4YZHA

Structure of the arabidopsis tap38/pph1 in complex with plhcb1 phosphopeptide substrate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
294
structure length
294
Chain Sequence
b'MRWGYTSVQGFRDEMEDDIVIRSDAVDSFSYAAVFDGHAGSSSVKFLREELYKECVGALQAGSLLNGGDFAAIKEALIKAFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGESCAVLSRSGQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWIVNGRICGDIAVSRAFGDIRFKTKKNDMLKKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWDYMKSSDVVSYVRDQLRKHGNVQLACESLAQVALDRRSQDNISIIIADLGRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 2C 57
publication title Structural Mechanism Underlying the Specific Recognition between the Arabidopsis State-Transition Phosphatase TAP38/PPH1 and Phosphorylated Light-Harvesting Complex Protein Lhcb1
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/hydrolase substrate
total genus 95
structure length 294
sequence length 294
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.10 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 PPM-type phosphatase domain 4yzhA00
4YZHA 4WVOB 3T9QA 5ITIA 3W43A 5JO2B 4OICB 3W44A 2I0OA 3UJKA 2XZVA 4LA7B 3W41A 4LGBB 4N0GA 2JFTA 2J82A 4YZGA 3RNRA 4JNDA 4RAGA 3RT0A 3FXLA 2CM1A 2Y09A 2J86A 2P8EA 3FXKA 3N3CA 3FXJA 3PU9A 3T91A 2J4OA 4LG5B 4DS8B 4LGAB 3ZT9A 5JO1B 3KB3B 3W40A 5D2UA 3KDJB 2PNQA 2JFSA 2IQ1A 3NMNB 3JRQA 3D8KA 3FXOA 4RAFA 3KE6A 2PK0A 3EQ2A 2ISNA 3FXMA 3W45A 2JFRA 3ZVUB 2V06A 1TXOA 3F79A 3W42A 2IRMA 2POPA 3NMVB 2POMA 3MQ3A 3NMTB 2I44A 4RA2A 3UJLB 5F1MA 3ES2A 3QN1B 4DA1A 1A6QA 3UJGB
chains in the Genus database with same CATH superfamily
4YZHA 4WVOB 3T9QA 5ITIA 3W43A 5JO2B 4OICB 3W44A 4IIPA 2I0OA 3UJKA 2XZVA 4IIKA 4LA7B 3W41A 4LGBB 4N0GA 2JFTA 2J82A 4YZGA 3RNRA 4JNDA 4RAGA 3RT0A 3FXLA 2CM1A 2Y09A 2J86A 2P8EA 3FXKA 3N3CA 3FXJA 3PU9A 3T91A 2J4OA 4LG5B 4DS8B 4LGAB 3ZT9A 5JO1B 3KB3B 3W40A 5D2UA 3KDJB 2PNQA 2JFSA 2IQ1A 3NMNB 3JRQA 3D8KA 3FXOA 4RAFA 3KE6A 2PK0A 3EQ2A 2ISNA 3FXMA 3W45A 2JFRA 3ZVUB 2V06A 1TXOA 3F79A 3W42A 2IRMA 2POPA 3NMVB 2POMA 3MQ3A 3NMTB 2I44A 4RA2A 3UJLB 5F1MA 3ES2A 3QN1B 4DA1A 1A6QA 3UJGB
chains in the Genus database with same CATH topology
4YZHA 4WVOB 3T9QA 5ITIA 3W43A 5JO2B 4OICB 3W44A 2I0OA 3UJKA 2XZVA 4LA7B 3W41A 4LGBB 4N0GA 2JFTA 2J82A 4YZGA 3RNRA 4JNDA 4RAGA 3RT0A 3FXLA 2CM1A 2Y09A 2J86A 2P8EA 3FXKA 3N3CA 3FXJA 3PU9A 3T91A 2J4OA 4LG5B 4DS8B 4LGAB 3ZT9A 5JO1B 3KB3B 3W40A 5D2UA 3KDJB 2PNQA 2JFSA 2IQ1A 3NMNB 3JRQA 3D8KA 3FXOA 4RAFA 3KE6A 2PK0A 3EQ2A 2ISNA 3FXMA 3W45A 2JFRA 3ZVUB 2V06A 1TXOA 3F79A 3W42A 2IRMA 2POPA 3NMVB 2POMA 3MQ3A 3NMTB 2I44A 4RA2A 3UJLB 5F1MA 3ES2A 3QN1B 4DA1A 1A6QA 3UJGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZH A;  4WVO B;  3T9Q A;  5ITI A;  3W43 A;  5JO2 B;  4OIC B;  3W44 A;  2I0O A;  3UJK A;  2XZV A;  4LA7 B;  3W41 A;  4LGB B;  4N0G A;  2JFT A;  2J82 A;  4YZG A;  3RNR A;  4JND A;  4RAG A;  3RT0 A;  3FXL A;  2CM1 A;  2Y09 A;  2J86 A;  2P8E A;  3FXK A;  3N3C A;  3FXJ A;  3PU9 A;  3T91 A;  2J4O A;  4LG5 B;  4DS8 B;  4LGA B;  3ZT9 A;  5JO1 B;  3KB3 B;  3W40 A;  5D2U A;  3KDJ B;  2PNQ A;  2JFS A;  2IQ1 A;  3NMN B;  3JRQ A;  3D8K A;  3FXO A;  4RAF A;  3KE6 A;  2PK0 A;  3EQ2 A;  2ISN A;  3FXM A;  3W45 A;  2JFR A;  3ZVU B;  2V06 A;  1TXO A;  3F79 A;  3W42 A;  2IRM A;  2POP A;  3NMV B;  2POM A;  3MQ3 A;  3NMT B;  2I44 A;  4RA2 A;  3UJL B;  5F1M A;  3ES2 A;  3QN1 B;  4DA1 A;  1A6Q A;  3UJG B; 
#chains in the Genus database with same CATH topology
 4YZH A;  4WVO B;  3T9Q A;  5ITI A;  3W43 A;  5JO2 B;  4OIC B;  3W44 A;  4IIP A;  2I0O A;  3UJK A;  2XZV A;  4IIK A;  4LA7 B;  3W41 A;  4LGB B;  4N0G A;  2JFT A;  2J82 A;  4YZG A;  3RNR A;  4JND A;  4RAG A;  3RT0 A;  3FXL A;  2CM1 A;  2Y09 A;  2J86 A;  2P8E A;  3FXK A;  3N3C A;  3FXJ A;  3PU9 A;  3T91 A;  2J4O A;  4LG5 B;  4DS8 B;  4LGA B;  3ZT9 A;  5JO1 B;  3KB3 B;  3W40 A;  5D2U A;  3KDJ B;  2PNQ A;  2JFS A;  2IQ1 A;  3NMN B;  3JRQ A;  3D8K A;  3FXO A;  4RAF A;  3KE6 A;  2PK0 A;  3EQ2 A;  2ISN A;  3FXM A;  3W45 A;  2JFR A;  3ZVU B;  2V06 A;  1TXO A;  3F79 A;  3W42 A;  2IRM A;  2POP A;  3NMV B;  2POM A;  3MQ3 A;  3NMT B;  2I44 A;  4RA2 A;  3UJL B;  5F1M A;  3ES2 A;  3QN1 B;  4DA1 A;  1A6Q A;  3UJG B; 
#chains in the Genus database with same CATH homology
 4YZH A;  4WVO B;  3T9Q A;  5ITI A;  3W43 A;  5JO2 B;  4OIC B;  3W44 A;  2I0O A;  3UJK A;  2XZV A;  4LA7 B;  3W41 A;  4LGB B;  4N0G A;  2JFT A;  2J82 A;  4YZG A;  3RNR A;  4JND A;  4RAG A;  3RT0 A;  3FXL A;  2CM1 A;  2Y09 A;  2J86 A;  2P8E A;  3FXK A;  3N3C A;  3FXJ A;  3PU9 A;  3T91 A;  2J4O A;  4LG5 B;  4DS8 B;  4LGA B;  3ZT9 A;  5JO1 B;  3KB3 B;  3W40 A;  5D2U A;  3KDJ B;  2PNQ A;  2JFS A;  2IQ1 A;  3NMN B;  3JRQ A;  3D8K A;  3FXO A;  4RAF A;  3KE6 A;  2PK0 A;  3EQ2 A;  2ISN A;  3FXM A;  3W45 A;  2JFR A;  3ZVU B;  2V06 A;  1TXO A;  3F79 A;  3W42 A;  2IRM A;  2POP A;  3NMV B;  2POM A;  3MQ3 A;  3NMT B;  2I44 A;  4RA2 A;  3UJL B;  5F1M A;  3ES2 A;  3QN1 B;  4DA1 A;  1A6Q A;  3UJG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...