4YY4A

Crystal structure of brd9 bromodomain bound to dmso
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
101
structure length
101
Chain Sequence
TPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 36
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yy4A00
5L98A 5FFWA 4WHUA 2DKWA 5C85A 5HJCA 5HRXA 5F36A 5CPEA 5HRVA 5DW2A 5E9IA 5CUEA 4YC9A 5F60A 2RNXA 5DFDA 5EA1A 5EK9A 5ENFA 3U5NA 5CQ5A 4NUEA 4LRGA 5E9VA 5AD2A 5CQ6A 4Y03A 2RNWA 4KCXA 2NXBA 5FB0A 4YYDA 2YEMA 5DFCA 4Z1SA 4QR3A 4QZSA 4NUCA 1N72A 5L97A 5F61A 4CFLA 4UIYA 5DY7A 3P1DA 2H60A 4NR8A 3UVYA 4LDFA 2KTBB 4ZC9A 4PS5A 4O76A 5CTLA 2DVQA 3TLPA 5FE0A 4CFKA 5A5PA 2D82A 4UITA 5HEMA 5CQ8A 4TZ2A 4YADA 5A85A 4HXLA 5I83A 4MR6A 5A7CA 4LC2A 3JVKA 4WIVA 4LZSA 4TS8A 3P1FA 4YAXA 5HQ6A 5FDZA 4O74A 5CZGA 4NYVA 5HLSA 4J1PA 3U5JA 5IGNA 3U5MA 5ACYA 3MB3A 4YBSA 4XUBA 5F62A 5ENCA 4QY4A 4HXRA 4J0RA 4YBTA 4LR6A 4NRBA 4IOOA 4Z6HA 4QSUA 4UYFA 4YYMA 3FKMX 2YQDA 5A82A 4IR4A 4FLPA 5C4QA 4NXJA 5IG6A 4QYDA 5FG6A 5EICA 4QSQA 4XYAA 5FE1A 3UVWA 5EI4A 4YYKA 4CL9A 5LUUA 4YH4A 2R0SA 5CUDA 5EV9A 5A5NA 5IGLA 5KTWA 4HBVA 4IR3A 3LXJA 2DVSA 2DWWA 3JVMA 5G4SA 3Q2FA 4QSTA 5F2PA 4NRCA 5I88A 5CQTA 4NR7A 5HFQA 5FE8A 4O77A 3LJWA 5LVQA 5L99A 2FSAA 4QBMA 5DW1A 4RVRA 5A81A 4CUTA 4NR4A 4UYDA 3UV5A 4BJXA 4TU4A 4N4GA 5C89A 4PKLA 5CY9A 2R0YA 5A5RA 4YK0A 5CS8A 4HXNA 2D9EA 5CP5A 5D25A 4WHWA 5II2A 3ONIA 4MEQA 5COIA 3AQAA 4PCEA 3K2JA 5LKXA 3MUKA 3MQMA 4LZ2A 1F68A 5ENBA 3D7CA 4TT2A 5LKTA 5TCMA 4ALGA 5DYUA 4ZQLA 4MENA 4YYHA 4A9LA 5A5OA 4LYWA 4YY6A 1E6IA 3LQHA 4QC3A 4UYEA 4NR5A 5EM3A 5HCLA 4A9OA 4OGJA 3G0JA 5E3GA 4J0SA 5EP7A 5E7DA 4ALHA 5FE7A 5IIDA 5H1UA 4C67A 5FE4A 4MR3A 5I29A 2E7OA 4Q0OA 2L85A 4Z93A 5H1TA 4NYWA 3LQJA 5F5ZA 2G4AA 5CRZA 5KHMA 2OO1A 3I3JA 5EPSA 5AD3A 5FFVA 2RI7A 5EGUA 2DATA 5A5SA 4A9NA 3JVLA 5CGPA 4BW3A 3SVFA 5CQ3A 3HMEA 3QZTA 4QSVA 2YEKA 2R10A 1ZS5A 5FG4A 4QSWA 3U5LA 4Z6IA 4CLBA 3QZVA 4HXOA 1WUGA 5EWDA 2R0VA 5HQ7A 5I80A 5F3AA 4BW2A 4QSRA 4QEVA 4N3WA 4GPJA 4TTEA 3U5KA 2I8NA 5JWMA 4BW1A 4OGIA 3HMFA 5H1VA 4F3IA 2DVRA 5E9YA 4YYIA 5ETBA 4NR9A 4AKNA 3P5OA 5FE6A 3UW9A 4IR5A 4XUAA 5D3SA 5AMFA 3Q2EA 5E3DA 4A9KA 5FE2A 5LJ1A 3JVJA 4O72A 4X2IA 5LJ0A 4O70A 4BW4A 5FE5A 4YYJA 4A9MA 4CUSA 5ENEA 4J3IA 4CURA 5II1A 4O7EA 1JM4B 4QUTA 4NRAA 3NXBA 4LYSA 3G0LA 3IU5A 4KV1A 4TT4A 5F25A 4CUQA 2DVVA 3IU6A 4IOQA 3S92A 4YATA 4QEUA 5D3PA 5D3JA 4QB3A 3UV2A 5DLXA 5LJ2A 5FH6A 4UIXA 5D7XA 4YABA 4NUDA 5I89A 2N9GA 5FG5A 5D3HA 3SVHA 5E9KA 4XY9A 4QSXA 2RFJA 4PTBA 5D24A 5CUAA 4KV4A 3O35A 4TYLA 4QSSA 5F1LA 5ENHA 2I7KA 2E3KA 4QYLA 5EWCA 5F63A 2MJVB 3U5PA 4HXPA 5HQ5A 5CQAA 5KTUA 3ZYUA 4YY4A 2YDWA 3AADA 2F6JA 4CUPA 5F1HA 5DFBA 2GRCA 4E96A 4IR6A 3U5OA 4HBWA 5I1QA 4UIZA 5AMEA 5DX4A 4HXSA 4MEOA 4O71A 4PY6A 4UYGA 5IGKA 4TT6A 4QR5A 5HRWA 5DYCA 5ETDA 5CUBA 5FFYA 4Z1QA 5L8TA 5H85A 5E74A 4NR6A 5KTXA 2YELA 5L96A 4PCIA 5DBMA 3S91A 5FE9A 5CRMA 5FH7A 4TU6A 5L8UA 5E9LA 5FBXA 5JI8A 5A5QA 5LVRA 5EPBA 3UV4A 4A9FA 5TB6A 4A9HA 4ZW1A 2RNYA 5CQ7A 5C8GA 3P1CA 3SVGA 4MR4A 4QNSA 4O75A 4LYIA 5EPRA 5BT3A 2OUOA 3P1EA 5EWWA 4O78A 4UYHA 5D3TA 5DYAA 5EWVA 4C66A 3HMHA 5I7YA 3UVXA 3GG3A 4TZ8A 4MR5A 4O7BA 5EVAA 2E7NA 4N4FA 4UIVA 3MXFA 4N4IA 1EQFA 5I86A 4Q0NA 2LSPB 4LZRA 5EISA 4BHWA 5I7XA 3DAIA 5DLZA 4A9JA 5C87A 4YBMA 3RCWA 5FE3A 4YH3A 2RS9B 5DKDA 3O36A 2L84A 4HBYA 2OSSA 5J0DA 5BT5A 4CUUA 5I40A 4A9IA 5CFWA 5CUGA 3UVDA 4MEPA 5HENA 4XY8A 1X0JA 3MULA 3LQIA 4HXMA 2L5EA 5IGMA 5FB1A 4NYXA 5DKHA 3O34A 5E9MA 5CQ4A 4UYFB 5K29A 5D0CA 5D3LA 5D26A 3O33A 4OUFA 4O7FA 4TQNA 1JSPB 2WP1A 4QC1A 5A83A 5DKCA 5DYXA 5G4RA 4A9EA 5E0RA 5HELA 5ENGA 5C7NA 5EU1A 2YYNA 4QEWA 5HFRA 4O7AA 1WUMA 5E73A 2YW5A 4UIWA 5BT4A 4O7CA 5ENIA 4HBXA 4YYNA 5D3NA 5KU3A 4IORA 4UIUA 5LKUA 4N4HA 4DONA 4QR4A 4QSPA 5D3RA 4NS5A 4QUUA 5KO4A 3O37A 4HXKA 3DWYA 5EQ1A 5EWHA 2RO1A 4NQMA 5FH8A 4YYGA 3QZSA 5IBNA 2WP2A 4NQNA 5CUCA 5HM0A 3MB4A 5CU8A 5LKZA 5ENJA 2F6NA
chains in the Genus database with same CATH superfamily
5L98A 5FFWA 4WHUA 2DKWA 5C85A 5HJCA 5HRXA 5F36A 5CPEA 5HRVA 5DW2A 5E9IA 5CUEA 4YC9A 5F60A 2RNXA 5DFDA 5EA1A 5EK9A 5ENFA 3U5NA 5CQ5A 4NUEA 4LRGA 5E9VA 5AD2A 3ERRA 4Y03A 5CQ6A 2RNWA 4KCXA 2NXBA 5FB0A 4YYDA 2YEMA 5DFCA 4Z1SA 4QR3A 4QZSA 4NUCA 1N72A 5L97A 5F61A 4CFLA 4UIYA 5DY7A 3P1DA 2H60A 4NR8A 3UVYA 4LDFA 2KTBB 4ZC9A 4PS5A 4O76A 5CTLA 2DVQA 3TLPA 5FE0A 4CFKA 5A5PA 2D82A 4UITA 5HEMA 5CQ8A 4TZ2A 4YADA 5A85A 4HXLA 5I83A 4MR6A 5A7CA 4LC2A 3JVKA 4WIVA 4LZSA 4TS8A 3P1FA 4YAXA 5HQ6A 5FDZA 4O74A 5CZGA 4NYVA 2EJNA 5HLSA 4J1PA 3U5JA 5IGNA 3U5MA 5ACYA 3MB3A 4YBSA 4XUBA 5F62A 5ENCA 4QY4A 4HXRA 4J0RA 4YBTA 4LR6A 4NRBA 4IOOA 4Z6HA 4QSUA 4UYFA 4YYMA 3FKMX 2YQDA 5A82A 4IR4A 4FLPA 5C4QA 4NXJA 5IG6A 4QYDA 5FG6A 5EICA 4QSQA 4XYAA 5FE1A 3UVWA 5EI4A 4YYKA 4CL9A 5LUUA 4YH4A 2R0SA 5CUDA 5EV9A 5A5NA 5IGLA 5KTWA 4HBVA 4IR3A 3LXJA 2DVSA 2DWWA 3JVMA 5G4SA 3Q2FA 4QSTA 5F2PA 4NRCA 5I88A 5CQTA 4NR7A 5HFQA 5FE8A 4O77A 3LJWA 5LVQA 5L99A 2FSAA 4QBMA 5DW1A 4RVRA 5A81A 4CUTA 4NR4A 4UYDA 3UV5A 4BJXA 4TU4A 4N4GA 5C89A 4AKHA 4PKLA 5CY9A 2R0YA 5A5RA 4YK0A 5CS8A 4HXNA 2D9EA 5CP5A 5D25A 4WHWA 5II2A 3ONIA 4MEQA 5COIA 3AQAA 4PCEA 3K2JA 5LKXA 3MUKA 3MQMA 4LZ2A 1F68A 5ENBA 3D7CA 4TT2A 5LKTA 5TCMA 4ALGA 5DYUA 4ZQLA 4MENA 4YYHA 4A9LA 5A5OA 4LYWA 4YY6A 1E6IA 3LQHA 4QC3A 4UYEA 4NR5A 5EM3A 5HCLA 4A9OA 4OGJA 3G0JA 5E3GA 4J0SA 5EP7A 5E7DA 4ALHA 5FE7A 5IIDA 5H1UA 4C67A 5FE4A 4MR3A 5I29A 1PUOA 2E7OA 4Q0OA 2L85A 4Z93A 5H1TA 4NYWA 3LQJA 5F5ZA 2G4AA 5CRZA 5KHMA 2OO1A 3I3JA 5EPSA 5AD3A 5FFVA 2RI7A 5EGUA 2DATA 5A5SA 4A9NA 3JVLA 5CGPA 4BW3A 3SVFA 5CQ3A 3HMEA 3QZTA 4QSVA 2YEKA 2R10A 1ZS5A 5FG4A 4QSWA 3U5LA 4Z6IA 4CLBA 3QZVA 4HXOA 1WUGA 5EWDA 2R0VA 5HQ7A 5I80A 5F3AA 4BW2A 4QSRA 4QEVA 4N3WA 4GPJA 4TTEA 3U5KA 2I8NA 5JWMA 4BW1A 4OGIA 3HMFA 5H1VA 4F3IA 2DVRA 5E9YA 4YYIA 3D1BA 5ETBA 4NR9A 4AKNA 3P5OA 5FE6A 3UW9A 4IR5A 4XUAA 5D3SA 5AMFA 3Q2EA 5E3DA 4A9KA 5FE2A 4AI6A 5LJ1A 3JVJA 4O72A 4X2IA 5LJ0A 4O70A 4BW4A 5FE5A 4YYJA 4A9MA 4CUSA 5ENEA 4J3IA 4CURA 5II1A 4O7EA 1JM4B 4QUTA 4NRAA 3NXBA 4LYSA 3G0LA 3IU5A 4KV1A 4TT4A 5F25A 4CUQA 2DVVA 3IU6A 4IOQA 3S92A 4YATA 4QEUA 5D3PA 5D3JA 4QB3A 3UV2A 5DLXA 5LJ2A 5FH6A 4UIXA 5D7XA 4YABA 4NUDA 5I89A 2N9GA 5FG5A 5D3HA 3SVHA 5E9KA 4XY9A 4QSXA 2RFJA 4PTBA 5D24A 5CUAA 4KV4A 3O35A 4TYLA 4QSSA 5F1LA 5ENHA 2I7KA 2E3KA 4QYLA 5EWCA 5F63A 2MJVB 3U5PA 4HXPA 5HQ5A 5CQAA 5KTUA 3ZYUA 4YY4A 2YDWA 3AADA 2F6JA 4CUPA 5F1HA 5DFBA 2GRCA 4E96A 4IR6A 3U5OA 4HBWA 5I1QA 4UIZA 5AMEA 5DX4A 4HXSA 4MEOA 4O71A 4PY6A 4UYGA 5IGKA 4TT6A 4QR5A 5HRWA 5DYCA 5ETDA 5CUBA 5FFYA 4Z1QA 5L8TA 5H85A 5E74A 4NR6A 5KTXA 2YELA 5L96A 4PCIA 5DBMA 3S91A 5FE9A 5CRMA 5FH7A 4TU6A 5L8UA 5E9LA 5FBXA 5JI8A 5A5QA 5LVRA 5EPBA 3UV4A 4A9FA 5TB6A 4A9HA 4ZW1A 2RNYA 4AKIA 5CQ7A 5C8GA 3P1CA 3SVGA 4MR4A 4QNSA 4O75A 4LYIA 5EPRA 5BT3A 2OUOA 3P1EA 5EWWA 4O78A 4UYHA 5D3TA 5DYAA 5EWVA 4C66A 3HMHA 5I7YA 3UVXA 3GG3A 4TZ8A 4MR5A 4O7BA 5EVAA 2E7NA 4N4FA 4UIVA 3MXFA 4N4IA 1EQFA 5I86A 4Q0NA 2LSPB 4LZRA 5EISA 4BHWA 5I7XA 3DAIA 5DLZA 4A9JA 4AKGA 5C87A 4YBMA 3RCWA 5FE3A 4YH3A 2RS9B 5DKDA 3O36A 2L84A 4HBYA 2OSSA 5J0DA 5BT5A 4CUUA 5I40A 4A9IA 5CFWA 5CUGA 3UVDA 4MEPA 5HENA 4XY8A 3VKGA 1X0JA 3MULA 3LQIA 4HXMA 2L5EA 5IGMA 5FB1A 4NYXA 5DKHA 3O34A 5E9MA 5CQ4A 4UYFB 5K29A 5D0CA 5D3LA 5D26A 3O33A 4OUFA 4O7FA 4TQNA 1JSPB 2WP1A 4QC1A 5A83A 5DKCA 5DYXA 5G4RA 4A9EA 5E0RA 5HELA 3VKHA 5ENGA 5C7NA 5EU1A 2YYNA 4QEWA 5HFRA 4O7AA 1WUMA 5E73A 2YW5A 4UIWA 5BT4A 4O7CA 5ENIA 4HBXA 4YYNA 5D3NA 5KU3A 4IORA 4UIUA 5LKUA 4N4HA 4DONA 4QR4A 4QSPA 3D1DA 5D3RA 4NS5A 4QUUA 5KO4A 3O37A 4HXKA 3DWYA 5EQ1A 5EWHA 2RO1A 4NQMA 5FH8A 4YYGA 3QZSA 5IBNA 2WP2A 4NQNA 1ZKRA 5CUCA 5HM0A 3MB4A 5CU8A 5LKZA 5ENJA 2F6NA
chains in the Genus database with same CATH topology
5L98A 5FFWA 4WHUA 2DKWA 5C85A 5HJCA 5HRXA 5F36A 5CPEA 5HRVA 5DW2A 5E9IA 5CUEA 4YC9A 5F60A 2RNXA 5DFDA 5EA1A 5EK9A 5ENFA 3U5NA 5CQ5A 4NUEA 4LRGA 5E9VA 5AD2A 5CQ6A 4Y03A 2RNWA 4KCXA 2NXBA 5FB0A 4YYDA 2YEMA 5DFCA 4Z1SA 4QR3A 4QZSA 4NUCA 1N72A 5L97A 5F61A 4CFLA 4UIYA 5DY7A 3P1DA 2H60A 4NR8A 3UVYA 4LDFA 2KTBB 4ZC9A 4PS5A 4O76A 5CTLA 2DVQA 3TLPA 5FE0A 4CFKA 5A5PA 2D82A 4UITA 5HEMA 5CQ8A 4TZ2A 4YADA 5A85A 4HXLA 5I83A 4MR6A 5A7CA 4LC2A 3JVKA 4WIVA 4LZSA 4TS8A 3P1FA 4YAXA 5HQ6A 5FDZA 4O74A 5CZGA 4NYVA 5HLSA 4J1PA 3U5JA 5IGNA 3U5MA 5ACYA 3MB3A 4YBSA 4XUBA 5F62A 5ENCA 4QY4A 4HXRA 4J0RA 4YBTA 4LR6A 4NRBA 4IOOA 4Z6HA 4QSUA 4UYFA 4YYMA 3FKMX 2YQDA 5A82A 4IR4A 4FLPA 5C4QA 4NXJA 5IG6A 4QYDA 5FG6A 5EICA 4QSQA 4XYAA 5FE1A 3UVWA 5EI4A 4YYKA 4CL9A 5LUUA 4YH4A 2R0SA 5CUDA 5EV9A 5A5NA 5IGLA 5KTWA 4HBVA 4IR3A 3LXJA 2DVSA 2DWWA 3JVMA 5G4SA 3Q2FA 4QSTA 5F2PA 4NRCA 5I88A 5CQTA 4NR7A 5HFQA 5FE8A 4O77A 3LJWA 5LVQA 5L99A 2FSAA 4QBMA 5DW1A 4RVRA 5A81A 4CUTA 4NR4A 4UYDA 3UV5A 4BJXA 4TU4A 4N4GA 5C89A 4PKLA 5CY9A 2R0YA 5A5RA 4YK0A 5CS8A 4HXNA 2D9EA 5CP5A 5D25A 4WHWA 5II2A 3ONIA 4MEQA 5COIA 3AQAA 4PCEA 3K2JA 5LKXA 3MUKA 3MQMA 4LZ2A 1F68A 5ENBA 3D7CA 4TT2A 5LKTA 5TCMA 4ALGA 5DYUA 4ZQLA 4MENA 4YYHA 4A9LA 5A5OA 4LYWA 4YY6A 1E6IA 3LQHA 4QC3A 4UYEA 4NR5A 5EM3A 5HCLA 4A9OA 4OGJA 3G0JA 5E3GA 4J0SA 5EP7A 5E7DA 4ALHA 5FE7A 5IIDA 5H1UA 4C67A 5FE4A 4MR3A 5I29A 2E7OA 4Q0OA 2L85A 4Z93A 5H1TA 4NYWA 3LQJA 5F5ZA 2G4AA 5CRZA 5KHMA 2OO1A 3I3JA 5EPSA 5AD3A 5FFVA 2RI7A 5EGUA 2DATA 5A5SA 4A9NA 3JVLA 5CGPA 4BW3A 3SVFA 5CQ3A 3HMEA 3QZTA 4QSVA 2YEKA 2R10A 1ZS5A 5FG4A 4QSWA 3U5LA 4Z6IA 4CLBA 3QZVA 4HXOA 1WUGA 5EWDA 2R0VA 5HQ7A 5I80A 5F3AA 4BW2A 4QSRA 4QEVA 4N3WA 4GPJA 4TTEA 3U5KA 2I8NA 5JWMA 4BW1A 4OGIA 3HMFA 5H1VA 4F3IA 2DVRA 5E9YA 4YYIA 5ETBA 4NR9A 4AKNA 3P5OA 5FE6A 3UW9A 4IR5A 4XUAA 5D3SA 5AMFA 3Q2EA 5E3DA 4A9KA 5FE2A 5LJ1A 3JVJA 4O72A 4X2IA 5LJ0A 4O70A 4BW4A 5FE5A 4YYJA 4A9MA 4CUSA 5ENEA 4J3IA 4CURA 5II1A 4O7EA 1JM4B 4QUTA 4NRAA 3NXBA 4LYSA 3G0LA 3IU5A 4KV1A 4TT4A 5F25A 4CUQA 2DVVA 3IU6A 4IOQA 3S92A 4YATA 4QEUA 5D3PA 5D3JA 4QB3A 3UV2A 5DLXA 5LJ2A 5FH6A 4UIXA 5D7XA 4YABA 4NUDA 5I89A 2N9GA 5FG5A 5D3HA 3SVHA 5E9KA 4XY9A 4QSXA 2RFJA 4PTBA 5D24A 5CUAA 4KV4A 3O35A 4TYLA 4QSSA 5F1LA 5ENHA 2I7KA 2E3KA 4QYLA 5EWCA 5F63A 2MJVB 3U5PA 4HXPA 5HQ5A 5CQAA 5KTUA 3ZYUA 4YY4A 2YDWA 3AADA 2F6JA 4CUPA 5F1HA 5DFBA 2GRCA 4E96A 4IR6A 3U5OA 4HBWA 5I1QA 4UIZA 5AMEA 5DX4A 4HXSA 4MEOA 4O71A 4PY6A 4UYGA 5IGKA 4TT6A 4QR5A 5HRWA 5DYCA 5ETDA 5CUBA 5FFYA 4Z1QA 5L8TA 5H85A 5E74A 4NR6A 5KTXA 2YELA 5L96A 4PCIA 5DBMA 3S91A 5FE9A 5CRMA 5FH7A 4TU6A 5L8UA 5E9LA 5FBXA 5JI8A 5A5QA 5LVRA 5EPBA 3UV4A 4A9FA 5TB6A 4A9HA 4ZW1A 2RNYA 5CQ7A 5C8GA 3P1CA 3SVGA 4MR4A 4QNSA 4O75A 4LYIA 5EPRA 5BT3A 2OUOA 3P1EA 5EWWA 4O78A 4UYHA 5D3TA 5DYAA 5EWVA 4C66A 3HMHA 5I7YA 3UVXA 3GG3A 4TZ8A 4MR5A 4O7BA 5EVAA 2E7NA 4N4FA 4UIVA 3MXFA 4N4IA 1EQFA 5I86A 4Q0NA 2LSPB 4LZRA 5EISA 4BHWA 5I7XA 3DAIA 5DLZA 4A9JA 5C87A 4YBMA 3RCWA 5FE3A 4YH3A 2RS9B 5DKDA 3O36A 2L84A 4HBYA 2OSSA 5J0DA 5BT5A 4CUUA 5I40A 4A9IA 5CFWA 5CUGA 3UVDA 4MEPA 5HENA 4XY8A 1X0JA 3MULA 3LQIA 4HXMA 2L5EA 5IGMA 5FB1A 4NYXA 5DKHA 3O34A 5E9MA 5CQ4A 4UYFB 5K29A 5D0CA 5D3LA 5D26A 3O33A 4OUFA 4O7FA 4TQNA 1JSPB 2WP1A 4QC1A 5A83A 5DKCA 5DYXA 5G4RA 4A9EA 5E0RA 5HELA 5ENGA 5C7NA 5EU1A 2YYNA 4QEWA 5HFRA 4O7AA 1WUMA 5E73A 2YW5A 4UIWA 5BT4A 4O7CA 5ENIA 4HBXA 4YYNA 5D3NA 5KU3A 4IORA 4UIUA 5LKUA 4N4HA 4DONA 4QR4A 4QSPA 5D3RA 4NS5A 4QUUA 5KO4A 3O37A 4HXKA 3DWYA 5EQ1A 5EWHA 2RO1A 4NQMA 5FH8A 4YYGA 3QZSA 5IBNA 2WP2A 4NQNA 5CUCA 5HM0A 3MB4A 5CU8A 5LKZA 5ENJA 2F6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L98 A;  5FFW A;  4WHU A;  2DKW A;  5C85 A;  5HJC A;  5HRX A;  5F36 A;  5CPE A;  5HRV A;  5DW2 A;  5E9I A;  5CUE A;  4YC9 A;  5F60 A;  2RNX A;  5DFD A;  5EA1 A;  5EK9 A;  5ENF A;  3U5N A;  5CQ5 A;  4NUE A;  4LRG A;  5E9V A;  5AD2 A;  5CQ6 A;  4Y03 A;  2RNW A;  4KCX A;  2NXB A;  5FB0 A;  4YYD A;  2YEM A;  5DFC A;  4Z1S A;  4QR3 A;  4QZS A;  4NUC A;  1N72 A;  5L97 A;  5F61 A;  4CFL A;  4UIY A;  5DY7 A;  3P1D A;  2H60 A;  4NR8 A;  3UVY A;  4LDF A;  2KTB B;  4ZC9 A;  4PS5 A;  4O76 A;  5CTL A;  2DVQ A;  3TLP A;  5FE0 A;  4CFK A;  5A5P A;  2D82 A;  4UIT A;  5HEM A;  5CQ8 A;  4TZ2 A;  4YAD A;  5A85 A;  4HXL A;  5I83 A;  4MR6 A;  5A7C A;  4LC2 A;  3JVK A;  4WIV A;  4LZS A;  4TS8 A;  3P1F A;  4YAX A;  5HQ6 A;  5FDZ A;  4O74 A;  5CZG A;  4NYV A;  5HLS A;  4J1P A;  3U5J A;  5IGN A;  3U5M A;  5ACY A;  3MB3 A;  4YBS A;  4XUB A;  5F62 A;  5ENC A;  4QY4 A;  4HXR A;  4J0R A;  4YBT A;  4LR6 A;  4NRB A;  4IOO A;  4Z6H A;  4QSU A;  4UYF A;  4YYM A;  3FKM X;  2YQD A;  5A82 A;  4IR4 A;  4FLP A;  5C4Q A;  4NXJ A;  5IG6 A;  4QYD A;  5FG6 A;  5EIC A;  4QSQ A;  4XYA A;  5FE1 A;  3UVW A;  5EI4 A;  4YYK A;  4CL9 A;  5LUU A;  4YH4 A;  2R0S A;  5CUD A;  5EV9 A;  5A5N A;  5IGL A;  5KTW A;  4HBV A;  4IR3 A;  3LXJ A;  2DVS A;  2DWW A;  3JVM A;  5G4S A;  3Q2F A;  4QST A;  5F2P A;  4NRC A;  5I88 A;  5CQT A;  4NR7 A;  5HFQ A;  5FE8 A;  4O77 A;  3LJW A;  5LVQ A;  5L99 A;  2FSA A;  4QBM A;  5DW1 A;  4RVR A;  5A81 A;  4CUT A;  4NR4 A;  4UYD A;  3UV5 A;  4BJX A;  4TU4 A;  4N4G A;  5C89 A;  4PKL A;  5CY9 A;  2R0Y A;  5A5R A;  4YK0 A;  5CS8 A;  4HXN A;  2D9E A;  5CP5 A;  5D25 A;  4WHW A;  5II2 A;  3ONI A;  4MEQ A;  5COI A;  3AQA A;  4PCE A;  3K2J A;  5LKX A;  3MUK A;  3MQM A;  4LZ2 A;  1F68 A;  5ENB A;  3D7C A;  4TT2 A;  5LKT A;  5TCM A;  4ALG A;  5DYU A;  4ZQL A;  4MEN A;  4YYH A;  4A9L A;  5A5O A;  4LYW A;  4YY6 A;  1E6I A;  3LQH A;  4QC3 A;  4UYE A;  4NR5 A;  5EM3 A;  5HCL A;  4A9O A;  4OGJ A;  3G0J A;  5E3G A;  4J0S A;  5EP7 A;  5E7D A;  4ALH A;  5FE7 A;  5IID A;  5H1U A;  4C67 A;  5FE4 A;  4MR3 A;  5I29 A;  2E7O A;  4Q0O A;  2L85 A;  4Z93 A;  5H1T A;  4NYW A;  3LQJ A;  5F5Z A;  2G4A A;  5CRZ A;  5KHM A;  2OO1 A;  3I3J A;  5EPS A;  5AD3 A;  5FFV A;  2RI7 A;  5EGU A;  2DAT A;  5A5S A;  4A9N A;  3JVL A;  5CGP A;  4BW3 A;  3SVF A;  5CQ3 A;  3HME A;  3QZT A;  4QSV A;  2YEK A;  2R10 A;  1ZS5 A;  5FG4 A;  4QSW A;  3U5L A;  4Z6I A;  4CLB A;  3QZV A;  4HXO A;  1WUG A;  5EWD A;  2R0V A;  5HQ7 A;  5I80 A;  5F3A A;  4BW2 A;  4QSR A;  4QEV A;  4N3W A;  4GPJ A;  4TTE A;  3U5K A;  2I8N A;  5JWM A;  4BW1 A;  4OGI A;  3HMF A;  5H1V A;  4F3I A;  2DVR A;  5E9Y A;  4YYI A;  5ETB A;  4NR9 A;  4AKN A;  3P5O A;  5FE6 A;  3UW9 A;  4IR5 A;  4XUA A;  5D3S A;  5AMF A;  3Q2E A;  5E3D A;  4A9K A;  5FE2 A;  5LJ1 A;  3JVJ A;  4O72 A;  4X2I A;  5LJ0 A;  4O70 A;  4BW4 A;  5FE5 A;  4YYJ A;  4A9M A;  4CUS A;  5ENE A;  4J3I A;  4CUR A;  5II1 A;  4O7E A;  1JM4 B;  4QUT A;  4NRA A;  3NXB A;  4LYS A;  3G0L A;  3IU5 A;  4KV1 A;  4TT4 A;  5F25 A;  4CUQ A;  2DVV A;  3IU6 A;  4IOQ A;  3S92 A;  4YAT A;  4QEU A;  5D3P A;  5D3J A;  4QB3 A;  3UV2 A;  5DLX A;  5LJ2 A;  5FH6 A;  4UIX A;  5D7X A;  4YAB A;  4NUD A;  5I89 A;  2N9G A;  5FG5 A;  5D3H A;  3SVH A;  5E9K A;  4XY9 A;  4QSX A;  2RFJ A;  4PTB A;  5D24 A;  5CUA A;  4KV4 A;  3O35 A;  4TYL A;  4QSS A;  5F1L A;  5ENH A;  2I7K A;  2E3K A;  4QYL A;  5EWC A;  5F63 A;  2MJV B;  3U5P A;  4HXP A;  5HQ5 A;  5CQA A;  5KTU A;  3ZYU A;  4YY4 A;  2YDW A;  3AAD A;  2F6J A;  4CUP A;  5F1H A;  5DFB A;  2GRC A;  4E96 A;  4IR6 A;  3U5O A;  4HBW A;  5I1Q A;  4UIZ A;  5AME A;  5DX4 A;  4HXS A;  4MEO A;  4O71 A;  4PY6 A;  4UYG A;  5IGK A;  4TT6 A;  4QR5 A;  5HRW A;  5DYC A;  5ETD A;  5CUB A;  5FFY A;  4Z1Q A;  5L8T A;  5H85 A;  5E74 A;  4NR6 A;  5KTX A;  2YEL A;  5L96 A;  4PCI A;  5DBM A;  3S91 A;  5FE9 A;  5CRM A;  5FH7 A;  4TU6 A;  5L8U A;  5E9L A;  5FBX A;  5JI8 A;  5A5Q A;  5LVR A;  5EPB A;  3UV4 A;  4A9F A;  5TB6 A;  4A9H A;  4ZW1 A;  2RNY A;  5CQ7 A;  5C8G A;  3P1C A;  3SVG A;  4MR4 A;  4QNS A;  4O75 A;  4LYI A;  5EPR A;  5BT3 A;  2OUO A;  3P1E A;  5EWW A;  4O78 A;  4UYH A;  5D3T A;  5DYA A;  5EWV A;  4C66 A;  3HMH A;  5I7Y A;  3UVX A;  3GG3 A;  4TZ8 A;  4MR5 A;  4O7B A;  5EVA A;  2E7N A;  4N4F A;  4UIV A;  3MXF A;  4N4I A;  1EQF A;  5I86 A;  4Q0N A;  2LSP B;  4LZR A;  5EIS A;  4BHW A;  5I7X A;  3DAI A;  5DLZ A;  4A9J A;  5C87 A;  4YBM A;  3RCW A;  5FE3 A;  4YH3 A;  2RS9 B;  5DKD A;  3O36 A;  2L84 A;  4HBY A;  2OSS A;  5J0D A;  5BT5 A;  4CUU A;  5I40 A;  4A9I A;  5CFW A;  5CUG A;  3UVD A;  4MEP A;  5HEN A;  4XY8 A;  1X0J A;  3MUL A;  3LQI A;  4HXM A;  2L5E A;  5IGM A;  5FB1 A;  4NYX A;  5DKH A;  3O34 A;  5E9M A;  5CQ4 A;  4UYF B;  5K29 A;  5D0C A;  5D3L A;  5D26 A;  3O33 A;  4OUF A;  4O7F A;  4TQN A;  1JSP B;  2WP1 A;  4QC1 A;  5A83 A;  5DKC A;  5DYX A;  5G4R A;  4A9E A;  5E0R A;  5HEL A;  5ENG A;  5C7N A;  5EU1 A;  2YYN A;  4QEW A;  5HFR A;  4O7A A;  1WUM A;  5E73 A;  2YW5 A;  4UIW A;  5BT4 A;  4O7C A;  5ENI A;  4HBX A;  4YYN A;  5D3N A;  5KU3 A;  4IOR A;  4UIU A;  5LKU A;  4N4H A;  4DON A;  4QR4 A;  4QSP A;  5D3R A;  4NS5 A;  4QUU A;  5KO4 A;  3O37 A;  4HXK A;  3DWY A;  5EQ1 A;  5EWH A;  2RO1 A;  4NQM A;  5FH8 A;  4YYG A;  3QZS A;  5IBN A;  2WP2 A;  4NQN A;  5CUC A;  5HM0 A;  3MB4 A;  5CU8 A;  5LKZ A;  5ENJ A;  2F6N A; 
#chains in the Genus database with same CATH topology
 5L98 A;  5FFW A;  4WHU A;  2DKW A;  5C85 A;  5HJC A;  5HRX A;  5F36 A;  5CPE A;  5HRV A;  5DW2 A;  5E9I A;  5CUE A;  4YC9 A;  5F60 A;  2RNX A;  5DFD A;  5EA1 A;  5EK9 A;  5ENF A;  3U5N A;  5CQ5 A;  4NUE A;  4LRG A;  5E9V A;  5AD2 A;  3ERR A;  4Y03 A;  5CQ6 A;  2RNW A;  4KCX A;  2NXB A;  5FB0 A;  4YYD A;  2YEM A;  5DFC A;  4Z1S A;  4QR3 A;  4QZS A;  4NUC A;  1N72 A;  5L97 A;  5F61 A;  4CFL A;  4UIY A;  5DY7 A;  3P1D A;  2H60 A;  4NR8 A;  3UVY A;  4LDF A;  2KTB B;  4ZC9 A;  4PS5 A;  4O76 A;  5CTL A;  2DVQ A;  3TLP A;  5FE0 A;  4CFK A;  5A5P A;  2D82 A;  4UIT A;  5HEM A;  5CQ8 A;  4TZ2 A;  4YAD A;  5A85 A;  4HXL A;  5I83 A;  4MR6 A;  5A7C A;  4LC2 A;  3JVK A;  4WIV A;  4LZS A;  4TS8 A;  3P1F A;  4YAX A;  5HQ6 A;  5FDZ A;  4O74 A;  5CZG A;  4NYV A;  2EJN A;  5HLS A;  4J1P A;  3U5J A;  5IGN A;  3U5M A;  5ACY A;  3MB3 A;  4YBS A;  4XUB A;  5F62 A;  5ENC A;  4QY4 A;  4HXR A;  4J0R A;  4YBT A;  4LR6 A;  4NRB A;  4IOO A;  4Z6H A;  4QSU A;  4UYF A;  4YYM A;  3FKM X;  2YQD A;  5A82 A;  4IR4 A;  4FLP A;  5C4Q A;  4NXJ A;  5IG6 A;  4QYD A;  5FG6 A;  5EIC A;  4QSQ A;  4XYA A;  5FE1 A;  3UVW A;  5EI4 A;  4YYK A;  4CL9 A;  5LUU A;  4YH4 A;  2R0S A;  5CUD A;  5EV9 A;  5A5N A;  5IGL A;  5KTW A;  4HBV A;  4IR3 A;  3LXJ A;  2DVS A;  2DWW A;  3JVM A;  5G4S A;  3Q2F A;  4QST A;  5F2P A;  4NRC A;  5I88 A;  5CQT A;  4NR7 A;  5HFQ A;  5FE8 A;  4O77 A;  3LJW A;  5LVQ A;  5L99 A;  2FSA A;  4QBM A;  5DW1 A;  4RVR A;  5A81 A;  4CUT A;  4NR4 A;  4UYD A;  3UV5 A;  4BJX A;  4TU4 A;  4N4G A;  5C89 A;  4AKH A;  4PKL A;  5CY9 A;  2R0Y A;  5A5R A;  4YK0 A;  5CS8 A;  4HXN A;  2D9E A;  5CP5 A;  5D25 A;  4WHW A;  5II2 A;  3ONI A;  4MEQ A;  5COI A;  3AQA A;  4PCE A;  3K2J A;  5LKX A;  3MUK A;  3MQM A;  4LZ2 A;  1F68 A;  5ENB A;  3D7C A;  4TT2 A;  5LKT A;  5TCM A;  4ALG A;  5DYU A;  4ZQL A;  4MEN A;  4YYH A;  4A9L A;  5A5O A;  4LYW A;  4YY6 A;  1E6I A;  3LQH A;  4QC3 A;  4UYE A;  4NR5 A;  5EM3 A;  5HCL A;  4A9O A;  4OGJ A;  3G0J A;  5E3G A;  4J0S A;  5EP7 A;  5E7D A;  4ALH A;  5FE7 A;  5IID A;  5H1U A;  4C67 A;  5FE4 A;  4MR3 A;  5I29 A;  1PUO A;  2E7O A;  4Q0O A;  2L85 A;  4Z93 A;  5H1T A;  4NYW A;  3LQJ A;  5F5Z A;  2G4A A;  5CRZ A;  5KHM A;  2OO1 A;  3I3J A;  5EPS A;  5AD3 A;  5FFV A;  2RI7 A;  5EGU A;  2DAT A;  5A5S A;  4A9N A;  3JVL A;  5CGP A;  4BW3 A;  3SVF A;  5CQ3 A;  3HME A;  3QZT A;  4QSV A;  2YEK A;  2R10 A;  1ZS5 A;  5FG4 A;  4QSW A;  3U5L A;  4Z6I A;  4CLB A;  3QZV A;  4HXO A;  1WUG A;  5EWD A;  2R0V A;  5HQ7 A;  5I80 A;  5F3A A;  4BW2 A;  4QSR A;  4QEV A;  4N3W A;  4GPJ A;  4TTE A;  3U5K A;  2I8N A;  5JWM A;  4BW1 A;  4OGI A;  3HMF A;  5H1V A;  4F3I A;  2DVR A;  5E9Y A;  4YYI A;  3D1B A;  5ETB A;  4NR9 A;  4AKN A;  3P5O A;  5FE6 A;  3UW9 A;  4IR5 A;  4XUA A;  5D3S A;  5AMF A;  3Q2E A;  5E3D A;  4A9K A;  5FE2 A;  4AI6 A;  5LJ1 A;  3JVJ A;  4O72 A;  4X2I A;  5LJ0 A;  4O70 A;  4BW4 A;  5FE5 A;  4YYJ A;  4A9M A;  4CUS A;  5ENE A;  4J3I A;  4CUR A;  5II1 A;  4O7E A;  1JM4 B;  4QUT A;  4NRA A;  3NXB A;  4LYS A;  3G0L A;  3IU5 A;  4KV1 A;  4TT4 A;  5F25 A;  4CUQ A;  2DVV A;  3IU6 A;  4IOQ A;  3S92 A;  4YAT A;  4QEU A;  5D3P A;  5D3J A;  4QB3 A;  3UV2 A;  5DLX A;  5LJ2 A;  5FH6 A;  4UIX A;  5D7X A;  4YAB A;  4NUD A;  5I89 A;  2N9G A;  5FG5 A;  5D3H A;  3SVH A;  5E9K A;  4XY9 A;  4QSX A;  2RFJ A;  4PTB A;  5D24 A;  5CUA A;  4KV4 A;  3O35 A;  4TYL A;  4QSS A;  5F1L A;  5ENH A;  2I7K A;  2E3K A;  4QYL A;  5EWC A;  5F63 A;  2MJV B;  3U5P A;  4HXP A;  5HQ5 A;  5CQA A;  5KTU A;  3ZYU A;  4YY4 A;  2YDW A;  3AAD A;  2F6J A;  4CUP A;  5F1H A;  5DFB A;  2GRC A;  4E96 A;  4IR6 A;  3U5O A;  4HBW A;  5I1Q A;  4UIZ A;  5AME A;  5DX4 A;  4HXS A;  4MEO A;  4O71 A;  4PY6 A;  4UYG A;  5IGK A;  4TT6 A;  4QR5 A;  5HRW A;  5DYC A;  5ETD A;  5CUB A;  5FFY A;  4Z1Q A;  5L8T A;  5H85 A;  5E74 A;  4NR6 A;  5KTX A;  2YEL A;  5L96 A;  4PCI A;  5DBM A;  3S91 A;  5FE9 A;  5CRM A;  5FH7 A;  4TU6 A;  5L8U A;  5E9L A;  5FBX A;  5JI8 A;  5A5Q A;  5LVR A;  5EPB A;  3UV4 A;  4A9F A;  5TB6 A;  4A9H A;  4ZW1 A;  2RNY A;  4AKI A;  5CQ7 A;  5C8G A;  3P1C A;  3SVG A;  4MR4 A;  4QNS A;  4O75 A;  4LYI A;  5EPR A;  5BT3 A;  2OUO A;  3P1E A;  5EWW A;  4O78 A;  4UYH A;  5D3T A;  5DYA A;  5EWV A;  4C66 A;  3HMH A;  5I7Y A;  3UVX A;  3GG3 A;  4TZ8 A;  4MR5 A;  4O7B A;  5EVA A;  2E7N A;  4N4F A;  4UIV A;  3MXF A;  4N4I A;  1EQF A;  5I86 A;  4Q0N A;  2LSP B;  4LZR A;  5EIS A;  4BHW A;  5I7X A;  3DAI A;  5DLZ A;  4A9J A;  4AKG A;  5C87 A;  4YBM A;  3RCW A;  5FE3 A;  4YH3 A;  2RS9 B;  5DKD A;  3O36 A;  2L84 A;  4HBY A;  2OSS A;  5J0D A;  5BT5 A;  4CUU A;  5I40 A;  4A9I A;  5CFW A;  5CUG A;  3UVD A;  4MEP A;  5HEN A;  4XY8 A;  3VKG A;  1X0J A;  3MUL A;  3LQI A;  4HXM A;  2L5E A;  5IGM A;  5FB1 A;  4NYX A;  5DKH A;  3O34 A;  5E9M A;  5CQ4 A;  4UYF B;  5K29 A;  5D0C A;  5D3L A;  5D26 A;  3O33 A;  4OUF A;  4O7F A;  4TQN A;  1JSP B;  2WP1 A;  4QC1 A;  5A83 A;  5DKC A;  5DYX A;  5G4R A;  4A9E A;  5E0R A;  5HEL A;  3VKH A;  5ENG A;  5C7N A;  5EU1 A;  2YYN A;  4QEW A;  5HFR A;  4O7A A;  1WUM A;  5E73 A;  2YW5 A;  4UIW A;  5BT4 A;  4O7C A;  5ENI A;  4HBX A;  4YYN A;  5D3N A;  5KU3 A;  4IOR A;  4UIU A;  5LKU A;  4N4H A;  4DON A;  4QR4 A;  4QSP A;  3D1D A;  5D3R A;  4NS5 A;  4QUU A;  5KO4 A;  3O37 A;  4HXK A;  3DWY A;  5EQ1 A;  5EWH A;  2RO1 A;  4NQM A;  5FH8 A;  4YYG A;  3QZS A;  5IBN A;  2WP2 A;  4NQN A;  1ZKR A;  5CUC A;  5HM0 A;  3MB4 A;  5CU8 A;  5LKZ A;  5ENJ A;  2F6N A; 
#chains in the Genus database with same CATH homology
 5L98 A;  5FFW A;  4WHU A;  2DKW A;  5C85 A;  5HJC A;  5HRX A;  5F36 A;  5CPE A;  5HRV A;  5DW2 A;  5E9I A;  5CUE A;  4YC9 A;  5F60 A;  2RNX A;  5DFD A;  5EA1 A;  5EK9 A;  5ENF A;  3U5N A;  5CQ5 A;  4NUE A;  4LRG A;  5E9V A;  5AD2 A;  5CQ6 A;  4Y03 A;  2RNW A;  4KCX A;  2NXB A;  5FB0 A;  4YYD A;  2YEM A;  5DFC A;  4Z1S A;  4QR3 A;  4QZS A;  4NUC A;  1N72 A;  5L97 A;  5F61 A;  4CFL A;  4UIY A;  5DY7 A;  3P1D A;  2H60 A;  4NR8 A;  3UVY A;  4LDF A;  2KTB B;  4ZC9 A;  4PS5 A;  4O76 A;  5CTL A;  2DVQ A;  3TLP A;  5FE0 A;  4CFK A;  5A5P A;  2D82 A;  4UIT A;  5HEM A;  5CQ8 A;  4TZ2 A;  4YAD A;  5A85 A;  4HXL A;  5I83 A;  4MR6 A;  5A7C A;  4LC2 A;  3JVK A;  4WIV A;  4LZS A;  4TS8 A;  3P1F A;  4YAX A;  5HQ6 A;  5FDZ A;  4O74 A;  5CZG A;  4NYV A;  5HLS A;  4J1P A;  3U5J A;  5IGN A;  3U5M A;  5ACY A;  3MB3 A;  4YBS A;  4XUB A;  5F62 A;  5ENC A;  4QY4 A;  4HXR A;  4J0R A;  4YBT A;  4LR6 A;  4NRB A;  4IOO A;  4Z6H A;  4QSU A;  4UYF A;  4YYM A;  3FKM X;  2YQD A;  5A82 A;  4IR4 A;  4FLP A;  5C4Q A;  4NXJ A;  5IG6 A;  4QYD A;  5FG6 A;  5EIC A;  4QSQ A;  4XYA A;  5FE1 A;  3UVW A;  5EI4 A;  4YYK A;  4CL9 A;  5LUU A;  4YH4 A;  2R0S A;  5CUD A;  5EV9 A;  5A5N A;  5IGL A;  5KTW A;  4HBV A;  4IR3 A;  3LXJ A;  2DVS A;  2DWW A;  3JVM A;  5G4S A;  3Q2F A;  4QST A;  5F2P A;  4NRC A;  5I88 A;  5CQT A;  4NR7 A;  5HFQ A;  5FE8 A;  4O77 A;  3LJW A;  5LVQ A;  5L99 A;  2FSA A;  4QBM A;  5DW1 A;  4RVR A;  5A81 A;  4CUT A;  4NR4 A;  4UYD A;  3UV5 A;  4BJX A;  4TU4 A;  4N4G A;  5C89 A;  4PKL A;  5CY9 A;  2R0Y A;  5A5R A;  4YK0 A;  5CS8 A;  4HXN A;  2D9E A;  5CP5 A;  5D25 A;  4WHW A;  5II2 A;  3ONI A;  4MEQ A;  5COI A;  3AQA A;  4PCE A;  3K2J A;  5LKX A;  3MUK A;  3MQM A;  4LZ2 A;  1F68 A;  5ENB A;  3D7C A;  4TT2 A;  5LKT A;  5TCM A;  4ALG A;  5DYU A;  4ZQL A;  4MEN A;  4YYH A;  4A9L A;  5A5O A;  4LYW A;  4YY6 A;  1E6I A;  3LQH A;  4QC3 A;  4UYE A;  4NR5 A;  5EM3 A;  5HCL A;  4A9O A;  4OGJ A;  3G0J A;  5E3G A;  4J0S A;  5EP7 A;  5E7D A;  4ALH A;  5FE7 A;  5IID A;  5H1U A;  4C67 A;  5FE4 A;  4MR3 A;  5I29 A;  2E7O A;  4Q0O A;  2L85 A;  4Z93 A;  5H1T A;  4NYW A;  3LQJ A;  5F5Z A;  2G4A A;  5CRZ A;  5KHM A;  2OO1 A;  3I3J A;  5EPS A;  5AD3 A;  5FFV A;  2RI7 A;  5EGU A;  2DAT A;  5A5S A;  4A9N A;  3JVL A;  5CGP A;  4BW3 A;  3SVF A;  5CQ3 A;  3HME A;  3QZT A;  4QSV A;  2YEK A;  2R10 A;  1ZS5 A;  5FG4 A;  4QSW A;  3U5L A;  4Z6I A;  4CLB A;  3QZV A;  4HXO A;  1WUG A;  5EWD A;  2R0V A;  5HQ7 A;  5I80 A;  5F3A A;  4BW2 A;  4QSR A;  4QEV A;  4N3W A;  4GPJ A;  4TTE A;  3U5K A;  2I8N A;  5JWM A;  4BW1 A;  4OGI A;  3HMF A;  5H1V A;  4F3I A;  2DVR A;  5E9Y A;  4YYI A;  5ETB A;  4NR9 A;  4AKN A;  3P5O A;  5FE6 A;  3UW9 A;  4IR5 A;  4XUA A;  5D3S A;  5AMF A;  3Q2E A;  5E3D A;  4A9K A;  5FE2 A;  5LJ1 A;  3JVJ A;  4O72 A;  4X2I A;  5LJ0 A;  4O70 A;  4BW4 A;  5FE5 A;  4YYJ A;  4A9M A;  4CUS A;  5ENE A;  4J3I A;  4CUR A;  5II1 A;  4O7E A;  1JM4 B;  4QUT A;  4NRA A;  3NXB A;  4LYS A;  3G0L A;  3IU5 A;  4KV1 A;  4TT4 A;  5F25 A;  4CUQ A;  2DVV A;  3IU6 A;  4IOQ A;  3S92 A;  4YAT A;  4QEU A;  5D3P A;  5D3J A;  4QB3 A;  3UV2 A;  5DLX A;  5LJ2 A;  5FH6 A;  4UIX A;  5D7X A;  4YAB A;  4NUD A;  5I89 A;  2N9G A;  5FG5 A;  5D3H A;  3SVH A;  5E9K A;  4XY9 A;  4QSX A;  2RFJ A;  4PTB A;  5D24 A;  5CUA A;  4KV4 A;  3O35 A;  4TYL A;  4QSS A;  5F1L A;  5ENH A;  2I7K A;  2E3K A;  4QYL A;  5EWC A;  5F63 A;  2MJV B;  3U5P A;  4HXP A;  5HQ5 A;  5CQA A;  5KTU A;  3ZYU A;  4YY4 A;  2YDW A;  3AAD A;  2F6J A;  4CUP A;  5F1H A;  5DFB A;  2GRC A;  4E96 A;  4IR6 A;  3U5O A;  4HBW A;  5I1Q A;  4UIZ A;  5AME A;  5DX4 A;  4HXS A;  4MEO A;  4O71 A;  4PY6 A;  4UYG A;  5IGK A;  4TT6 A;  4QR5 A;  5HRW A;  5DYC A;  5ETD A;  5CUB A;  5FFY A;  4Z1Q A;  5L8T A;  5H85 A;  5E74 A;  4NR6 A;  5KTX A;  2YEL A;  5L96 A;  4PCI A;  5DBM A;  3S91 A;  5FE9 A;  5CRM A;  5FH7 A;  4TU6 A;  5L8U A;  5E9L A;  5FBX A;  5JI8 A;  5A5Q A;  5LVR A;  5EPB A;  3UV4 A;  4A9F A;  5TB6 A;  4A9H A;  4ZW1 A;  2RNY A;  5CQ7 A;  5C8G A;  3P1C A;  3SVG A;  4MR4 A;  4QNS A;  4O75 A;  4LYI A;  5EPR A;  5BT3 A;  2OUO A;  3P1E A;  5EWW A;  4O78 A;  4UYH A;  5D3T A;  5DYA A;  5EWV A;  4C66 A;  3HMH A;  5I7Y A;  3UVX A;  3GG3 A;  4TZ8 A;  4MR5 A;  4O7B A;  5EVA A;  2E7N A;  4N4F A;  4UIV A;  3MXF A;  4N4I A;  1EQF A;  5I86 A;  4Q0N A;  2LSP B;  4LZR A;  5EIS A;  4BHW A;  5I7X A;  3DAI A;  5DLZ A;  4A9J A;  5C87 A;  4YBM A;  3RCW A;  5FE3 A;  4YH3 A;  2RS9 B;  5DKD A;  3O36 A;  2L84 A;  4HBY A;  2OSS A;  5J0D A;  5BT5 A;  4CUU A;  5I40 A;  4A9I A;  5CFW A;  5CUG A;  3UVD A;  4MEP A;  5HEN A;  4XY8 A;  1X0J A;  3MUL A;  3LQI A;  4HXM A;  2L5E A;  5IGM A;  5FB1 A;  4NYX A;  5DKH A;  3O34 A;  5E9M A;  5CQ4 A;  4UYF B;  5K29 A;  5D0C A;  5D3L A;  5D26 A;  3O33 A;  4OUF A;  4O7F A;  4TQN A;  1JSP B;  2WP1 A;  4QC1 A;  5A83 A;  5DKC A;  5DYX A;  5G4R A;  4A9E A;  5E0R A;  5HEL A;  5ENG A;  5C7N A;  5EU1 A;  2YYN A;  4QEW A;  5HFR A;  4O7A A;  1WUM A;  5E73 A;  2YW5 A;  4UIW A;  5BT4 A;  4O7C A;  5ENI A;  4HBX A;  4YYN A;  5D3N A;  5KU3 A;  4IOR A;  4UIU A;  5LKU A;  4N4H A;  4DON A;  4QR4 A;  4QSP A;  5D3R A;  4NS5 A;  4QUU A;  5KO4 A;  3O37 A;  4HXK A;  3DWY A;  5EQ1 A;  5EWH A;  2RO1 A;  4NQM A;  5FH8 A;  4YYG A;  3QZS A;  5IBN A;  2WP2 A;  4NQN A;  5CUC A;  5HM0 A;  3MB4 A;  5CU8 A;  5LKZ A;  5ENJ A;  2F6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...