4YZXA

C. bescii family 3 pectate lyase double mutant k108a/d107n in complex with trigalacturonic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
198
structure length
198
Chain Sequence
HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAANAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
molecule keywords Pectate lyase
total genus 81
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzxA00
3EQNA 1RWRA 4XORA 3B4NA 1RMGA 1H80A 1EE6A 3ZSCA 4YZ0A 4PMHA 3SUCA 2NZMA 3FY3A 2EWEA 3GQ7A 2Z8GA 2O0VA 4U4BA 4XONA 1VBLA 1XG2A 4HWVA 3JURA 4W8SA 4XLAA 2O0WA 1OFMA 1CZFA 1DBGA 1BN8A 2NTBA 3B90A 1O8FA 2X6XA 3GRHA 3VMWA 2BSPA 2X85A 1O8DA 2X6YA 3KRGA 4OJ5A 1K5CA 1IDKA 1O8MA 5C1EA 2UVFA 2VBKA 4URRA 1OFLA 2NT9A 4NK8A 2INVA 3T9GA 2NTPA 4XN0A 2IQ7A 1IDJA 2X6WA 2NTQA 3VSTA 2INUA 2O1DA 2UVEA 4XKVA 4XLCA 2QY1A 4OZYA 4XLEA 2NSTA 4XLHA 4YZXA 4U49A 3UW0A 4XOPA 1IA5A 4Z05A 2VBEA 1QCXA 3VMVA 1OGMX 4C2LA 2NSPA 1NHCA 4W8RA 2VJJA 4XMYA 4EW9A 1O88A 4NK6A 1KCDA 1O8IA 2O17A 4YZQA 4XQFA 4XR6A 3ZPPA 2QXZA 4XKWA 1RU4A 1DBOA 2PECA 2PYGA 1HG8A 1O8KA 1O8HA 1IB4A 4Z03A 1O8GA 1O8JA 4OJ6A 3WWGA 3GQ9A 2PYHA 2ODLA 1PXZA 5AMVA 4AVZA 2VBMA 2O04A 4W8QA 4XL9A 1AIRA 1KCCA 4YELA 4MXNA 4OJOA 3GQAA 1X0CA 4Z06A 1KTWA 1QJVA 4OJPA 1GQ8A 1PE9A 1O8LA 2QX3A 3VSUA 1JRGA 3EQOA 4OJLA 2X3HA 4XNFA 1OGOX 4I84A 1BHEA 4XM3A 3GQ8A 4YEJA 5C1CA 4MR0A 2NT6A 4W8TA 3VSVA 1O8EA 4YZAA 3B8YA 1PLUA 2VJIA 4XOTA 3LMWA 4OZZA 4XLFA 1WMRA 1OOCA 4XN3A 1JTAA
chains in the Genus database with same CATH superfamily
1CLWA 3EQNA 1RWRA 2J8KA 5DNSA 4XORA 3B4NA 1QRCA 5JLVC 1RMGA 1H80A 1EE6A 3ZSCA 4YZ0A 3PSZA 4OPWA 4PMHA 3SUCA 1LLZA 3LYCA 2NZMA 3FY3A 1TYUA 4YFOA 2EWEA 2BM7A 3GQ7A 2J8IA 2Z8GA 2XC1A 2O0VA 4U4BA 4XONA 1VBLA 1XG2A 4HWVA 3JURA 4W8SA 4XLAA 2XT4A 3JX8A 2O0WA 5JMCB 1OFMA 1CZFA 1DBGA 1BN8A 1TYVA 2NTBA 3B90A 3PETA 1O8FA 3LJYA 1K4ZA 3N90A 2X6XA 1DABA 3GRHA 3VMWA 2B0RA 2BSPA 2X85A 1O8DA 1K8FA 3BH6B 2X6YA 3KRGA 4OJ5A 3SYJA 1K5CA 1IDKA 1O8MA 2F3LA 5C1EA 3DU1X 3NAWA 2QYUA 2UVFA 2G0YA 2VBKA 4V02C 4URRA 1OFLA 2NT9A 2BM6A 4NK8A 2VFNA 3RIQA 2INVA 3T9GA 2NTPA 2BM5A 4XN0A 2IQ7A 1IDJA 4YDTA 4YEIA 2X6WA 3AK5A 2NTQA 3VSTA 2INUA 2O1DA 2UVEA 4XKVA 2V5IA 4XLCA 2QY1A 4OZYA 4XLEA 2NSTA 4XLHA 1QA3A 2VFOA 3VSVA 4YZXA 4U49A 3UW0A 3H09A 3N6ZA 4XOPA 1IA5A 4Z05A 2VBEA 1L1IA 1QCXA 2O6WA 3VMVA 1OGMX 4C2LA 2NSPA 4YCQA 1NHCA 2XTYA 1OFEA 4W8RA 1QA2A 2VJJA 4XMYA 4EW9A 2VFMA 1O88A 1LM1A 4NK6A 1EA0A 1KCDA 1O8IA 2O17A 4YZQA 3SY2A 1EZGA 1TYXA 4XR6A 2W7ZA 3ZPPA 4XQFA 1HF2A 2QXZA 3NB2A 4XKWA 1RU4A 1DBOA 1TSPA 2BX6A 2PECA 2PYGA 1HG8A 1O8KA 1O8HA 1IB4A 2XT2A 2BM4A 4Z03A 1LLWA 4OM9A 4JRAC 1O8GA 1O8JA 4OJ6A 3WWGA 3P4GA 3GQ9A 1TYWA 2PYHA 2ODLA 1PXZA 5AMVA 1WXRA 4AVZA 2VBMA 2O04A 3SQVA 4YC5A 4W8QA 4XL9A 1AIRA 1KCCA 2VFQA 1QQ1A 4YELA 4MXNA 4OJOA 1OFDA 3GQAA 1X0CA 4Z06A 1KTWA 1QJVA 4OJPA 1QA1A 1GQ8A 1PE9A 2IOUG 2VFPA 3BH7B 1KQ5A 1O8LA 1QRBA 2QX3A 2YUHA 3VSUA 1JRGA 3EQOA 4OJLA 3TH0A 2X3HA 4XNFA 1OGOX 2XTXA 4I84A 1BHEA 4KH3A 4XM3A 3GQ8A 4YEJA 5C1CA 2XTWA 4MR0A 2NT6A 4W8TA 2QZAA 1O8EA 4YZAA 3B8YA 3SZEA 1PLUA 3ML3A 2VJIA 4XOTA 3LMWA 4OZZA 3PSSA 1WMRA 4XLFA 1OOCA 4XN3A 1JTAA
chains in the Genus database with same CATH topology
3EQNA 1RWRA 4XORA 3B4NA 1RMGA 1H80A 1EE6A 3ZSCA 4YZ0A 4PMHA 3SUCA 2NZMA 3FY3A 2EWEA 3GQ7A 2Z8GA 2O0VA 4U4BA 4XONA 1VBLA 1XG2A 4HWVA 3JURA 4W8SA 4XLAA 2O0WA 1OFMA 1CZFA 1DBGA 1BN8A 2NTBA 3B90A 1O8FA 2X6XA 3GRHA 3VMWA 2BSPA 2X85A 1O8DA 2X6YA 3KRGA 4OJ5A 1K5CA 1IDKA 1O8MA 5C1EA 2UVFA 2VBKA 4URRA 1OFLA 2NT9A 4NK8A 2INVA 3T9GA 2NTPA 4XN0A 2IQ7A 1IDJA 2X6WA 2NTQA 3VSTA 2INUA 2O1DA 2UVEA 4XKVA 4XLCA 2QY1A 4OZYA 4XLEA 2NSTA 4XLHA 4YZXA 4U49A 3UW0A 4XOPA 1IA5A 4Z05A 2VBEA 1QCXA 3VMVA 1OGMX 4C2LA 2NSPA 1NHCA 4W8RA 2VJJA 4XMYA 4EW9A 1O88A 4NK6A 1KCDA 1O8IA 2O17A 4YZQA 4XQFA 4XR6A 3ZPPA 2QXZA 4XKWA 1RU4A 1DBOA 2PECA 2PYGA 1HG8A 1O8KA 1O8HA 1IB4A 4Z03A 1O8GA 1O8JA 4OJ6A 3WWGA 3GQ9A 2PYHA 2ODLA 1PXZA 5AMVA 4AVZA 2VBMA 2O04A 4W8QA 4XL9A 1AIRA 1KCCA 4YELA 4MXNA 4OJOA 3GQAA 1X0CA 4Z06A 1KTWA 1QJVA 4OJPA 1GQ8A 1PE9A 1O8LA 2QX3A 3VSUA 1JRGA 3EQOA 4OJLA 2X3HA 4XNFA 1OGOX 4I84A 1BHEA 4XM3A 3GQ8A 4YEJA 5C1CA 4MR0A 2NT6A 4W8TA 3VSVA 1O8EA 4YZAA 3B8YA 1PLUA 2VJIA 4XOTA 3LMWA 4OZZA 4XLFA 1WMRA 1OOCA 4XN3A 1JTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQN A;  1RWR A;  4XOR A;  3B4N A;  1RMG A;  1H80 A;  1EE6 A;  3ZSC A;  4YZ0 A;  4PMH A;  3SUC A;  2NZM A;  3FY3 A;  2EWE A;  3GQ7 A;  2Z8G A;  2O0V A;  4U4B A;  4XON A;  1VBL A;  1XG2 A;  4HWV A;  3JUR A;  4W8S A;  4XLA A;  2O0W A;  1OFM A;  1CZF A;  1DBG A;  1BN8 A;  2NTB A;  3B90 A;  1O8F A;  2X6X A;  3GRH A;  3VMW A;  2BSP A;  2X85 A;  1O8D A;  2X6Y A;  3KRG A;  4OJ5 A;  1K5C A;  1IDK A;  1O8M A;  5C1E A;  2UVF A;  2VBK A;  4URR A;  1OFL A;  2NT9 A;  4NK8 A;  2INV A;  3T9G A;  2NTP A;  4XN0 A;  2IQ7 A;  1IDJ A;  2X6W A;  2NTQ A;  3VST A;  2INU A;  2O1D A;  2UVE A;  4XKV A;  4XLC A;  2QY1 A;  4OZY A;  4XLE A;  2NST A;  4XLH A;  4YZX A;  4U49 A;  3UW0 A;  4XOP A;  1IA5 A;  4Z05 A;  2VBE A;  1QCX A;  3VMV A;  1OGM X;  4C2L A;  2NSP A;  1NHC A;  4W8R A;  2VJJ A;  4XMY A;  4EW9 A;  1O88 A;  4NK6 A;  1KCD A;  1O8I A;  2O17 A;  4YZQ A;  4XQF A;  4XR6 A;  3ZPP A;  2QXZ A;  4XKW A;  1RU4 A;  1DBO A;  2PEC A;  2PYG A;  1HG8 A;  1O8K A;  1O8H A;  1IB4 A;  4Z03 A;  1O8G A;  1O8J A;  4OJ6 A;  3WWG A;  3GQ9 A;  2PYH A;  2ODL A;  1PXZ A;  5AMV A;  4AVZ A;  2VBM A;  2O04 A;  4W8Q A;  4XL9 A;  1AIR A;  1KCC A;  4YEL A;  4MXN A;  4OJO A;  3GQA A;  1X0C A;  4Z06 A;  1KTW A;  1QJV A;  4OJP A;  1GQ8 A;  1PE9 A;  1O8L A;  2QX3 A;  3VSU A;  1JRG A;  3EQO A;  4OJL A;  2X3H A;  4XNF A;  1OGO X;  4I84 A;  1BHE A;  4XM3 A;  3GQ8 A;  4YEJ A;  5C1C A;  4MR0 A;  2NT6 A;  4W8T A;  3VSV A;  1O8E A;  4YZA A;  3B8Y A;  1PLU A;  2VJI A;  4XOT A;  3LMW A;  4OZZ A;  4XLF A;  1WMR A;  1OOC A;  4XN3 A;  1JTA A; 
#chains in the Genus database with same CATH topology
 1CLW A;  3EQN A;  1RWR A;  2J8K A;  5DNS A;  4XOR A;  3B4N A;  1QRC A;  5JLV C;  1RMG A;  1H80 A;  1EE6 A;  3ZSC A;  4YZ0 A;  3PSZ A;  4OPW A;  4PMH A;  3SUC A;  1LLZ A;  3LYC A;  2NZM A;  3FY3 A;  1TYU A;  4YFO A;  2EWE A;  2BM7 A;  3GQ7 A;  2J8I A;  2Z8G A;  2XC1 A;  2O0V A;  4U4B A;  4XON A;  1VBL A;  1XG2 A;  4HWV A;  3JUR A;  4W8S A;  4XLA A;  2XT4 A;  3JX8 A;  2O0W A;  5JMC B;  1OFM A;  1CZF A;  1DBG A;  1BN8 A;  1TYV A;  2NTB A;  3B90 A;  3PET A;  1O8F A;  3LJY A;  1K4Z A;  3N90 A;  2X6X A;  1DAB A;  3GRH A;  3VMW A;  2B0R A;  2BSP A;  2X85 A;  1O8D A;  1K8F A;  3BH6 B;  2X6Y A;  3KRG A;  4OJ5 A;  3SYJ A;  1K5C A;  1IDK A;  1O8M A;  2F3L A;  5C1E A;  3DU1 X;  3NAW A;  2QYU A;  2UVF A;  2G0Y A;  2VBK A;  4V02 C;  4URR A;  1OFL A;  2NT9 A;  2BM6 A;  4NK8 A;  2VFN A;  3RIQ A;  2INV A;  3T9G A;  2NTP A;  2BM5 A;  4XN0 A;  2IQ7 A;  1IDJ A;  4YDT A;  4YEI A;  2X6W A;  3AK5 A;  2NTQ A;  3VST A;  2INU A;  2O1D A;  2UVE A;  4XKV A;  2V5I A;  4XLC A;  2QY1 A;  4OZY A;  4XLE A;  2NST A;  4XLH A;  1QA3 A;  2VFO A;  3VSV A;  4YZX A;  4U49 A;  3UW0 A;  3H09 A;  3N6Z A;  4XOP A;  1IA5 A;  4Z05 A;  2VBE A;  1L1I A;  1QCX A;  2O6W A;  3VMV A;  1OGM X;  4C2L A;  2NSP A;  4YCQ A;  1NHC A;  2XTY A;  1OFE A;  4W8R A;  1QA2 A;  2VJJ A;  4XMY A;  4EW9 A;  2VFM A;  1O88 A;  1LM1 A;  4NK6 A;  1EA0 A;  1KCD A;  1O8I A;  2O17 A;  4YZQ A;  3SY2 A;  1EZG A;  1TYX A;  4XR6 A;  2W7Z A;  3ZPP A;  4XQF A;  1HF2 A;  2QXZ A;  3NB2 A;  4XKW A;  1RU4 A;  1DBO A;  1TSP A;  2BX6 A;  2PEC A;  2PYG A;  1HG8 A;  1O8K A;  1O8H A;  1IB4 A;  2XT2 A;  2BM4 A;  4Z03 A;  1LLW A;  4OM9 A;  4JRA C;  1O8G A;  1O8J A;  4OJ6 A;  3WWG A;  3P4G A;  3GQ9 A;  1TYW A;  2PYH A;  2ODL A;  1PXZ A;  5AMV A;  1WXR A;  4AVZ A;  2VBM A;  2O04 A;  3SQV A;  4YC5 A;  4W8Q A;  4XL9 A;  1AIR A;  1KCC A;  2VFQ A;  1QQ1 A;  4YEL A;  4MXN A;  4OJO A;  1OFD A;  3GQA A;  1X0C A;  4Z06 A;  1KTW A;  1QJV A;  4OJP A;  1QA1 A;  1GQ8 A;  1PE9 A;  2IOU G;  2VFP A;  3BH7 B;  1KQ5 A;  1O8L A;  1QRB A;  2QX3 A;  2YUH A;  3VSU A;  1JRG A;  3EQO A;  4OJL A;  3TH0 A;  2X3H A;  4XNF A;  1OGO X;  2XTX A;  4I84 A;  1BHE A;  4KH3 A;  4XM3 A;  3GQ8 A;  4YEJ A;  5C1C A;  2XTW A;  4MR0 A;  2NT6 A;  4W8T A;  2QZA A;  1O8E A;  4YZA A;  3B8Y A;  3SZE A;  1PLU A;  3ML3 A;  2VJI A;  4XOT A;  3LMW A;  4OZZ A;  3PSS A;  1WMR A;  4XLF A;  1OOC A;  4XN3 A;  1JTA A; 
#chains in the Genus database with same CATH homology
 3EQN A;  1RWR A;  4XOR A;  3B4N A;  1RMG A;  1H80 A;  1EE6 A;  3ZSC A;  4YZ0 A;  4PMH A;  3SUC A;  2NZM A;  3FY3 A;  2EWE A;  3GQ7 A;  2Z8G A;  2O0V A;  4U4B A;  4XON A;  1VBL A;  1XG2 A;  4HWV A;  3JUR A;  4W8S A;  4XLA A;  2O0W A;  1OFM A;  1CZF A;  1DBG A;  1BN8 A;  2NTB A;  3B90 A;  1O8F A;  2X6X A;  3GRH A;  3VMW A;  2BSP A;  2X85 A;  1O8D A;  2X6Y A;  3KRG A;  4OJ5 A;  1K5C A;  1IDK A;  1O8M A;  5C1E A;  2UVF A;  2VBK A;  4URR A;  1OFL A;  2NT9 A;  4NK8 A;  2INV A;  3T9G A;  2NTP A;  4XN0 A;  2IQ7 A;  1IDJ A;  2X6W A;  2NTQ A;  3VST A;  2INU A;  2O1D A;  2UVE A;  4XKV A;  4XLC A;  2QY1 A;  4OZY A;  4XLE A;  2NST A;  4XLH A;  4YZX A;  4U49 A;  3UW0 A;  4XOP A;  1IA5 A;  4Z05 A;  2VBE A;  1QCX A;  3VMV A;  1OGM X;  4C2L A;  2NSP A;  1NHC A;  4W8R A;  2VJJ A;  4XMY A;  4EW9 A;  1O88 A;  4NK6 A;  1KCD A;  1O8I A;  2O17 A;  4YZQ A;  4XQF A;  4XR6 A;  3ZPP A;  2QXZ A;  4XKW A;  1RU4 A;  1DBO A;  2PEC A;  2PYG A;  1HG8 A;  1O8K A;  1O8H A;  1IB4 A;  4Z03 A;  1O8G A;  1O8J A;  4OJ6 A;  3WWG A;  3GQ9 A;  2PYH A;  2ODL A;  1PXZ A;  5AMV A;  4AVZ A;  2VBM A;  2O04 A;  4W8Q A;  4XL9 A;  1AIR A;  1KCC A;  4YEL A;  4MXN A;  4OJO A;  3GQA A;  1X0C A;  4Z06 A;  1KTW A;  1QJV A;  4OJP A;  1GQ8 A;  1PE9 A;  1O8L A;  2QX3 A;  3VSU A;  1JRG A;  3EQO A;  4OJL A;  2X3H A;  4XNF A;  1OGO X;  4I84 A;  1BHE A;  4XM3 A;  3GQ8 A;  4YEJ A;  5C1C A;  4MR0 A;  2NT6 A;  4W8T A;  3VSV A;  1O8E A;  4YZA A;  3B8Y A;  1PLU A;  2VJI A;  4XOT A;  3LMW A;  4OZZ A;  4XLF A;  1WMR A;  1OOC A;  4XN3 A;  1JTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...