4YZAA

C. bescii family 3 pectate lyase double mutant k108a/q111a in complex with trigalacturonic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFALNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
molecule keywords Pectate lyase
molecule tags Lyase
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
total genus 82
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzaA00
1O8KA 4XOTA 4AVZA 1DBOA 1OFLA 4HWVA 4YZXA 3B8YA 1O8JA 3ZPPA 1IB4A 3UW0A 1QCXA 2O17A 2O0WA 2NTBA 4MR0A 4XR6A 2NSTA 4YZQA 2QXZA 1OOCA 2INUA 4XM3A 1WMRA 4XL9A 1HG8A 1O8IA 3EQNA 3WWGA 4C2LA 4W8QA 2X3HA 4XORA 3GQ7A 3EQOA 1PLUA 2EWEA 2VBMA 2VBEA 1QJVA 4NK6A 4XLCA 1IDJA 3LMWA 4XKVA 4W8SA 3KRGA 1O8GA 3SUCA 2UVEA 3GRHA 1O8HA 3ZSCA 4XLEA 2IQ7A 4XLAA 4NK8A 3FY3A 4URRA 4XMYA 4XLHA 2UVFA 4I84A 3VMWA 2QY1A 2NT9A 1KCDA 3VSVA 4Z05A 4W8TA 2X6YA 1O8MA 1RWRA 1IDKA 2X6WA 3GQ9A 1PE9A 4YZAA 1KCCA 3VSUA 5AMVA 2ODLA 4YZ0A 1O8LA 2PYGA 3JURA 4XOPA 1KTWA 1OGOX 3GQAA 4Z06A 1DBGA 2PECA 4Z03A 4EW9A 1O88A 4PMHA 2X6XA 2NT6A 1K5CA 2X85A 2QX3A 2NSPA 1JRGA 4W8RA 3GQ8A 3VMVA 2BSPA 4XNFA 1OFMA 3B90A 2NZMA 1CZFA 2VJIA 1JTAA 1GQ8A 2O1DA 4XONA 2Z8GA 1O8EA 2VBKA 4OJ6A 1RU4A 1X0CA 4OJPA 1O8DA 4XN3A 3B4NA 4OZYA 4XQFA 2INVA 1EE6A 1O8FA 1OGMX 2VJJA 3T9GA 2NTQA 4OZZA 2O0VA 4OJ5A 1BHEA 4U4BA 1NHCA 4XKWA 1XG2A 1IA5A 3VSTA 5C1CA 1BN8A 4OJLA 4YELA 4XLFA 4YEJA 2NTPA 4U49A 1AIRA 1RMGA 4XN0A 1H80A 2O04A 1VBLA 1PXZA 4MXNA 5C1EA 4OJOA 2PYHA
chains in the Genus database with same CATH superfamily
1O8KA 1CLWA 4XOTA 4AVZA 1DBOA 1OFLA 4HWVA 4YZXA 2BM6A 1O8JA 2QYUA 3B8YA 3ZPPA 1QA3A 1IB4A 3UW0A 1QCXA 2VFPA 2O17A 2O0WA 2NTBA 4MR0A 4XR6A 3SY2A 2NSTA 4YZQA 2QXZA 1OOCA 2INUA 1KQ5A 4XM3A 5JLVC 2VFMA 5JMCB 1WMRA 2B0RA 4XL9A 1HG8A 4YDTA 1O8IA 3EQNA 3WWGA 1TYWA 2J8IA 4C2LA 4W8QA 2X3HA 2F3LA 3N6ZA 3LJYA 3GQ7A 4XORA 3TH0A 3EQOA 1TSPA 1PLUA 1EA0A 2EWEA 2VBMA 1QJVA 2V5IA 2VBEA 4NK6A 4XLCA 1IDJA 3LMWA 4YC5A 4XKVA 5DNSA 2XT4A 4W8SA 3KRGA 1O8GA 3SUCA 2UVEA 3GRHA 1O8HA 3ZSCA 3PETA 4XLEA 2VFQA 1TYUA 2BX6A 3SZEA 2IQ7A 2XTXA 4XLAA 3AK5A 4NK8A 3FY3A 1LLZA 4YEIA 4URRA 4XMYA 4XLHA 2UVFA 4I84A 3VMWA 1EZGA 2NT9A 2QY1A 1KCDA 3VSVA 4Z05A 2YUHA 4W8TA 2BM7A 2X6YA 1O8MA 1RWRA 3H09A 1IDKA 2X6WA 3GQ9A 1PE9A 4YZAA 1KCCA 3VSUA 5AMVA 3LYCA 2ODLA 2VFOA 1QRCA 1HF2A 4YZ0A 1O8LA 2PYGA 3JURA 2BM4A 2IOUG 4JRAC 4XOPA 1KTWA 1OGOX 3GQAA 4Z06A 1DBGA 1OFDA 2J8KA 2PECA 3NB2A 4Z03A 1TYXA 4EW9A 1O88A 2G0YA 4PMHA 2X6XA 2NT6A 1K5CA 3BH7B 2X85A 2NSPA 2QX3A 1JRGA 1TYVA 2BM5A 3GQ8A 2VFNA 4W8RA 4YCQA 3VMVA 2BSPA 2XTWA 4XNFA 1OFMA 3B90A 2NZMA 3JX8A 3PSZA 1QRBA 3DU1X 1CZFA 2VJIA 1JTAA 1GQ8A 1LLWA 2O1DA 4XONA 2Z8GA 1WXRA 1K8FA 1O8EA 2VBKA 2XTYA 4OJ6A 1RU4A 1QQ1A 3PSSA 1DABA 1X0CA 4OJPA 1O8DA 2W7ZA 3NAWA 1K4ZA 1QA1A 4V02C 3B4NA 4XN3A 4OZYA 2O6WA 3N90A 4XQFA 2INVA 1EE6A 3ML3A 1QA2A 1L1IA 1O8FA 1OGMX 2VJJA 3T9GA 3SYJA 2NTQA 4OZZA 2O0VA 2XT2A 4OJ5A 3SQVA 1BHEA 4U4BA 4YFOA 4XKWA 1NHCA 1XG2A 2XC1A 1IA5A 4OM9A 3VSTA 1BN8A 5C1CA 4OJLA 4YELA 4XLFA 4YEJA 2QZAA 2NTPA 1LM1A 1AIRA 4OPWA 1RMGA 4U49A 4XN0A 1H80A 2O04A 1OFEA 3P4GA 3BH6B 1VBLA 3RIQA 1PXZA 4MXNA 4KH3A 5C1EA 4OJOA 2PYHA
chains in the Genus database with same CATH topology
1O8KA 4XOTA 4AVZA 1DBOA 1OFLA 4HWVA 4YZXA 3B8YA 1O8JA 3ZPPA 1IB4A 3UW0A 1QCXA 2O17A 2O0WA 2NTBA 4MR0A 4XR6A 2NSTA 4YZQA 2QXZA 1OOCA 2INUA 4XM3A 1WMRA 4XL9A 1HG8A 1O8IA 3EQNA 3WWGA 4C2LA 4W8QA 2X3HA 4XORA 3GQ7A 3EQOA 1PLUA 2EWEA 2VBMA 2VBEA 1QJVA 4NK6A 4XLCA 1IDJA 3LMWA 4XKVA 4W8SA 3KRGA 1O8GA 3SUCA 2UVEA 3GRHA 1O8HA 3ZSCA 4XLEA 2IQ7A 4XLAA 4NK8A 3FY3A 4URRA 4XMYA 4XLHA 2UVFA 4I84A 3VMWA 2QY1A 2NT9A 1KCDA 3VSVA 4Z05A 4W8TA 2X6YA 1O8MA 1RWRA 1IDKA 2X6WA 3GQ9A 1PE9A 4YZAA 1KCCA 3VSUA 5AMVA 2ODLA 4YZ0A 1O8LA 2PYGA 3JURA 4XOPA 1KTWA 1OGOX 3GQAA 4Z06A 1DBGA 2PECA 4Z03A 4EW9A 1O88A 4PMHA 2X6XA 2NT6A 1K5CA 2X85A 2QX3A 2NSPA 1JRGA 4W8RA 3GQ8A 3VMVA 2BSPA 4XNFA 1OFMA 3B90A 2NZMA 1CZFA 2VJIA 1JTAA 1GQ8A 2O1DA 4XONA 2Z8GA 1O8EA 2VBKA 4OJ6A 1RU4A 1X0CA 4OJPA 1O8DA 4XN3A 3B4NA 4OZYA 4XQFA 2INVA 1EE6A 1O8FA 1OGMX 2VJJA 3T9GA 2NTQA 4OZZA 2O0VA 4OJ5A 1BHEA 4U4BA 1NHCA 4XKWA 1XG2A 1IA5A 3VSTA 5C1CA 1BN8A 4OJLA 4YELA 4XLFA 4YEJA 2NTPA 4U49A 1AIRA 1RMGA 4XN0A 1H80A 2O04A 1VBLA 1PXZA 4MXNA 5C1EA 4OJOA 2PYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8K A;  4XOT A;  4AVZ A;  1DBO A;  1OFL A;  4HWV A;  4YZX A;  3B8Y A;  1O8J A;  3ZPP A;  1IB4 A;  3UW0 A;  1QCX A;  2O17 A;  2O0W A;  2NTB A;  4MR0 A;  4XR6 A;  2NST A;  4YZQ A;  2QXZ A;  1OOC A;  2INU A;  4XM3 A;  1WMR A;  4XL9 A;  1HG8 A;  1O8I A;  3EQN A;  3WWG A;  4C2L A;  4W8Q A;  2X3H A;  4XOR A;  3GQ7 A;  3EQO A;  1PLU A;  2EWE A;  2VBM A;  2VBE A;  1QJV A;  4NK6 A;  4XLC A;  1IDJ A;  3LMW A;  4XKV A;  4W8S A;  3KRG A;  1O8G A;  3SUC A;  2UVE A;  3GRH A;  1O8H A;  3ZSC A;  4XLE A;  2IQ7 A;  4XLA A;  4NK8 A;  3FY3 A;  4URR A;  4XMY A;  4XLH A;  2UVF A;  4I84 A;  3VMW A;  2QY1 A;  2NT9 A;  1KCD A;  3VSV A;  4Z05 A;  4W8T A;  2X6Y A;  1O8M A;  1RWR A;  1IDK A;  2X6W A;  3GQ9 A;  1PE9 A;  4YZA A;  1KCC A;  3VSU A;  5AMV A;  2ODL A;  4YZ0 A;  1O8L A;  2PYG A;  3JUR A;  4XOP A;  1KTW A;  1OGO X;  3GQA A;  4Z06 A;  1DBG A;  2PEC A;  4Z03 A;  4EW9 A;  1O88 A;  4PMH A;  2X6X A;  2NT6 A;  1K5C A;  2X85 A;  2QX3 A;  2NSP A;  1JRG A;  4W8R A;  3GQ8 A;  3VMV A;  2BSP A;  4XNF A;  1OFM A;  3B90 A;  2NZM A;  1CZF A;  2VJI A;  1JTA A;  1GQ8 A;  2O1D A;  4XON A;  2Z8G A;  1O8E A;  2VBK A;  4OJ6 A;  1RU4 A;  1X0C A;  4OJP A;  1O8D A;  4XN3 A;  3B4N A;  4OZY A;  4XQF A;  2INV A;  1EE6 A;  1O8F A;  1OGM X;  2VJJ A;  3T9G A;  2NTQ A;  4OZZ A;  2O0V A;  4OJ5 A;  1BHE A;  4U4B A;  1NHC A;  4XKW A;  1XG2 A;  1IA5 A;  3VST A;  5C1C A;  1BN8 A;  4OJL A;  4YEL A;  4XLF A;  4YEJ A;  2NTP A;  4U49 A;  1AIR A;  1RMG A;  4XN0 A;  1H80 A;  2O04 A;  1VBL A;  1PXZ A;  4MXN A;  5C1E A;  4OJO A;  2PYH A; 
#chains in the Genus database with same CATH topology
 1O8K A;  1CLW A;  4XOT A;  4AVZ A;  1DBO A;  1OFL A;  4HWV A;  4YZX A;  2BM6 A;  1O8J A;  2QYU A;  3B8Y A;  3ZPP A;  1QA3 A;  1IB4 A;  3UW0 A;  1QCX A;  2VFP A;  2O17 A;  2O0W A;  2NTB A;  4MR0 A;  4XR6 A;  3SY2 A;  2NST A;  4YZQ A;  2QXZ A;  1OOC A;  2INU A;  1KQ5 A;  4XM3 A;  5JLV C;  2VFM A;  5JMC B;  1WMR A;  2B0R A;  4XL9 A;  1HG8 A;  4YDT A;  1O8I A;  3EQN A;  3WWG A;  1TYW A;  2J8I A;  4C2L A;  4W8Q A;  2X3H A;  2F3L A;  3N6Z A;  3LJY A;  3GQ7 A;  4XOR A;  3TH0 A;  3EQO A;  1TSP A;  1PLU A;  1EA0 A;  2EWE A;  2VBM A;  1QJV A;  2V5I A;  2VBE A;  4NK6 A;  4XLC A;  1IDJ A;  3LMW A;  4YC5 A;  4XKV A;  5DNS A;  2XT4 A;  4W8S A;  3KRG A;  1O8G A;  3SUC A;  2UVE A;  3GRH A;  1O8H A;  3ZSC A;  3PET A;  4XLE A;  2VFQ A;  1TYU A;  2BX6 A;  3SZE A;  2IQ7 A;  2XTX A;  4XLA A;  3AK5 A;  4NK8 A;  3FY3 A;  1LLZ A;  4YEI A;  4URR A;  4XMY A;  4XLH A;  2UVF A;  4I84 A;  3VMW A;  1EZG A;  2NT9 A;  2QY1 A;  1KCD A;  3VSV A;  4Z05 A;  2YUH A;  4W8T A;  2BM7 A;  2X6Y A;  1O8M A;  1RWR A;  3H09 A;  1IDK A;  2X6W A;  3GQ9 A;  1PE9 A;  4YZA A;  1KCC A;  3VSU A;  5AMV A;  3LYC A;  2ODL A;  2VFO A;  1QRC A;  1HF2 A;  4YZ0 A;  1O8L A;  2PYG A;  3JUR A;  2BM4 A;  2IOU G;  4JRA C;  4XOP A;  1KTW A;  1OGO X;  3GQA A;  4Z06 A;  1DBG A;  1OFD A;  2J8K A;  2PEC A;  3NB2 A;  4Z03 A;  1TYX A;  4EW9 A;  1O88 A;  2G0Y A;  4PMH A;  2X6X A;  2NT6 A;  1K5C A;  3BH7 B;  2X85 A;  2NSP A;  2QX3 A;  1JRG A;  1TYV A;  2BM5 A;  3GQ8 A;  2VFN A;  4W8R A;  4YCQ A;  3VMV A;  2BSP A;  2XTW A;  4XNF A;  1OFM A;  3B90 A;  2NZM A;  3JX8 A;  3PSZ A;  1QRB A;  3DU1 X;  1CZF A;  2VJI A;  1JTA A;  1GQ8 A;  1LLW A;  2O1D A;  4XON A;  2Z8G A;  1WXR A;  1K8F A;  1O8E A;  2VBK A;  2XTY A;  4OJ6 A;  1RU4 A;  1QQ1 A;  3PSS A;  1DAB A;  1X0C A;  4OJP A;  1O8D A;  2W7Z A;  3NAW A;  1K4Z A;  1QA1 A;  4V02 C;  3B4N A;  4XN3 A;  4OZY A;  2O6W A;  3N90 A;  4XQF A;  2INV A;  1EE6 A;  3ML3 A;  1QA2 A;  1L1I A;  1O8F A;  1OGM X;  2VJJ A;  3T9G A;  3SYJ A;  2NTQ A;  4OZZ A;  2O0V A;  2XT2 A;  4OJ5 A;  3SQV A;  1BHE A;  4U4B A;  4YFO A;  4XKW A;  1NHC A;  1XG2 A;  2XC1 A;  1IA5 A;  4OM9 A;  3VST A;  1BN8 A;  5C1C A;  4OJL A;  4YEL A;  4XLF A;  4YEJ A;  2QZA A;  2NTP A;  1LM1 A;  1AIR A;  4OPW A;  1RMG A;  4U49 A;  4XN0 A;  1H80 A;  2O04 A;  1OFE A;  3P4G A;  3BH6 B;  1VBL A;  3RIQ A;  1PXZ A;  4MXN A;  4KH3 A;  5C1E A;  4OJO A;  2PYH A; 
#chains in the Genus database with same CATH homology
 1O8K A;  4XOT A;  4AVZ A;  1DBO A;  1OFL A;  4HWV A;  4YZX A;  3B8Y A;  1O8J A;  3ZPP A;  1IB4 A;  3UW0 A;  1QCX A;  2O17 A;  2O0W A;  2NTB A;  4MR0 A;  4XR6 A;  2NST A;  4YZQ A;  2QXZ A;  1OOC A;  2INU A;  4XM3 A;  1WMR A;  4XL9 A;  1HG8 A;  1O8I A;  3EQN A;  3WWG A;  4C2L A;  4W8Q A;  2X3H A;  4XOR A;  3GQ7 A;  3EQO A;  1PLU A;  2EWE A;  2VBM A;  2VBE A;  1QJV A;  4NK6 A;  4XLC A;  1IDJ A;  3LMW A;  4XKV A;  4W8S A;  3KRG A;  1O8G A;  3SUC A;  2UVE A;  3GRH A;  1O8H A;  3ZSC A;  4XLE A;  2IQ7 A;  4XLA A;  4NK8 A;  3FY3 A;  4URR A;  4XMY A;  4XLH A;  2UVF A;  4I84 A;  3VMW A;  2QY1 A;  2NT9 A;  1KCD A;  3VSV A;  4Z05 A;  4W8T A;  2X6Y A;  1O8M A;  1RWR A;  1IDK A;  2X6W A;  3GQ9 A;  1PE9 A;  4YZA A;  1KCC A;  3VSU A;  5AMV A;  2ODL A;  4YZ0 A;  1O8L A;  2PYG A;  3JUR A;  4XOP A;  1KTW A;  1OGO X;  3GQA A;  4Z06 A;  1DBG A;  2PEC A;  4Z03 A;  4EW9 A;  1O88 A;  4PMH A;  2X6X A;  2NT6 A;  1K5C A;  2X85 A;  2QX3 A;  2NSP A;  1JRG A;  4W8R A;  3GQ8 A;  3VMV A;  2BSP A;  4XNF A;  1OFM A;  3B90 A;  2NZM A;  1CZF A;  2VJI A;  1JTA A;  1GQ8 A;  2O1D A;  4XON A;  2Z8G A;  1O8E A;  2VBK A;  4OJ6 A;  1RU4 A;  1X0C A;  4OJP A;  1O8D A;  4XN3 A;  3B4N A;  4OZY A;  4XQF A;  2INV A;  1EE6 A;  1O8F A;  1OGM X;  2VJJ A;  3T9G A;  2NTQ A;  4OZZ A;  2O0V A;  4OJ5 A;  1BHE A;  4U4B A;  1NHC A;  4XKW A;  1XG2 A;  1IA5 A;  3VST A;  5C1C A;  1BN8 A;  4OJL A;  4YEL A;  4XLF A;  4YEJ A;  2NTP A;  4U49 A;  1AIR A;  1RMG A;  4XN0 A;  1H80 A;  2O04 A;  1VBL A;  1PXZ A;  4MXN A;  5C1E A;  4OJO A;  2PYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...