4YZAA

C. bescii family 3 pectate lyase double mutant k108a/q111a in complex with trigalacturonic acid
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
198
structure length
198
Chain Sequence
b'HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADAVFALNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 82
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzaA00
3UW0A 4Z06A 3EQNA 3LMWA 1OGOX 3B4NA 5C1CA 3GQ9A 4XLFA 3EQOA 3GQAA 4W8TA 3GRHA 4OJOA 1KCDA 2VBMA 1BHEA 1NHCA 4XR6A 2VBKA 2PYHA 2NT9A 4XKWA 4XKVA 2NTPA 4OJ6A 3B8YA 1KTWA 1O8LA 1O88A 2X85A 4OJ5A 3KRGA 4XMYA 4NK8A 2NSPA 4C2LA 2EWEA 4XM3A 1XG2A 1BN8A 1O8HA 2X6YA 3SUCA 4MR0A 2Z8GA 4OZZA 2VJIA 4NK6A 2VJJA 4YZXA 1GQ8A 1OFMA 4HWVA 4U4BA 4OJLA 1AIRA 1JTAA 1IDJA 4I84A 1O8KA 1CZFA 1RMGA 2NT6A 1O8JA 2O0WA 3GQ7A 2X6XA 1DBOA 4XLAA 1H80A 4XONA 4XLEA 4YEJA 4XN3A 4XOPA 3VMVA 1VBLA 1O8GA 4XL9A 3FY3A 2IQ7A 4U49A 2UVEA 1RWRA 2QXZA 2O0VA 1DBGA 1O8FA 1PLUA 1RU4A 4YZQA 2X6WA 2NTBA 2O1DA 1IB4A 2VBEA 2PYGA 4MXNA 3VMWA 2BSPA 1QCXA 1PE9A 1O8MA 4W8RA 4XQFA 1JRGA 4OZYA 1IA5A 2QX3A 4Z05A 3B90A 2NTQA 2O17A 3JURA 4W8SA 4XLHA 4XN0A 1K5CA 1QJVA 1OFLA 4XORA 4YZAA 1OGMX 2QY1A 5C1EA 1O8EA 4YELA 2PECA 4EW9A 1EE6A 2UVFA 1KCCA 4XNFA 3ZPPA 1O8DA 4XLCA 1O8IA 5AMVA 3T9GA 2INVA 2X3HA 3VSTA 4AVZA 3ZSCA 1PXZA 4Z03A 3VSVA 4YZ0A 3WWGA 4XOTA 2NSTA 1X0CA 2INUA 4W8QA 1IDKA 2NZMA 1OOCA 4URRA 1HG8A 3VSUA 4OJPA 2ODLA 1WMRA 2O04A 3GQ8A 4PMHA
chains in the Genus database with same CATH superfamily
3UW0A 4Z06A 1DABA 1TYWA 3EQNA 3LMWA 1OGOX 3TH0A 1K8FA 3B4NA 5C1CA 3GQ9A 4XLFA 3JX8A 3EQOA 3GQAA 4W8TA 3GRHA 4OJOA 1KCDA 2VBMA 1BHEA 1NHCA 4XR6A 2VBKA 1EZGA 2BX6A 2PYHA 2W7ZA 1TYXA 1QRBA 1EA0A 1QRCA 1OFEA 2NT9A 3BH6B 2NTPA 4OJ6A 4XKWA 3B8YA 4XKVA 1KTWA 1O8LA 1O88A 2X85A 4OJ5A 1QA3A 3PSSA 3KRGA 1TYUA 4XMYA 4NK8A 4YDTA 1K4ZA 2NSPA 4C2LA 3N6ZA 3PETA 2EWEA 2VFPA 3SYJA 4XM3A 1XG2A 1TSPA 1QA2A 1BN8A 1O8HA 2X6YA 3SUCA 4MR0A 2Z8GA 4OZZA 2VJIA 4NK6A 2VJJA 4YZXA 1GQ8A 1OFMA 4HWVA 2QYUA 3NAWA 4OJLA 1QQ1A 4U4BA 1AIRA 1JTAA 1IDJA 4I84A 1O8KA 1CZFA 1RMGA 4YEIA 2NT6A 1O8JA 2XC1A 2O0WA 3GQ7A 2X6XA 1DBOA 4XLAA 4YCQA 1H80A 5JMCB 4XONA 4XLEA 4YEJA 4XN3A 4XOPA 3VMVA 1VBLA 1O8GA 2VFNA 3FY3A 4XL9A 2IQ7A 2V5IA 4U49A 3SY2A 2UVEA 1RWRA 2QXZA 2O0VA 1DBGA 4OM9A 1O8FA 1PLUA 1RU4A 2J8KA 3ML3A 4YZQA 2X6WA 5JLVC 2NTBA 2O1DA 1IB4A 2VBEA 2PYGA 4MXNA 2BM7A 2XT4A 2BSPA 3VMWA 1QCXA 1PE9A 3AK5A 1O8MA 4W8RA 4XQFA 1JRGA 2VFMA 3SQVA 3SZEA 4OZYA 2J8IA 5DNSA 3LYCA 1IA5A 2QX3A 2BM5A 1HF2A 4Z05A 3B90A 2NTQA 2O17A 3JURA 4W8SA 4XLHA 4XN0A 1K5CA 1QJVA 1OFLA 4XORA 4YZAA 1LLZA 1OGMX 2B0RA 2QY1A 2XTXA 5C1EA 3N90A 4OPWA 1O8EA 1LM1A 2F3LA 4YELA 2PECA 4EW9A 2O6WA 1L1IA 1EE6A 2VFQA 2XTYA 2UVFA 1KCCA 4XNFA 3ZPPA 4YFOA 4YC5A 1O8DA 4XLCA 1O8IA 3P4GA 5AMVA 2BM6A 2XTWA 3T9GA 2INVA 2X3HA 4V02C 3BH7B 3RIQA 2XT2A 3VSTA 4AVZA 2YUHA 2G0YA 1QA1A 3ZSCA 1PXZA 2VFOA 4Z03A 4KH3A 3VSVA 4YZ0A 3WWGA 3H09A 4XOTA 1CLWA 2NSTA 3LJYA 1X0CA 2INUA 1OFDA 1WXRA 1KQ5A 3DU1X 2QZAA 4W8QA 1IDKA 2NZMA 1TYVA 1OOCA 4JRAC 2BM4A 4URRA 1LLWA 1HG8A 3PSZA 3VSUA 4OJPA 2ODLA 1WMRA 2O04A 3GQ8A 2IOUG 3NB2A 4PMHA
chains in the Genus database with same CATH topology
3UW0A 4Z06A 3EQNA 3LMWA 1OGOX 3B4NA 5C1CA 3GQ9A 4XLFA 3EQOA 3GQAA 4W8TA 3GRHA 4OJOA 1KCDA 2VBMA 1BHEA 1NHCA 4XR6A 2VBKA 2PYHA 2NT9A 4XKWA 4XKVA 2NTPA 4OJ6A 3B8YA 1KTWA 1O8LA 1O88A 2X85A 4OJ5A 3KRGA 4XMYA 4NK8A 2NSPA 4C2LA 2EWEA 4XM3A 1XG2A 1BN8A 1O8HA 2X6YA 3SUCA 4MR0A 2Z8GA 4OZZA 2VJIA 4NK6A 2VJJA 4YZXA 1GQ8A 1OFMA 4HWVA 4U4BA 4OJLA 1AIRA 1JTAA 1IDJA 4I84A 1O8KA 1CZFA 1RMGA 2NT6A 1O8JA 2O0WA 3GQ7A 2X6XA 1DBOA 4XLAA 1H80A 4XONA 4XLEA 4YEJA 4XN3A 4XOPA 3VMVA 1VBLA 1O8GA 4XL9A 3FY3A 2IQ7A 4U49A 2UVEA 1RWRA 2QXZA 2O0VA 1DBGA 1O8FA 1PLUA 1RU4A 4YZQA 2X6WA 2NTBA 2O1DA 1IB4A 2VBEA 2PYGA 4MXNA 3VMWA 2BSPA 1QCXA 1PE9A 1O8MA 4W8RA 4XQFA 1JRGA 4OZYA 1IA5A 2QX3A 4Z05A 3B90A 2NTQA 2O17A 3JURA 4W8SA 4XLHA 4XN0A 1K5CA 1QJVA 1OFLA 4XORA 4YZAA 1OGMX 2QY1A 5C1EA 1O8EA 4YELA 2PECA 4EW9A 1EE6A 2UVFA 1KCCA 4XNFA 3ZPPA 1O8DA 4XLCA 1O8IA 5AMVA 3T9GA 2INVA 2X3HA 3VSTA 4AVZA 3ZSCA 1PXZA 4Z03A 3VSVA 4YZ0A 3WWGA 4XOTA 2NSTA 1X0CA 2INUA 4W8QA 1IDKA 2NZMA 1OOCA 4URRA 1HG8A 3VSUA 4OJPA 2ODLA 1WMRA 2O04A 3GQ8A 4PMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UW0 A;  4Z06 A;  3EQN A;  3LMW A;  1OGO X;  3B4N A;  5C1C A;  3GQ9 A;  4XLF A;  3EQO A;  3GQA A;  4W8T A;  3GRH A;  4OJO A;  1KCD A;  2VBM A;  1BHE A;  1NHC A;  4XR6 A;  2VBK A;  2PYH A;  2NT9 A;  4XKW A;  4XKV A;  2NTP A;  4OJ6 A;  3B8Y A;  1KTW A;  1O8L A;  1O88 A;  2X85 A;  4OJ5 A;  3KRG A;  4XMY A;  4NK8 A;  2NSP A;  4C2L A;  2EWE A;  4XM3 A;  1XG2 A;  1BN8 A;  1O8H A;  2X6Y A;  3SUC A;  4MR0 A;  2Z8G A;  4OZZ A;  2VJI A;  4NK6 A;  2VJJ A;  4YZX A;  1GQ8 A;  1OFM A;  4HWV A;  4U4B A;  4OJL A;  1AIR A;  1JTA A;  1IDJ A;  4I84 A;  1O8K A;  1CZF A;  1RMG A;  2NT6 A;  1O8J A;  2O0W A;  3GQ7 A;  2X6X A;  1DBO A;  4XLA A;  1H80 A;  4XON A;  4XLE A;  4YEJ A;  4XN3 A;  4XOP A;  3VMV A;  1VBL A;  1O8G A;  4XL9 A;  3FY3 A;  2IQ7 A;  4U49 A;  2UVE A;  1RWR A;  2QXZ A;  2O0V A;  1DBG A;  1O8F A;  1PLU A;  1RU4 A;  4YZQ A;  2X6W A;  2NTB A;  2O1D A;  1IB4 A;  2VBE A;  2PYG A;  4MXN A;  3VMW A;  2BSP A;  1QCX A;  1PE9 A;  1O8M A;  4W8R A;  4XQF A;  1JRG A;  4OZY A;  1IA5 A;  2QX3 A;  4Z05 A;  3B90 A;  2NTQ A;  2O17 A;  3JUR A;  4W8S A;  4XLH A;  4XN0 A;  1K5C A;  1QJV A;  1OFL A;  4XOR A;  4YZA A;  1OGM X;  2QY1 A;  5C1E A;  1O8E A;  4YEL A;  2PEC A;  4EW9 A;  1EE6 A;  2UVF A;  1KCC A;  4XNF A;  3ZPP A;  1O8D A;  4XLC A;  1O8I A;  5AMV A;  3T9G A;  2INV A;  2X3H A;  3VST A;  4AVZ A;  3ZSC A;  1PXZ A;  4Z03 A;  3VSV A;  4YZ0 A;  3WWG A;  4XOT A;  2NST A;  1X0C A;  2INU A;  4W8Q A;  1IDK A;  2NZM A;  1OOC A;  4URR A;  1HG8 A;  3VSU A;  4OJP A;  2ODL A;  1WMR A;  2O04 A;  3GQ8 A;  4PMH A; 
#chains in the Genus database with same CATH topology
 3UW0 A;  4Z06 A;  1DAB A;  1TYW A;  3EQN A;  3LMW A;  1OGO X;  3TH0 A;  1K8F A;  3B4N A;  5C1C A;  3GQ9 A;  4XLF A;  3JX8 A;  3EQO A;  3GQA A;  4W8T A;  3GRH A;  4OJO A;  1KCD A;  2VBM A;  1BHE A;  1NHC A;  4XR6 A;  2VBK A;  1EZG A;  2BX6 A;  2PYH A;  2W7Z A;  1TYX A;  1QRB A;  1EA0 A;  1QRC A;  1OFE A;  2NT9 A;  3BH6 B;  2NTP A;  4OJ6 A;  4XKW A;  3B8Y A;  4XKV A;  1KTW A;  1O8L A;  1O88 A;  2X85 A;  4OJ5 A;  1QA3 A;  3PSS A;  3KRG A;  1TYU A;  4XMY A;  4NK8 A;  4YDT A;  1K4Z A;  2NSP A;  4C2L A;  3N6Z A;  3PET A;  2EWE A;  2VFP A;  3SYJ A;  4XM3 A;  1XG2 A;  1TSP A;  1QA2 A;  1BN8 A;  1O8H A;  2X6Y A;  3SUC A;  4MR0 A;  2Z8G A;  4OZZ A;  2VJI A;  4NK6 A;  2VJJ A;  4YZX A;  1GQ8 A;  1OFM A;  4HWV A;  2QYU A;  3NAW A;  4OJL A;  1QQ1 A;  4U4B A;  1AIR A;  1JTA A;  1IDJ A;  4I84 A;  1O8K A;  1CZF A;  1RMG A;  4YEI A;  2NT6 A;  1O8J A;  2XC1 A;  2O0W A;  3GQ7 A;  2X6X A;  1DBO A;  4XLA A;  4YCQ A;  1H80 A;  5JMC B;  4XON A;  4XLE A;  4YEJ A;  4XN3 A;  4XOP A;  3VMV A;  1VBL A;  1O8G A;  2VFN A;  3FY3 A;  4XL9 A;  2IQ7 A;  2V5I A;  4U49 A;  3SY2 A;  2UVE A;  1RWR A;  2QXZ A;  2O0V A;  1DBG A;  4OM9 A;  1O8F A;  1PLU A;  1RU4 A;  2J8K A;  3ML3 A;  4YZQ A;  2X6W A;  5JLV C;  2NTB A;  2O1D A;  1IB4 A;  2VBE A;  2PYG A;  4MXN A;  2BM7 A;  2XT4 A;  2BSP A;  3VMW A;  1QCX A;  1PE9 A;  3AK5 A;  1O8M A;  4W8R A;  4XQF A;  1JRG A;  2VFM A;  3SQV A;  3SZE A;  4OZY A;  2J8I A;  5DNS A;  3LYC A;  1IA5 A;  2QX3 A;  2BM5 A;  1HF2 A;  4Z05 A;  3B90 A;  2NTQ A;  2O17 A;  3JUR A;  4W8S A;  4XLH A;  4XN0 A;  1K5C A;  1QJV A;  1OFL A;  4XOR A;  4YZA A;  1LLZ A;  1OGM X;  2B0R A;  2QY1 A;  2XTX A;  5C1E A;  3N90 A;  4OPW A;  1O8E A;  1LM1 A;  2F3L A;  4YEL A;  2PEC A;  4EW9 A;  2O6W A;  1L1I A;  1EE6 A;  2VFQ A;  2XTY A;  2UVF A;  1KCC A;  4XNF A;  3ZPP A;  4YFO A;  4YC5 A;  1O8D A;  4XLC A;  1O8I A;  3P4G A;  5AMV A;  2BM6 A;  2XTW A;  3T9G A;  2INV A;  2X3H A;  4V02 C;  3BH7 B;  3RIQ A;  2XT2 A;  3VST A;  4AVZ A;  2YUH A;  2G0Y A;  1QA1 A;  3ZSC A;  1PXZ A;  2VFO A;  4Z03 A;  4KH3 A;  3VSV A;  4YZ0 A;  3WWG A;  3H09 A;  4XOT A;  1CLW A;  2NST A;  3LJY A;  1X0C A;  2INU A;  1OFD A;  1WXR A;  1KQ5 A;  3DU1 X;  2QZA A;  4W8Q A;  1IDK A;  2NZM A;  1TYV A;  1OOC A;  4JRA C;  2BM4 A;  4URR A;  1LLW A;  1HG8 A;  3PSZ A;  3VSU A;  4OJP A;  2ODL A;  1WMR A;  2O04 A;  3GQ8 A;  2IOU G;  3NB2 A;  4PMH A; 
#chains in the Genus database with same CATH homology
 3UW0 A;  4Z06 A;  3EQN A;  3LMW A;  1OGO X;  3B4N A;  5C1C A;  3GQ9 A;  4XLF A;  3EQO A;  3GQA A;  4W8T A;  3GRH A;  4OJO A;  1KCD A;  2VBM A;  1BHE A;  1NHC A;  4XR6 A;  2VBK A;  2PYH A;  2NT9 A;  4XKW A;  4XKV A;  2NTP A;  4OJ6 A;  3B8Y A;  1KTW A;  1O8L A;  1O88 A;  2X85 A;  4OJ5 A;  3KRG A;  4XMY A;  4NK8 A;  2NSP A;  4C2L A;  2EWE A;  4XM3 A;  1XG2 A;  1BN8 A;  1O8H A;  2X6Y A;  3SUC A;  4MR0 A;  2Z8G A;  4OZZ A;  2VJI A;  4NK6 A;  2VJJ A;  4YZX A;  1GQ8 A;  1OFM A;  4HWV A;  4U4B A;  4OJL A;  1AIR A;  1JTA A;  1IDJ A;  4I84 A;  1O8K A;  1CZF A;  1RMG A;  2NT6 A;  1O8J A;  2O0W A;  3GQ7 A;  2X6X A;  1DBO A;  4XLA A;  1H80 A;  4XON A;  4XLE A;  4YEJ A;  4XN3 A;  4XOP A;  3VMV A;  1VBL A;  1O8G A;  4XL9 A;  3FY3 A;  2IQ7 A;  4U49 A;  2UVE A;  1RWR A;  2QXZ A;  2O0V A;  1DBG A;  1O8F A;  1PLU A;  1RU4 A;  4YZQ A;  2X6W A;  2NTB A;  2O1D A;  1IB4 A;  2VBE A;  2PYG A;  4MXN A;  3VMW A;  2BSP A;  1QCX A;  1PE9 A;  1O8M A;  4W8R A;  4XQF A;  1JRG A;  4OZY A;  1IA5 A;  2QX3 A;  4Z05 A;  3B90 A;  2NTQ A;  2O17 A;  3JUR A;  4W8S A;  4XLH A;  4XN0 A;  1K5C A;  1QJV A;  1OFL A;  4XOR A;  4YZA A;  1OGM X;  2QY1 A;  5C1E A;  1O8E A;  4YEL A;  2PEC A;  4EW9 A;  1EE6 A;  2UVF A;  1KCC A;  4XNF A;  3ZPP A;  1O8D A;  4XLC A;  1O8I A;  5AMV A;  3T9G A;  2INV A;  2X3H A;  3VST A;  4AVZ A;  3ZSC A;  1PXZ A;  4Z03 A;  3VSV A;  4YZ0 A;  3WWG A;  4XOT A;  2NST A;  1X0C A;  2INU A;  4W8Q A;  1IDK A;  2NZM A;  1OOC A;  4URR A;  1HG8 A;  3VSU A;  4OJP A;  2ODL A;  1WMR A;  2O04 A;  3GQ8 A;  4PMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...