4YZXA

C. bescii family 3 pectate lyase double mutant k108a/d107n in complex with trigalacturonic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAANAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 81
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzxA00
1RU4A 2IQ7A 4OJPA 1PLUA 4OJLA 4NK8A 1OOCA 2NSTA 2O17A 2PYGA 1KTWA 2QY1A 1PE9A 5AMVA 1KCDA 3EQNA 3GQAA 2NTBA 4XL9A 2QXZA 1CZFA 2QX3A 4W8QA 2INVA 4XR6A 3VSTA 1JRGA 1BHEA 2VJJA 1O8FA 1DBOA 4OJ5A 3GQ7A 1DBGA 1KCCA 4XLAA 2UVFA 1BN8A 4XLFA 3UW0A 3GQ8A 2ODLA 1O8DA 1OGOX 4XM3A 1EE6A 3ZPPA 1OFLA 1O8IA 1O8JA 3B90A 4Z03A 2O0VA 2BSPA 4W8TA 3ZSCA 4XORA 3VSUA 3FY3A 4AVZA 5C1EA 4XNFA 4YEJA 4YZ0A 1IDKA 4HWVA 2NTQA 2X6YA 2O04A 4XMYA 1OGMX 4OZYA 1QJVA 1PXZA 2O1DA 4MXNA 4XLEA 1VBLA 2INUA 4YELA 2X3HA 4OJ6A 3VMVA 4OJOA 2EWEA 1IB4A 1H80A 2X6WA 1NHCA 2PECA 4Z05A 4XN0A 4XKWA 2UVEA 1O8EA 4W8SA 3WWGA 4XQFA 3EQOA 1AIRA 4URRA 1HG8A 1RWRA 2NT9A 4XONA 1JTAA 1O8LA 4XKVA 5C1CA 1GQ8A 4XN3A 4I84A 2O0WA 2Z8GA 4OZZA 1X0CA 3SUCA 2VBKA 4YZQA 4XOPA 2PYHA 3VMWA 1OFMA 2X6XA 2NTPA 2NT6A 3LMWA 4EW9A 1RMGA 4MR0A 2NZMA 1O88A 3GQ9A 3T9GA 3GRHA 1QCXA 3JURA 4XLCA 2VBEA 2NSPA 1IA5A 1WMRA 4YZAA 1O8MA 1O8HA 2X85A 2VJIA 4XLHA 4C2LA 3VSVA 4U49A 4PMHA 1K5CA 3KRGA 3B4NA 1O8GA 4NK6A 2VBMA 4U4BA 4W8RA 1XG2A 1O8KA 4Z06A 3B8YA 1IDJA 4XOTA 4YZXA
chains in the Genus database with same CATH superfamily
1TYUA 2W7ZA 1RU4A 2IQ7A 4OJPA 1PLUA 2J8IA 3DU1X 4OJLA 1K4ZA 4NK8A 1OOCA 2NSTA 2O17A 2PYGA 3SQVA 1KTWA 2QY1A 1PE9A 1QRCA 5AMVA 1KCDA 1WXRA 3EQNA 3GQAA 2NTBA 4XL9A 1QQ1A 1CZFA 2QXZA 2QX3A 4W8QA 2INVA 4XR6A 3VSTA 1JRGA 1BHEA 2VJJA 1O8FA 1DBOA 4OJ5A 3GQ7A 1DBGA 1KCCA 4XLAA 2UVFA 1BN8A 4XLFA 2V5IA 3UW0A 1L1IA 1OFEA 2VFPA 3GQ8A 3PSZA 1QA3A 1EA0A 2ODLA 1O8DA 1OGOX 1K8FA 1EE6A 4XM3A 1OFLA 1O8IA 1O8JA 3B90A 2XTYA 4YFOA 4Z03A 3ZPPA 2O0VA 2BSPA 1KQ5A 4YDTA 4W8TA 3SZEA 3ZSCA 4XORA 3VSUA 3FY3A 4AVZA 2XC1A 5C1EA 4XNFA 4OM9A 4YEJA 4YZ0A 1IDKA 4HWVA 2NTQA 2IOUG 2O6WA 3AK5A 3N90A 2X6YA 2O04A 4XMYA 1OGMX 3TH0A 4OZYA 2XT2A 4YCQA 1TYXA 1QJVA 1PXZA 2O1DA 1HF2A 4MXNA 4XLEA 1VBLA 2INUA 2G0YA 5JLVC 3NAWA 1TYWA 2X3HA 4YELA 4OJ6A 1LLZA 4OJOA 3VMVA 2EWEA 1CLWA 1IB4A 4OPWA 2F3LA 2XT4A 1H80A 4KH3A 2X6WA 1NHCA 2PECA 4Z05A 4XN0A 1TYVA 4XKWA 2QZAA 2UVEA 1O8EA 2YUHA 4W8SA 3WWGA 1QA2A 2BM5A 4XQFA 2J8KA 3EQOA 1AIRA 3P4GA 4URRA 3NB2A 1OFDA 1HG8A 1RWRA 2NT9A 2VFNA 3SYJA 4XONA 1JTAA 1O8LA 4XKVA 5C1CA 1GQ8A 4XN3A 3BH6B 4I84A 2O0WA 2BM7A 2Z8GA 1X0CA 1LM1A 2VBKA 4OZZA 4YZQA 3SUCA 3JX8A 4XOPA 2PYHA 3LYCA 5DNSA 2BM4A 3VMWA 1OFMA 2X6XA 2NTPA 2NT6A 3LMWA 4EW9A 1RMGA 3SY2A 4MR0A 1TSPA 2NZMA 2XTWA 3H09A 1O88A 2BM6A 1QA1A 4YEIA 3GQ9A 3T9GA 3GRHA 3PSSA 1QCXA 3JURA 1QRBA 3BH7B 4XLCA 2VBEA 2B0RA 2NSPA 2QYUA 2VFQA 1WMRA 1IA5A 4YZAA 1O8MA 1O8HA 2X85A 2VJIA 4XLHA 4C2LA 3VSVA 4V02C 3LJYA 1EZGA 4U49A 4PMHA 2BX6A 1K5CA 1LLWA 3KRGA 3B4NA 1O8GA 4NK6A 2VBMA 4U4BA 2VFOA 4W8RA 2XTXA 3PETA 4JRAC 1XG2A 3RIQA 3N6ZA 1O8KA 4Z06A 3ML3A 3B8YA 2VFMA 4YC5A 1DABA 1IDJA 4XOTA 5JMCB 4YZXA
chains in the Genus database with same CATH topology
1RU4A 2IQ7A 4OJPA 1PLUA 4OJLA 4NK8A 1OOCA 2NSTA 2O17A 2PYGA 1KTWA 2QY1A 1PE9A 5AMVA 1KCDA 3EQNA 3GQAA 2NTBA 4XL9A 2QXZA 1CZFA 2QX3A 4W8QA 2INVA 4XR6A 3VSTA 1JRGA 1BHEA 2VJJA 1O8FA 1DBOA 4OJ5A 3GQ7A 1DBGA 1KCCA 4XLAA 2UVFA 1BN8A 4XLFA 3UW0A 3GQ8A 2ODLA 1O8DA 1OGOX 4XM3A 1EE6A 3ZPPA 1OFLA 1O8IA 1O8JA 3B90A 4Z03A 2O0VA 2BSPA 4W8TA 3ZSCA 4XORA 3VSUA 3FY3A 4AVZA 5C1EA 4XNFA 4YEJA 4YZ0A 1IDKA 4HWVA 2NTQA 2X6YA 2O04A 4XMYA 1OGMX 4OZYA 1QJVA 1PXZA 2O1DA 4MXNA 4XLEA 1VBLA 2INUA 4YELA 2X3HA 4OJ6A 3VMVA 4OJOA 2EWEA 1IB4A 1H80A 2X6WA 1NHCA 2PECA 4Z05A 4XN0A 4XKWA 2UVEA 1O8EA 4W8SA 3WWGA 4XQFA 3EQOA 1AIRA 4URRA 1HG8A 1RWRA 2NT9A 4XONA 1JTAA 1O8LA 4XKVA 5C1CA 1GQ8A 4XN3A 4I84A 2O0WA 2Z8GA 4OZZA 1X0CA 3SUCA 2VBKA 4YZQA 4XOPA 2PYHA 3VMWA 1OFMA 2X6XA 2NTPA 2NT6A 3LMWA 4EW9A 1RMGA 4MR0A 2NZMA 1O88A 3GQ9A 3T9GA 3GRHA 1QCXA 3JURA 4XLCA 2VBEA 2NSPA 1IA5A 1WMRA 4YZAA 1O8MA 1O8HA 2X85A 2VJIA 4XLHA 4C2LA 3VSVA 4U49A 4PMHA 1K5CA 3KRGA 3B4NA 1O8GA 4NK6A 2VBMA 4U4BA 4W8RA 1XG2A 1O8KA 4Z06A 3B8YA 1IDJA 4XOTA 4YZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU4 A;  2IQ7 A;  4OJP A;  1PLU A;  4OJL A;  4NK8 A;  1OOC A;  2NST A;  2O17 A;  2PYG A;  1KTW A;  2QY1 A;  1PE9 A;  5AMV A;  1KCD A;  3EQN A;  3GQA A;  2NTB A;  4XL9 A;  2QXZ A;  1CZF A;  2QX3 A;  4W8Q A;  2INV A;  4XR6 A;  3VST A;  1JRG A;  1BHE A;  2VJJ A;  1O8F A;  1DBO A;  4OJ5 A;  3GQ7 A;  1DBG A;  1KCC A;  4XLA A;  2UVF A;  1BN8 A;  4XLF A;  3UW0 A;  3GQ8 A;  2ODL A;  1O8D A;  1OGO X;  4XM3 A;  1EE6 A;  3ZPP A;  1OFL A;  1O8I A;  1O8J A;  3B90 A;  4Z03 A;  2O0V A;  2BSP A;  4W8T A;  3ZSC A;  4XOR A;  3VSU A;  3FY3 A;  4AVZ A;  5C1E A;  4XNF A;  4YEJ A;  4YZ0 A;  1IDK A;  4HWV A;  2NTQ A;  2X6Y A;  2O04 A;  4XMY A;  1OGM X;  4OZY A;  1QJV A;  1PXZ A;  2O1D A;  4MXN A;  4XLE A;  1VBL A;  2INU A;  4YEL A;  2X3H A;  4OJ6 A;  3VMV A;  4OJO A;  2EWE A;  1IB4 A;  1H80 A;  2X6W A;  1NHC A;  2PEC A;  4Z05 A;  4XN0 A;  4XKW A;  2UVE A;  1O8E A;  4W8S A;  3WWG A;  4XQF A;  3EQO A;  1AIR A;  4URR A;  1HG8 A;  1RWR A;  2NT9 A;  4XON A;  1JTA A;  1O8L A;  4XKV A;  5C1C A;  1GQ8 A;  4XN3 A;  4I84 A;  2O0W A;  2Z8G A;  4OZZ A;  1X0C A;  3SUC A;  2VBK A;  4YZQ A;  4XOP A;  2PYH A;  3VMW A;  1OFM A;  2X6X A;  2NTP A;  2NT6 A;  3LMW A;  4EW9 A;  1RMG A;  4MR0 A;  2NZM A;  1O88 A;  3GQ9 A;  3T9G A;  3GRH A;  1QCX A;  3JUR A;  4XLC A;  2VBE A;  2NSP A;  1IA5 A;  1WMR A;  4YZA A;  1O8M A;  1O8H A;  2X85 A;  2VJI A;  4XLH A;  4C2L A;  3VSV A;  4U49 A;  4PMH A;  1K5C A;  3KRG A;  3B4N A;  1O8G A;  4NK6 A;  2VBM A;  4U4B A;  4W8R A;  1XG2 A;  1O8K A;  4Z06 A;  3B8Y A;  1IDJ A;  4XOT A;  4YZX A; 
#chains in the Genus database with same CATH topology
 1TYU A;  2W7Z A;  1RU4 A;  2IQ7 A;  4OJP A;  1PLU A;  2J8I A;  3DU1 X;  4OJL A;  1K4Z A;  4NK8 A;  1OOC A;  2NST A;  2O17 A;  2PYG A;  3SQV A;  1KTW A;  2QY1 A;  1PE9 A;  1QRC A;  5AMV A;  1KCD A;  1WXR A;  3EQN A;  3GQA A;  2NTB A;  4XL9 A;  1QQ1 A;  1CZF A;  2QXZ A;  2QX3 A;  4W8Q A;  2INV A;  4XR6 A;  3VST A;  1JRG A;  1BHE A;  2VJJ A;  1O8F A;  1DBO A;  4OJ5 A;  3GQ7 A;  1DBG A;  1KCC A;  4XLA A;  2UVF A;  1BN8 A;  4XLF A;  2V5I A;  3UW0 A;  1L1I A;  1OFE A;  2VFP A;  3GQ8 A;  3PSZ A;  1QA3 A;  1EA0 A;  2ODL A;  1O8D A;  1OGO X;  1K8F A;  1EE6 A;  4XM3 A;  1OFL A;  1O8I A;  1O8J A;  3B90 A;  2XTY A;  4YFO A;  4Z03 A;  3ZPP A;  2O0V A;  2BSP A;  1KQ5 A;  4YDT A;  4W8T A;  3SZE A;  3ZSC A;  4XOR A;  3VSU A;  3FY3 A;  4AVZ A;  2XC1 A;  5C1E A;  4XNF A;  4OM9 A;  4YEJ A;  4YZ0 A;  1IDK A;  4HWV A;  2NTQ A;  2IOU G;  2O6W A;  3AK5 A;  3N90 A;  2X6Y A;  2O04 A;  4XMY A;  1OGM X;  3TH0 A;  4OZY A;  2XT2 A;  4YCQ A;  1TYX A;  1QJV A;  1PXZ A;  2O1D A;  1HF2 A;  4MXN A;  4XLE A;  1VBL A;  2INU A;  2G0Y A;  5JLV C;  3NAW A;  1TYW A;  2X3H A;  4YEL A;  4OJ6 A;  1LLZ A;  4OJO A;  3VMV A;  2EWE A;  1CLW A;  1IB4 A;  4OPW A;  2F3L A;  2XT4 A;  1H80 A;  4KH3 A;  2X6W A;  1NHC A;  2PEC A;  4Z05 A;  4XN0 A;  1TYV A;  4XKW A;  2QZA A;  2UVE A;  1O8E A;  2YUH A;  4W8S A;  3WWG A;  1QA2 A;  2BM5 A;  4XQF A;  2J8K A;  3EQO A;  1AIR A;  3P4G A;  4URR A;  3NB2 A;  1OFD A;  1HG8 A;  1RWR A;  2NT9 A;  2VFN A;  3SYJ A;  4XON A;  1JTA A;  1O8L A;  4XKV A;  5C1C A;  1GQ8 A;  4XN3 A;  3BH6 B;  4I84 A;  2O0W A;  2BM7 A;  2Z8G A;  1X0C A;  1LM1 A;  2VBK A;  4OZZ A;  4YZQ A;  3SUC A;  3JX8 A;  4XOP A;  2PYH A;  3LYC A;  5DNS A;  2BM4 A;  3VMW A;  1OFM A;  2X6X A;  2NTP A;  2NT6 A;  3LMW A;  4EW9 A;  1RMG A;  3SY2 A;  4MR0 A;  1TSP A;  2NZM A;  2XTW A;  3H09 A;  1O88 A;  2BM6 A;  1QA1 A;  4YEI A;  3GQ9 A;  3T9G A;  3GRH A;  3PSS A;  1QCX A;  3JUR A;  1QRB A;  3BH7 B;  4XLC A;  2VBE A;  2B0R A;  2NSP A;  2QYU A;  2VFQ A;  1WMR A;  1IA5 A;  4YZA A;  1O8M A;  1O8H A;  2X85 A;  2VJI A;  4XLH A;  4C2L A;  3VSV A;  4V02 C;  3LJY A;  1EZG A;  4U49 A;  4PMH A;  2BX6 A;  1K5C A;  1LLW A;  3KRG A;  3B4N A;  1O8G A;  4NK6 A;  2VBM A;  4U4B A;  2VFO A;  4W8R A;  2XTX A;  3PET A;  4JRA C;  1XG2 A;  3RIQ A;  3N6Z A;  1O8K A;  4Z06 A;  3ML3 A;  3B8Y A;  2VFM A;  4YC5 A;  1DAB A;  1IDJ A;  4XOT A;  5JMC B;  4YZX A; 
#chains in the Genus database with same CATH homology
 1RU4 A;  2IQ7 A;  4OJP A;  1PLU A;  4OJL A;  4NK8 A;  1OOC A;  2NST A;  2O17 A;  2PYG A;  1KTW A;  2QY1 A;  1PE9 A;  5AMV A;  1KCD A;  3EQN A;  3GQA A;  2NTB A;  4XL9 A;  2QXZ A;  1CZF A;  2QX3 A;  4W8Q A;  2INV A;  4XR6 A;  3VST A;  1JRG A;  1BHE A;  2VJJ A;  1O8F A;  1DBO A;  4OJ5 A;  3GQ7 A;  1DBG A;  1KCC A;  4XLA A;  2UVF A;  1BN8 A;  4XLF A;  3UW0 A;  3GQ8 A;  2ODL A;  1O8D A;  1OGO X;  4XM3 A;  1EE6 A;  3ZPP A;  1OFL A;  1O8I A;  1O8J A;  3B90 A;  4Z03 A;  2O0V A;  2BSP A;  4W8T A;  3ZSC A;  4XOR A;  3VSU A;  3FY3 A;  4AVZ A;  5C1E A;  4XNF A;  4YEJ A;  4YZ0 A;  1IDK A;  4HWV A;  2NTQ A;  2X6Y A;  2O04 A;  4XMY A;  1OGM X;  4OZY A;  1QJV A;  1PXZ A;  2O1D A;  4MXN A;  4XLE A;  1VBL A;  2INU A;  4YEL A;  2X3H A;  4OJ6 A;  3VMV A;  4OJO A;  2EWE A;  1IB4 A;  1H80 A;  2X6W A;  1NHC A;  2PEC A;  4Z05 A;  4XN0 A;  4XKW A;  2UVE A;  1O8E A;  4W8S A;  3WWG A;  4XQF A;  3EQO A;  1AIR A;  4URR A;  1HG8 A;  1RWR A;  2NT9 A;  4XON A;  1JTA A;  1O8L A;  4XKV A;  5C1C A;  1GQ8 A;  4XN3 A;  4I84 A;  2O0W A;  2Z8G A;  4OZZ A;  1X0C A;  3SUC A;  2VBK A;  4YZQ A;  4XOP A;  2PYH A;  3VMW A;  1OFM A;  2X6X A;  2NTP A;  2NT6 A;  3LMW A;  4EW9 A;  1RMG A;  4MR0 A;  2NZM A;  1O88 A;  3GQ9 A;  3T9G A;  3GRH A;  1QCX A;  3JUR A;  4XLC A;  2VBE A;  2NSP A;  1IA5 A;  1WMR A;  4YZA A;  1O8M A;  1O8H A;  2X85 A;  2VJI A;  4XLH A;  4C2L A;  3VSV A;  4U49 A;  4PMH A;  1K5C A;  3KRG A;  3B4N A;  1O8G A;  4NK6 A;  2VBM A;  4U4B A;  4W8R A;  1XG2 A;  1O8K A;  4Z06 A;  3B8Y A;  1IDJ A;  4XOT A;  4YZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...