4YZAA

C. bescii family 3 pectate lyase double mutant k108a/q111a in complex with trigalacturonic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFALNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 82
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzaA00
3GQ9A 4XR6A 1JRGA 2UVEA 4OJLA 4XLFA 3SUCA 1O8DA 2VBMA 2PYGA 4XOTA 2O17A 1EE6A 1HG8A 1OGOX 2X3HA 1PE9A 4OZZA 4YZAA 1O8LA 1O8MA 4I84A 4XKVA 1O8JA 3GRHA 1RU4A 3VMWA 2X6XA 4XORA 1O88A 2EWEA 4XMYA 3LMWA 1RWRA 2BSPA 2NT9A 2O0VA 4OJPA 1JTAA 2NTBA 4NK6A 4XONA 2X6WA 1PXZA 4XL9A 1X0CA 2PECA 1OGMX 2INUA 3B8YA 3UW0A 1BHEA 2NZMA 4W8TA 1WMRA 2NSPA 1AIRA 2NT6A 1O8HA 1RMGA 4XLCA 3WWGA 1PLUA 4W8RA 4MR0A 4XNFA 4XOPA 4HWVA 2VBEA 1O8GA 1IA5A 1GQ8A 3EQOA 2X85A 1IDKA 4YZXA 2VJJA 1KCDA 4URRA 1KCCA 1QJVA 1O8IA 3KRGA 1VBLA 2INVA 1K5CA 2VBKA 1IB4A 1XG2A 1O8KA 1DBGA 4C2LA 3FY3A 4XN3A 3B4NA 1NHCA 2Z8GA 4XLAA 1KTWA 2UVFA 4XKWA 2QY1A 1CZFA 2VJIA 5AMVA 4YZ0A 3EQNA 4OJOA 4U4BA 4AVZA 2PYHA 1DBOA 4YZQA 3VSVA 1BN8A 1IDJA 2X6YA 4XM3A 3VMVA 4PMHA 4XLHA 3T9GA 4OJ5A 2IQ7A 4XLEA 3B90A 3ZSCA 3GQ7A 2O04A 4MXNA 3VSTA 1OFLA 5C1EA 3GQAA 4EW9A 5C1CA 1O8FA 1QCXA 4XN0A 4W8SA 3VSUA 1OFMA 2O1DA 2NSTA 4NK8A 2O0WA 2QXZA 1H80A 1OOCA 4OJ6A 4Z03A 4Z05A 2NTQA 4U49A 3JURA 4XQFA 2ODLA 3GQ8A 2NTPA 4OZYA 3ZPPA 2QX3A 1O8EA 4YEJA 4Z06A 4YELA 4W8QA
chains in the Genus database with same CATH superfamily
3SYJA 3GQ9A 4XR6A 1JRGA 2UVEA 4OJLA 4XLFA 2BM5A 3SUCA 4OPWA 1O8DA 2VBMA 3PSSA 2XT4A 2PYGA 4XOTA 1WXRA 2O17A 1EE6A 1HG8A 1OGOX 1LM1A 2X3HA 1PE9A 4OZZA 2QZAA 4YZAA 1O8LA 1O8MA 3ML3A 4I84A 4XKVA 1O8JA 2BM4A 3GRHA 1RU4A 2XC1A 3VMWA 2X6XA 4XORA 1O88A 2EWEA 3H09A 4XMYA 3LMWA 1K4ZA 1RWRA 3DU1X 2BSPA 4YDTA 2NT9A 1EZGA 2O0VA 1KQ5A 4OJPA 4YC5A 1JTAA 2B0RA 2NTBA 4NK6A 4XONA 1LLWA 2X6WA 1PXZA 4XL9A 1X0CA 3TH0A 1TYWA 2PECA 1OGMX 2INUA 3B8YA 4JRAC 3UW0A 2IOUG 2BM6A 1BHEA 2NZMA 4W8TA 1WMRA 1HF2A 2NSPA 1AIRA 5JLVC 2NT6A 1O8HA 1RMGA 2VFQA 4XLCA 3WWGA 5JMCB 1PLUA 4W8RA 4MR0A 4XNFA 4XOPA 4HWVA 2VBEA 2G0YA 2J8KA 1O8GA 1IA5A 2BX6A 1GQ8A 2VFMA 3EQOA 3NAWA 2X85A 3BH6B 1IDKA 1TYUA 4YZXA 3LYCA 2VJJA 1KCDA 4URRA 1KCCA 1QJVA 1O8IA 2QYUA 3KRGA 1VBLA 2INVA 3LJYA 3SZEA 1K5CA 1QA3A 2VBKA 1IB4A 1XG2A 1O8KA 1OFEA 1DBGA 4C2LA 3FY3A 4XN3A 3B4NA 1NHCA 2XTXA 2Z8GA 2XTWA 4XLAA 3N90A 1KTWA 1TYVA 2UVFA 4XKWA 2QY1A 1CZFA 2VFPA 2XT2A 2VJIA 5AMVA 4YZ0A 3EQNA 4OJOA 4U4BA 2YUHA 4AVZA 1QRBA 3PSZA 2PYHA 1DBOA 4YZQA 3VSVA 2W7ZA 1BN8A 1IDJA 2X6YA 3AK5A 4XM3A 3VMVA 2VFNA 4PMHA 3PETA 4XLHA 3SQVA 3T9GA 1CLWA 4OJ5A 2IQ7A 4XLEA 1QA2A 3B90A 3ZSCA 3GQ7A 3BH7B 2O04A 4MXNA 3VSTA 1OFLA 3RIQA 3JX8A 3N6ZA 1QQ1A 1K8FA 3GQAA 4V02C 5C1EA 4EW9A 4YEIA 5C1CA 2VFOA 1QRCA 1LLZA 3SY2A 1O8FA 2O6WA 3P4GA 1QCXA 1TYXA 4XN0A 4W8SA 1QA1A 4KH3A 1TSPA 3VSUA 1OFMA 2O1DA 2NSTA 4NK8A 2O0WA 2QXZA 1EA0A 4OM9A 1H80A 1OOCA 2F3LA 4OJ6A 5DNSA 4Z03A 4Z05A 2NTQA 4U49A 3JURA 4XQFA 2ODLA 3GQ8A 2J8IA 2NTPA 2V5IA 4OZYA 2QX3A 3ZPPA 1L1IA 1OFDA 1O8EA 2BM7A 4YCQA 4YFOA 1DABA 3NB2A 4YEJA 4Z06A 4YELA 4W8QA 2XTYA
chains in the Genus database with same CATH topology
3GQ9A 4XR6A 1JRGA 2UVEA 4OJLA 4XLFA 3SUCA 1O8DA 2VBMA 2PYGA 4XOTA 2O17A 1EE6A 1HG8A 1OGOX 2X3HA 1PE9A 4OZZA 4YZAA 1O8LA 1O8MA 4I84A 4XKVA 1O8JA 3GRHA 1RU4A 3VMWA 2X6XA 4XORA 1O88A 2EWEA 4XMYA 3LMWA 1RWRA 2BSPA 2NT9A 2O0VA 4OJPA 1JTAA 2NTBA 4NK6A 4XONA 2X6WA 1PXZA 4XL9A 1X0CA 2PECA 1OGMX 2INUA 3B8YA 3UW0A 1BHEA 2NZMA 4W8TA 1WMRA 2NSPA 1AIRA 2NT6A 1O8HA 1RMGA 4XLCA 3WWGA 1PLUA 4W8RA 4MR0A 4XNFA 4XOPA 4HWVA 2VBEA 1O8GA 1IA5A 1GQ8A 3EQOA 2X85A 1IDKA 4YZXA 2VJJA 1KCDA 4URRA 1KCCA 1QJVA 1O8IA 3KRGA 1VBLA 2INVA 1K5CA 2VBKA 1IB4A 1XG2A 1O8KA 1DBGA 4C2LA 3FY3A 4XN3A 3B4NA 1NHCA 2Z8GA 4XLAA 1KTWA 2UVFA 4XKWA 2QY1A 1CZFA 2VJIA 5AMVA 4YZ0A 3EQNA 4OJOA 4U4BA 4AVZA 2PYHA 1DBOA 4YZQA 3VSVA 1BN8A 1IDJA 2X6YA 4XM3A 3VMVA 4PMHA 4XLHA 3T9GA 4OJ5A 2IQ7A 4XLEA 3B90A 3ZSCA 3GQ7A 2O04A 4MXNA 3VSTA 1OFLA 5C1EA 3GQAA 4EW9A 5C1CA 1O8FA 1QCXA 4XN0A 4W8SA 3VSUA 1OFMA 2O1DA 2NSTA 4NK8A 2O0WA 2QXZA 1H80A 1OOCA 4OJ6A 4Z03A 4Z05A 2NTQA 4U49A 3JURA 4XQFA 2ODLA 3GQ8A 2NTPA 4OZYA 3ZPPA 2QX3A 1O8EA 4YEJA 4Z06A 4YELA 4W8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ9 A;  4XR6 A;  1JRG A;  2UVE A;  4OJL A;  4XLF A;  3SUC A;  1O8D A;  2VBM A;  2PYG A;  4XOT A;  2O17 A;  1EE6 A;  1HG8 A;  1OGO X;  2X3H A;  1PE9 A;  4OZZ A;  4YZA A;  1O8L A;  1O8M A;  4I84 A;  4XKV A;  1O8J A;  3GRH A;  1RU4 A;  3VMW A;  2X6X A;  4XOR A;  1O88 A;  2EWE A;  4XMY A;  3LMW A;  1RWR A;  2BSP A;  2NT9 A;  2O0V A;  4OJP A;  1JTA A;  2NTB A;  4NK6 A;  4XON A;  2X6W A;  1PXZ A;  4XL9 A;  1X0C A;  2PEC A;  1OGM X;  2INU A;  3B8Y A;  3UW0 A;  1BHE A;  2NZM A;  4W8T A;  1WMR A;  2NSP A;  1AIR A;  2NT6 A;  1O8H A;  1RMG A;  4XLC A;  3WWG A;  1PLU A;  4W8R A;  4MR0 A;  4XNF A;  4XOP A;  4HWV A;  2VBE A;  1O8G A;  1IA5 A;  1GQ8 A;  3EQO A;  2X85 A;  1IDK A;  4YZX A;  2VJJ A;  1KCD A;  4URR A;  1KCC A;  1QJV A;  1O8I A;  3KRG A;  1VBL A;  2INV A;  1K5C A;  2VBK A;  1IB4 A;  1XG2 A;  1O8K A;  1DBG A;  4C2L A;  3FY3 A;  4XN3 A;  3B4N A;  1NHC A;  2Z8G A;  4XLA A;  1KTW A;  2UVF A;  4XKW A;  2QY1 A;  1CZF A;  2VJI A;  5AMV A;  4YZ0 A;  3EQN A;  4OJO A;  4U4B A;  4AVZ A;  2PYH A;  1DBO A;  4YZQ A;  3VSV A;  1BN8 A;  1IDJ A;  2X6Y A;  4XM3 A;  3VMV A;  4PMH A;  4XLH A;  3T9G A;  4OJ5 A;  2IQ7 A;  4XLE A;  3B90 A;  3ZSC A;  3GQ7 A;  2O04 A;  4MXN A;  3VST A;  1OFL A;  5C1E A;  3GQA A;  4EW9 A;  5C1C A;  1O8F A;  1QCX A;  4XN0 A;  4W8S A;  3VSU A;  1OFM A;  2O1D A;  2NST A;  4NK8 A;  2O0W A;  2QXZ A;  1H80 A;  1OOC A;  4OJ6 A;  4Z03 A;  4Z05 A;  2NTQ A;  4U49 A;  3JUR A;  4XQF A;  2ODL A;  3GQ8 A;  2NTP A;  4OZY A;  3ZPP A;  2QX3 A;  1O8E A;  4YEJ A;  4Z06 A;  4YEL A;  4W8Q A; 
#chains in the Genus database with same CATH topology
 3SYJ A;  3GQ9 A;  4XR6 A;  1JRG A;  2UVE A;  4OJL A;  4XLF A;  2BM5 A;  3SUC A;  4OPW A;  1O8D A;  2VBM A;  3PSS A;  2XT4 A;  2PYG A;  4XOT A;  1WXR A;  2O17 A;  1EE6 A;  1HG8 A;  1OGO X;  1LM1 A;  2X3H A;  1PE9 A;  4OZZ A;  2QZA A;  4YZA A;  1O8L A;  1O8M A;  3ML3 A;  4I84 A;  4XKV A;  1O8J A;  2BM4 A;  3GRH A;  1RU4 A;  2XC1 A;  3VMW A;  2X6X A;  4XOR A;  1O88 A;  2EWE A;  3H09 A;  4XMY A;  3LMW A;  1K4Z A;  1RWR A;  3DU1 X;  2BSP A;  4YDT A;  2NT9 A;  1EZG A;  2O0V A;  1KQ5 A;  4OJP A;  4YC5 A;  1JTA A;  2B0R A;  2NTB A;  4NK6 A;  4XON A;  1LLW A;  2X6W A;  1PXZ A;  4XL9 A;  1X0C A;  3TH0 A;  1TYW A;  2PEC A;  1OGM X;  2INU A;  3B8Y A;  4JRA C;  3UW0 A;  2IOU G;  2BM6 A;  1BHE A;  2NZM A;  4W8T A;  1WMR A;  1HF2 A;  2NSP A;  1AIR A;  5JLV C;  2NT6 A;  1O8H A;  1RMG A;  2VFQ A;  4XLC A;  3WWG A;  5JMC B;  1PLU A;  4W8R A;  4MR0 A;  4XNF A;  4XOP A;  4HWV A;  2VBE A;  2G0Y A;  2J8K A;  1O8G A;  1IA5 A;  2BX6 A;  1GQ8 A;  2VFM A;  3EQO A;  3NAW A;  2X85 A;  3BH6 B;  1IDK A;  1TYU A;  4YZX A;  3LYC A;  2VJJ A;  1KCD A;  4URR A;  1KCC A;  1QJV A;  1O8I A;  2QYU A;  3KRG A;  1VBL A;  2INV A;  3LJY A;  3SZE A;  1K5C A;  1QA3 A;  2VBK A;  1IB4 A;  1XG2 A;  1O8K A;  1OFE A;  1DBG A;  4C2L A;  3FY3 A;  4XN3 A;  3B4N A;  1NHC A;  2XTX A;  2Z8G A;  2XTW A;  4XLA A;  3N90 A;  1KTW A;  1TYV A;  2UVF A;  4XKW A;  2QY1 A;  1CZF A;  2VFP A;  2XT2 A;  2VJI A;  5AMV A;  4YZ0 A;  3EQN A;  4OJO A;  4U4B A;  2YUH A;  4AVZ A;  1QRB A;  3PSZ A;  2PYH A;  1DBO A;  4YZQ A;  3VSV A;  2W7Z A;  1BN8 A;  1IDJ A;  2X6Y A;  3AK5 A;  4XM3 A;  3VMV A;  2VFN A;  4PMH A;  3PET A;  4XLH A;  3SQV A;  3T9G A;  1CLW A;  4OJ5 A;  2IQ7 A;  4XLE A;  1QA2 A;  3B90 A;  3ZSC A;  3GQ7 A;  3BH7 B;  2O04 A;  4MXN A;  3VST A;  1OFL A;  3RIQ A;  3JX8 A;  3N6Z A;  1QQ1 A;  1K8F A;  3GQA A;  4V02 C;  5C1E A;  4EW9 A;  4YEI A;  5C1C A;  2VFO A;  1QRC A;  1LLZ A;  3SY2 A;  1O8F A;  2O6W A;  3P4G A;  1QCX A;  1TYX A;  4XN0 A;  4W8S A;  1QA1 A;  4KH3 A;  1TSP A;  3VSU A;  1OFM A;  2O1D A;  2NST A;  4NK8 A;  2O0W A;  2QXZ A;  1EA0 A;  4OM9 A;  1H80 A;  1OOC A;  2F3L A;  4OJ6 A;  5DNS A;  4Z03 A;  4Z05 A;  2NTQ A;  4U49 A;  3JUR A;  4XQF A;  2ODL A;  3GQ8 A;  2J8I A;  2NTP A;  2V5I A;  4OZY A;  2QX3 A;  3ZPP A;  1L1I A;  1OFD A;  1O8E A;  2BM7 A;  4YCQ A;  4YFO A;  1DAB A;  3NB2 A;  4YEJ A;  4Z06 A;  4YEL A;  4W8Q A;  2XTY A; 
#chains in the Genus database with same CATH homology
 3GQ9 A;  4XR6 A;  1JRG A;  2UVE A;  4OJL A;  4XLF A;  3SUC A;  1O8D A;  2VBM A;  2PYG A;  4XOT A;  2O17 A;  1EE6 A;  1HG8 A;  1OGO X;  2X3H A;  1PE9 A;  4OZZ A;  4YZA A;  1O8L A;  1O8M A;  4I84 A;  4XKV A;  1O8J A;  3GRH A;  1RU4 A;  3VMW A;  2X6X A;  4XOR A;  1O88 A;  2EWE A;  4XMY A;  3LMW A;  1RWR A;  2BSP A;  2NT9 A;  2O0V A;  4OJP A;  1JTA A;  2NTB A;  4NK6 A;  4XON A;  2X6W A;  1PXZ A;  4XL9 A;  1X0C A;  2PEC A;  1OGM X;  2INU A;  3B8Y A;  3UW0 A;  1BHE A;  2NZM A;  4W8T A;  1WMR A;  2NSP A;  1AIR A;  2NT6 A;  1O8H A;  1RMG A;  4XLC A;  3WWG A;  1PLU A;  4W8R A;  4MR0 A;  4XNF A;  4XOP A;  4HWV A;  2VBE A;  1O8G A;  1IA5 A;  1GQ8 A;  3EQO A;  2X85 A;  1IDK A;  4YZX A;  2VJJ A;  1KCD A;  4URR A;  1KCC A;  1QJV A;  1O8I A;  3KRG A;  1VBL A;  2INV A;  1K5C A;  2VBK A;  1IB4 A;  1XG2 A;  1O8K A;  1DBG A;  4C2L A;  3FY3 A;  4XN3 A;  3B4N A;  1NHC A;  2Z8G A;  4XLA A;  1KTW A;  2UVF A;  4XKW A;  2QY1 A;  1CZF A;  2VJI A;  5AMV A;  4YZ0 A;  3EQN A;  4OJO A;  4U4B A;  4AVZ A;  2PYH A;  1DBO A;  4YZQ A;  3VSV A;  1BN8 A;  1IDJ A;  2X6Y A;  4XM3 A;  3VMV A;  4PMH A;  4XLH A;  3T9G A;  4OJ5 A;  2IQ7 A;  4XLE A;  3B90 A;  3ZSC A;  3GQ7 A;  2O04 A;  4MXN A;  3VST A;  1OFL A;  5C1E A;  3GQA A;  4EW9 A;  5C1C A;  1O8F A;  1QCX A;  4XN0 A;  4W8S A;  3VSU A;  1OFM A;  2O1D A;  2NST A;  4NK8 A;  2O0W A;  2QXZ A;  1H80 A;  1OOC A;  4OJ6 A;  4Z03 A;  4Z05 A;  2NTQ A;  4U49 A;  3JUR A;  4XQF A;  2ODL A;  3GQ8 A;  2NTP A;  4OZY A;  3ZPP A;  2QX3 A;  1O8E A;  4YEJ A;  4Z06 A;  4YEL A;  4W8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...