4YZXA

C. bescii family 3 pectate lyase double mutant k108a/d107n in complex with trigalacturonic acid
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
198
structure length
198
Chain Sequence
b'HHVGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAANAVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 81
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yzxA00
4XQFA 4MXNA 2VBEA 1XG2A 2PYHA 4XN3A 1OOCA 1O88A 1PXZA 1O8LA 2X6YA 2O04A 2VJJA 3VSTA 1AIRA 4YEJA 4W8QA 1PE9A 2IQ7A 1RWRA 1RMGA 1JRGA 2X3HA 4XL9A 3ZPPA 1OFLA 2VJIA 4W8SA 4EW9A 1O8IA 4OJPA 4URRA 2PYGA 3B4NA 3ZSCA 3JURA 3GQ7A 2INUA 4C2LA 3VMVA 3EQOA 4OJ6A 4XOTA 4XLAA 4Z05A 1O8KA 1O8HA 4Z03A 4YZQA 4XLFA 5C1CA 4YZAA 2VBKA 2NZMA 2X6XA 1K5CA 2INVA 4XONA 4XKWA 1X0CA 2UVEA 3GQAA 4OJOA 1KCDA 1O8JA 3GRHA 3SUCA 5AMVA 2QY1A 4XNFA 3EQNA 1OGOX 4YELA 1RU4A 4Z06A 4W8TA 2EWEA 1O8FA 2O0WA 2O0VA 3GQ9A 1IDJA 2O17A 1HG8A 1KTWA 2NTQA 4XM3A 5C1EA 4U4BA 4XORA 4PMHA 4U49A 4W8RA 4NK8A 4XN0A 4HWVA 2NTPA 2NTBA 1IDKA 1IB4A 3VMWA 3KRGA 1QCXA 2VBMA 1CZFA 4OJLA 2X6WA 3LMWA 4AVZA 2NT6A 4OZZA 2PECA 1H80A 3B8YA 2X85A 4XLCA 4MR0A 3UW0A 1JTAA 1PLUA 4XLHA 4I84A 2QXZA 2Z8GA 3WWGA 2NT9A 4OJ5A 4XKVA 1WMRA 2BSPA 1O8MA 3FY3A 3B90A 1BHEA 1NHCA 1IA5A 1KCCA 3VSVA 2QX3A 4XMYA 2ODLA 1O8GA 1OGMX 1OFMA 1O8DA 4XR6A 3VSUA 3GQ8A 1EE6A 4YZ0A 1O8EA 1VBLA 4OZYA 2UVFA 4XOPA 2NSPA 2O1DA 4YZXA 1GQ8A 1QJVA 1BN8A 4XLEA 4NK6A 3T9GA 1DBOA 2NSTA 1DBGA
chains in the Genus database with same CATH superfamily
1QRBA 4XQFA 4MXNA 2VBEA 1XG2A 2PYHA 4XN3A 1OOCA 1O88A 1PXZA 1O8LA 1TYVA 2X6YA 3ML3A 2O04A 2VFOA 2J8KA 3LYCA 2VJJA 3VSTA 3PSZA 1AIRA 4YEJA 4W8QA 3SZEA 1PE9A 2IQ7A 3JX8A 1RWRA 3PETA 1K4ZA 1RMGA 1JRGA 2X3HA 4XL9A 3ZPPA 1OFLA 1EA0A 2XT4A 1K8FA 2VJIA 1OFDA 4W8SA 4EW9A 1O8IA 4OJPA 4OM9A 1OFEA 4URRA 2PYGA 2G0YA 2XTYA 3B4NA 3JURA 3ZSCA 1TYUA 3GQ7A 1LLWA 1QA1A 2VFNA 2YUHA 2INUA 4C2LA 1QA2A 3VMVA 3EQOA 4OJ6A 4XOTA 4XLAA 3BH7B 4Z05A 1O8KA 3AK5A 1O8HA 4Z03A 4YZQA 3RIQA 4XLFA 5C1CA 4YZAA 2VBKA 3PSSA 2QZAA 2NZMA 2B0RA 2X6XA 3P4GA 4YFOA 1K5CA 2BM4A 2INVA 4XONA 4XKWA 1X0CA 2UVEA 2BX6A 3GQAA 3LJYA 4OJOA 1DABA 3N6ZA 1O8JA 1KCDA 3GRHA 3N90A 4YDTA 3SUCA 5JLVC 5AMVA 2QY1A 1LLZA 4XNFA 3EQNA 1OGOX 4YELA 1RU4A 4YC5A 4KH3A 4Z06A 4W8TA 4JRAC 2VFMA 3BH6B 2EWEA 1O8FA 3NAWA 1HF2A 2O0WA 2O0VA 2XTWA 3GQ9A 3SYJA 1IDJA 2O17A 1HG8A 3SY2A 1KTWA 2NTQA 4XM3A 5C1EA 4U4BA 4XORA 1TSPA 2VFQA 2VFPA 2IOUG 4PMHA 2BM5A 1EZGA 1TYXA 4U49A 4W8RA 4NK8A 4XN0A 1QRCA 4HWVA 2NTPA 4YCQA 1KQ5A 2NTBA 2XT2A 1IDKA 4OPWA 1IB4A 3VMWA 3KRGA 3SQVA 1QCXA 2VBMA 1CZFA 1LM1A 4OJLA 2X6WA 3LMWA 4AVZA 4YEIA 2NT6A 2W7ZA 4OZZA 5JMCB 2PECA 1H80A 3B8YA 2X85A 4XLCA 4MR0A 3UW0A 1JTAA 1PLUA 4XLHA 1QA3A 5DNSA 2J8IA 4I84A 2QXZA 2QYUA 2Z8GA 2NT9A 4V02C 3WWGA 4OJ5A 4XKVA 1WMRA 2BSPA 1O8MA 3FY3A 3B90A 1BHEA 1NHCA 1IA5A 1KCCA 1L1IA 2XTXA 1DBGA 2O6WA 3VSVA 3DU1X 2QX3A 1QQ1A 3H09A 4XMYA 2ODLA 1O8GA 1OGMX 1OFMA 1O8DA 2BM6A 2V5IA 4XR6A 3VSUA 3GQ8A 1EE6A 4YZ0A 1O8EA 1VBLA 1TYWA 2XC1A 4OZYA 2UVFA 3TH0A 4XOPA 2NSPA 2O1DA 1WXRA 4YZXA 1GQ8A 1QJVA 1BN8A 1CLWA 4XLEA 4NK6A 3T9GA 1DBOA 3NB2A 2BM7A 2NSTA 2F3LA
chains in the Genus database with same CATH topology
4XQFA 4MXNA 2VBEA 1XG2A 2PYHA 4XN3A 1OOCA 1O88A 1PXZA 1O8LA 2X6YA 2O04A 2VJJA 3VSTA 1AIRA 4YEJA 4W8QA 1PE9A 2IQ7A 1RWRA 1RMGA 1JRGA 2X3HA 4XL9A 3ZPPA 1OFLA 2VJIA 4W8SA 4EW9A 1O8IA 4OJPA 4URRA 2PYGA 3B4NA 3ZSCA 3JURA 3GQ7A 2INUA 4C2LA 3VMVA 3EQOA 4OJ6A 4XOTA 4XLAA 4Z05A 1O8KA 1O8HA 4Z03A 4YZQA 4XLFA 5C1CA 4YZAA 2VBKA 2NZMA 2X6XA 1K5CA 2INVA 4XONA 4XKWA 1X0CA 2UVEA 3GQAA 4OJOA 1KCDA 1O8JA 3GRHA 3SUCA 5AMVA 2QY1A 4XNFA 3EQNA 1OGOX 4YELA 1RU4A 4Z06A 4W8TA 2EWEA 1O8FA 2O0WA 2O0VA 3GQ9A 1IDJA 2O17A 1HG8A 1KTWA 2NTQA 4XM3A 5C1EA 4U4BA 4XORA 4PMHA 4U49A 4W8RA 4NK8A 4XN0A 4HWVA 2NTPA 2NTBA 1IDKA 1IB4A 3VMWA 3KRGA 1QCXA 2VBMA 1CZFA 4OJLA 2X6WA 3LMWA 4AVZA 2NT6A 4OZZA 2PECA 1H80A 3B8YA 2X85A 4XLCA 4MR0A 3UW0A 1JTAA 1PLUA 4XLHA 4I84A 2QXZA 2Z8GA 3WWGA 2NT9A 4OJ5A 4XKVA 1WMRA 2BSPA 1O8MA 3FY3A 3B90A 1BHEA 1NHCA 1IA5A 1KCCA 3VSVA 2QX3A 4XMYA 2ODLA 1O8GA 1OGMX 1OFMA 1O8DA 4XR6A 3VSUA 3GQ8A 1EE6A 4YZ0A 1O8EA 1VBLA 4OZYA 2UVFA 4XOPA 2NSPA 2O1DA 4YZXA 1GQ8A 1QJVA 1BN8A 4XLEA 4NK6A 3T9GA 1DBOA 2NSTA 1DBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQF A;  4MXN A;  2VBE A;  1XG2 A;  2PYH A;  4XN3 A;  1OOC A;  1O88 A;  1PXZ A;  1O8L A;  2X6Y A;  2O04 A;  2VJJ A;  3VST A;  1AIR A;  4YEJ A;  4W8Q A;  1PE9 A;  2IQ7 A;  1RWR A;  1RMG A;  1JRG A;  2X3H A;  4XL9 A;  3ZPP A;  1OFL A;  2VJI A;  4W8S A;  4EW9 A;  1O8I A;  4OJP A;  4URR A;  2PYG A;  3B4N A;  3ZSC A;  3JUR A;  3GQ7 A;  2INU A;  4C2L A;  3VMV A;  3EQO A;  4OJ6 A;  4XOT A;  4XLA A;  4Z05 A;  1O8K A;  1O8H A;  4Z03 A;  4YZQ A;  4XLF A;  5C1C A;  4YZA A;  2VBK A;  2NZM A;  2X6X A;  1K5C A;  2INV A;  4XON A;  4XKW A;  1X0C A;  2UVE A;  3GQA A;  4OJO A;  1KCD A;  1O8J A;  3GRH A;  3SUC A;  5AMV A;  2QY1 A;  4XNF A;  3EQN A;  1OGO X;  4YEL A;  1RU4 A;  4Z06 A;  4W8T A;  2EWE A;  1O8F A;  2O0W A;  2O0V A;  3GQ9 A;  1IDJ A;  2O17 A;  1HG8 A;  1KTW A;  2NTQ A;  4XM3 A;  5C1E A;  4U4B A;  4XOR A;  4PMH A;  4U49 A;  4W8R A;  4NK8 A;  4XN0 A;  4HWV A;  2NTP A;  2NTB A;  1IDK A;  1IB4 A;  3VMW A;  3KRG A;  1QCX A;  2VBM A;  1CZF A;  4OJL A;  2X6W A;  3LMW A;  4AVZ A;  2NT6 A;  4OZZ A;  2PEC A;  1H80 A;  3B8Y A;  2X85 A;  4XLC A;  4MR0 A;  3UW0 A;  1JTA A;  1PLU A;  4XLH A;  4I84 A;  2QXZ A;  2Z8G A;  3WWG A;  2NT9 A;  4OJ5 A;  4XKV A;  1WMR A;  2BSP A;  1O8M A;  3FY3 A;  3B90 A;  1BHE A;  1NHC A;  1IA5 A;  1KCC A;  3VSV A;  2QX3 A;  4XMY A;  2ODL A;  1O8G A;  1OGM X;  1OFM A;  1O8D A;  4XR6 A;  3VSU A;  3GQ8 A;  1EE6 A;  4YZ0 A;  1O8E A;  1VBL A;  4OZY A;  2UVF A;  4XOP A;  2NSP A;  2O1D A;  4YZX A;  1GQ8 A;  1QJV A;  1BN8 A;  4XLE A;  4NK6 A;  3T9G A;  1DBO A;  2NST A;  1DBG A; 
#chains in the Genus database with same CATH topology
 1QRB A;  4XQF A;  4MXN A;  2VBE A;  1XG2 A;  2PYH A;  4XN3 A;  1OOC A;  1O88 A;  1PXZ A;  1O8L A;  1TYV A;  2X6Y A;  3ML3 A;  2O04 A;  2VFO A;  2J8K A;  3LYC A;  2VJJ A;  3VST A;  3PSZ A;  1AIR A;  4YEJ A;  4W8Q A;  3SZE A;  1PE9 A;  2IQ7 A;  3JX8 A;  1RWR A;  3PET A;  1K4Z A;  1RMG A;  1JRG A;  2X3H A;  4XL9 A;  3ZPP A;  1OFL A;  1EA0 A;  2XT4 A;  1K8F A;  2VJI A;  1OFD A;  4W8S A;  4EW9 A;  1O8I A;  4OJP A;  4OM9 A;  1OFE A;  4URR A;  2PYG A;  2G0Y A;  2XTY A;  3B4N A;  3JUR A;  3ZSC A;  1TYU A;  3GQ7 A;  1LLW A;  1QA1 A;  2VFN A;  2YUH A;  2INU A;  4C2L A;  1QA2 A;  3VMV A;  3EQO A;  4OJ6 A;  4XOT A;  4XLA A;  3BH7 B;  4Z05 A;  1O8K A;  3AK5 A;  1O8H A;  4Z03 A;  4YZQ A;  3RIQ A;  4XLF A;  5C1C A;  4YZA A;  2VBK A;  3PSS A;  2QZA A;  2NZM A;  2B0R A;  2X6X A;  3P4G A;  4YFO A;  1K5C A;  2BM4 A;  2INV A;  4XON A;  4XKW A;  1X0C A;  2UVE A;  2BX6 A;  3GQA A;  3LJY A;  4OJO A;  1DAB A;  3N6Z A;  1O8J A;  1KCD A;  3GRH A;  3N90 A;  4YDT A;  3SUC A;  5JLV C;  5AMV A;  2QY1 A;  1LLZ A;  4XNF A;  3EQN A;  1OGO X;  4YEL A;  1RU4 A;  4YC5 A;  4KH3 A;  4Z06 A;  4W8T A;  4JRA C;  2VFM A;  3BH6 B;  2EWE A;  1O8F A;  3NAW A;  1HF2 A;  2O0W A;  2O0V A;  2XTW A;  3GQ9 A;  3SYJ A;  1IDJ A;  2O17 A;  1HG8 A;  3SY2 A;  1KTW A;  2NTQ A;  4XM3 A;  5C1E A;  4U4B A;  4XOR A;  1TSP A;  2VFQ A;  2VFP A;  2IOU G;  4PMH A;  2BM5 A;  1EZG A;  1TYX A;  4U49 A;  4W8R A;  4NK8 A;  4XN0 A;  1QRC A;  4HWV A;  2NTP A;  4YCQ A;  1KQ5 A;  2NTB A;  2XT2 A;  1IDK A;  4OPW A;  1IB4 A;  3VMW A;  3KRG A;  3SQV A;  1QCX A;  2VBM A;  1CZF A;  1LM1 A;  4OJL A;  2X6W A;  3LMW A;  4AVZ A;  4YEI A;  2NT6 A;  2W7Z A;  4OZZ A;  5JMC B;  2PEC A;  1H80 A;  3B8Y A;  2X85 A;  4XLC A;  4MR0 A;  3UW0 A;  1JTA A;  1PLU A;  4XLH A;  1QA3 A;  5DNS A;  2J8I A;  4I84 A;  2QXZ A;  2QYU A;  2Z8G A;  2NT9 A;  4V02 C;  3WWG A;  4OJ5 A;  4XKV A;  1WMR A;  2BSP A;  1O8M A;  3FY3 A;  3B90 A;  1BHE A;  1NHC A;  1IA5 A;  1KCC A;  1L1I A;  2XTX A;  1DBG A;  2O6W A;  3VSV A;  3DU1 X;  2QX3 A;  1QQ1 A;  3H09 A;  4XMY A;  2ODL A;  1O8G A;  1OGM X;  1OFM A;  1O8D A;  2BM6 A;  2V5I A;  4XR6 A;  3VSU A;  3GQ8 A;  1EE6 A;  4YZ0 A;  1O8E A;  1VBL A;  1TYW A;  2XC1 A;  4OZY A;  2UVF A;  3TH0 A;  4XOP A;  2NSP A;  2O1D A;  1WXR A;  4YZX A;  1GQ8 A;  1QJV A;  1BN8 A;  1CLW A;  4XLE A;  4NK6 A;  3T9G A;  1DBO A;  3NB2 A;  2BM7 A;  2NST A;  2F3L A; 
#chains in the Genus database with same CATH homology
 4XQF A;  4MXN A;  2VBE A;  1XG2 A;  2PYH A;  4XN3 A;  1OOC A;  1O88 A;  1PXZ A;  1O8L A;  2X6Y A;  2O04 A;  2VJJ A;  3VST A;  1AIR A;  4YEJ A;  4W8Q A;  1PE9 A;  2IQ7 A;  1RWR A;  1RMG A;  1JRG A;  2X3H A;  4XL9 A;  3ZPP A;  1OFL A;  2VJI A;  4W8S A;  4EW9 A;  1O8I A;  4OJP A;  4URR A;  2PYG A;  3B4N A;  3ZSC A;  3JUR A;  3GQ7 A;  2INU A;  4C2L A;  3VMV A;  3EQO A;  4OJ6 A;  4XOT A;  4XLA A;  4Z05 A;  1O8K A;  1O8H A;  4Z03 A;  4YZQ A;  4XLF A;  5C1C A;  4YZA A;  2VBK A;  2NZM A;  2X6X A;  1K5C A;  2INV A;  4XON A;  4XKW A;  1X0C A;  2UVE A;  3GQA A;  4OJO A;  1KCD A;  1O8J A;  3GRH A;  3SUC A;  5AMV A;  2QY1 A;  4XNF A;  3EQN A;  1OGO X;  4YEL A;  1RU4 A;  4Z06 A;  4W8T A;  2EWE A;  1O8F A;  2O0W A;  2O0V A;  3GQ9 A;  1IDJ A;  2O17 A;  1HG8 A;  1KTW A;  2NTQ A;  4XM3 A;  5C1E A;  4U4B A;  4XOR A;  4PMH A;  4U49 A;  4W8R A;  4NK8 A;  4XN0 A;  4HWV A;  2NTP A;  2NTB A;  1IDK A;  1IB4 A;  3VMW A;  3KRG A;  1QCX A;  2VBM A;  1CZF A;  4OJL A;  2X6W A;  3LMW A;  4AVZ A;  2NT6 A;  4OZZ A;  2PEC A;  1H80 A;  3B8Y A;  2X85 A;  4XLC A;  4MR0 A;  3UW0 A;  1JTA A;  1PLU A;  4XLH A;  4I84 A;  2QXZ A;  2Z8G A;  3WWG A;  2NT9 A;  4OJ5 A;  4XKV A;  1WMR A;  2BSP A;  1O8M A;  3FY3 A;  3B90 A;  1BHE A;  1NHC A;  1IA5 A;  1KCC A;  3VSV A;  2QX3 A;  4XMY A;  2ODL A;  1O8G A;  1OGM X;  1OFM A;  1O8D A;  4XR6 A;  3VSU A;  3GQ8 A;  1EE6 A;  4YZ0 A;  1O8E A;  1VBL A;  4OZY A;  2UVF A;  4XOP A;  2NSP A;  2O1D A;  4YZX A;  1GQ8 A;  1QJV A;  1BN8 A;  4XLE A;  4NK6 A;  3T9G A;  1DBO A;  2NST A;  1DBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...