS3A 4NLSA 5DLGA 4WU3A 1M1GA 1XR7A 5D8HB 4B9UA 2F63A 4KO0A 3EX7B 3HK2A 5E3CA 4C0HA 3BQ0A 1YK9A 4ALZA 1CC7A 3AFGA 2DH9A 1C0UB 2CPFA 5CA5A 5DDRC 1S1TB 1V5VA 3W5YA 1HI1A 2ZKUA 2ZVIA 3UNGC 3IR7B 4MKVA 4CYUA 4DL0C 2ATCB 4F25A 3MM8A 3IMQJ 4M5MA 4EU0A 2YNHB 4TU9A 1NSAA 2CUYA 1UTAA 3K8WA 2L9DA 5L1IA 4YQWA 1BWVA 2QIFA 2F9DA 3MD3A 4NLRA 5KTQA 2EKYA 3OTEA 1NDLA 2XYPB 1FESA 1HQUA 4MIWA 4P73A 3KLIA 3DRSA 2EG1A 3O6QA 1C1CA 1S6QA 1PBAA 4QIVA 5AE1A 2ZITA 1ELOA 2H5EA 3KJFB 3HXMA 3D3BJ 3DGPB 3ENWA 4C98A 1TTHB 1U1LA 2OJ3A 1SKUB 5D3GA 4KFBB 1ZH5A 2FUG9 3CGIA 1HNVB 4OI3A 1FERA 4ZIVA 2Y3YA 4TQSA 2J0QD 3HSDA 2FVPA 1QE1A 4PUOB 3Q23A 3H25A 1IR2A 1WI8A 4PG7A 1MW7A 2VV5A 4DS4A 2HHHJ 2JSXA 2IHR1 3QIPB 4C8NA 3BR9A 3Q89A 5L38A 4LREA 3EPGA 5KT6A 4HDHA 5ETTA 2F7VA 4LFBJ 1KOHA 4F67A 2VFUA 5LT5A 1BUXA 1U48A 5FJ4A 3Q2SC 3L9ZA 5MAOA 3QRRA 5LXYA 3CW2C 3OFHA 3OL6A 2ASLA 1CBKA 1ZM4A 2IYIA 4WXWA 5DG7A 2OEKA 2CADA 2LVWA 3PVXA 1RT1A 2H3EB 4LSLB 5U47A 2IA0A 2JEJA 3K5LA 3V81B 3B54A 2HFNA 2IA6A 5KFVA 4GVLA 5C2GA 3MR3A 2QMUB 3VF0B 2B8PA 3CJ5A 1F9EB 1TL5A 1L3SA 2IBOA 1IJFB 1MN7A 4LFAF 3DOKA 3LH2S 2XNQA 2Y0SD 2I1RA 3HSJA 2W25A 1TMJA 2IC3B 4IFVA 4S0MA 2MZ1A 1N0UA 4PG8A 1UVLA 3LP1A 1N52B 4JI2J 2IM2A 4ID5A 1HBMA 2U2FA 4F04B 4KFBA 2GQCA 4DV1J 2LXIA 2E7WA 3AH6A 1URNA 1T02A 5KFFA 3OFGA 4K4ZA 2OSQA 5F8MA 2IRUA 4DPYA 3D5MA 4C7QA 4IR9A 1AW0A 2MTLA 4PXBA 4PAAA 3PNIA 1DFDA 2V4JB 1GMWA 2A0FB 2C2OB 1IR1A 4LRAA 3R7SB 1JJHA 4OX9F 2N7CA 3X1LB 1TKXB 1EB0A 2C1EB 4RW7B 5B0BA 4C2MA 4DN9A 3LWLA 2HZAA 4C3KA 4CYUB 2RU3A 2WK4A 2EFVA 2ZD1B 3LAMA 4EZ6A 2J9EA 2HFZA 5HMYA 3CCSS 3BO3A 3T5HA 2KM8C 1TK0A 2DT9A 1UWAA 2VASA 4KV8A 4QYZJ 2CPHA 4DV0F 4DWIA 2PA3A 2XTJP 3GILA 2KI2A 3DM2B 4MJKA 3OFEA 1HA1A 1JLEA 3J81j 3OTOF 2K1RA 2Q6BA 5J2PA 5B0CA 2CNNB 5F8NA 1FE0A 1TP7A 2E1PA 2IYGA 3LP2A 1H7XA 3NWGA 2FQQB 3PRDA 4MYUA 5IWAJ 3QGPA 3QO9B 3SQGA 1PYTA 1Q81T 1QSSA 2KXNB 2IM0A 3FSYA 3HSGA 1KFSA 3MFHA 4OLOA 2YPYA 5DQIA 3RR7A 4TYBA 3O2IA 2QL9B 2E5JA 4P6QA 1WI6A 2OPSB 4ZKAA 5B08A 2DR5A 3THPA 4DUYF 4KGXB 4B3SJ 3HFZB 1DBDA 3MR7A 5KT5A 4NYZA 3MMBA 3OTBA 4DR3J 5HROB 4O3PA 5CH7B 5HVGA 3NGRA 4RW4B 1LW0B 4I0WA 1Y9OA 5M2UA 1GMVA 3VCDA 1ZYQA 1EX8A 3QT7A 1XNRJ 5HL7Q 3K7RA 4MYTA 4TKTA 2DR7A 1LK5A 3VGVA 1C0TB 4LF4J 2RH3A 4LR7A 3TUZC 4QQBA 3TX8A 1QUVA 3T1HJ 2HVIA 4IFVB 4LF5F 1WDDA 1EETB 2JC1A 1JLFB 1YVFA 4G1IA 2CPEA 1C4AA 8ATCB 2J0XA 3EVOA 3IGVA 1SL0A 1UVKA 1VMBA 3FQLA 1RTIB 2VQEF 2P6TA 4NZ0A 1WC0A 1GX5A 4RBUA 4OI0A 2RDIA 5JXSA 3L7PA 4PABA 5GADU 3FBFA 5CZXA 3BGRB 3BKTA 3PHTA 4NL5A 2JH3A 5T7LA 2CIMA 2MQ8A 5JMNA 4DL4A 1TFYA 4MK8A 3QLHA 4Z2XA 4OYBA 1XEZA 1T8EA 3DRRA 4HL9A 3PG9A 3OXGA 2CVIA 1KDNA 3FEYB 1CG2A 2FJEB 1RT3B 3AXMA 4CIOA 3GIKA 3MMBB 4C8YA 5HROA 1RTZA 3M8QA 2DEJA 2CNKB 1HW8A 2DR9A 1HFEL 1Y10A 4JI6J 2DRAA 1CSJA 3HLUA 2PEBA 5F8LA 3UVJB 2Y1IA 1U26A 1NHUA 4USMA 3OBIA 2ADCA 4W92B 4U7CA 2IVFB 1UFLA 1D09B 2VFRA 2CQ0A 3RW6A 4URQU 5B0EA 4ZJQA 3IR5B 4DOZA 5D6GA 2QC3A 1VLOA 4URSA 3O5TB 1K9MT 2PFFB 1FTRA 2KJWA 3DLEB 3P5TL 4QIEA 1HKAA 3EXYA 3TQEA 1JXVA 3TZWA 3IN5A 1BWEA 3N0VA 4J9VA 2QSWA 5CAAA 4E2FB 3TI0A 4FYDA 4MKAA 3CDWA 5KG7A 2R8HA 4F02A 1GH8A 2B43A 3A1YG 3RB4A 5HLFB 1ITPA 3T9ZA 5JVHQ 1N5TA 4IO9Q 2IM3A 3TOQA 2XLIA 2UUBJ 4PZVA 5D0RA 3ISNC 3RGIA 3B82A 1MROA 4RWWA 1U2FA 1VJWA 2QGFB 2XSJA 3CSKA 4K59A 2R8GA 3MEGA 4R8UB 3CD0A 3CWJA 1RLCL 5DM6Q 3CMES 2LU2A 2IAJA 2IPOB 3M2UA 5KT2A 4ELUA 2ZDPA 1DZ5A 2UVRA 1XNRF 2QA4S 3THTA 3SEOA 3MMJA 4MK7A 2GGPB 2PMHA 4GRSA 3ITHA 4EMDA 1VQKS 2QRRA 4RNHA 1DLOB 1YJVA 1TV6B 2KL8A 4U95A 3CCJS 4C8LA 3UN5A 3KWMA 3AD8C 3M8ZA 4OHYA 2A3JA 3WIUA 1OYDA 5HLFA 2FGCA 5CQGA 2MZJA 2RQMA 3ZTQA 3BJYA 4OYZA 2HVEA 5KOXA 1NKCA 4PR6A 1S1XA 3M05A 3TZYA 4DLGA 4DFKA 4H4KA 3DGVA 3BN4A 4KQZA 1S0MA 1VQ8S 5JVGQ 1I1GA 2M4MA 1JMTA 2NUHA 1HYSB 1LWCA 1UJ5A 2D3UA 2G1HA 2W4CA 3IBCB 4ZPAA 4QWEA 3CCQS 4OHZA 1U47A 1RT1B 4LSLA 5K20B 2GC8A 4KSEB 4P72A 4RW9A 5A0YA 4A8OA 4BC7A 1S0NA 4YB5A 3IG1A 1X5SA 4ZP6A 4C3MA 2CQHA 1MMNA 4XPEA 2MB0B 4WK3A 1JJCB 4DR5F 3NGUA 2F4VF 4LQ9A 3TP2A 1H73A 2MQMA 2E7XA 1TK8A 3LPYA 1IBLJ 2DPJA 2AYGA 2I0XA 3QIPA 3HD2A 4FYYB 2JEFA 2C3UA 4A8KA 1VIXA 3JS9A 1U2CA 3FMWA 1JLQB 1YRTA 5DDQC 3BGFA 2KFZA 3KLGB 2DB1A 4DV2F 3GYGA 3H2LA 2J9CA 4H4OB 3VGUA 2FIUA 1VR6A 2JRSA 3GSIA 1RLDA 1VQMS 1T3NA 2V8PA 1OO0B 5F3TA 3KLVA 4K4VA 1NK8A 1SVDA 3AAWB 3KK2A 2RUGA 5HJXA 3QT5A 1K8AT 4DR7J 4FKXA 1B7FA 4WZQA 4X4VA 3GU0A 5DG9A 4UQTA 5HP1B 1QUPA 1R27B 2DY1A 4CTAA 3KG0A 4ZDNA 4AD6A 2BUNA 3PY8A 2V9WA 2COLA 1RABB 3PDNA 1Q53A 4PXEA 4MTPA 2G2YA 2R42A 3R2DJ 1TKZB 3KKFA 3RRKA 1C4CA 4DSJA 2EBGA 2I5JA 3ISZA 4RUHA 5K9FA 3GR1A 5F9LA 3JSMB 3KOAA 1LW0A 4JV1A 3OR1A 1ZA1B 5HBMB 1T9VA 4QOTA 3HT3A 1S1TA 2YY3A 4ZHRA 3Q8SB 3CCUS 2BOAA 3HFKA 1IBKF 3TUPA 4N41A 1VYAA 5D0GA 2IMOA 1LW2B 1VISA 4X84A 5AJ3J 1WC5A 4RX6A 2QO3A 3H59A 5B7WA 3OJUA 3D6FB 1RAEB 3C16B 5LM7E 1K1SA 1OQ3A 5HI7A 5HQLA 4RUBA 3QGHA 3IRXB 3NMAA 1Q7LB 2HQDA 5B09A 1M1KT 4JOUA 3C15A 4PG5A 5IT0A 5C2CA 2HVZA 1M1HA 2IJNA 1N0VC 3G82A 2HHPA 5D4LA 1U49A 2DR6A 4TU7A 2AX1A 4M5KA 3MM6A 2NQPA 1MNEA 2L3MA 1WHWA 2DH7A 2W2MP 1UFKA 4FNHA 5BXIA 2GQQA 4JV0A 1WELA 1I94F 3D66A 2OI2A 4QWBA 4O4GB 1VRUB 5I3UB 3LANA 3EUNA 2WSCC 2YVSA 4XDDA 1S7HA 3MWBA 3KJVB 1B0VA 1UVNA 3AODA 3L95X 4ZCIA 3S01A 2HBRB 1RTIA 5KFJA 1UETA 2F3JA 5GAHU 4OX7A 2HS4A 1NKEA 1N4LA 4J9UE 3J81U 3E51A 4IOAQ 1NM2A 3DFEA 3H7HB 3C3LA 1U09A 3TANA 2DGXA 2W7OA 5GAGI 1TKTB 1E6VB 1YQHA 1UWBA 2Y1LB 3I82A 2W24A 1GMUA 3JSYA 1BHNA 3RBEA 4U8VA 4L3KA 2F40A 2ZH7A 3LOUA 5KFMA 2R8KA 2QN6B 3ADAC 3KJNB 2W7AA 2I2YA 2YBVA 3DOLB 4NMLA 1TR0A 3FUYA 3OTDA 4WPAA 7FD1A 1UAWA 3H20A 5K8NA 2Y8WA 1D3WA 3PJ9A 3W60A 3BQ2A 3RAXA 4DEZA 2DHAA 2FJBB 1FFGB 2WVFA 2Z2MA 3DCAA 3MEGB 4R8UA 3SMZA 2MKIA 4CM0A 3SCLE 2EEYA 1AB8A 4KY3A 5IS2A 2O1PA 4CLZA 3S8SA 4YP3A 3OV7A 4EBCA 2QLWA 2HRYA 2BYCA 3DHXA 3I6PA 3OUYB 2HNZA 2JLFA 4ZITA 5KFPA 5I42A 3G8TA 2DHSA 4OZ2A 3BH6B 3BO2A 2AP6A 4ZVUB 1GAOA 1AT1B 3DLKA 2BW7A 5LJ3Y 1V9OA 3HHDA 2VJVA 1RBLA 1LEOA 2FLNA 1QVFR 1UCNA 5C24A 2YNIB 1L3VA 5C5JA 4D3HA 4JI4J 2W4PA 4IYQA 4Y34A 3FSXA 4U67Q 4E0DA 3KFWX 1TZ0A 5IWAF 2FC9A 1IKVB 2H4WB 3CTRA 1QM9A 3BEGB 2HBZB 3J80Y 4KHPF 3DDKA 3PYEA 4KB7A 3BSAA 1FXLA 5H9FK 2AGOA 2GMJA 2H65B 1NJWA 5J2NA 2BJDA 3G4SS 1VQYA 1K1QA 2BXJA 4K4UA 2VKRA 1ZA2B 1H74A 4MFBB 3R5JB 1NK6A 4QIGA 3PM9A 1LQ9A 4JI5F 2HS0A 4DR5J 3TAPA 1U6ZA 2HQIA 2ZHBA 3EVWA 1U1NA 3W64A 2CFXA 4QU6A 4HTIA 3QBCA 5BR8F 1EQ0A 2W8LA 2VF3A 2IM1A 2YXLA 2Z57B 4NA2A 2ZJRQ 1J5EF 3NCRA 3M9OB 1FEEA 2CQ4A 2POKA 4GKJF 2DR8A 3C66A 3NP5A 2GO9A 3V5RA 2L9WA 1IBMF 3ILOA 4DV1F 4B3TF 2XWXA 2CJBA 4PQAA 3UQSA 4AE5A 4OYXA 2CQ3A 1U1OA 1YDLA 3HCXA 2VFSA 2OMLA 1UP1A 1Z4UA 2CG8A 3D28A 5DLFA 1D9FA 3OXLA 1WHYA 2CQ2A 4B08A 3N6MA 5A76A 4NXNJ 3WC2A 3PX4A 3P49B 3RRGA 1YJ9S 2HQCA 2K3KA 1IBCB 2X51A 5E41A 5KT4A 2BA9A 3L4BC 4CCHA 4BWMA 3W5ZA 2B56A 2JLEA 3NBPB 4DR6F 3PACA 2PD1A 3SCIE 4CLPA 4EFAC 1RA7A 3NNHA 1KTQA 1S97A 1RWVB 1NU4A 3HKWA 4I2PB 2JVOA 4JI0F 5LMNJ 1DQAA 1OMSA 3IG1B 1I3OB 2MHNA 3M7VA 2XCAA 2XY7A 5F9NA 2M8DB 2D3O1 1OWXA 1QAIA 3MEDA 1NH7A 2V68A 3MXHP 5T7LB 2NS1B 1KD1T 1U0HA 3KHGA 1WF2A 2ZVSA 1LWEB 2ACYA 2P8IA 2MQPA 3JAMU 3OHBA 2BMBA 4QBUA 3MAQA 1U45A 2HGLA 2RQKA 3D54A 2Q3PA 3W5XA 2DK2A 4JI7F 4IG3B 2I38A 3FRZA 1CJKB 2YWGA 1IBMJ 4B3TJ 1T0TV 1VRTA 4AQYJ 1FX4A 2C22A 3DDNA 3AA9A 4HEA9 3CJ2A 5G0RB 3CCZA 3O44A 4X62J 4HH0A 2JC0A 2R7RA 2ZC3A 4ZN1A 3V6DA 1FJ7A 1S6UA 2K3IA 3PRBA 3QT6A 4KGZB 4WYWA 4GKKF 1U2RA 3M6WA 3ICLA 4KT0C 1SJ3P 2PI5A 2HYIB 3TVYA 2HHXA 1SL2A 1NJXA 3N01A 4GMKA 5LSLA 1YBTA 2OKQA 2C2DA 2RVJA 2ZHAA 1H2VZ 2QJ3A 5A2QY 3D1QA 4FDFA 3UDVA 2BJ3A 1HHTP 3Q86A 5E3RA 3GR0A 3LPEA 2ATLA 4ZLLA 3MECB 1X0PA 4DZ6A 1IKVA 2H9ZA 3RB3A 1S10A 1T9WA 3OFFA 3TWZA 1RHQB 1Q16B 1S48A 4FF3A 3NGKA 4ID5B 1NNDA 1D0EA 3VAIA 4K4SA 2KFNA 2LA4A 1FRHA 3HPOA 2IVYA 4B3MF 3FBCA 3QZ8A 2MHEA 2NCKL 1ZZNA 5HMZA 3M6XA 5A8RB 1CS4B 1YKWA 3GG0A 4IQMA 3DLEA 1I6JA 1TL3B 4YHHJ 3BYRA 1X5TA 2B51A 1HWIA 2YWEA 4H4KC 2KT2A 4ZPCA 4DPUA 1NHKL 4EUVA 3GP9A 1NSQA 3V81A 1SH3A 3K8VA 4CLUA 4KKOA 5LJ5Y 3AD7C 2KJVA 4USJC 1YJNS 1T03B 2AJ1A 3UDEA 3HZEA 3MECA 1RWNB 4MIAA 3TA1A 3CJ4A 1BGXT 2CZVC 2V8GA 1PC4A 3CD7A 3DMJA 4OHXA 3VVUA 1B3TA 4IRKA 3I56S 2XCPA 2BKNA 3E01A 3O8WA 2ZEJA 2HLUA 1RBOB 4OI6A 2BRKA 2WSEC 5A2QU 2D41A 4USVA 4DR2F 1RAGB 2WB1D 1Y4ZB 4L3NA 1FNOA 2A1BA 1UWBB 2DPIA 2WONA 1N32F 2GIRA 4FF2A 3MDFA 1ZM2A 2RHQB 1XMOJ 2F5GA 2HFUA 1F6TA 3I96A 5DRKA 5G0RA 4JI2F 3UCGA 4CO3A 1RAIB 2AKWB 2W1BA 5EWGA 3OVBA 1R8CA 2RQ4A 4M5DB 4O3OA 2V4QA 1U1MA 4OZ5A 2QLXA 3D6TB 1HMVA 2QYGA 1IKYA 4TY8B 2HIYA 3FFIA 1SB6A 2GVDA 4PQUB 2RNEA 1NXIA 4HLBA 1XTZA 1UFWA 2XGPA 3OVAA 1N54B 1RI7A 4O3RA 3MM5B 4NCGB 2V63A 2PMWA 1Y5IB 1PJ7A 3H2VE 2FHMA 4CLKA 1PKUA 1MMDA 1NSKL 3PIOQ 2ZH1A 4XTTA 4RNOA 4DS5A 4NLTA 2UXBJ 1YG0A 4HVZA 2R2SA 2BANB 1H7WA 1BMQB 3GONA 3MCNA 3VGTA 3DXBA 1CS4A 3BB5A 4J9KA 3UFCX 2CZ9A 4PWWA 2ZM6J 3C6UA 4ECYA 1X4GA 2NREA 3BDEA 4FBUA 1J5OB 4GKJJ 4B9LA 3BQ1A 3JSRA 1AA1B 1HWJA 4HR2A 4Q2LA 2PEHA 3CB4A 3FJ2A 1XMOF 3I0RB 2YWKA 1FJCA 1SJRA 4DX7A 2BABA 4UTGA 2EFNA 1C1CB 2PT0A 4QIFA 2Q1LA 1U8SA 3SYZA 1U1QA 2LQ9A 4P7TA 4HTJA 4RO0A 1S59A 4Q44A 1CEZA 3QPIA 1O0PA 2JHEA 1RTHA 5E33A 1GNKA 2DIVA 2YWWA 3UWTA 2GAGC 4C0OC 3TEGA 1KVIA 4YR3A 4JYAF 3POTB 1G6BA 4JYAJ 1RT6A 3N28A 2KXFA 1LKZA 4HI2A 4J91A 2BJEA 4NOHA 2CZ4A 4LFCJ 2N4DA 2QT7A 1HHSA 4CTAB 1OY9A 3H4BA 1T7PA 2MDAA 1TELA 3PKMA 4UOGA 2GW8A 2CJXB 2RSQA 2UXDF 3T9NA 4OMFG 2YH1A 1NK4A 3RAQA 3VR1A 2QFJA 3M9NB 3KK2B 3MOJB 1N33F 2ZH8A 2AGQA 4B3MJ 2ZJQQ 2DXFA 3J80U 3MEDB 4KHMA 4KYZA 3K5PA 5KG2A 5ETKA 4LT6A 4ED3A 1FRKA 3UD4P 4RZRA 2K7JA 5IV3A 4PRFA 2KVIA 4K4WA 2XEXA 2X1AA 2GMHA 1JXEA 2G2OA 2J6SA 1ZAXA 1XERA 2MSSA 3A3OB 1OQ6A 1RGVA 3OR2B 5KFTA 2AJQA 3EDRB 3RBXA 5GMKa 2P9CA 4PG4A 4QYRA 2UZAA 2XMAA 3M8PB 1FWKA 4P2MA 3T3FA 2V8DA 2W7PA 3KUHA 4WXOA 1X9MA 4OL8A 1HLWA 4M1KA 5ETVA 3RZAA 4BLGA 2HNYA 1B0PA 5CZVA 5C25A 3GYXB 2QE5A 2RS2A 3T19A 4DF4A 2ZOGA 4ZVHA 3ZZTA 2HFSA 1HNWJ 1JLEB 3GJTB 2RILA 1O8BA 2PI4A 2Y9HA 3W8PA 3L7UA 4F3OA 2APOA 1XNQJ 4USUA 2KG1A 3KJQB 1KS2A 1Q79A 2RKIA 1I5OB 3K5OA 4UW2A 2MZSA 2D3OR 1AFIA 3RRHA 2GV1A 3IP0A 3MPYA 4JI3F 1AYEA 1OYEA 1TKTA 1WG5A 1SPBP 3JTPA 1GMWD 5K14B 4ZJOA 3W2VA 4OYIA 4OI1A 1N5SA 3ZFVA 1TV6A 2ZOMA 4LF2A 1WWHA 4DV4F 4DV4J 4RW7A 5HMWA 4RBVA 2FLOA 1Q5VA 4PUOA 5HQ8A 3JQJA 2DHHA 2ADBA 1RTDA 4ANEA 3NAIA 1TUVA 4P2FA 1FRXA 1T9XA 1F3VA 2PO4A 1KNZA 1NO8A 2W9BA 2HNDA 3M2UB 1X4CA 3Q8RB 2W9AA 5I3UA 4M5IA 4LF6J 2AWZA 3ILJA 1KLMA 4K2JA 3DRXA 4O44B 1IKXA 3S7RA 2E1CA 2KO1A 1FFWB 2Z2LA 3V6DB 4RJVA 2AJ0A 2Z56B 2C2NA 1T05B 5IOLA 3QSYB 2JL9A 4M5GA 2ALZA 2DJWA 2JOQA 4WFZA 5KFGA 2YX7A 3A4TA 3MURP 2XS5A 1S1WA 2GA7A 1FE4A 4P52A 3DLKB 3I32A 2Q79A 4LIWA 2IFXA 3U1MA 4V1Ak 1ZZFA 3DLHA 4N77A 3N5FA 4LBHA 1Y7PA 5I42B 3RR8A 4DX8H 3KHHA 3DRPB 4USWA 4WP9A 1LK7A 1BY9A 4U6PA 3BO4A 2DNPA 3KNGA 4A8SA 4QW9A 4HKQA 2ZWOA 4EI2A 2F8MA 3GIMA 2E9ZA 3GE9A 4ENOA 1KBRA 5IZHA 4CO0A 1WG4A 2P2CB 4WZMA 5DETA 2OEMA 1PAUB 4KAIA 1UVIA 1TL1B 2VL1A 4ZHRB 2O67A 1X31C 3V2UC 1TL7B 4WFXA 4YN3B 4RW6B 2E44A 2ZBQA 1FDAA 1K47A 1NEEA 1XK8A 2BRLA 4USIA 3JTNA 3UDLA 5CCLA 3B6BA 2I5JB 2MQLA 3ELHA 4X4QA 3KHLA 4ECXA 2F8EX 3MM9B 3ILIA 4W4MA 3H8YA 2V2ZA 1ZM9A 4RPFA 2OLWA 3R3TA 3CMAS 2FLPA 2AYEA 1NUEA 3K58A 3AB4B 3M2RA 3GPAA 2KTQA 3EPIA 2VG5A 1NPKA 3TAMB 4DMZA 2F1FA 2LQJA 2VPZB 4G65A 3EVMA 2HURA 3CO0P 3KMQA 4KJIA 1ACMB 4X2BA 1EETA 2FGOA 3EDQB 4GC6A 1X4AA 1S6PA 3F56A 4RNFA 4CT8A 3EWGA 4P9SA 2XQCA 1UJ4A 4B3RJ 2XBPA 1YJWS 3UCUP 1N5YA 3PJXA 4IQXA 4ICLA 4C48A 2RAQA 5EX0A 3LO3A 1F9HA 1WEYA 4NLWA 4Y2MA 1PGZA 1PAEX 2VD3A 3TZXA 2MJUA 2CG4A 3SV4A 3QQCD 2BE7D 1R6VA 2ZWPA 3UDCA 3DN9A 3LWMA 3Q83A 2UVUA 1HI0P 1PYSB 4DR3F 1XNQF 2D9OA 2CQ1A 2QMWA 1KFDA 2X1BA 2XHWA 3GV5B 1FO1A 1QTNB 2BJ9A 1HBUA 2MZRA 3C46A 4WKRA 4LIRA 5BYRA 2OD6A 3FCHA 4TXSA 3TUIC 3NGDA 3OJSA 2XZTB 4OX6A 1HR0F 1HNWF 2DXEA 2GVZB 2JEGA 2JNJA 3T1AA 3AOCA 1REGX 4FF4A 2Q66A 4B3OA 1OY6A 4IH7A 4LQ3A 2HGMA 4A46A 5DS7A 4N47A 2YNGB 2VDIA 4KR0B 1NRKA 2NSCA 4QIWD 5CYQB 2D1CA 2ZBIA 3F41A 3K59A 3RAMA 1J5OA 2V9KA 2HHUA 1Q95G 1SIWB 1RACB 4ZVFA 4LRCA 3M8SA 3D1OA 4DV0J 2H48B 3HULA 1IM6A 3TJ9A 4DR1J 4NXMJ 1U8WA 4UUWA 4G6VB 5HO4A 3RJMB 4Y2CA 1XQIA 2XGQA 1RU2A 2XYGB 4Q0BB 1H72C 1NB2A 1HNZJ 1P8GA 1TAQA 2YKPA 1FEHA 3R5BA 4KGKA 5KG3A 5K8OA 2VONA 2NYIA 1FRMA 4CLYA 4ZCMA 1P1TA 1K73T 4OX8A 4NMXA 2P9GA 1QLNA 4ZPWR 1FCAA 4CH7A 1N36F 3SSSA 3AJDA 2FB0A 4PPZA 5ETLA 1HQEA 3BBFA 1RSCA 1M5PC 3PCOB 5EWFA 3PX6A 4ATNA 3D7SB 2GO8A 2IDEA 1Z2LA 3GFXA 1S6OA 1XR6A 3CCLS 1FVQA 3CDEA 4F4KA 2BBEA 1N33J 1TL4A 3RB0A 3ENAA 5JUMA 4DUTA 1GK8A 3FCWA 1JLQA 1UPMB 4AUKA 5BYSA 1FT8A 1RUSA 3R97A 2EW9A 1R43A 1SV5A 2XZWA 4HDGA 3CXCR 2LDIA 1FJGF 3GQCA 4G1PA 2Q43A 4F4WA 3IBFB 2P9EA 4UT4A 1NPRA 3MMCA 1RXOB 1Y3KA 2ROGA 1SQEA 4RR5A 4X4TA 1ZM3A 4IDKA 4NEZA 3GG1A 5KFZA 4MT1A 4ZCLA 1E6YB 4I7FB 4EK2A 3PFEA 3CJRA 1LWCB 3AQOA 1HIYA 1R8AA 1RCXB 2F4VJ 1CJUB 1VQ5S 2HK2A 5IM0A 3Q8UA 5MLCV 3UPFA 2H51B 3DDIA 4UOCA 2WOMA 1S79A 2J7KA 1TVRB 4K2XA 1DTTA 1S0OA 1JLAB 4LVNP 5A8KB 3EGZA 5GMEA 2R4FA 3KUGA 4LRFA 1UVJA 4DFPA 3NS7B 4G1QA 4YFUA 4F26A 3MR6A 1JKHA 3G71S 2OIHA 3P3DA 4LUBA 3LP0A 3OTOJ 1HNVA 2OTLS 4CLFA 3DGPA 5KG5A 3BSOA 1W2IA 4I68A 4JBCA 4I1TA 3PYGA 3PW7A 2Z4PA 3SCKE 4LJMA 1S6QB 4QR2A 4DPWA 2AMCB 4I2QA 1HPZA 1ZTWA 2VQFF 1FFSB 3AD9C 1WF0A 3HVAA 3CCVS 1RTJA 2AU0A 1REVA 3J7A1 1FXDA 5F41A 1MROB 1IR0A 1CJVA 3AJ2A 4CQ1A 2KZMA 3QYYA 3CVKA 1HL6A 4UY8T 2DEIA 2VPWB 3DYAB 3MM8B 2P5VA 3CIZA 4B9SA 1IKXB 4O23A 5E2QA 3G6VA 5ETSA 3CD5A 3V4MA 4L74A 1YBUA 2CPXA 3DLGB 3R7NB 1B99A 2D3ZA 3QIDA 4NYPA 2ZH2A 4HYKA 4FF1A 2GJ2A 1CQMA 4IG3A 4RWXA 1RAFB 4C97A 2MKHA 4F36A 4URGA 4FS1A 2VA2A 3CJQA 3QMQA 3OLAA 1GEHA 4NPOA 1N6QB 1TQLA 3GV7B 4IUFA 1HQ2A 1U0HB 3O1LA 1KHWA 3R6LB 4IH6A 4X65J 1S9GB 2HWHA 4V19X 3C6UB 2IJRA 3QAEA 3R1HA 4IFYA 4PKDB 4G1QB 4NXNF 4C4WA 3QAUA 3K2YA 1TVRA 4R25A 4OZ0A 1WKJA 1WNEA 4B3RF 1X7VA 4CZCA 2UVWA 3LW5C 1S1VB 3OQ2A 2BZ2A 4QZVB 4USKA 2XG8A 5RUBA 5B0AA 2LYVA 2WCXA 2G0JA 2GNKA 5KFQA 4WFBQ 5D4NA 4FXDA 5CD4A 1TKXA 1V3ZA 1E6YA 3HI9A 3R5AA 4I7FA 3TRGA 5J1EA 1SKWA 4RW8B 2QL5B 1Y00A 3GMGA 3NEKA 3OT9A 2WW4A 1PJ6A 5BR8J 1X0FA 2G4BA 2CJ9A 4OYMA 1RT2A 4L6V3 4ED2A 5AE3A 1IQTA 2WVBA 3FZBA 4DG1B 2OPQB 3HHLB 2D9PA 1FRLA 4OYOA 3U1LA 1J27A 2ACMA 5ADZA 1RT7A 3CJKA 3NNAA 2B8QA 1TK5A 1L3TA 2ZBCA 4Q45A 2FJDB 1HBMB 1DJ0A 4NLYA 4F4XA 2A6MA 1RAOA 2EPIA 2NUUG 2QZ8A 1ZTTA 2GZOA 3FMBA 3IWXA 3DU5A 3BDPA 2VIHA 2F9JA 3OL7A 3T5JA 3PYDA 1XMQJ 1NJYA 4ITSA 1B7YB 4WK1A 4EO8A 4KHPJ 3SSQA 2HWIA 3QFHA 1SKSA 1R8PA 5B0GA 1AUDA 1QSLA 3VQTA 5CCMA 4P74A 4HACB 3Q2TC 2XLJA 1WOSA 3E01B 5GAGU 3PIPQ 2XO6A 3A8JA 1WC4A 3H98A 2Z2YB 4ETXA 2XS7A 2E1AA 3R7BB 3PW0A 3CEDA 4NCAA 2GFFA 3MUVP 4M5HA 2DO4A 2HVHA 3J7ZT 2V34A 4IO1A 3OR2A 5KFBA 1N48A 1VQ4S 4J9SA 2UXDJ 1JLBB 3UW1A 4ZVGA 4USHA 1MU2B 1CLFA 5I3PA 3ZTSA 1S1XB 3KXDA 5AJ3F 2BQUA 2JWNA 3X3UA 3CC4S 1FD2A 1NH8A 4CLSA 4KRWA 4FBTA 3AOBA 4KPYA 4WKYA 4ED6A 1NB7A 5KFKA 3IBWA 1WHXA 1W26A 2X1GA 5A6WA 5EHHA 3OUYA 3ETOA 3N6NA 4O44A 5DM7Q 3DOMB 4JI1J 4WF9Q 1W2BR 1RWOB 3KYLA 2VFTA 2EKNA 1NK0A 4I4BA 1F0XA 1HBUB 1WORA 2EBEA 3BYPA 3HP6A 3ZZPA 3D2WA 1ZETA 4B9TA 1S9FA 1IUJA 5ETOA 3EGNA 4OHWA 3ZNUA 4BHQA 1RTDB 3G8QA 4IR1A 3OR1B 2BJ1A 5HBMA 5T41A 1FJEB 3E8OA 4FYWB 3SSRA 1PYOB 1T9YA 4OZNA 2XMJA 1CULA 2B9YA 1N5QA 2Y0BB 2MQQA 2MKKA 3HHKA 3LAKA 1YJRA 3MPDA 1KC8T 4CNYA 3BGOP 1Q5YA 1HBOB 3PHEA 5AXMA 1WUUA 4DPOA 3TARA 2AF6A 2VKZG 4QPXA 3GFZA 2QFIA 4LBPA 2DNGA 4HT5A 2RRNA 4AL7A 4TY9A 1Q7YT 4Q8EA 4PWDA 3IA0A 2J8AA 2XHCA 1S99A 5CD4H 2QA1A 2VG5B 4OV6A 4RW8A 2BR0A 4F4AA 4DX5A 3IR6B 2LQ5A 2NPFA 1IQZA 1HNZF 4DX6A 2K06A 3LP0B 2R7WA 3MM9A 3DC2A 5BJRA 2L41A 4M5JA 4J90A 3MUMP 2RRBA 1WHVA 5I3QA 4RW6A 2DNZA 4B9MA 2WOMB 3LUYA 4FXWA 3JB9k 4F3QA 3FEXB 3VZHA 3HO1A 1A7GE 1X8DA 3NBPA 4FYXB 1SCJB 3ETMA 4OV1A 5KFDA 2B7CB 3GJRB 4M5LA 5FIIA 3VAHA 3D0GE 4NRTA 5H1SV 5G4DA 2E5LJ 2E5LF 3QRPA 5EN1A 4IDKB 3A8KA 2DNRA 3KLEB 2B4UA 2FLLA 1BLUA 1N32J 2MXYA 3ZXWA 3KK1A 2KT3A 1CJTB 1VK8A 2IRYA 2LXFA 2CA9A 4PG6A 4Z37A 2FVRA 5DDOC 3PV8A 1DY3A 5F8GA 4DUZF 2MLZA 4I67A 3TAMA 1Y0HA 1FNMA 1D8ZA 2RU9A 2VC0A 3SZ2A 2QLBB 3ZZOA 2VQFJ 5KFWA 3CCES 1C0TA 2BEFA 2LEBA 2WTFA 2YQ0A 4G3IA 2CJQA 4LFBF 2XI3A 4KGMA 3ITHB 1KWMA 3UD5A 1UEVA 5ITHA 3BKUA 2VHGA 3RTVA 2JFKA 3QWUA 1TL7A 4LBIA 1RWKB 3MAAB 4Z7CA 5AXKA 1IKWA 2A2DA 2M9KA 2OELA 2BW2A 5M2RA 5HQMA 1JJ2R 3MUTP 1H38A 1TFWA 4K0KJ 1AFJA 1F3FA 3VGSA 2V2KA 5T14A 3SV3A 2GMLA 1KLNA 1Z1ZA 2MKJA 3HX9A 5D78A 4FVCA 4ZLPA 4RBTA 4P7VA 3TEHB 5C24B 3L09A 1WTFA 3NMRA 2FY1A 4R5PA 4KPCA 2CXEA 3HD1A 4C11B 2CPIA 1NLKL 2YNIA 3D9BA 4K5RA 1H3DA 3SFGA 5J2PB 4NE9C 3AOAA 2BKPA 1QAYA 2OPPA 2YKMA 4BS2A 4NCBA 2C3PA 2OUGA 2RKIB 3W62A 2HZVA 3K89A 2MZTA 1YITS 2DH8A 1JLGB 1U0SA 2E5HA 1F2HA 2IDLA 2N7YA 4NI2A 4X4OA 2XY5A 1K0TA 2C42A 2VUGA 1IVZA 1T05A 4Y28C 4DU7A 2UV8G 3GFHA 2J7WA 3P8BB 1Q78A 4ZVQB 2V0NA 3KDOA 4M5NA 2UP1A 2AZ3A 2V69A 4CDIA 2Y1JA 5K8MA 3P6YC 2V8HA 3CJSA 4A8FA 5HVFA 4OX9J 2JLGA 2CQPA 4DQIA 4DR6J 1HR0J 5IT9Y 1FKPB 1S57A 1ZS6A 3CDAA 3VHQA 4X64F 4ED8A 3OSPA 1SKRA 2WW8A 4FXVA 4ES2A 2GX8A 3LGNA 1P9QC 2XS2A 4XIUA 8AT1B 2XY6A 1KONA 1NBEB 3M6VA 2AW0A 4M94A 2UV8A 1A9NB 2OH2A 1TAUA 2AEMA 4TLQA 1FD8A 2F8HA 4UZBA 4F2SA 2HBYB 2CYYA 1VRTB 2J6TA 4YOEA 2CPZA 1RISA 4OZLA 1FDNA 4LVOP 5EWEA 3UD3P 3TUJC 2NYHA 3HFVA 3KLFA 4MK9A 1Y5NB 1SJ4P 1G4CA 3KJVA 2DGSA 4ZVSB 2OAUA 3EE3A 4B3SF 1LNQA 4DDFA 1BC6A 1S7IA 5J1EB 2HLTA 1SJFA 3HVTA 3CNQP 3OPKA 4DCOB 2FZCB 4RUAA 1PC5A 4DV3J 1UL3A 1B64A 4AYBD 4I2PA 4N76A 3UI3A 3VQSA 2FVSA 1BD6A 2R3VA 1DARA 3GZ7A 4NLUA 4DL6A 3G9CA 3H5XA 3JSBA 1G2EA 3L3CA 4NWBA 3ZTRA 2IY5B 1VQNS 3OW2R 2OPPB 3K5NA 2RMLA 1CC8A 1PJ5A 3JYTA 2CDQA 1P9YA 2HMIB 3W3SA 3PXGa 1VQ9S 4HHJA 4B17A 5CYJA 3H40A 3KG1A 3FSIA 1R31A 1LWXA 2XMWA 3C16A 5F0WA 3HSZA 2QL7B 4KIAA 3L7OA 1RAJA 2KFYA 1KTVA 2R7TA 3H42A 3M2VB 5EDWA 2HFVA 3LGHA 4KC5A 4GKKJ 1Q8KA 2BACA 1SUQB 1HARA 1YJ7A 1YLXA 3QJPA 1DAXA 4RU2A 3I9V9 2C3YA 1R0AA 2VG6B 1UA0A 5C42B 4NLGA 2VFVA 1QJHA 5F0UA 8RUCA 1MWQA 4DL5A 2EWHA 4F7VA 1KQSR 5D15A 4F4ZA 2RJZA 4EGLA 1WC3A 5DQHA 3EGVA 2ZUAA 1WJ9A 3BM7A 1R0BG 4Y65A 3RW7A 1CJVB 4OQJA 4LF8F 1REVB 1OIAA 2CWXA 2MKCA 3AA8A 1RTHB 5F8JA 4FN5A 3MPWA 5D0EA 3HJFA 2MQOA 1FDBA 3H2UB 2DISA 2A2CA 9ATCB 2ILYA 2WBMA 3UNYA 1D1UA 5D77A 4KO0B 2EI5A 2FJAB 2N3OA 3H5SA 4KH0B 4TQRA 4DR4F 4Y2IA 2G9OA 2R9LA 5DZ6A 4A8YA 1G1XA 2R7XA 2YQ1A 3BBBA 9RUBA 5FLXY 1KVKA 3P4UB 2J9DA 3MAHA 1X4DA 1GTHA 1AXQA 3PFOA 4KHRA 2KG0A 3I9ZA 2DY9A 3N5BA 4CO5A 1UZDA 2ZZTA 2OFGX 1Q86T 4HHHA 1JX4A 3MF5A 4K4YA 3OL9A 1QSYA 2AQ4A 2XMMA 2F4FA 4YMEA 2PC6A 1CPZA 4C3LA 4OFZA 3BF4A 1NHVA 5IFMA 1HQEB 3T6JA 3DMJB 5CABA 4OZ3A 2W9CA 3ET6A 2GIQA 1RHKB 4YB1P 5KFHA 2YH0A 3MPUB 2ZJPQ 4A4JA 1I94J 4ELVA 2FPHX 1WKLA 2HBQB 2WRMA 1G3OA 4DL2A 3D4JA 3G6YA 4DSIA 3WDOA 1NK5A 4N56A 3QO9A 4RLEA 1Y5LB 3SQGB 3VTIA 3PR4A 1RWMB 4FVMA 5LL6d 4KBIA 1KEKA 2ZM6F 4WIQA 5J2MB 4B9NA 3MTKA 4WE1A 4DF8A 2VBXA 4QR0A 1IKYB 1MN9A 2XZDB 3MM6B 3I4HX 5A8RA 1X5PA 3BREA 3KLHB 1SC4B 4ED7A 2B4VA 2UXCF 3QGGA 4KE5A 2KM8B 2R7QA 1QE1B 3RUBL 2ZZNA 3HKZD 1M5VC 1SQGA 4Y2AA 4RUCA 4ANCA 3PTWA 2NXCA 2YNGA 3EZUA 4PPDA 4WJBA 4YR0A 2ZBPA 2QTWA 3BS9A 3BV8A 2DNHA 4ZP9A 1Q8BA 1R6YA 1RE1B 1S9EB 2DNOA 2E5IA 2L08A 2LXUA 3MEEA 2O3DA 3HM9A 1RKJA 1SQFA 3ZO7A 4QWAA 4MMOA 2E29A 2PIIA 3TAQA 2HNDB 1U7LA 1WEZA 2M0GB 2PMZD 1B4SA 2OP5A 2WVEA 3CJ3A 3EXCX 3RYLA 2CDRB 2BVZA 1X4BA 3W2WB 4O3SA 2MEWA 3QZ7A 1IKWB 2V50A 2D7SA 2HAFA 2OFHX 1Q4RA 2FYXA 3ZZRA 1P27B 1KR4A 3Q0AA 4XK8C 2BM1A 4JUZA 1NK7A 3FC9A 3OD2A 5IT4A 2O01C 1FRJA 4QWDA 4ELTA 2LECA 1WF1A 2EG2A 1VBYA 3UR3C 1S6PB 2CQCA 2IC3A 3G82B 4OIXA 1CJKA 3HHLA 3MM7A 4UZCA 1MSWD 2YTCA 3DOKB 1JLBA 2XI2A 3K5MA 5J1NA 4PYDA 2LDYA 4FPRA 3RBDA 1XR5A 3CJTA 2AD9A 4MH8A 1ROFA 2E9TA 1RT4B 1NMEB 1T11A 4UY85 2K8GA 3G8SA 3NGTA 1O51A 5KFSA 3UVJA 4C0BA 2DGOA 1SH0A 2CAJA 2V2QA 1HWKA 1WG1A 1AROP 2B6AA 3TW0A 4NZ7A 1G7CB 4BCAA 4X4SA 3C6TB 2W9CB 2UUTA 2J9DE 3HVRA 4DL7A 3V4IA 4HACA 4N8NA 2HGNA 4EO6A 2EFQA 1R8BA 3PKYA 2W2PP 2VBYA 1KVJA 2CJKA 2DVIA 5HN0A 2XB2D 1P6TA 5IM0B 4AT1B 1FKOB 1Q8LA 3NAHA 4DPXA 3A8IA 5F8IA 2B4OA 4ZA1A 1U1KA 2FJVA 2FHKA 1RP5A 2C28A 2MYFA 2DKOB 4WTOB 3CMQA 4GC7A 2ABYA 1EZZB 2E1MC 3HVTB 3M1VB 4X4UA 2NR0A 1CQNA 1RWXB 3NNCA 2E7VA 2FTRA 4C9DA 1RT4A 3JAMY 4BC9A 2J0WA 3I5AA 3ZZUA 2B9EA 5E0OA 1F60B 1PG5B 3TO8A 5HSPA 4ECRA 1R0CB 1S4FA 1SJ1A 2VQEJ 1X9WA 2PA8D 1T94A 3R27A 5FDLA 5IC6B 2AX0A 3MM7B 4PWDB 1YJUA 3JQMA 2J6UA 4LSZB 3M2RB 5C7PA 2XLKA 1JNRB 1RK8A 2A10A 2ALYB 2HWTA 1OPZA 1N34J 4DV6F 1YWXA 4C6AA 1WSRA 4X65F 4EBDA 1VBKA 4DUZJ 3P5BP 1SC1B 2MGZB 2OPRA 2ZDOA 1UA1A 4Q2MA 4RL1A 2KB2A 4MKYA 4HH1A 4CM2A 5JJBA 1WC6A 3TQ1A 1DLOA 2CPYA 2GCFA 1F5AA 2SXLA 3A8EA 3GJSB 5HK4A 4QWCA 1NZ8A 5KG1A 1R3NA 4NASA 3OLBA 2W8KA 1X5OA 2OMOA 4ED5A 2VB6A 2H5JB 1LFWA 2ZH4A 3CCMS 3MI7X 3B4DA 1OPIA 1BQMB 4NLPA 2WAQD 3PR5B 4IG0A 1R0AB 1K0VA 3KK3A 2ZH6A 3CF5Q 5A0YB 3R5GA 1M5KC 1HWUA 3MEEB 3MMAB 1IBKJ 3FKBA 3ZC4A 2CNOB 3A3NB 3AQPA 3DLJA 4CNZA 2QV6A 4ID8A 2HZCA 3FDSA 4DV2J 3HF5A 4ZVRB 3RB6A 2M3DA 4Q0BA 3AJ1A 1GT8A 2KKHA 1SC3B 2CVEA 5J2QB 2WBRA 2AV5A 1KQGB 4UOHA 2LLZA 4XDCA 4Y6IA 5LSRA 1N34F 1XBWA 2HEKA 3T6BA 1VQOS 4JV5F 4FPIA 3S6EA 3UO0A 2FVQA 1M5HA 5HANA 4C11A 2NXEA 1JWWA 1JNZB 1KN6A 3H5UA 3FEZA 3IWLA 3VZIA 3M30B 3GB0A 3WBZA 1TKZA 3RBZA 2JX2A 3NS5A 5IQ6A 4J9NA 4DV5F 4DV7F 1QVGR 3EM1A 4N8OA 4J9QA 1HNXJ 1KLMB 2FC8A 5GVQA 1YZ7A 3D67A 3M8RA 3N6LA 3ET6B 1F9FA 4DFMA 4JP8A 5F8HA 1U1RA 5CYMA 2LCWA 3W9HA 1BQMA 5J2NB 1M0SA 2KHCA 5HVHA 4NA3A 2B5JB 3CCWA 2Z2ZA 2BE2B 2WVCA 3D3CJ 3M6UA 2UXBF 5AE2A 4ERDA 2DGUA 4NLOA 3NS6A 4XO0A 3F73A 2CQDA 2RIJA 1DQ9A 2WZ1A 2CPJA 2DNQA 4OZJA 2D69A 2DHXA 2DCLA 1N56A 4WFAQ 3CJ8A 5F3ZA 2VOOA 2DGTA 4QR1A 3D1HA 1YBAA 3P96A 3TA2A 2OPRB 3SXLA 4YDDB 2AIRB 2FZKB 5KFEA 3H5YA 5E7OB 5KFIA 2EXUA 2LP4A 4OJHA 1YRUA 2HKEA 4OJ3A 5SUHA 3ZZYA 4J9PA 1SH2A 1YGYA 2DGQA 3U7JA 2RF2A 1VC0A 4JI4F 2OPQA 2FJXA 2GQ2A 5FDLB 1SIZA 1CJUA 2KXHA 1FWPA 4A8QA 2MKYA 1JIHA 3A3PB 4KTQA 2AZ1A 4DSKA 4DL3A 1JQGA 2KRRA 4DI6A 1VK3A 4O4GA 1RT6B 3FNNA 1PO6A 1GXLA 1O6XA 4KH1B 2KZZA 1BQNA 3G2XA 2OTJS 4ZP7A 1C1BB 1GQEA 4ZCKA 2W2NP 3FBBA 1VI7A 2L9NA 4F4YA 1RKIA 1LWFA 4B9VA 2C2KB 5IT9U 3MFIA 4CO2A 1F1BB 1SXLA 4OZ1A 4W98A 1DQ8A 4LFAJ 4Z7YA 2NLWA 3HHEA 4ZS6A 2P6SA 3B8HA 1RHRB 4UUXA 4DQRA 3T5LA 2M2BA 1P1LA 2M5YA 1YZ6A 4ER8A 4LRBA 2OPSA 3I87A 5M2PA 1J5EJ 4LR9A 4NRUA 4I69A 3DI6B 5CYQA 1OS5A 2VC1A 3QNWB 3R8YA 1S5ZA 2HFOA 3D6HB 3LGMA 5IQQA 1N6QA 2AEFA 2UUWA 1VC6A 3V6JA 1I51B 2X3GA 3K0JA 2KVQE 3C8YA 4ANDA 4F0HA 4AL6A 4JV5J 1MLAA 3JTOA 2ZC4A 2AHOB 2FZGB 2K1RB 3PYFA 1JLCB 3KDNA 3Q8YA 4IOBA 2UU9J 4JI3J 2MZQA 3SIPB 3J7YI 1WTBA 2VODA 5H9EJ 3EJMA 4XAKA 1XMQF 1RYSA 1T95A 3AXKA 4KV8B 4DR7F 5EX3A 3QWPA 1NDKA 2RQCA 2YKAA 3CDUA 3EMTA 3N4WA 4FNIA 4K5SA 4BBYA 4L76A 4X66F 4WCEQ 3GIIA 1FTCA 3V6KA 4UOFA 2R2TA 1NJIT 3G96A 5L8RC 5A8WA 3HDSA 1J2VA 1IN0A 2V8VA 3JSMA 1S77D 2OD4A 5IV4A 4A8WA 1RBAA 4FS2A 3DLBA 2PE8A 4ICLB 4Q5VA 2RDJA 2OHDA 1C0UA 3QSIA 1JXLA 4QCLA 4GO5X 3ZTPA 2W9BB 3W63A 3C2PA 2ZFHA 1HPZB 2UUCF 1RCOB 3LALA 4ZVTB 2UXCJ 4A47A 2J0SD 2O5DA 2EK6A 4TNOA 4ZLJA 3UR0A 1JLCA 1S4EA 3G6XA 3T1YF 4M95A 1S9EA 3CPWR 1UPPA 2VPXB 1DTQB 3DI6A 2KN4A 4K7QA 3KLGA 4DV6J 3T1HF 3FK4A 1LW2A 2FY8A 3E2EA 1ZPWX 4H4MB 1LV5A 2BOPA 1LWFB 4TYAA 1RT3A 1VQLS 3R1LA 1C1BA 4CO4A 1L5UA 1X4FA 2BANA 1WDTA 2YX4A 1H6KX 3DRRB 1O5JA 4MAKA 5ETRA 4IOCQ 4BDPA 3DHWC 3PW2A 3MM5A 3R5DA 3C19A 3MTJA 1FRIA 3CE8A 5DJBA 2Q6CA 4RNNA 4TLRA 4LF8J 3GV8B 4LF9F 2GVDB 2LU1A 2CJYB 3IWNC 4JI8J 5DG8A 1ZAWA 1QAJA 4TY8A 4BWJA 5KFLA 2EFGA 1UVMA 2HW3A 1FWLA 2H1YA 2YKMB 3U02A 2ZE2A 1V6HA 3M8YA 2JFDA 3I4PA 5L9XA 1D8YA 4R5PB 2X3DA 5HMXA 1FVSA 1RDRA 3GSDA 1TU0B 2RDDA 2D74B 3LP1B 4DPTA 2DITA 4CLLA 4RU9A 1C2PA 1FF2A 1HBNA 1VDHA 1D9DA 2M52A 4LF1A 2XSFA 1NCLA 2CNLB 2LKZA 4CI0B 4D3GA 1LXJA 4E8UA 2BQ3A 4XPCA 4DQQA 4U7UD 1FKPA 1KRPA 1Y3JA 3MAAA 4NZ6A 3G6ES 1KQKA 2R8JA 3T41A 4ECZA 4DU8A 2VBZA 5THWA 2EK1A 2IMWP 5B0DA 2ZNZA 2K7KA 1EQMA 1MG7A 2XSJB 3M30A 3ZNJ1 1SI9A 5KFNA 1X4EA 3PEJA 5CXTA 2AJ4A 2MKSA 5AT1B 1Y11A 2FHJA 2UUAJ 4DR2J 1RZMA 1F2GA 4IKAA 4F50A 1RAAB 1RB0A 2I6WA 1GXUA 1RWPB 4NI2B 3AY0A 2GS8A 5ETPA 3FBEA 4WP8A 4LF5J 4H4MA 3VV2B 4ZPDA 2PFDA 2XM3A 1VHIA 1PILA 3N79A 3VAJA 3BH7B 2ZD1A 3ZTOA 1LWEA 1S9GA 4QYZK 1FHTA 2YWHA 4NLQA 2RD5C 2R7VA 4P71A 1U1PA 2N3LA 1D9AA 2HNYB 4K50A 1IM4A 2XMKA 3TJ8A 2I8EA 5GAHI 4I56A 1HNIB 3WZ0A 2GVZA 3Q24A 3HHNB 2HMIA 3W7BA 4X66J 2DNLA 1Z2ZA 3BBCA 2ASJA 1HD1A 4C8KA 1EJ7L 1N5VA 4DUYJ 2MY7A 2BQRA 3DLGA 1L3UA 3MPVA 3M32B 4PEOA 4DN0A 1FK9A 1NSPA 4X64J 2AJFE 5DZ7A 1HI8A 3JXOA 2JEIA 3CDBA 2HQGA 3DYAA 3W2VB 3NCPA 5GADI 2DNMA 5KFYA 3WHIA 2VICA 4PWUA 1X9SA 2WVDA 1E6VA 5E3AA 1RTJB 2LFVA 3LQVA 3QJJA 2EFPA 2V6AA 1KHVA 3BGUA 1GFWB 2HG4A 3BPSP 4X4PA 2BX6A 5L39A 1W7WA 4E98A 3T1YJ 1N5YB 4DG1A 1A6LA 4Y0FA 3CIMA 1S1UB 1ULRA 6FDRA 2CQGA 2W2OP 3D0IE 3K57A 1FNXH 4DBQA 2ASDA 1UEUA 3GFYA 2YNFA 3DRYA 3F0NA 3IFEA 4WBFA 3MCMA 1V5IB 1CULB 3OXFA 5H9FJ 4ECTA 3OL8A 1YTYA 2HK3A 4CWBA 2HS3A 4NA1A 4WTYA 3M1VA 4Y00A 2FDNA 4QJVA 3WC0A 4J9MA 2GJIA 3GJQB 3W8GA 4CRJA 1Q8IA 3IO1A 4WU2A 1HD0A 1ZBTA 4F2RA 2QX0A 4ILRA 5KFXA 1FKOA 3NGSA 1S1VA 1IXKA 2H54B 1FI4A 1LXNA 2C2ZB 3N9UC 4RW4A 2KYZA 3MEKA 1BXNA 2GAHC 3NRBA 3QFWA 4QW8A 3W9IA 2VG6A 4ED0A 3NLCA 5L9NA 5LOQA 3D6MB 4IFYB 3AHPA 2B6AB 1HNIA 2KDOA 1KQFB 5IXUA 1H0HB 2RB7A 1BE4A 1R8HA 1UW9A 2X7IA 3BPDA 3C6TA 2W01A 4H54A 3I0SA 4ZPVR 1YSJA 3PW4A 1VQ6S 3BN7A 4MKBA 4WFYA 3VALA 2DBBA 4NLVA 2E5GA 2RRAA 2XYHB 5KOWA 3DRPA 2MSTA 4A8XA 2MY8A 4EYHB 1T3OA 2V67A 4DSLA 1F5BA 3NXZA 4EZ9A 2KT5A 2K2PA 1OJ4A 2ZBRA 4J5OA 1QDUB 1VCTA 5ETMA 3UCZP 1V3RA 4LRDA 4CT9A 1SV5B 3MZIA 2AJ2A 4FZVA 4O0IA 3VAMA 2NXUA 2V2VA 1RAHB 2FHJD 2YWFA 5FD1A 1KOOA 1H2UX 1WOPA 3V6HA 3POTA 3KHRA 2VBWA 1W25A 3G86A 3H0PA 2B7BB 2HPUA 3HJVA 5A8WB 2B0GA 2R7UA 1VOMA 3IRWP 1RHUB 4O3QA 4DV5J 1YIJS 1FK9B 5KAKA 2PDAA 3D68A 1TKDA 2OGUA 2A6OA 2CKWA 4ZPTR 4OJGA 2DYAA 4ED4A 2IJFA 3VWSA 2Z30B 1XC9A 3Q22A 3KTQA 1HMVB 4LFCF 2LEPA 3D0HE 3DKDA 5LXRA 4DSEA 4P2SA 3QJLA 1KP6A 4ECUA 2BJ7A 1IBLF 4LF4F 4QU7A 3PO5A 1APSA 4GVBA 4OHVA 5D4PA 3NL0A 2DGWA 2LEAA 3SDEA 1HNXF 4AXIA 1JKHB 2YKOA 4OI2A 2ZNYA 2VDHA 2LQ8A 3RU0A 1QTMA 2DRBA 2UU9F 3R9LA 2YKNB 4CLWA 3OVSA 1WD6A 2VH7A 2VOPA 1JLAA 4DR1F 3W65A 3QT8A 1MMLA 3UN2A 4B02A 2AT1B 4R0JA 2KH9A 2XMTA 3IM9A 1YHQS 5L46A 4K4TA 1BQXA 1K44A 2H4YB 4L72B 4P75A 1MWZA 2NPIA 3MMAA 4UQGA 3C14B 4EWTA 1RJJA 3MHYA 3ONQA 2AYBA 5EUHA 2NSBA 5L1LA 3DXSX 3M8PA 4IG0B 2PSZA 4C8OA 4RKUC 2ZZMA 1DRZA 4JI6F 2HHQA 2R2UA 5E3PA 1JLGA 1TUWA 2J7UA 4YDXA 4CH1A 1U4BA 2ZHOA 2JZ5A 3IAM9 2CRLA 4N7TA 3SFUA 2ZUGA 2Z58B 3CJ0A 2N4CA 1YX2A 4ZN3A 2CWKA 2F65A 5KT7A 3GIJA 3CT9A 1WOOA 4YEAA 2W4DA 2WONB 3EYZA 1YI2S 3TR5A 3FQKA 2NZCA 4Q43A 3W61A 2E66A 4J7CA 1RYRA 1WC1A 2G1DA 2GJFA 3MCOA 2VA3A 1RT5A 4LMZA 3HHLC 1RHMB 2RHSB 4QPTA 3WQPA 1FJGJ 3FRYA 4FKYA 2XMVA 3QRQA 1CVJA 1HBOA 2CPDA 4U96A 2U1AA 2YKQA 2OSRA 3FCVA 4PCQA 3RG6A 2ZKTA 2V4RA 3EGWB 2QEXS 2HHVA 2WSFC 3PRVA 2HAIA 4KKOB 3NOCA 5B0FA 2YNHA 5KG6A 3THVA 3IS9B 4NLXA 3K17A 5GAEI 4K0KF 4Y2KA 3GTYX 2LQBA 2DD8S 5C42A 1B70B 1R7IA 1S12A 3AT1B 4HT7A 3GIRA 1WKKA 3PZPA 1LFPA 3M4XA 2HVDA 3TYTA 3V4IB 4ETZA 2QLJB 3KMSA 1ICEB 3AB2B 1RADB 1ZAVA 1VQPS 2NXNA 1SUQA 1CJTA 3Q8QB 3C15B 3ISND 3IXQA 5L1KA 4ECSA 5D3GB 3G87A 3KLEA 4OI4A 1KSPA 3M9MB 2BKOA 3I0RA 4TVAB 2J76E 5ETQA 4DCJB 2XWYA 2RUSA 4X4RA 4HI1A 3BSNA 2DTJA 3KLIB 3WX4A 5A8KA 5HJYA 2QG9B 2A18A 2QMXA 3M8QB 4CO1A 1V3SA 1NAQA 4F0MA 4X62F 3JYTB 3CC7S 3I31A 1EHWA 4DLEA 3LA0A 3EZ5A 1XJWB 4FYVB 1UJ6A 1IWGA 3J81Y 2HQ3A 3E3XA 1FKAF 3QGIA 3NKYA 4U9RA 2B3TB 4NCGA 4TN2A 3CCRS 1VGYA 4I6WA 2MGZA 3T5KA 2E9RX 3CULA 1B0TA 1PIEA 3TVKA 2YQ3A 2R7OA 2JJ4D 3BGRA 3TZZA 4EEYA 3FFIB 3MMCB 3R5CA 4P2XA 5K5MA 5D4OA 2V4JA 1GTEA 3SBMA 4PQUA 2GHVC 3Q8PB 2ZH9A 3HHLD 4M5DA 2GHPA 3IGNA 5IC4B 3TNVA 3EICA 1TUGB 4DJBA 3PX0A 2HHWA 3KUEA 5GMDA 1EARA 3OSNA 2LA6A 3M8WA 4M63A 2VG7A 4JI7J 2R7SA 3BGLA 1EKSA 3I5CA 5I4MA
chains in the Genus database with same CATH topology
4NXMJ 4DR7J 5A2QU 2UUAJ 4DR2J 2E5LJ 1HNZJ 4DR5J 4JI0J 5IT9U 1N32J 4GKKJ 4LF5J 3D3BJ 4LFAJ 3R2DJ 4NEYA 1N36J 1XMOJ 5BR8J 4DV4J 2MQ8A 4LF9J 1J5EJ 4JI5J 4HHUA 2VQFJ 2HHHJ 2KVQE 4JV5J 1N33J 4LF6J 4X66J 2UU9J 4JI6J 3R2CJ 4JI3J 5AJ3J 4LFBJ 4DUYJ 5LMUJ 2VQEJ 4RJVA 5LM7E 1XMQJ 4NXNJ 4KHPJ 1XNQJ 2UXBJ 4X64J 1N34J 4K0KJ 4DUZJ 4V1Ak 4PWWA 2ZM6J 4LF7J 3T1YJ 4NEZA 5LMNJ 4GKJJ 1FJGJ 4YY3J 4JI2J 2UUBJ 2UXDJ 2F4VJ 2UXCJ 3JAMU 4DV1J 1IBKJ 1I94J 1IBMJ 4B3TJ 4AQYJ 4DV2J 4DV6J 2MTLA 4DR4J 3T1HJ 3J81U 4X62J 4JI1J 3OTOJ 4OX9J 4JYAJ 4DR6J 1HR0J 4DV7J 2KL8A 4LFCJ 3J7AN 4B3RJ 1HNXJ 4LF8J 4B3MJ 4JI8J 3J80U 4KY3A 4KYZA 5IWAJ 3D3CJ 2MEWA 5FLXU 3W1YC 4B3SJ 2UUCJ 4DV5J 4YHHJ 1IBLJ 4DV3J 4DR3J 4X65J 4JI4J 1XNRJ 4LF4J 1HNWJ 3IMQJ 4JI7J 4DV0J 4DR1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM J;  4DR7 J;  5A2Q U;  2UUA J;  4DR2 J;  2E5L J;  1HNZ J;  4DR5 J;  4JI0 J;  5IT9 U;  1N32 J;  4GKK J;  4LF5 J;  3D3B J;  4LFA J;  3R2D J;  4NEY A;  1N36 J;  1XMO J;  5BR8 J;  4DV4 J;  2MQ8 A;  4LF9 J;  1J5E J;  4JI5 J;  4HHU A;  2VQF J;  2HHH J;  2KVQ E;  4JV5 J;  1N33 J;  4LF6 J;  4X66 J;  2UU9 J;  4JI6 J;  3R2C J;  4JI3 J;  5AJ3 J;  4LFB J;  4DUY J;  5LMU J;  2VQE J;  4RJV A;  5LM7 E;  1XMQ J;  4NXN J;  4KHP J;  1XNQ J;  2UXB J;  4X64 J;  1N34 J;  4K0K J;  4DUZ J;  4V1A k;  4PWW A;  2ZM6 J;  4LF7 J;  3T1Y J;  4NEZ A;  5LMN J;  4GKJ J;  1FJG J;  4YY3 J;  4JI2 J;  2UUB J;  2UXD J;  2F4V J;  2UXC J;  3JAM U;  4DV1 J;  1IBK J;  1I94 J;  1IBM J;  4B3T J;  4AQY J;  4DV2 J;  4DV6 J;  2MTL A;  4DR4 J;  3T1H J;  3J81 U;  4X62 J;  4JI1 J;  3OTO J;  4OX9 J;  4JYA J;  4DR6 J;  1HR0 J;  4DV7 J;  2KL8 A;  4LFC J;  3J7A N;  4B3R J;  1HNX J;  4LF8 J;  4B3M J;  4JI8 J;  3J80 U;  4KY3 A;  4KYZ A;  5IWA J;  3D3C J;  2MEW A;  5FLX U;  3W1Y C;  4B3S J;  2UUC J;  4DV5 J;  4YHH J;  1IBL J;  4DV3 J;  4DR3 J;  4X65 J;  4JI4 J;  1XNR J;  4LF4 J;  1HNW J;  3IMQ J;  4JI7 J;  4DV0 J;  4DR1 J; 
#chains in the Genus database with same CATH topology
 5AXL A;  2G0I A;  5EGY A;  3OHA A;  4AQY F;  2UUB F;  1URR A;  2MLY A;  2HHS A;  3H4D A;  4ES1 A;  1HW9 A;  4I64 A;  4UST A;  2XO7 A;  2IVM A;  2WHO A;  2MMY A;  3NOG A;  1JB0 C;  1QD1 A;  1YRX A;  4R0E A;  1XWL A;  1VC5 A;  4WE1 B;  3R2C J;  2IAJ B;  2N82 B;  2IBK A;  4NEY A;  1N36 J;  2DGV A;  2YX1 A;  3FGV A;  4RW9 B;  1L3K A;  4ZVP B;  4JI5 J;  2CQB A;  4HHU A;  2V94 A;  3IAS 9;  5LMN F;  2I9S A;  3LF0 A;  1T03 A;  4ED1 A;  1H98 A;  2GHW A;  2X1F A;  2VU5 A;  3LP2 B;  3J7Z 5;  3SCJ E;  1TL3 A;  2DXD A;  1UKU A;  3VAK A;  1ZPV A;  1UMJ A;  3DM2 A;  3GYN A;  2AEJ A;  3GLJ A;  3HVW A;  1OY8 A;  5KG4 A;  5J1P A;  1YJT A;  1IWA A;  2RS8 A;  5E5N A;  4WII A;  6AT1 B;  5LMU J;  5KFA A;  2M7S A;  1RQ0 A;  5J2Q A;  5DQG A;  3NY0 A;  4IRC A;  2IIH A;  2Z0G A;  4JI1 F;  4DQP A;  1LOU A;  2MJN A;  1HHQ A;  3BZQ A;  4O4R A;  3MR5 A;  1XN9 A;  3FVY A;  3TA0 A;  2B9W A;  3NCQ A;  4GVB B;  5KFR A;  2HSE B;  3W66 A;  3VAG A;  4AL5 A;  4EBE A;  1HWL A;  1UZH A;  3FZ2 A;  3P45 B;  3R6G B;  3LTO A;  2MQN A;  4Q8F A;  4LF7 J;  2NZ4 A;  4ECW A;  1XIQ A;  4MFB A;  5K8P A;  2BE2 A;  5KFC A;  2HHH F;  3QAT A;  3DRS B;  4L73 A;  4K4X A;  1M5O C;  1EAY C;  3MOZ A;  2UVV A;  2OO4 A;  2M70 A;  3IC1 A;  3PO4 A;  2KYX A;  1ZOT A;  2QYC A;  2W2Q P;  5CYM B;  1SL1 A;  3WIV A;  5DDP C;  4OJ1 A;  1NZA A;  2BV3 A;  1R89 A;  1HBN B;  1WAC A;  2QSF A;  1Q1K A;  7AT1 B;  3ILL A;  1EP4 A;  5CHC B;  5D0H A;  5E3Q A;  2XC9 A;  2B9X A;  4ECV A;  1S72 S;  4LF6 F;  4C8Z A;  5AXN A;  1S76 D;  4YY3 F;  2HHT A;  5KG0 A;  1GX6 A;  2LMI A;  3CJK B;  1GXT A;  2HQF A;  4DR4 J;  4ZK7 M;  1T9T A;  3CC2 S;  4FP9 A;  2AGP A;  2PN6 A;  2DHG A;  4WYL A;  3TX0 A;  1VHF A;  1JK9 B;  3M2V A;  4YHH F;  4M8L A;  3OTC A;  4LSN A;  1RT5 B;  3CD6 S;  3KK1 B;  1UEK A;  1UW4 A;  1QAX A;  3ZZZ A;  4YUD A;  2QA4 G;  1FDD A;  3B4M A;  3F44 A;  4JV2 A;  2GIF A;  4F3M A;  3BSC A;  5GAE U;  1RA6 A;  2KRB A;  1VRU A;  4OYA A;  2DNY A;  1N8R T;  1N88 A;  2NXJ A;  3I55 S;  3KK3 B;  3CUN A;  4DFJ A;  2XNR A;  4NYO A;  1DTT B;  2G0C A;  3ENQ A;  1TL1 A;  3J7Y U;  3EZO A;  4PXC A;  1IJE B;  1DUR A;  1TMM A;  3IS9 A;  2ZOF A;  4I6Y A;  3S1T A;  2ROP A;  2QA2 A;  2ERR A;  4O3N A;  1WEX A;  2EC2 A;  1BQN B;  4DXL A;  4U8Y A;  3H90 A;  2DNK A;  4AXJ A;  1X60 A;  5FLX U;  2UUA F;  4CLT A;  1VQ7 S;  1DTQ A;  3W1Y C;  4ZOS A;  4CH0 S;  1DHM A;  2DO0 A;  1MWY A;  1XMB A;  1VIO A;  4ES3 A;  1SC6 A;  1Q0N A;  5LMU F;  2UUC J;  4X4N A;  2V5H G;  3GWC A;  2ROE A;  2QLF B;  4ZMM A;  4I6A A;  3CO9 A;  2C2E A;  1M90 T;  2R8I A;  1S1W B;  1VJQ A;  1S1U A;  3MGJ A;  3I5B A;  2DNN A;  3VAF A;  2ASY A;  1H2T Z;  1U24 A;  2HRU A;  4ZVO B;  1NK9 A;  4ZIW A;  4LF7 F;  1JJ4 A;  1U25 A;  1PSD A;  1EP4 B;  2J5A A;  3HT0 A;  3NWR A;  4UF4 A;  3U27 A;  3SQO P;  2C3M A;  4NLD A;  3HZG A;  1F5C A;  3GCW P;  6FD1 A;  3UE2 A;  4C8M A;  1OSC A;  5KT3 A;  5KFU A;  4YB7 A;  4O0N A;  3JQK A;  4DZD A;  1HYS A;  3TVZ A;  2G2Z A;  4OYW A;  4DSF A;  2J8S A;  2VJU A;  2GGP A;  3IM8 A;  2Z8Q A;  3M32 A;  5DGA A;  2M8H A;  4WP3 A;  4DCP B;  3DLL Q;  2BJ8 A;  1QY7 A;  4I2Q B;  4EYI B;  4JI0 J;  2MPU A;  2ZH3 A;  4DQS A;  3ZZ0 A;  4J9R A;  3VVT A;  5BYQ A;  4J37 A;  1NPP A;  4LF9 J;  4PYA A;  3DOM A;  4ZP8 A;  3WX8 A;  4F0K A;  7FDR A;  5KFO A;  3US5 A;  2EFO A;  2H5I B;  1FXR A;  2BE9 B;  1EKR A;  2E1R A;  4LSN B;  2HIQ A;  3UN3 A;  4J9L A;  3PEH A;  3KNA A;  1Q82 T;  2C2M B;  3BKF A;  5DO2 A;  4Y3C A;  2Y8Y A;  2BM0 A;  3KLH A;  4OYP A;  1AZS B;  1MU2 A;  1PBU A;  5SZT A;  4A8M P;  5L1J A;  1OSD A;  2ZH5 A;  5LSO A;  3O3L A;  2VZ9 A;  5J2M A;  3DNC A;  4F8R A;  3GCX P;  1FX2 A;  3BR8 A;  5HAT A;  1KKH A;  4PXD A;  3PJW A;  1VBZ A;  2HNZ B;  1U6F A;  2DRD A;  1EIY B;  4B3O B;  3MR2 A;  1NDC A;  2MLX A;  1RU1 A;  3I0S B;  4AFF A;  3Q8V A;  3MD1 A;  1RWU A;  1X4H A;  4NX9 A;  2XUL A;  5HP1 A;  2FJW A;  3PW5 A;  4KGV B;  2B4P A;  4ZPB A;  3W2W A;  3KLF B;  3W9J A;  2O66 A;  2JDJ A;  2AYM A;  2RE1 A;  2RF2 B;  4GO7 X;  4WWS A;  4YY3 J;  4L75 A;  3DOL A;  2IRX A;  2YPZ A;  2L48 A;  1RWW B;  3B78 A;  4H4O A;  3QLH B;  2DIU A;  4P10 A;  2CQI A;  3CCT A;  4ZVE A;  2VG7 B;  2KU7 A;  1VBX A;  4A48 A;  2KHD A;  1RT7 B;  4W90 B;  4J9O A;  1NDP A;  1U02 A;  1WSV A;  2ZE2 B;  4TU8 A;  1RT2 B;  2B5J A;  4YR2 A;  5K14 A;  1NJZ A;  1HQU B;  2FD2 A;  4YS2 A;  2DCU B;  3A13 A;  3KG4 A;  1T9U A;  1JLF A;  1VQS A;  1SJQ A;  4DV3 F;  2PGC A;  3C14 A;  3DU6 A;  2FVC A;  4IH5 A;  4K8R A;  5C25 B;  4DV7 J;  1S0V A;  1AUS L;  2M88 A;  4ILL A;  3J7A N;  4DHV A;  5HAO A;  2C2R A;  4MIB A;  2JVR A;  3TJA A;  4WFN Q;  1M5S A;  5DGB A;  2G13 A;  2VPY B;  3A12 A;  4N5S A;  1U6B A;  3U1N A;  4V19 J;  3SI8 A;  2EC0 A;  1SBR A;  3ULH A;  2XMU A;  4U7U K;  4Q7A A;  5A6P A;  4ZLN A;  4ECQ A;  4ILM A;  2CJA A;  3HMJ G;  4CP5 A;  4LR8 A;  5ETN A;  4RNM A;  1VFJ A;  2EVZ A;  1AZS A;  2FHO B;  2ILZ A;  2RT3 A;  2YKN A;  4JI8 F;  1NKB A;  4IRD A;  2R2R A;  1FA0 A;  2OEJ A;  4JB8 B;  4YB6 A;  3IRX A;  3ENV A;  3SDE B;  2BDP A;  3NG8 A;  1RHJ B;  2C3O A;  2YNF B;  1VRQ C;  4OLP A;  1A0O B;  1VLY A;  1S49 A;  1PCA A;  3MCS A;  4ZJL A;  2HRT A;  2WB4 A;  2Y1R I;  5H9E K;  4NXM F;  1VS3 A;  4NLS A;  5DLG A;  4WU3 A;  1M1G A;  1XR7 A;  5D8H B;  4B9U A;  2F63 A;  4KO0 A;  3EX7 B;  3HK2 A;  5E3C A;  4C0H A;  3BQ0 A;  1YK9 A;  4ALZ A;  1CC7 A;  3AFG A;  2DH9 A;  1C0U B;  2CPF A;  5CA5 A;  5DDR C;  1S1T B;  1V5V A;  3W5Y A;  1HI1 A;  2ZKU A;  2ZVI A;  3UNG C;  3IR7 B;  4MKV A;  4CYU A;  4DL0 C;  2ATC B;  4F25 A;  3MM8 A;  3IMQ J;  4M5M A;  4EU0 A;  2YNH B;  4TU9 A;  1NSA A;  2CUY A;  1UTA A;  3K8W A;  2L9D A;  5L1I A;  4YQW A;  1BWV A;  2QIF A;  2F9D A;  3MD3 A;  4NLR A;  5KTQ A;  2EKY A;  3OTE A;  1NDL A;  2XYP B;  1FES A;  1HQU A;  4MIW A;  4P73 A;  3KLI A;  3DRS A;  2EG1 A;  3O6Q A;  1C1C A;  1S6Q A;  1PBA A;  4QIV A;  5AE1 A;  2ZIT A;  1ELO A;  2H5E A;  3KJF B;  3HXM A;  3D3B J;  3DGP B;  3ENW A;  4C98 A;  1TTH B;  1U1L A;  2OJ3 A;  1SKU B;  5D3G A;  4KFB B;  1ZH5 A;  2FUG 9;  3CGI A;  1HNV B;  4OI3 A;  1FER A;  4ZIV A;  2Y3Y A;  4TQS A;  2J0Q D;  3HSD A;  2FVP A;  1QE1 A;  4PUO B;  3Q23 A;  3H25 A;  1IR2 A;  1WI8 A;  4PG7 A;  1MW7 A;  2VV5 A;  4DS4 A;  2HHH J;  2JSX A;  2IHR 1;  3QIP B;  4C8N A;  3BR9 A;  3Q89 A;  5L38 A;  4LRE A;  3EPG A;  5KT6 A;  4HDH A;  5ETT A;  2F7V A;  4LFB J;  1KOH A;  4F67 A;  2VFU A;  5LT5 A;  1BUX A;  1U48 A;  5FJ4 A;  3Q2S C;  3L9Z A;  5MAO A;  3QRR A;  5LXY A;  3CW2 C;  3OFH A;  3OL6 A;  2ASL A;  1CBK A;  1ZM4 A;  2IYI A;  4WXW A;  5DG7 A;  2OEK A;  2CAD A;  2LVW A;  3PVX A;  1RT1 A;  2H3E B;  4LSL B;  5U47 A;  2IA0 A;  2JEJ A;  3K5L A;  3V81 B;  3B54 A;  2HFN A;  2IA6 A;  5KFV A;  4GVL A;  5C2G A;  3MR3 A;  2QMU B;  3VF0 B;  2B8P A;  3CJ5 A;  1F9E B;  1TL5 A;  1L3S A;  2IBO A;  1IJF B;  1MN7 A;  4LFA F;  3DOK A;  3LH2 S;  2XNQ A;  2Y0S D;  2I1R A;  3HSJ A;  2W25 A;  1TMJ A;  2IC3 B;  4IFV A;  4S0M A;  2MZ1 A;  1N0U A;  4PG8 A;  1UVL A;  3LP1 A;  1N52 B;  4JI2 J;  2IM2 A;  4ID5 A;  1HBM A;  2U2F A;  4F04 B;  4KFB A;  2GQC A;  4DV1 J;  2LXI A;  2E7W A;  3AH6 A;  1URN A;  1T02 A;  5KFF A;  3OFG A;  4K4Z A;  2OSQ A;  5F8M A;  2IRU A;  4DPY A;  3D5M A;  4C7Q A;  4IR9 A;  1AW0 A;  2MTL A;  4PXB A;  4PAA A;  3PNI A;  1DFD A;  2V4J B;  1GMW A;  2A0F B;  2C2O B;  1IR1 A;  4LRA A;  3R7S B;  1JJH A;  4OX9 F;  2N7C A;  3X1L B;  1TKX B;  1EB0 A;  2C1E B;  4RW7 B;  5B0B A;  4C2M A;  4DN9 A;  3LWL A;  2HZA A;  4C3K A;  4CYU B;  2RU3 A;  2WK4 A;  2EFV A;  2ZD1 B;  3LAM A;  4EZ6 A;  2J9E A;  2HFZ A;  5HMY A;  3CCS S;  3BO3 A;  3T5H A;  2KM8 C;  1TK0 A;  2DT9 A;  1UWA A;  2VAS A;  4KV8 A;  4QYZ J;  2CPH A;  4DV0 F;  4DWI A;  2PA3 A;  2XTJ P;  3GIL A;  2KI2 A;  3DM2 B;  4MJK A;  3OFE A;  1HA1 A;  1JLE A;  3J81 j;  3OTO F;  2K1R A;  2Q6B A;  5J2P A;  5B0C A;  2CNN B;  5F8N A;  1FE0 A;  1TP7 A;  2E1P A;  2IYG A;  3LP2 A;  1H7X A;  3NWG A;  2FQQ B;  3PRD A;  4MYU A;  5IWA J;  3QGP A;  3QO9 B;  3SQG A;  1PYT A;  1Q81 T;  1QSS A;  2KXN B;  2IM0 A;  3FSY A;  3HSG A;  1KFS A;  3MFH A;  4OLO A;  2YPY A;  5DQI A;  3RR7 A;  4TYB A;  3O2I A;  2QL9 B;  2E5J A;  4P6Q A;  1WI6 A;  2OPS B;  4ZKA A;  5B08 A;  2DR5 A;  3THP A;  4DUY F;  4KGX B;  4B3S J;  3HFZ B;  1DBD A;  3MR7 A;  5KT5 A;  4NYZ A;  3MMB A;  3OTB A;  4DR3 J;  5HRO B;  4O3P A;  5CH7 B;  5HVG A;  3NGR A;  4RW4 B;  1LW0 B;  4I0W A;  1Y9O A;  5M2U A;  1GMV A;  3VCD A;  1ZYQ A;  1EX8 A;  3QT7 A;  1XNR J;  5HL7 Q;  3K7R A;  4MYT A;  4TKT A;  2DR7 A;  1LK5 A;  3VGV A;  1C0T B;  4LF4 J;  2RH3 A;  4LR7 A;  3TUZ C;  4QQB A;  3TX8 A;  1QUV A;  3T1H J;  2HVI A;  4IFV B;  4LF5 F;  1WDD A;  1EET B;  2JC1 A;  1JLF B;  1YVF A;  4G1I A;  2CPE A;  1C4A A;  8ATC B;  2J0X A;  3EVO A;  3IGV A;  1SL0 A;  1UVK A;  1VMB A;  3FQL A;  1RTI B;  2VQE F;  2P6T A;  4NZ0 A;  1WC0 A;  1GX5 A;  4RBU A;  4OI0 A;  2RDI A;  5JXS A;  3L7P A;  4PAB A;  5GAD U;  3FBF A;  5CZX A;  3BGR B;  3BKT A;  3PHT A;  4NL5 A;  2JH3 A;  5T7L A;  2CIM A;  2MQ8 A;  5JMN A;  4DL4 A;  1TFY A;  4MK8 A;  3QLH A;  4Z2X A;  4OYB A;  1XEZ A;  1T8E A;  3DRR A;  4HL9 A;  3PG9 A;  3OXG A;  2CVI A;  1KDN A;  3FEY B;  1CG2 A;  2FJE B;  1RT3 B;  3AXM A;  4CIO A;  3GIK A;  3MMB B;  4C8Y A;  5HRO A;  1RTZ A;  3M8Q A;  2DEJ A;  2CNK B;  1HW8 A;  2DR9 A;  1HFE L;  1Y10 A;  4JI6 J;  2DRA A;  1CSJ A;  3HLU A;  2PEB A;  5F8L A;  3UVJ B;  2Y1I A;  1U26 A;  1NHU A;  4USM A;  3OBI A;  2ADC A;  4W92 B;  4U7C A;  2IVF B;  1UFL A;  1D09 B;  2VFR A;  2CQ0 A;  3RW6 A;  4URQ U;  5B0E A;  4ZJQ A;  3IR5 B;  4DOZ A;  5D6G A;  2QC3 A;  1VLO A;  4URS A;  3O5T B;  1K9M T;  2PFF B;  1FTR A;  2KJW A;  3DLE B;  3P5T L;  4QIE A;  1HKA A;  3EXY A;  3TQE A;  1JXV A;  3TZW A;  3IN5 A;  1BWE A;  3N0V A;  4J9V A;  2QSW A;  5CAA A;  4E2F B;  3TI0 A;  4FYD A;  4MKA A;  3CDW A;  5KG7 A;  2R8H A;  4F02 A;  1GH8 A;  2B43 A;  3A1Y G;  3RB4 A;  5HLF B;  1ITP A;  3T9Z A;  5JVH Q;  1N5T A;  4IO9 Q;  2IM3 A;  3TOQ A;  2XLI A;  2UUB J;  4PZV A;  5D0R A;  3ISN C;  3RGI A;  3B82 A;  1MRO A;  4RWW A;  1U2F A;  1VJW A;  2QGF B;  2XSJ A;  3CSK A;  4K59 A;  2R8G A;  3MEG A;  4R8U B;  3CD0 A;  3CWJ A;  1RLC L;  5DM6 Q;  3CME S;  2LU2 A;  2IAJ A;  2IPO B;  3M2U A;  5KT2 A;  4ELU A;  2ZDP A;  1DZ5 A;  2UVR A;  1XNR F;  2QA4 S;  3THT A;  3SEO A;  3MMJ A;  4MK7 A;  2GGP B;  2PMH A;  4GRS A;  3ITH A;  4EMD A;  1VQK S;  2QRR A;  4RNH A;  1DLO B;  1YJV A;  1TV6 B;  2KL8 A;  4U95 A;  3CCJ S;  4C8L A;  3UN5 A;  3KWM A;  3AD8 C;  3M8Z A;  4OHY A;  2A3J A;  3WIU A;  1OYD A;  5HLF A;  2FGC A;  5CQG A;  2MZJ A;  2RQM A;  3ZTQ A;  3BJY A;  4OYZ A;  2HVE A;  5KOX A;  1NKC A;  4PR6 A;  1S1X A;  3M05 A;  3TZY A;  4DLG A;  4DFK A;  4H4K A;  3DGV A;  3BN4 A;  4KQZ A;  1S0M A;  1VQ8 S;  5JVG Q;  1I1G A;  2M4M A;  1JMT A;  2NUH A;  1HYS B;  1LWC A;  1UJ5 A;  2D3U A;  2G1H A;  2W4C A;  3IBC B;  4ZPA A;  4QWE A;  3CCQ S;  4OHZ A;  1U47 A;  1RT1 B;  4LSL A;  5K20 B;  2GC8 A;  4KSE B;  4P72 A;  4RW9 A;  5A0Y A;  4A8O A;  4BC7 A;  1S0N A;  4YB5 A;  3IG1 A;  1X5S A;  4ZP6 A;  4C3M A;  2CQH A;  1MMN A;  4XPE A;  2MB0 B;  4WK3 A;  1JJC B;  4DR5 F;  3NGU A;  2F4V F;  4LQ9 A;  3TP2 A;  1H73 A;  2MQM A;  2E7X A;  1TK8 A;  3LPY A;  1IBL J;  2DPJ A;  2AYG A;  2I0X A;  3QIP A;  3HD2 A;  4FYY B;  2JEF A;  2C3U A;  4A8K A;  1VIX A;  3JS9 A;  1U2C A;  3FMW A;  1JLQ B;  1YRT A;  5DDQ C;  3BGF A;  2KFZ A;  3KLG B;  2DB1 A;  4DV2 F;  3GYG A;  3H2L A;  2J9C A;  4H4O B;  3VGU A;  2FIU A;  1VR6 A;  2JRS A;  3GSI A;  1RLD A;  1VQM S;  1T3N A;  2V8P A;  1OO0 B;  5F3T A;  3KLV A;  4K4V A;  1NK8 A;  1SVD A;  3AAW B;  3KK2 A;  2RUG A;  5HJX A;  3QT5 A;  1K8A T;  4DR7 J;  4FKX A;  1B7F A;  4WZQ A;  4X4V A;  3GU0 A;  5DG9 A;  4UQT A;  5HP1 B;  1QUP A;  1R27 B;  2DY1 A;  4CTA A;  3KG0 A;  4ZDN A;  4AD6 A;  2BUN A;  3PY8 A;  2V9W A;  2COL A;  1RAB B;  3PDN A;  1Q53 A;  4PXE A;  4MTP A;  2G2Y A;  2R42 A;  3R2D J;  1TKZ B;  3KKF A;  3RRK A;  1C4C A;  4DSJ A;  2EBG A;  2I5J A;  3ISZ A;  4RUH A;  5K9F A;  3GR1 A;  5F9L A;  3JSM B;  3KOA A;  1LW0 A;  4JV1 A;  3OR1 A;  1ZA1 B;  5HBM B;  1T9V A;  4QOT A;  3HT3 A;  1S1T A;  2YY3 A;  4ZHR A;  3Q8S B;  3CCU S;  2BOA A;  3HFK A;  1IBK F;  3TUP A;  4N41 A;  1VYA A;  5D0G A;  2IMO A;  1LW2 B;  1VIS A;  4X84 A;  5AJ3 J;  1WC5 A;  4RX6 A;  2QO3 A;  3H59 A;  5B7W A;  3OJU A;  3D6F B;  1RAE B;  3C16 B;  5LM7 E;  1K1S A;  1OQ3 A;  5HI7 A;  5HQL A;  4RUB A;  3QGH A;  3IRX B;  3NMA A;  1Q7L B;  2HQD A;  5B09 A;  1M1K T;  4JOU A;  3C15 A;  4PG5 A;  5IT0 A;  5C2C A;  2HVZ A;  1M1H A;  2IJN A;  1N0V C;  3G82 A;  2HHP A;  5D4L A;  1U49 A;  2DR6 A;  4TU7 A;  2AX1 A;  4M5K A;  3MM6 A;  2NQP A;  1MNE A;  2L3M A;  1WHW A;  2DH7 A;  2W2M P;  1UFK A;  4FNH A;  5BXI A;  2GQQ A;  4JV0 A;  1WEL A;  1I94 F;  3D66 A;  2OI2 A;  4QWB A;  4O4G B;  1VRU B;  5I3U B;  3LAN A;  3EUN A;  2WSC C;  2YVS A;  4XDD A;  1S7H A;  3MWB A;  3KJV B;  1B0V A;  1UVN A;  3AOD A;  3L95 X;  4ZCI A;  3S01 A;  2HBR B;  1RTI A;  5KFJ A;  1UET A;  2F3J A;  5GAH U;  4OX7 A;  2HS4 A;  1NKE A;  1N4L A;  4J9U E;  3J81 U;  3E51 A;  4IOA Q;  1NM2 A;  3DFE A;  3H7H B;  3C3L A;  1U09 A;  3TAN A;  2DGX A;  2W7O A;  5GAG I;  1TKT B;  1E6V B;  1YQH A;  1UWB A;  2Y1L B;  3I82 A;  2W24 A;  1GMU A;  3JSY A;  1BHN A;  3RBE A;  4U8V A;  4L3K A;  2F40 A;  2ZH7 A;  3LOU A;  5KFM A;  2R8K A;  2QN6 B;  3ADA C;  3KJN B;  2W7A A;  2I2Y A;  2YBV A;  3DOL B;  4NML A;  1TR0 A;  3FUY A;  3OTD A;  4WPA A;  7FD1 A;  1UAW A;  3H20 A;  5K8N A;  2Y8W A;  1D3W A;  3PJ9 A;  3W60 A;  3BQ2 A;  3RAX A;  4DEZ A;  2DHA A;  2FJB B;  1FFG B;  2WVF A;  2Z2M A;  3DCA A;  3MEG B;  4R8U A;  3SMZ A;  2MKI A;  4CM0 A;  3SCL E;  2EEY A;  1AB8 A;  4KY3 A;  5IS2 A;  2O1P A;  4CLZ A;  3S8S A;  4YP3 A;  3OV7 A;  4EBC A;  2QLW A;  2HRY A;  2BYC A;  3DHX A;  3I6P A;  3OUY B;  2HNZ A;  2JLF A;  4ZIT A;  5KFP A;  5I42 A;  3G8T A;  2DHS A;  4OZ2 A;  3BH6 B;  3BO2 A;  2AP6 A;  4ZVU B;  1GAO A;  1AT1 B;  3DLK A;  2BW7 A;  5LJ3 Y;  1V9O A;  3HHD A;  2VJV A;  1RBL A;  1LEO A;  2FLN A;  1QVF R;  1UCN A;  5C24 A;  2YNI B;  1L3V A;  5C5J A;  4D3H A;  4JI4 J;  2W4P A;  4IYQ A;  4Y34 A;  3FSX A;  4U67 Q;  4E0D A;  3KFW X;  1TZ0 A;  5IWA F;  2FC9 A;  1IKV B;  2H4W B;  3CTR A;  1QM9 A;  3BEG B;  2HBZ B;  3J80 Y;  4KHP F;  3DDK A;  3PYE A;  4KB7 A;  3BSA A;  1FXL A;  5H9F K;  2AGO A;  2GMJ A;  2H65 B;  1NJW A;  5J2N A;  2BJD A;  3G4S S;  1VQY A;  1K1Q A;  2BXJ A;  4K4U A;  2VKR A;  1ZA2 B;  1H74 A;  4MFB B;  3R5J B;  1NK6 A;  4QIG A;  3PM9 A;  1LQ9 A;  4JI5 F;  2HS0 A;  4DR5 J;  3TAP A;  1U6Z A;  2HQI A;  2ZHB A;  3EVW A;  1U1N A;  3W64 A;  2CFX A;  4QU6 A;  4HTI A;  3QBC A;  5BR8 F;  1EQ0 A;  2W8L A;  2VF3 A;  2IM1 A;  2YXL A;  2Z57 B;  4NA2 A;  2ZJR Q;  1J5E F;  3NCR A;  3M9O B;  1FEE A;  2CQ4 A;  2POK A;  4GKJ F;  2DR8 A;  3C66 A;  3NP5 A;  2GO9 A;  3V5R A;  2L9W A;  1IBM F;  3ILO A;  4DV1 F;  4B3T F;  2XWX A;  2CJB A;  4PQA A;  3UQS A;  4AE5 A;  4OYX A;  2CQ3 A;  1U1O A;  1YDL A;  3HCX A;  2VFS A;  2OML A;  1UP1 A;  1Z4U A;  2CG8 A;  3D28 A;  5DLF A;  1D9F A;  3OXL A;  1WHY A;  2CQ2 A;  4B08 A;  3N6M A;  5A76 A;  4NXN J;  3WC2 A;  3PX4 A;  3P49 B;  3RRG A;  1YJ9 S;  2HQC A;  2K3K A;  1IBC B;  2X51 A;  5E41 A;  5KT4 A;  2BA9 A;  3L4B C;  4CCH A;  4BWM A;  3W5Z A;  2B56 A;  2JLE A;  3NBP B;  4DR6 F;  3PAC A;  2PD1 A;  3SCI E;  4CLP A;  4EFA C;  1RA7 A;  3NNH A;  1KTQ A;  1S97 A;  1RWV B;  1NU4 A;  3HKW A;  4I2P B;  2JVO A;  4JI0 F;  5LMN J;  1DQA A;  1OMS A;  3IG1 B;  1I3O B;  2MHN A;  3M7V A;  2XCA A;  2XY7 A;  5F9N A;  2M8D B;  2D3O 1;  1OWX A;  1QAI A;  3MED A;  1NH7 A;  2V68 A;  3MXH P;  5T7L B;  2NS1 B;  1KD1 T;  1U0H A;  3KHG A;  1WF2 A;  2ZVS A;  1LWE B;  2ACY A;  2P8I A;  2MQP A;  3JAM U;  3OHB A;  2BMB A;  4QBU A;  3MAQ A;  1U45 A;  2HGL A;  2RQK A;  3D54 A;  2Q3P A;  3W5X A;  2DK2 A;  4JI7 F;  4IG3 B;  2I38 A;  3FRZ A;  1CJK B;  2YWG A;  1IBM J;  4B3T J;  1T0T V;  1VRT A;  4AQY J;  1FX4 A;  2C22 A;  3DDN A;  3AA9 A;  4HEA 9;  3CJ2 A;  5G0R B;  3CCZ A;  3O44 A;  4X62 J;  4HH0 A;  2JC0 A;  2R7R A;  2ZC3 A;  4ZN1 A;  3V6D A;  1FJ7 A;  1S6U A;  2K3I A;  3PRB A;  3QT6 A;  4KGZ B;  4WYW A;  4GKK F;  1U2R A;  3M6W A;  3ICL A;  4KT0 C;  1SJ3 P;  2PI5 A;  2HYI B;  3TVY A;  2HHX A;  1SL2 A;  1NJX A;  3N01 A;  4GMK A;  5LSL A;  1YBT A;  2OKQ A;  2C2D A;  2RVJ A;  2ZHA A;  1H2V Z;  2QJ3 A;  5A2Q Y;  3D1Q A;  4FDF A;  3UDV A;  2BJ3 A;  1HHT P;  3Q86 A;  5E3R A;  3GR0 A;  3LPE A;  2ATL A;  4ZLL A;  3MEC B;  1X0P A;  4DZ6 A;  1IKV A;  2H9Z A;  3RB3 A;  1S10 A;  1T9W A;  3OFF A;  3TWZ A;  1RHQ B;  1Q16 B;  1S48 A;  4FF3 A;  3NGK A;  4ID5 B;  1NND A;  1D0E A;  3VAI A;  4K4S A;  2KFN A;  2LA4 A;  1FRH A;  3HPO A;  2IVY A;  4B3M F;  3FBC A;  3QZ8 A;  2MHE A;  2NCK L;  1ZZN A;  5HMZ A;  3M6X A;  5A8R B;  1CS4 B;  1YKW A;  3GG0 A;  4IQM A;  3DLE A;  1I6J A;  1TL3 B;  4YHH J;  3BYR A;  1X5T A;  2B51 A;  1HWI A;  2YWE A;  4H4K C;  2KT2 A;  4ZPC A;  4DPU A;  1NHK L;  4EUV A;  3GP9 A;  1NSQ A;  3V81 A;  1SH3 A;  3K8V A;  4CLU A;  4KKO A;  5LJ5 Y;  3AD7 C;  2KJV A;  4USJ C;  1YJN S;  1T03 B;  2AJ1 A;  3UDE A;  3HZE A;  3MEC A;  1RWN B;  4MIA A;  3TA1 A;  3CJ4 A;  1BGX T;  2CZV C;  2V8G A;  1PC4 A;  3CD7 A;  3DMJ A;  4OHX A;  3VVU A;  1B3T A;  4IRK A;  3I56 S;  2XCP A;  2BKN A;  3E01 A;  3O8W A;  2ZEJ A;  2HLU A;  1RBO B;  4OI6 A;  2BRK A;  2WSE C;  5A2Q U;  2D41 A;  4USV A;  4DR2 F;  1RAG B;  2WB1 D;  1Y4Z B;  4L3N A;  1FNO A;  2A1B A;  1UWB B;  2DPI A;  2WON A;  1N32 F;  2GIR A;  4FF2 A;  3MDF A;  1ZM2 A;  2RHQ B;  1XMO J;  2F5G A;  2HFU A;  1F6T A;  3I96 A;  5DRK A;  5G0R A;  4JI2 F;  3UCG A;  4CO3 A;  1RAI B;  2AKW B;  2W1B A;  5EWG A;  3OVB A;  1R8C A;  2RQ4 A;  4M5D B;  4O3O A;  2V4Q A;  1U1M A;  4OZ5 A;  2QLX A;  3D6T B;  1HMV A;  2QYG A;  1IKY A;  4TY8 B;  2HIY A;  3FFI A;  1SB6 A;  2GVD A;  4PQU B;  2RNE A;  1NXI A;  4HLB A;  1XTZ A;  1UFW A;  2XGP A;  3OVA A;  1N54 B;  1RI7 A;  4O3R A;  3MM5 B;  4NCG B;  2V63 A;  2PMW A;  1Y5I B;  1PJ7 A;  3H2V E;  2FHM A;  4CLK A;  1PKU A;  1MMD A;  1NSK L;  3PIO Q;  2ZH1 A;  4XTT A;  4RNO A;  4DS5 A;  4NLT A;  2UXB J;  1YG0 A;  4HVZ A;  2R2S A;  2BAN B;  1H7W A;  1BMQ B;  3GON A;  3MCN A;  3VGT A;  3DXB A;  1CS4 A;  3BB5 A;  4J9K A;  3UFC X;  2CZ9 A;  4PWW A;  2ZM6 J;  3C6U A;  4ECY A;  1X4G A;  2NRE A;  3BDE A;  4FBU A;  1J5O B;  4GKJ J;  4B9L A;  3BQ1 A;  3JSR A;  1AA1 B;  1HWJ A;  4HR2 A;  4Q2L A;  2PEH A;  3CB4 A;  3FJ2 A;  1XMO F;  3I0R B;  2YWK A;  1FJC A;  1SJR A;  4DX7 A;  2BAB A;  4UTG A;  2EFN A;  1C1C B;  2PT0 A;  4QIF A;  2Q1L A;  1U8S A;  3SYZ A;  1U1Q A;  2LQ9 A;  4P7T A;  4HTJ A;  4RO0 A;  1S59 A;  4Q44 A;  1CEZ A;  3QPI A;  1O0P A;  2JHE A;  1RTH A;  5E33 A;  1GNK A;  2DIV A;  2YWW A;  3UWT A;  2GAG C;  4C0O C;  3TEG A;  1KVI A;  4YR3 A;  4JYA F;  3POT B;  1G6B A;  4JYA J;  1RT6 A;  3N28 A;  2KXF A;  1LKZ A;  4HI2 A;  4J91 A;  2BJE A;  4NOH A;  2CZ4 A;  4LFC J;  2N4D A;  2QT7 A;  1HHS A;  4CTA B;  1OY9 A;  3H4B A;  1T7P A;  2MDA A;  1TEL A;  3PKM A;  4UOG A;  2GW8 A;  2CJX B;  2RSQ A;  2UXD F;  3T9N A;  4OMF G;  2YH1 A;  1NK4 A;  3RAQ A;  3VR1 A;  2QFJ A;  3M9N B;  3KK2 B;  3MOJ B;  1N33 F;  2ZH8 A;  2AGQ A;  4B3M J;  2ZJQ Q;  2DXF A;  3J80 U;  3MED B;  4KHM A;  4KYZ A;  3K5P A;  5KG2 A;  5ETK A;  4LT6 A;  4ED3 A;  1FRK A;  3UD4 P;  4RZR A;  2K7J A;  5IV3 A;  4PRF A;  2KVI A;  4K4W A;  2XEX A;  2X1A A;  2GMH A;  1JXE A;  2G2O A;  2J6S A;  1ZAX A;  1XER A;  2MSS A;  3A3O B;  1OQ6 A;  1RGV A;  3OR2 B;  5KFT A;  2AJQ A;  3EDR B;  3RBX A;  5GMK a;  2P9C A;  4PG4 A;  4QYR A;  2UZA A;  2XMA A;  3M8P B;  1FWK A;  4P2M A;  3T3F A;  2V8D A;  2W7P A;  3KUH A;  4WXO A;  1X9M A;  4OL8 A;  1HLW A;  4M1K A;  5ETV A;  3RZA A;  4BLG A;  2HNY A;  1B0P A;  5CZV A;  5C25 A;  3GYX B;  2QE5 A;  2RS2 A;  3T19 A;  4DF4 A;  2ZOG A;  4ZVH A;  3ZZT A;  2HFS A;  1HNW J;  1JLE B;  3GJT B;  2RIL A;  1O8B A;  2PI4 A;  2Y9H A;  3W8P A;  3L7U A;  4F3O A;  2APO A;  1XNQ J;  4USU A;  2KG1 A;  3KJQ B;  1KS2 A;  1Q79 A;  2RKI A;  1I5O B;  3K5O A;  4UW2 A;  2MZS A;  2D3O R;  1AFI A;  3RRH A;  2GV1 A;  3IP0 A;  3MPY A;  4JI3 F;  1AYE A;  1OYE A;  1TKT A;  1WG5 A;  1SPB P;  3JTP A;  1GMW D;  5K14 B;  4ZJO A;  3W2V A;  4OYI A;  4OI1 A;  1N5S A;  3ZFV A;  1TV6 A;  2ZOM A;  4LF2 A;  1WWH A;  4DV4 F;  4DV4 J;  4RW7 A;  5HMW A;  4RBV A;  2FLO A;  1Q5V A;  4PUO A;  5HQ8 A;  3JQJ A;  2DHH A;  2ADB A;  1RTD A;  4ANE A;  3NAI A;  1TUV A;  4P2F A;  1FRX A;  1T9X A;  1F3V A;  2PO4 A;  1KNZ A;  1NO8 A;  2W9B A;  2HND A;  3M2U B;  1X4C A;  3Q8R B;  2W9A A;  5I3U A;  4M5I A;  4LF6 J;  2AWZ A;  3ILJ A;  1KLM A;  4K2J A;  3DRX A;  4O44 B;  1IKX A;  3S7R A;  2E1C A;  2KO1 A;  1FFW B;  2Z2L A;  3V6D B;  4RJV A;  2AJ0 A;  2Z56 B;  2C2N A;  1T05 B;  5IOL A;  3QSY B;  2JL9 A;  4M5G A;  2ALZ A;  2DJW A;  2JOQ A;  4WFZ A;  5KFG A;  2YX7 A;  3A4T A;  3MUR P;  2XS5 A;  1S1W A;  2GA7 A;  1FE4 A;  4P52 A;  3DLK B;  3I32 A;  2Q79 A;  4LIW A;  2IFX A;  3U1M A;  4V1A k;  1ZZF A;  3DLH A;  4N77 A;  3N5F A;  4LBH A;  1Y7P A;  5I42 B;  3RR8 A;  4DX8 H;  3KHH A;  3DRP B;  4USW A;  4WP9 A;  1LK7 A;  1BY9 A;  4U6P A;  3BO4 A;  2DNP A;  3KNG A;  4A8S A;  4QW9 A;  4HKQ A;  2ZWO A;  4EI2 A;  2F8M A;  3GIM A;  2E9Z A;  3GE9 A;  4ENO A;  1KBR A;  5IZH A;  4CO0 A;  1WG4 A;  2P2C B;  4WZM A;  5DET A;  2OEM A;  1PAU B;  4KAI A;  1UVI A;  1TL1 B;  2VL1 A;  4ZHR B;  2O67 A;  1X31 C;  3V2U C;  1TL7 B;  4WFX A;  4YN3 B;  4RW6 B;  2E44 A;  2ZBQ A;  1FDA A;  1K47 A;  1NEE A;  1XK8 A;  2BRL A;  4USI A;  3JTN A;  3UDL A;  5CCL A;  3B6B A;  2I5J B;  2MQL A;  3ELH A;  4X4Q A;  3KHL A;  4ECX A;  2F8E X;  3MM9 B;  3ILI A;  4W4M A;  3H8Y A;  2V2Z A;  1ZM9 A;  4RPF A;  2OLW A;  3R3T A;  3CMA S;  2FLP A;  2AYE A;  1NUE A;  3K58 A;  3AB4 B;  3M2R A;  3GPA A;  2KTQ A;  3EPI A;  2VG5 A;  1NPK A;  3TAM B;  4DMZ A;  2F1F A;  2LQJ A;  2VPZ B;  4G65 A;  3EVM A;  2HUR A;  3CO0 P;  3KMQ A;  4KJI A;  1ACM B;  4X2B A;  1EET A;  2FGO A;  3EDQ B;  4GC6 A;  1X4A A;  1S6P A;  3F56 A;  4RNF A;  4CT8 A;  3EWG A;  4P9S A;  2XQC A;  1UJ4 A;  4B3R J;  2XBP A;  1YJW S;  3UCU P;  1N5Y A;  3PJX A;  4IQX A;  4ICL A;  4C48 A;  2RAQ A;  5EX0 A;  3LO3 A;  1F9H A;  1WEY A;  4NLW A;  4Y2M A;  1PGZ A;  1PAE X;  2VD3 A;  3TZX A;  2MJU A;  2CG4 A;  3SV4 A;  3QQC D;  2BE7 D;  1R6V A;  2ZWP A;  3UDC A;  3DN9 A;  3LWM A;  3Q83 A;  2UVU A;  1HI0 P;  1PYS B;  4DR3 F;  1XNQ F;  2D9O A;  2CQ1 A;  2QMW A;  1KFD A;  2X1B A;  2XHW A;  3GV5 B;  1FO1 A;  1QTN B;  2BJ9 A;  1HBU A;  2MZR A;  3C46 A;  4WKR A;  4LIR A;  5BYR A;  2OD6 A;  3FCH A;  4TXS A;  3TUI C;  3NGD A;  3OJS A;  2XZT B;  4OX6 A;  1HR0 F;  1HNW F;  2DXE A;  2GVZ B;  2JEG A;  2JNJ A;  3T1A A;  3AOC A;  1REG X;  4FF4 A;  2Q66 A;  4B3O A;  1OY6 A;  4IH7 A;  4LQ3 A;  2HGM A;  4A46 A;  5DS7 A;  4N47 A;  2YNG B;  2VDI A;  4KR0 B;  1NRK A;  2NSC A;  4QIW D;  5CYQ B;  2D1C A;  2ZBI A;  3F41 A;  3K59 A;  3RAM A;  1J5O A;  2V9K A;  2HHU A;  1Q95 G;  1SIW B;  1RAC B;  4ZVF A;  4LRC A;  3M8S A;  3D1O A;  4DV0 J;  2H48 B;  3HUL A;  1IM6 A;  3TJ9 A;  4DR1 J;  4NXM J;  1U8W A;  4UUW A;  4G6V B;  5HO4 A;  3RJM B;  4Y2C A;  1XQI A;  2XGQ A;  1RU2 A;  2XYG B;  4Q0B B;  1H72 C;  1NB2 A;  1HNZ J;  1P8G A;  1TAQ A;  2YKP A;  1FEH A;  3R5B A;  4KGK A;  5KG3 A;  5K8O A;  2VON A;  2NYI A;  1FRM A;  4CLY A;  4ZCM A;  1P1T A;  1K73 T;  4OX8 A;  4NMX A;  2P9G A;  1QLN A;  4ZPW R;  1FCA A;  4CH7 A;  1N36 F;  3SSS A;  3AJD A;  2FB0 A;  4PPZ A;  5ETL A;  1HQE A;  3BBF A;  1RSC A;  1M5P C;  3PCO B;  5EWF A;  3PX6 A;  4ATN A;  3D7S B;  2GO8 A;  2IDE A;  1Z2L A;  3GFX A;  1S6O A;  1XR6 A;  3CCL S;  1FVQ A;  3CDE A;  4F4K A;  2BBE A;  1N33 J;  1TL4 A;  3RB0 A;  3ENA A;  5JUM A;  4DUT A;  1GK8 A;  3FCW A;  1JLQ A;  1UPM B;  4AUK A;  5BYS A;  1FT8 A;  1RUS A;  3R97 A;  2EW9 A;  1R43 A;  1SV5 A;  2XZW A;  4HDG A;  3CXC R;  2LDI A;  1FJG F;  3GQC A;  4G1P A;  2Q43 A;  4F4W A;  3IBF B;  2P9E A;  4UT4 A;  1NPR A;  3MMC A;  1RXO B;  1Y3K A;  2ROG A;  1SQE A;  4RR5 A;  4X4T A;  1ZM3 A;  4IDK A;  4NEZ A;  3GG1 A;  5KFZ A;  4MT1 A;  4ZCL A;  1E6Y B;  4I7F B;  4EK2 A;  3PFE A;  3CJR A;  1LWC B;  3AQO A;  1HIY A;  1R8A A;  1RCX B;  2F4V J;  1CJU B;  1VQ5 S;  2HK2 A;  5IM0 A;  3Q8U A;  5MLC V;  3UPF A;  2H51 B;  3DDI A;  4UOC A;  2WOM A;  1S79 A;  2J7K A;  1TVR B;  4K2X A;  1DTT A;  1S0O A;  1JLA B;  4LVN P;  5A8K B;  3EGZ A;  5GME A;  2R4F A;  3KUG A;  4LRF A;  1UVJ A;  4DFP A;  3NS7 B;  4G1Q A;  4YFU A;  4F26 A;  3MR6 A;  1JKH A;  3G71 S;  2OIH A;  3P3D A;  4LUB A;  3LP0 A;  3OTO J;  1HNV A;  2OTL S;  4CLF A;  3DGP A;  5KG5 A;  3BSO A;  1W2I A;  4I68 A;  4JBC A;  4I1T A;  3PYG A;  3PW7 A;  2Z4P A;  3SCK E;  4LJM A;  1S6Q B;  4QR2 A;  4DPW A;  2AMC B;  4I2Q A;  1HPZ A;  1ZTW A;  2VQF F;  1FFS B;  3AD9 C;  1WF0 A;  3HVA A;  3CCV S;  1RTJ A;  2AU0 A;  1REV A;  3J7A 1;  1FXD A;  5F41 A;  1MRO B;  1IR0 A;  1CJV A;  3AJ2 A;  4CQ1 A;  2KZM A;  3QYY A;  3CVK A;  1HL6 A;  4UY8 T;  2DEI A;  2VPW B;  3DYA B;  3MM8 B;  2P5V A;  3CIZ A;  4B9S A;  1IKX B;  4O23 A;  5E2Q A;  3G6V A;  5ETS A;  3CD5 A;  3V4M A;  4L74 A;  1YBU A;  2CPX A;  3DLG B;  3R7N B;  1B99 A;  2D3Z A;  3QID A;  4NYP A;  2ZH2 A;  4HYK A;  4FF1 A;  2GJ2 A;  1CQM A;  4IG3 A;  4RWX A;  1RAF B;  4C97 A;  2MKH A;  4F36 A;  4URG A;  4FS1 A;  2VA2 A;  3CJQ A;  3QMQ A;  3OLA A;  1GEH A;  4NPO A;  1N6Q B;  1TQL A;  3GV7 B;  4IUF A;  1HQ2 A;  1U0H B;  3O1L A;  1KHW A;  3R6L B;  4IH6 A;  4X65 J;  1S9G B;  2HWH A;  4V19 X;  3C6U B;  2IJR A;  3QAE A;  3R1H A;  4IFY A;  4PKD B;  4G1Q B;  4NXN F;  4C4W A;  3QAU A;  3K2Y A;  1TVR A;  4R25 A;  4OZ0 A;  1WKJ A;  1WNE A;  4B3R F;  1X7V A;  4CZC A;  2UVW A;  3LW5 C;  1S1V B;  3OQ2 A;  2BZ2 A;  4QZV B;  4USK A;  2XG8 A;  5RUB A;  5B0A A;  2LYV A;  2WCX A;  2G0J A;  2GNK A;  5KFQ A;  4WFB Q;  5D4N A;  4FXD A;  5CD4 A;  1TKX A;  1V3Z A;  1E6Y A;  3HI9 A;  3R5A A;  4I7F A;  3TRG A;  5J1E A;  1SKW A;  4RW8 B;  2QL5 B;  1Y00 A;  3GMG A;  3NEK A;  3OT9 A;  2WW4 A;  1PJ6 A;  5BR8 J;  1X0F A;  2G4B A;  2CJ9 A;  4OYM A;  1RT2 A;  4L6V 3;  4ED2 A;  5AE3 A;  1IQT A;  2WVB A;  3FZB A;  4DG1 B;  2OPQ B;  3HHL B;  2D9P A;  1FRL A;  4OYO A;  3U1L A;  1J27 A;  2ACM A;  5ADZ A;  1RT7 A;  3CJK A;  3NNA A;  2B8Q A;  1TK5 A;  1L3T A;  2ZBC A;  4Q45 A;  2FJD B;  1HBM B;  1DJ0 A;  4NLY A;  4F4X A;  2A6M A;  1RAO A;  2EPI A;  2NUU G;  2QZ8 A;  1ZTT A;  2GZO A;  3FMB A;  3IWX A;  3DU5 A;  3BDP A;  2VIH A;  2F9J A;  3OL7 A;  3T5J A;  3PYD A;  1XMQ J;  1NJY A;  4ITS A;  1B7Y B;  4WK1 A;  4EO8 A;  4KHP J;  3SSQ A;  2HWI A;  3QFH A;  1SKS A;  1R8P A;  5B0G A;  1AUD A;  1QSL A;  3VQT A;  5CCM A;  4P74 A;  4HAC B;  3Q2T C;  2XLJ A;  1WOS A;  3E01 B;  5GAG U;  3PIP Q;  2XO6 A;  3A8J A;  1WC4 A;  3H98 A;  2Z2Y B;  4ETX A;  2XS7 A;  2E1A A;  3R7B B;  3PW0 A;  3CED A;  4NCA A;  2GFF A;  3MUV P;  4M5H A;  2DO4 A;  2HVH A;  3J7Z T;  2V34 A;  4IO1 A;  3OR2 A;  5KFB A;  1N48 A;  1VQ4 S;  4J9S A;  2UXD J;  1JLB B;  3UW1 A;  4ZVG A;  4USH A;  1MU2 B;  1CLF A;  5I3P A;  3ZTS A;  1S1X B;  3KXD A;  5AJ3 F;  2BQU A;  2JWN A;  3X3U A;  3CC4 S;  1FD2 A;  1NH8 A;  4CLS A;  4KRW A;  4FBT A;  3AOB A;  4KPY A;  4WKY A;  4ED6 A;  1NB7 A;  5KFK A;  3IBW A;  1WHX A;  1W26 A;  2X1G A;  5A6W A;  5EHH A;  3OUY A;  3ETO A;  3N6N A;  4O44 A;  5DM7 Q;  3DOM B;  4JI1 J;  4WF9 Q;  1W2B R;  1RWO B;  3KYL A;  2VFT A;  2EKN A;  1NK0 A;  4I4B A;  1F0X A;  1HBU B;  1WOR A;  2EBE A;  3BYP A;  3HP6 A;  3ZZP A;  3D2W A;  1ZET A;  4B9T A;  1S9F A;  1IUJ A;  5ETO A;  3EGN A;  4OHW A;  3ZNU A;  4BHQ A;  1RTD B;  3G8Q A;  4IR1 A;  3OR1 B;  2BJ1 A;  5HBM A;  5T41 A;  1FJE B;  3E8O A;  4FYW B;  3SSR A;  1PYO B;  1T9Y A;  4OZN A;  2XMJ A;  1CUL A;  2B9Y A;  1N5Q A;  2Y0B B;  2MQQ A;  2MKK A;  3HHK A;  3LAK A;  1YJR A;  3MPD A;  1KC8 T;  4CNY A;  3BGO P;  1Q5Y A;  1HBO B;  3PHE A;  5AXM A;  1WUU A;  4DPO A;  3TAR A;  2AF6 A;  2VKZ G;  4QPX A;  3GFZ A;  2QFI A;  4LBP A;  2DNG A;  4HT5 A;  2RRN A;  4AL7 A;  4TY9 A;  1Q7Y T;  4Q8E A;  4PWD A;  3IA0 A;  2J8A A;  2XHC A;  1S99 A;  5CD4 H;  2QA1 A;  2VG5 B;  4OV6 A;  4RW8 A;  2BR0 A;  4F4A A;  4DX5 A;  3IR6 B;  2LQ5 A;  2NPF A;  1IQZ A;  1HNZ F;  4DX6 A;  2K06 A;  3LP0 B;  2R7W A;  3MM9 A;  3DC2 A;  5BJR A;  2L41 A;  4M5J A;  4J90 A;  3MUM P;  2RRB A;  1WHV A;  5I3Q A;  4RW6 A;  2DNZ A;  4B9M A;  2WOM B;  3LUY A;  4FXW A;  3JB9 k;  4F3Q A;  3FEX B;  3VZH A;  3HO1 A;  1A7G E;  1X8D A;  3NBP A;  4FYX B;  1SCJ B;  3ETM A;  4OV1 A;  5KFD A;  2B7C B;  3GJR B;  4M5L A;  5FII A;  3VAH A;  3D0G E;  4NRT A;  5H1S V;  5G4D A;  2E5L J;  2E5L F;  3QRP A;  5EN1 A;  4IDK B;  3A8K A;  2DNR A;  3KLE B;  2B4U A;  2FLL A;  1BLU A;  1N32 J;  2MXY A;  3ZXW A;  3KK1 A;  2KT3 A;  1CJT B;  1VK8 A;  2IRY A;  2LXF A;  2CA9 A;  4PG6 A;  4Z37 A;  2FVR A;  5DDO C;  3PV8 A;  1DY3 A;  5F8G A;  4DUZ F;  2MLZ A;  4I67 A;  3TAM A;  1Y0H A;  1FNM A;  1D8Z A;  2RU9 A;  2VC0 A;  3SZ2 A;  2QLB B;  3ZZO A;  2VQF J;  5KFW A;  3CCE S;  1C0T A;  2BEF A;  2LEB A;  2WTF A;  2YQ0 A;  4G3I A;  2CJQ A;  4LFB F;  2XI3 A;  4KGM A;  3ITH B;  1KWM A;  3UD5 A;  1UEV A;  5ITH A;  3BKU A;  2VHG A;  3RTV A;  2JFK A;  3QWU A;  1TL7 A;  4LBI A;  1RWK B;  3MAA B;  4Z7C A;  5AXK A;  1IKW A;  2A2D A;  2M9K A;  2OEL A;  2BW2 A;  5M2R A;  5HQM A;  1JJ2 R;  3MUT P;  1H38 A;  1TFW A;  4K0K J;  1AFJ A;  1F3F A;  3VGS A;  2V2K A;  5T14 A;  3SV3 A;  2GML A;  1KLN A;  1Z1Z A;  2MKJ A;  3HX9 A;  5D78 A;  4FVC A;  4ZLP A;  4RBT A;  4P7V A;  3TEH B;  5C24 B;  3L09 A;  1WTF A;  3NMR A;  2FY1 A;  4R5P A;  4KPC A;  2CXE A;  3HD1 A;  4C11 B;  2CPI A;  1NLK L;  2YNI A;  3D9B A;  4K5R A;  1H3D A;  3SFG A;  5J2P B;  4NE9 C;  3AOA A;  2BKP A;  1QAY A;  2OPP A;  2YKM A;  4BS2 A;  4NCB A;  2C3P A;  2OUG A;  2RKI B;  3W62 A;  2HZV A;  3K89 A;  2MZT A;  1YIT S;  2DH8 A;  1JLG B;  1U0S A;  2E5H A;  1F2H A;  2IDL A;  2N7Y A;  4NI2 A;  4X4O A;  2XY5 A;  1K0T A;  2C42 A;  2VUG A;  1IVZ A;  1T05 A;  4Y28 C;  4DU7 A;  2UV8 G;  3GFH A;  2J7W A;  3P8B B;  1Q78 A;  4ZVQ B;  2V0N A;  3KDO A;  4M5N A;  2UP1 A;  2AZ3 A;  2V69 A;  4CDI A;  2Y1J A;  5K8M A;  3P6Y C;  2V8H A;  3CJS A;  4A8F A;  5HVF A;  4OX9 J;  2JLG A;  2CQP A;  4DQI A;  4DR6 J;  1HR0 J;  5IT9 Y;  1FKP B;  1S57 A;  1ZS6 A;  3CDA A;  3VHQ A;  4X64 F;  4ED8 A;  3OSP A;  1SKR A;  2WW8 A;  4FXV A;  4ES2 A;  2GX8 A;  3LGN A;  1P9Q C;  2XS2 A;  4XIU A;  8AT1 B;  2XY6 A;  1KON A;  1NBE B;  3M6V A;  2AW0 A;  4M94 A;  2UV8 A;  1A9N B;  2OH2 A;  1TAU A;  2AEM A;  4TLQ A;  1FD8 A;  2F8H A;  4UZB A;  4F2S A;  2HBY B;  2CYY A;  1VRT B;  2J6T A;  4YOE A;  2CPZ A;  1RIS A;  4OZL A;  1FDN A;  4LVO P;  5EWE A;  3UD3 P;  3TUJ C;  2NYH A;  3HFV A;  3KLF A;  4MK9 A;  1Y5N B;  1SJ4 P;  1G4C A;  3KJV A;  2DGS A;  4ZVS B;  2OAU A;  3EE3 A;  4B3S F;  1LNQ A;  4DDF A;  1BC6 A;  1S7I A;  5J1E B;  2HLT A;  1SJF A;  3HVT A;  3CNQ P;  3OPK A;  4DCO B;  2FZC B;  4RUA A;  1PC5 A;  4DV3 J;  1UL3 A;  1B64 A;  4AYB D;  4I2P A;  4N76 A;  3UI3 A;  3VQS A;  2FVS A;  1BD6 A;  2R3V A;  1DAR A;  3GZ7 A;  4NLU A;  4DL6 A;  3G9C A;  3H5X A;  3JSB A;  1G2E A;  3L3C A;  4NWB A;  3ZTR A;  2IY5 B;  1VQN S;  3OW2 R;  2OPP B;  3K5N A;  2RML A;  1CC8 A;  1PJ5 A;  3JYT A;  2CDQ A;  1P9Y A;  2HMI B;  3W3S A;  3PXG a;  1VQ9 S;  4HHJ A;  4B17 A;  5CYJ A;  3H40 A;  3KG1 A;  3FSI A;  1R31 A;  1LWX A;  2XMW A;  3C16 A;  5F0W A;  3HSZ A;  2QL7 B;  4KIA A;  3L7O A;  1RAJ A;  2KFY A;  1KTV A;  2R7T A;  3H42 A;  3M2V B;  5EDW A;  2HFV A;  3LGH A;  4KC5 A;  4GKK J;  1Q8K A;  2BAC A;  1SUQ B;  1HAR A;  1YJ7 A;  1YLX A;  3QJP A;  1DAX A;  4RU2 A;  3I9V 9;  2C3Y A;  1R0A A;  2VG6 B;  1UA0 A;  5C42 B;  4NLG A;  2VFV A;  1QJH A;  5F0U A;  8RUC A;  1MWQ A;  4DL5 A;  2EWH A;  4F7V A;  1KQS R;  5D15 A;  4F4Z A;  2RJZ A;  4EGL A;  1WC3 A;  5DQH A;  3EGV A;  2ZUA A;  1WJ9 A;  3BM7 A;  1R0B G;  4Y65 A;  3RW7 A;  1CJV B;  4OQJ A;  4LF8 F;  1REV B;  1OIA A;  2CWX A;  2MKC A;  3AA8 A;  1RTH B;  5F8J A;  4FN5 A;  3MPW A;  5D0E A;  3HJF A;  2MQO A;  1FDB A;  3H2U B;  2DIS A;  2A2C A;  9ATC B;  2ILY A;  2WBM A;  3UNY A;  1D1U A;  5D77 A;  4KO0 B;  2EI5 A;  2FJA B;  2N3O A;  3H5S A;  4KH0 B;  4TQR A;  4DR4 F;  4Y2I A;  2G9O A;  2R9L A;  5DZ6 A;  4A8Y A;  1G1X A;  2R7X A;  2YQ1 A;  3BBB A;  9RUB A;  5FLX Y;  1KVK A;  3P4U B;  2J9D A;  3MAH A;  1X4D A;  1GTH A;  1AXQ A;  3PFO A;  4KHR A;  2KG0 A;  3I9Z A;  2DY9 A;  3N5B A;  4CO5 A;  1UZD A;  2ZZT A;  2OFG X;  1Q86 T;  4HHH A;  1JX4 A;  3MF5 A;  4K4Y A;  3OL9 A;  1QSY A;  2AQ4 A;  2XMM A;  2F4F A;  4YME A;  2PC6 A;  1CPZ A;  4C3L A;  4OFZ A;  3BF4 A;  1NHV A;  5IFM A;  1HQE B;  3T6J A;  3DMJ B;  5CAB A;  4OZ3 A;  2W9C A;  3ET6 A;  2GIQ A;  1RHK B;  4YB1 P;  5KFH A;  2YH0 A;  3MPU B;  2ZJP Q;  4A4J A;  1I94 J;  4ELV A;  2FPH X;  1WKL A;  2HBQ B;  2WRM A;  1G3O A;  4DL2 A;  3D4J A;  3G6Y A;  4DSI A;  3WDO A;  1NK5 A;  4N56 A;  3QO9 A;  4RLE A;  1Y5L B;  3SQG B;  3VTI A;  3PR4 A;  1RWM B;  4FVM A;  5LL6 d;  4KBI A;  1KEK A;  2ZM6 F;  4WIQ A;  5J2M B;  4B9N A;  3MTK A;  4WE1 A;  4DF8 A;  2VBX A;  4QR0 A;  1IKY B;  1MN9 A;  2XZD B;  3MM6 B;  3I4H X;  5A8R A;  1X5P A;  3BRE A;  3KLH B;  1SC4 B;  4ED7 A;  2B4V A;  2UXC F;  3QGG A;  4KE5 A;  2KM8 B;  2R7Q A;  1QE1 B;  3RUB L;  2ZZN A;  3HKZ D;  1M5V C;  1SQG A;  4Y2A A;  4RUC A;  4ANC A;  3PTW A;  2NXC A;  2YNG A;  3EZU A;  4PPD A;  4WJB A;  4YR0 A;  2ZBP A;  2QTW A;  3BS9 A;  3BV8 A;  2DNH A;  4ZP9 A;  1Q8B A;  1R6Y A;  1RE1 B;  1S9E B;  2DNO A;  2E5I A;  2L08 A;  2LXU A;  3MEE A;  2O3D A;  3HM9 A;  1RKJ A;  1SQF A;  3ZO7 A;  4QWA A;  4MMO A;  2E29 A;  2PII A;  3TAQ A;  2HND B;  1U7L A;  1WEZ A;  2M0G B;  2PMZ D;  1B4S A;  2OP5 A;  2WVE A;  3CJ3 A;  3EXC X;  3RYL A;  2CDR B;  2BVZ A;  1X4B A;  3W2W B;  4O3S A;  2MEW A;  3QZ7 A;  1IKW B;  2V50 A;  2D7S A;  2HAF A;  2OFH X;  1Q4R A;  2FYX A;  3ZZR A;  1P27 B;  1KR4 A;  3Q0A A;  4XK8 C;  2BM1 A;  4JUZ A;  1NK7 A;  3FC9 A;  3OD2 A;  5IT4 A;  2O01 C;  1FRJ A;  4QWD A;  4ELT A;  2LEC A;  1WF1 A;  2EG2 A;  1VBY A;  3UR3 C;  1S6P B;  2CQC A;  2IC3 A;  3G82 B;  4OIX A;  1CJK A;  3HHL A;  3MM7 A;  4UZC A;  1MSW D;  2YTC A;  3DOK B;  1JLB A;  2XI2 A;  3K5M A;  5J1N A;  4PYD A;  2LDY A;  4FPR A;  3RBD A;  1XR5 A;  3CJT A;  2AD9 A;  4MH8 A;  1ROF A;  2E9T A;  1RT4 B;  1NME B;  1T11 A;  4UY8 5;  2K8G A;  3G8S A;  3NGT A;  1O51 A;  5KFS A;  3UVJ A;  4C0B A;  2DGO A;  1SH0 A;  2CAJ A;  2V2Q A;  1HWK A;  1WG1 A;  1ARO P;  2B6A A;  3TW0 A;  4NZ7 A;  1G7C B;  4BCA A;  4X4S A;  3C6T B;  2W9C B;  2UUT A;  2J9D E;  3HVR A;  4DL7 A;  3V4I A;  4HAC A;  4N8N A;  2HGN A;  4EO6 A;  2EFQ A;  1R8B A;  3PKY A;  2W2P P;  2VBY A;  1KVJ A;  2CJK A;  2DVI A;  5HN0 A;  2XB2 D;  1P6T A;  5IM0 B;  4AT1 B;  1FKO B;  1Q8L A;  3NAH A;  4DPX A;  3A8I A;  5F8I A;  2B4O A;  4ZA1 A;  1U1K A;  2FJV A;  2FHK A;  1RP5 A;  2C28 A;  2MYF A;  2DKO B;  4WTO B;  3CMQ A;  4GC7 A;  2ABY A;  1EZZ B;  2E1M C;  3HVT B;  3M1V B;  4X4U A;  2NR0 A;  1CQN A;  1RWX B;  3NNC A;  2E7V A;  2FTR A;  4C9D A;  1RT4 A;  3JAM Y;  4BC9 A;  2J0W A;  3I5A A;  3ZZU A;  2B9E A;  5E0O A;  1F60 B;  1PG5 B;  3TO8 A;  5HSP A;  4ECR A;  1R0C B;  1S4F A;  1SJ1 A;  2VQE J;  1X9W A;  2PA8 D;  1T94 A;  3R27 A;  5FDL A;  5IC6 B;  2AX0 A;  3MM7 B;  4PWD B;  1YJU A;  3JQM A;  2J6U A;  4LSZ B;  3M2R B;  5C7P A;  2XLK A;  1JNR B;  1RK8 A;  2A10 A;  2ALY B;  2HWT A;  1OPZ A;  1N34 J;  4DV6 F;  1YWX A;  4C6A A;  1WSR A;  4X65 F;  4EBD A;  1VBK A;  4DUZ J;  3P5B P;  1SC1 B;  2MGZ B;  2OPR A;  2ZDO A;  1UA1 A;  4Q2M A;  4RL1 A;  2KB2 A;  4MKY A;  4HH1 A;  4CM2 A;  5JJB A;  1WC6 A;  3TQ1 A;  1DLO A;  2CPY A;  2GCF A;  1F5A A;  2SXL A;  3A8E A;  3GJS B;  5HK4 A;  4QWC A;  1NZ8 A;  5KG1 A;  1R3N A;  4NAS A;  3OLB A;  2W8K A;  1X5O A;  2OMO A;  4ED5 A;  2VB6 A;  2H5J B;  1LFW A;  2ZH4 A;  3CCM S;  3MI7 X;  3B4D A;  1OPI A;  1BQM B;  4NLP A;  2WAQ D;  3PR5 B;  4IG0 A;  1R0A B;  1K0V A;  3KK3 A;  2ZH6 A;  3CF5 Q;  5A0Y B;  3R5G A;  1M5K C;  1HWU A;  3MEE B;  3MMA B;  1IBK J;  3FKB A;  3ZC4 A;  2CNO B;  3A3N B;  3AQP A;  3DLJ A;  4CNZ A;  2QV6 A;  4ID8 A;  2HZC A;  3FDS A;  4DV2 J;  3HF5 A;  4ZVR B;  3RB6 A;  2M3D A;  4Q0B A;  3AJ1 A;  1GT8 A;  2KKH A;  1SC3 B;  2CVE A;  5J2Q B;  2WBR A;  2AV5 A;  1KQG B;  4UOH A;  2LLZ A;  4XDC A;  4Y6I A;  5LSR A;  1N34 F;  1XBW A;  2HEK A;  3T6B A;  1VQO S;  4JV5 F;  4FPI A;  3S6E A;  3UO0 A;  2FVQ A;  1M5H A;  5HAN A;  4C11 A;  2NXE A;  1JWW A;  1JNZ B;  1KN6 A;  3H5U A;  3FEZ A;  3IWL A;  3VZI A;  3M30 B;  3GB0 A;  3WBZ A;  1TKZ A;  3RBZ A;  2JX2 A;  3NS5 A;  5IQ6 A;  4J9N A;  4DV5 F;  4DV7 F;  1QVG R;  3EM1 A;  4N8O A;  4J9Q A;  1HNX J;  1KLM B;  2FC8 A;  5GVQ A;  1YZ7 A;  3D67 A;  3M8R A;  3N6L A;  3ET6 B;  1F9F A;  4DFM A;  4JP8 A;  5F8H A;  1U1R A;  5CYM A;  2LCW A;  3W9H A;  1BQM A;  5J2N B;  1M0S A;  2KHC A;  5HVH A;  4NA3 A;  2B5J B;  3CCW A;  2Z2Z A;  2BE2 B;  2WVC A;  3D3C J;  3M6U A;  2UXB F;  5AE2 A;  4ERD A;  2DGU A;  4NLO A;  3NS6 A;  4XO0 A;  3F73 A;  2CQD A;  2RIJ A;  1DQ9 A;  2WZ1 A;  2CPJ A;  2DNQ A;  4OZJ A;  2D69 A;  2DHX A;  2DCL A;  1N56 A;  4WFA Q;  3CJ8 A;  5F3Z A;  2VOO A;  2DGT A;  4QR1 A;  3D1H A;  1YBA A;  3P96 A;  3TA2 A;  2OPR B;  3SXL A;  4YDD B;  2AIR B;  2FZK B;  5KFE A;  3H5Y A;  5E7O B;  5KFI A;  2EXU A;  2LP4 A;  4OJH A;  1YRU A;  2HKE A;  4OJ3 A;  5SUH A;  3ZZY A;  4J9P A;  1SH2 A;  1YGY A;  2DGQ A;  3U7J A;  2RF2 A;  1VC0 A;  4JI4 F;  2OPQ A;  2FJX A;  2GQ2 A;  5FDL B;  1SIZ A;  1CJU A;  2KXH A;  1FWP A;  4A8Q A;  2MKY A;  1JIH A;  3A3P B;  4KTQ A;  2AZ1 A;  4DSK A;  4DL3 A;  1JQG A;  2KRR A;  4DI6 A;  1VK3 A;  4O4G A;  1RT6 B;  3FNN A;  1PO6 A;  1GXL A;  1O6X A;  4KH1 B;  2KZZ A;  1BQN A;  3G2X A;  2OTJ S;  4ZP7 A;  1C1B B;  1GQE A;  4ZCK A;  2W2N P;  3FBB A;  1VI7 A;  2L9N A;  4F4Y A;  1RKI A;  1LWF A;  4B9V A;  2C2K B;  5IT9 U;  3MFI A;  4CO2 A;  1F1B B;  1SXL A;  4OZ1 A;  4W98 A;  1DQ8 A;  4LFA J;  4Z7Y A;  2NLW A;  3HHE A;  4ZS6 A;  2P6S A;  3B8H A;  1RHR B;  4UUX A;  4DQR A;  3T5L A;  2M2B A;  1P1L A;  2M5Y A;  1YZ6 A;  4ER8 A;  4LRB A;  2OPS A;  3I87 A;  5M2P A;  1J5E J;  4LR9 A;  4NRU A;  4I69 A;  3DI6 B;  5CYQ A;  1OS5 A;  2VC1 A;  3QNW B;  3R8Y A;  1S5Z A;  2HFO A;  3D6H B;  3LGM A;  5IQQ A;  1N6Q A;  2AEF A;  2UUW A;  1VC6 A;  3V6J A;  1I51 B;  2X3G A;  3K0J A;  2KVQ E;  3C8Y A;  4AND A;  4F0H A;  4AL6 A;  4JV5 J;  1MLA A;  3JTO A;  2ZC4 A;  2AHO B;  2FZG B;  2K1R B;  3PYF A;  1JLC B;  3KDN A;  3Q8Y A;  4IOB A;  2UU9 J;  4JI3 J;  2MZQ A;  3SIP B;  3J7Y I;  1WTB A;  2VOD A;  5H9E J;  3EJM A;  4XAK A;  1XMQ F;  1RYS A;  1T95 A;  3AXK A;  4KV8 B;  4DR7 F;  5EX3 A;  3QWP A;  1NDK A;  2RQC A;  2YKA A;  3CDU A;  3EMT A;  3N4W A;  4FNI A;  4K5S A;  4BBY A;  4L76 A;  4X66 F;  4WCE Q;  3GII A;  1FTC A;  3V6K A;  4UOF A;  2R2T A;  1NJI T;  3G96 A;  5L8R C;  5A8W A;  3HDS A;  1J2V A;  1IN0 A;  2V8V A;  3JSM A;  1S77 D;  2OD4 A;  5IV4 A;  4A8W A;  1RBA A;  4FS2 A;  3DLB A;  2PE8 A;  4ICL B;  4Q5V A;  2RDJ A;  2OHD A;  1C0U A;  3QSI A;  1JXL A;  4QCL A;  4GO5 X;  3ZTP A;  2W9B B;  3W63 A;  3C2P A;  2ZFH A;  1HPZ B;  2UUC F;  1RCO B;  3LAL A;  4ZVT B;  2UXC J;  4A47 A;  2J0S D;  2O5D A;  2EK6 A;  4TNO A;  4ZLJ A;  3UR0 A;  1JLC A;  1S4E A;  3G6X A;  3T1Y F;  4M95 A;  1S9E A;  3CPW R;  1UPP A;  2VPX B;  1DTQ B;  3DI6 A;  2KN4 A;  4K7Q A;  3KLG A;  4DV6 J;  3T1H F;  3FK4 A;  1LW2 A;  2FY8 A;  3E2E A;  1ZPW X;  4H4M B;  1LV5 A;  2BOP A;  1LWF B;  4TYA A;  1RT3 A;  1VQL S;  3R1L A;  1C1B A;  4CO4 A;  1L5U A;  1X4F A;  2BAN A;  1WDT A;  2YX4 A;  1H6K X;  3DRR B;  1O5J A;  4MAK A;  5ETR A;  4IOC Q;  4BDP A;  3DHW C;  3PW2 A;  3MM5 A;  3R5D A;  3C19 A;  3MTJ A;  1FRI A;  3CE8 A;  5DJB A;  2Q6C A;  4RNN A;  4TLR A;  4LF8 J;  3GV8 B;  4LF9 F;  2GVD B;  2LU1 A;  2CJY B;  3IWN C;  4JI8 J;  5DG8 A;  1ZAW A;  1QAJ A;  4TY8 A;  4BWJ A;  5KFL A;  2EFG A;  1UVM A;  2HW3 A;  1FWL A;  2H1Y A;  2YKM B;  3U02 A;  2ZE2 A;  1V6H A;  3M8Y A;  2JFD A;  3I4P A;  5L9X A;  1D8Y A;  4R5P B;  2X3D A;  5HMX A;  1FVS A;  1RDR A;  3GSD A;  1TU0 B;  2RDD A;  2D74 B;  3LP1 B;  4DPT A;  2DIT A;  4CLL A;  4RU9 A;  1C2P A;  1FF2 A;  1HBN A;  1VDH A;  1D9D A;  2M52 A;  4LF1 A;  2XSF A;  1NCL A;  2CNL B;  2LKZ A;  4CI0 B;  4D3G A;  1LXJ A;  4E8U A;  2BQ3 A;  4XPC A;  4DQQ A;  4U7U D;  1FKP A;  1KRP A;  1Y3J A;  3MAA A;  4NZ6 A;  3G6E S;  1KQK A;  2R8J A;  3T41 A;  4ECZ A;  4DU8 A;  2VBZ A;  5THW A;  2EK1 A;  2IMW P;  5B0D A;  2ZNZ A;  2K7K A;  1EQM A;  1MG7 A;  2XSJ B;  3M30 A;  3ZNJ 1;  1SI9 A;  5KFN A;  1X4E A;  3PEJ A;  5CXT A;  2AJ4 A;  2MKS A;  5AT1 B;  1Y11 A;  2FHJ A;  2UUA J;  4DR2 J;  1RZM A;  1F2G A;  4IKA A;  4F50 A;  1RAA B;  1RB0 A;  2I6W A;  1GXU A;  1RWP B;  4NI2 B;  3AY0 A;  2GS8 A;  5ETP A;  3FBE A;  4WP8 A;  4LF5 J;  4H4M A;  3VV2 B;  4ZPD A;  2PFD A;  2XM3 A;  1VHI A;  1PIL A;  3N79 A;  3VAJ A;  3BH7 B;  2ZD1 A;  3ZTO A;  1LWE A;  1S9G A;  4QYZ K;  1FHT A;  2YWH A;  4NLQ A;  2RD5 C;  2R7V A;  4P71 A;  1U1P A;  2N3L A;  1D9A A;  2HNY B;  4K50 A;  1IM4 A;  2XMK A;  3TJ8 A;  2I8E A;  5GAH I;  4I56 A;  1HNI B;  3WZ0 A;  2GVZ A;  3Q24 A;  3HHN B;  2HMI A;  3W7B A;  4X66 J;  2DNL A;  1Z2Z A;  3BBC A;  2ASJ A;  1HD1 A;  4C8K A;  1EJ7 L;  1N5V A;  4DUY J;  2MY7 A;  2BQR A;  3DLG A;  1L3U A;  3MPV A;  3M32 B;  4PEO A;  4DN0 A;  1FK9 A;  1NSP A;  4X64 J;  2AJF E;  5DZ7 A;  1HI8 A;  3JXO A;  2JEI A;  3CDB A;  2HQG A;  3DYA A;  3W2V B;  3NCP A;  5GAD I;  2DNM A;  5KFY A;  3WHI A;  2VIC A;  4PWU A;  1X9S A;  2WVD A;  1E6V A;  5E3A A;  1RTJ B;  2LFV A;  3LQV A;  3QJJ A;  2EFP A;  2V6A A;  1KHV A;  3BGU A;  1GFW B;  2HG4 A;  3BPS P;  4X4P A;  2BX6 A;  5L39 A;  1W7W A;  4E98 A;  3T1Y J;  1N5Y B;  4DG1 A;  1A6L A;  4Y0F A;  3CIM A;  1S1U B;  1ULR A;  6FDR A;  2CQG A;  2W2O P;  3D0I E;  3K57 A;  1FNX H;  4DBQ A;  2ASD A;  1UEU A;  3GFY A;  2YNF A;  3DRY A;  3F0N A;  3IFE A;  4WBF A;  3MCM A;  1V5I B;  1CUL B;  3OXF A;  5H9F J;  4ECT A;  3OL8 A;  1YTY A;  2HK3 A;  4CWB A;  2HS3 A;  4NA1 A;  4WTY A;  3M1V A;  4Y00 A;  2FDN A;  4QJV A;  3WC0 A;  4J9M A;  2GJI A;  3GJQ B;  3W8G A;  4CRJ A;  1Q8I A;  3IO1 A;  4WU2 A;  1HD0 A;  1ZBT A;  4F2R A;  2QX0 A;  4ILR A;  5KFX A;  1FKO A;  3NGS A;  1S1V A;  1IXK A;  2H54 B;  1FI4 A;  1LXN A;  2C2Z B;  3N9U C;  4RW4 A;  2KYZ A;  3MEK A;  1BXN A;  2GAH C;  3NRB A;  3QFW A;  4QW8 A;  3W9I A;  2VG6 A;  4ED0 A;  3NLC A;  5L9N A;  5LOQ A;  3D6M B;  4IFY B;  3AHP A;  2B6A B;  1HNI A;  2KDO A;  1KQF B;  5IXU A;  1H0H B;  2RB7 A;  1BE4 A;  1R8H A;  1UW9 A;  2X7I A;  3BPD A;  3C6T A;  2W01 A;  4H54 A;  3I0S A;  4ZPV R;  1YSJ A;  3PW4 A;  1VQ6 S;  3BN7 A;  4MKB A;  4WFY A;  3VAL A;  2DBB A;  4NLV A;  2E5G A;  2RRA A;  2XYH B;  5KOW A;  3DRP A;  2MST A;  4A8X A;  2MY8 A;  4EYH B;  1T3O A;  2V67 A;  4DSL A;  1F5B A;  3NXZ A;  4EZ9 A;  2KT5 A;  2K2P A;  1OJ4 A;  2ZBR A;  4J5O A;  1QDU B;  1VCT A;  5ETM A;  3UCZ P;  1V3R A;  4LRD A;  4CT9 A;  1SV5 B;  3MZI A;  2AJ2 A;  4FZV A;  4O0I A;  3VAM A;  2NXU A;  2V2V A;  1RAH B;  2FHJ D;  2YWF A;  5FD1 A;  1KOO A;  1H2U X;  1WOP A;  3V6H A;  3POT A;  3KHR A;  2VBW A;  1W25 A;  3G86 A;  3H0P A;  2B7B B;  2HPU A;  3HJV A;  5A8W B;  2B0G A;  2R7U A;  1VOM A;  3IRW P;  1RHU B;  4O3Q A;  4DV5 J;  1YIJ S;  1FK9 B;  5KAK A;  2PDA A;  3D68 A;  1TKD A;  2OGU A;  2A6O A;  2CKW A;  4ZPT R;  4OJG A;  2DYA A;  4ED4 A;  2IJF A;  3VWS A;  2Z30 B;  1XC9 A;  3Q22 A;  3KTQ A;  1HMV B;  4LFC F;  2LEP A;  3D0H E;  3DKD A;  5LXR A;  4DSE A;  4P2S A;  3QJL A;  1KP6 A;  4ECU A;  2BJ7 A;  1IBL F;  4LF4 F;  4QU7 A;  3PO5 A;  1APS A;  4GVB A;  4OHV A;  5D4P A;  3NL0 A;  2DGW A;  2LEA A;  3SDE A;  1HNX F;  4AXI A;  1JKH B;  2YKO A;  4OI2 A;  2ZNY A;  2VDH A;  2LQ8 A;  3RU0 A;  1QTM A;  2DRB A;  2UU9 F;  3R9L A;  2YKN B;  4CLW A;  3OVS A;  1WD6 A;  2VH7 A;  2VOP A;  1JLA A;  4DR1 F;  3W65 A;  3QT8 A;  1MML A;  3UN2 A;  4B02 A;  2AT1 B;  4R0J A;  2KH9 A;  2XMT A;  3IM9 A;  1YHQ S;  5L46 A;  4K4T A;  1BQX A;  1K44 A;  2H4Y B;  4L72 B;  4P75 A;  1MWZ A;  2NPI A;  3MMA A;  4UQG A;  3C14 B;  4EWT A;  1RJJ A;  3MHY A;  3ONQ A;  2AYB A;  5EUH A;  2NSB A;  5L1L A;  3DXS X;  3M8P A;  4IG0 B;  2PSZ A;  4C8O A;  4RKU C;  2ZZM A;  1DRZ A;  4JI6 F;  2HHQ A;  2R2U A;  5E3P A;  1JLG A;  1TUW A;  2J7U A;  4YDX A;  4CH1 A;  1U4B A;  2ZHO A;  2JZ5 A;  3IAM 9;  2CRL A;  4N7T A;  3SFU A;  2ZUG A;  2Z58 B;  3CJ0 A;  2N4C A;  1YX2 A;  4ZN3 A;  2CWK A;  2F65 A;  5KT7 A;  3GIJ A;  3CT9 A;  1WOO A;  4YEA A;  2W4D A;  2WON B;  3EYZ A;  1YI2 S;  3TR5 A;  3FQK A;  2NZC A;  4Q43 A;  3W61 A;  2E66 A;  4J7C A;  1RYR A;  1WC1 A;  2G1D A;  2GJF A;  3MCO A;  2VA3 A;  1RT5 A;  4LMZ A;  3HHL C;  1RHM B;  2RHS B;  4QPT A;  3WQP A;  1FJG J;  3FRY A;  4FKY A;  2XMV A;  3QRQ A;  1CVJ A;  1HBO A;  2CPD A;  4U96 A;  2U1A A;  2YKQ A;  2OSR A;  3FCV A;  4PCQ A;  3RG6 A;  2ZKT A;  2V4R A;  3EGW B;  2QEX S;  2HHV A;  2WSF C;  3PRV A;  2HAI A;  4KKO B;  3NOC A;  5B0F A;  2YNH A;  5KG6 A;  3THV A;  3IS9 B;  4NLX A;  3K17 A;  5GAE I;  4K0K F;  4Y2K A;  3GTY X;  2LQB A;  2DD8 S;  5C42 A;  1B70 B;  1R7I A;  1S12 A;  3AT1 B;  4HT7 A;  3GIR A;  1WKK A;  3PZP A;  1LFP A;  3M4X A;  2HVD A;  3TYT A;  3V4I B;  4ETZ A;  2QLJ B;  3KMS A;  1ICE B;  3AB2 B;  1RAD B;  1ZAV A;  1VQP S;  2NXN A;  1SUQ A;  1CJT A;  3Q8Q B;  3C15 B;  3ISN D;  3IXQ A;  5L1K A;  4ECS A;  5D3G B;  3G87 A;  3KLE A;  4OI4 A;  1KSP A;  3M9M B;  2BKO A;  3I0R A;  4TVA B;  2J76 E;  5ETQ A;  4DCJ B;  2XWY A;  2RUS A;  4X4R A;  4HI1 A;  3BSN A;  2DTJ A;  3KLI B;  3WX4 A;  5A8K A;  5HJY A;  2QG9 B;  2A18 A;  2QMX A;  3M8Q B;  4CO1 A;  1V3S A;  1NAQ A;  4F0M A;  4X62 F;  3JYT B;  3CC7 S;  3I31 A;  1EHW A;  4DLE A;  3LA0 A;  3EZ5 A;  1XJW B;  4FYV B;  1UJ6 A;  1IWG A;  3J81 Y;  2HQ3 A;  3E3X A;  1FKA F;  3QGI A;  3NKY A;  4U9R A;  2B3T B;  4NCG A;  4TN2 A;  3CCR S;  1VGY A;  4I6W A;  2MGZ A;  3T5K A;  2E9R X;  3CUL A;  1B0T A;  1PIE A;  3TVK A;  2YQ3 A;  2R7O A;  2JJ4 D;  3BGR A;  3TZZ A;  4EEY A;  3FFI B;  3MMC B;  3R5C A;  4P2X A;  5K5M A;  5D4O A;  2V4J A;  1GTE A;  3SBM A;  4PQU A;  2GHV C;  3Q8P B;  2ZH9 A;  3HHL D;  4M5D A;  2GHP A;  3IGN A;  5IC4 B;  3TNV A;  3EIC A;  1TUG B;  4DJB A;  3PX0 A;  2HHW A;  3KUE A;  5GMD A;  1EAR A;  3OSN A;  2LA6 A;  3M8W A;  4M63 A;  2VG7 A;  4JI7 J;  2R7S A;  3BGL A;  1EKS A;  3I5C A;  5I4M A; 
#chains in the Genus database with same CATH homology
 4NXM J;  4DR7 J;  5A2Q U;  2UUA J;  4DR2 J;  2E5L J;  1HNZ J;  4DR5 J;  4JI0 J;  5IT9 U;  1N32 J;  4GKK J;  4LF5 J;  3D3B J;  4LFA J;  3R2D J;  4NEY A;  1N36 J;  1XMO J;  5BR8 J;  4DV4 J;  2MQ8 A;  4LF9 J;  1J5E J;  4JI5 J;  4HHU A;  2VQF J;  2HHH J;  2KVQ E;  4JV5 J;  1N33 J;  4LF6 J;  4X66 J;  2UU9 J;  4JI6 J;  3R2C J;  4JI3 J;  5AJ3 J;  4LFB J;  4DUY J;  5LMU J;  2VQE J;  4RJV A;  5LM7 E;  1XMQ J;  4NXN J;  4KHP J;  1XNQ J;  2UXB J;  4X64 J;  1N34 J;  4K0K J;  4DUZ J;  4V1A k;  4PWW A;  2ZM6 J;  4LF7 J;  3T1Y J;  4NEZ A;  5LMN J;  4GKJ J;  1FJG J;  4YY3 J;  4JI2 J;  2UUB J;  2UXD J;  2F4V J;  2UXC J;  3JAM U;  4DV1 J;  1IBK J;  1I94 J;  1IBM J;  4B3T J;  4AQY J;  4DV2 J;  4DV6 J;  2MTL A;  4DR4 J;  3T1H J;  3J81 U;  4X62 J;  4JI1 J;  3OTO J;  4OX9 J;  4JYA J;  4DR6 J;  1HR0 J;  4DV7 J;  2KL8 A;  4LFC J;  3J7A N;  4B3R J;  1HNX J;  4LF8 J;  4B3M J;  4JI8 J;  3J80 U;  4KY3 A;  4KYZ A;  5IWA J;  3D3C J;  2MEW A;  5FLX U;  3W1Y C;  4B3S J;  2UUC J;  4DV5 J;  4YHH J;  1IBL J;  4DV3 J;  4DR3 J;  4X65 J;  4JI4 J;  1XNR J;  4LF4 J;  1HNW J;  3IMQ J;  4JI7 J;  4DV0 J;  4DR1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...