4YYPA

Crystal structure of human plk4-pb3 in complex with stil-cc
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
b'SAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK4
publication title STIL binding to Polo-box 3 of PLK4 regulates centriole duplication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4yypA00
5DMVC 4YYPA 4O56A 5J19A 4LKMA 3BZIA 4WHLA 4DFWA 3Q1IA 1Q4OA 3HIHA 4H5XA 4HCOA 1Q4KA 4X9RA 3HIKA 3P36A 3P35A 4J7BB 4O6WA 4WHHA 2OJXA 3P2WA 4HY2A 3P2ZA 4RCPA 2OGQA 4RS6A 5LHZA 4X9WA 1UMWA 4H71A 3C5LA 5DNJA 4XB0A 3P34A 4LKLA 4X9VA 2N19A 4HABA 3P37A 5DMSA 4E9DA 4WHKA 3FVHA 4E67A 4E9CA 4O9WA 3RQ7A
chains in the Genus database with same CATH superfamily
1FSUA 1N2LA 3BZIA 3HIHA 3P35A 4NKBA 1F32A 4RCPA 4RS6A 3LXQA 4X9WA 3FS3A 1E1ZP 4X9VA 2IA9A 4N7ZA 2QZUA 1E2SP 3GYVA 2E50A 2UV8G 4LKMA 1Q4OA 4CYRA 2I9ZA 4CXSA 1AUKA 1E2TA 4FDIA 4N9JA 3P2ZA 2VKZG 3LM3A 4H71A 5DNJA 4XB0A 5DAYA 3KDRA 4E9DA 4WHKA 4E9CA 5DMVC 4YYPA 4N7VA 1HDHA 1E33P 4O56A 4WHLA 4DFWA 3Q1IA 3HMJG 4H5XA 4HCOA 4X9RA 3HIKA 4J7BB 4O6WA 2OJXA 5LHZA 2I9XA 1UMWA 3C5LA 3P34A 5AJ9A 3GYWA 3P37A 1A87A 5DMSA 3FVHA 4O9WA 1F34B 3RQ7A 4FDJA 5J19A 4CXUA 1Q4KA 4CYSA 1N2KA 3P36A 3HFDA 4WHHA 3P2WA 4HY2A 4NK7A 2OGQA 4G7NA 1P49A 4LKLA 2N19A 4HABA 1E3CP 4CXKA 3ED4A 4E67A
chains in the Genus database with same CATH topology
5DMVC 4YYPA 4O56A 5J19A 4LKMA 3BZIA 4WHLA 4DFWA 3Q1IA 1Q4OA 3HIHA 4H5XA 4HCOA 1Q4KA 4X9RA 3HIKA 3P36A 3P35A 4J7BB 4O6WA 4WHHA 2OJXA 3P2WA 4HY2A 3P2ZA 4RCPA 2OGQA 4RS6A 5LHZA 4X9WA 1UMWA 4H71A 3C5LA 5DNJA 4XB0A 3P34A 4LKLA 4X9VA 2N19A 4HABA 3P37A 5DMSA 4E9DA 4WHKA 3FVHA 4E67A 4E9CA 4O9WA 3RQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DMV C;  4YYP A;  4O56 A;  5J19 A;  4LKM A;  3BZI A;  4WHL A;  4DFW A;  3Q1I A;  1Q4O A;  3HIH A;  4H5X A;  4HCO A;  1Q4K A;  4X9R A;  3HIK A;  3P36 A;  3P35 A;  4J7B B;  4O6W A;  4WHH A;  2OJX A;  3P2W A;  4HY2 A;  3P2Z A;  4RCP A;  2OGQ A;  4RS6 A;  5LHZ A;  4X9W A;  1UMW A;  4H71 A;  3C5L A;  5DNJ A;  4XB0 A;  3P34 A;  4LKL A;  4X9V A;  2N19 A;  4HAB A;  3P37 A;  5DMS A;  4E9D A;  4WHK A;  3FVH A;  4E67 A;  4E9C A;  4O9W A;  3RQ7 A; 
#chains in the Genus database with same CATH topology
 1FSU A;  1N2L A;  3BZI A;  3HIH A;  3P35 A;  4NKB A;  1F32 A;  4RCP A;  4RS6 A;  3LXQ A;  4X9W A;  3FS3 A;  1E1Z P;  4X9V A;  2IA9 A;  4N7Z A;  2QZU A;  1E2S P;  3GYV A;  2E50 A;  2UV8 G;  4LKM A;  1Q4O A;  4CYR A;  2I9Z A;  4CXS A;  1AUK A;  1E2T A;  4FDI A;  4N9J A;  3P2Z A;  2VKZ G;  3LM3 A;  4H71 A;  5DNJ A;  4XB0 A;  5DAY A;  3KDR A;  4E9D A;  4WHK A;  4E9C A;  5DMV C;  4YYP A;  4N7V A;  1HDH A;  1E33 P;  4O56 A;  4WHL A;  4DFW A;  3Q1I A;  3HMJ G;  4H5X A;  4HCO A;  4X9R A;  3HIK A;  4J7B B;  4O6W A;  2OJX A;  5LHZ A;  2I9X A;  1UMW A;  3C5L A;  3P34 A;  5AJ9 A;  3GYW A;  3P37 A;  1A87 A;  5DMS A;  3FVH A;  4O9W A;  1F34 B;  3RQ7 A;  4FDJ A;  5J19 A;  4CXU A;  1Q4K A;  4CYS A;  1N2K A;  3P36 A;  3HFD A;  4WHH A;  3P2W A;  4HY2 A;  4NK7 A;  2OGQ A;  4G7N A;  1P49 A;  4LKL A;  2N19 A;  4HAB A;  1E3C P;  4CXK A;  3ED4 A;  4E67 A; 
#chains in the Genus database with same CATH homology
 5DMV C;  4YYP A;  4O56 A;  5J19 A;  4LKM A;  3BZI A;  4WHL A;  4DFW A;  3Q1I A;  1Q4O A;  3HIH A;  4H5X A;  4HCO A;  1Q4K A;  4X9R A;  3HIK A;  3P36 A;  3P35 A;  4J7B B;  4O6W A;  4WHH A;  2OJX A;  3P2W A;  4HY2 A;  3P2Z A;  4RCP A;  2OGQ A;  4RS6 A;  5LHZ A;  4X9W A;  1UMW A;  4H71 A;  3C5L A;  5DNJ A;  4XB0 A;  3P34 A;  4LKL A;  4X9V A;  2N19 A;  4HAB A;  3P37 A;  5DMS A;  4E9D A;  4WHK A;  3FVH A;  4E67 A;  4E9C A;  4O9W A;  3RQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...