4Z02A

Crystal structure of brd1 in complex with isoquinoline-3-carboxylic acid
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'PLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 1
publication title Crystal structure of BRD1 incomplex with Isoquinoline-3-carboxylic acid
rcsb
source organism Homo sapiens
molecule tags Histone-binding protein
total genus 28
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4z02A01
4OVAA 4FU6A 4CRIA 3OYFA 1OZ3A 2QQRA 3OS1A 1G5VA 4BE1A 3MP8A 2R58A 2RHIA 2K3YA 4NS5A 4E7LA 2GFAA 3MEAA 5IAYA 4C5IA 3META 3CEYA 2GFUA 4LD6A 3GOXA 1WJSA 2XK0A 2GF7A 4BD3A 5KH6A 3QIIA 3QKJA 3F70A 2JTFA 3MEVA 4A4FA 2B8AA 3OQ5A 1XNIA 2RI2A 4C5HA 2E6NA 3SD4A 3UT1A 3UWNA 3ASKA 3H6ZA 2RI3A 3DB3A 3DB4A 3OYHA 4BACA 3ME9A 2XDPA 3C4SA 3LX7A 2K3XA 2MWPA 2CKKA 2EFIA 2O4XB 2RJDA 3OYMA 3PFSA 1N27A 3Q1JA 4B9XA 2LTOA 3LLRA 3LH0A 2PQWA 3FLGA 2EKOA 5D6YA 2HQXA 3L2WA 4N4GA 2X4WA 3KUFA 2MWOA 3PMIA 5KE3A 2LDMA 4ZTJA 5CIUA 3L2QA 4PLLA 2L3RA 2NLUA 5C6SA 3NTKA 3QBYA 3P8HA 4N4HA 1OI1A 5J26A 3OYDA 3L2UA 3L2RA 2HQEA 1SSFA 2BUDA 4II1A 3E9FA 1WJQA 5IN1A 3OYJA 4QVZA 3E9GA 2RHUA 3S3MA 1KHCA 2L8DA 3LYIA 4E7HA 2R57A 4Z02A 4E7IA 3BDLA 3NTIA 4IUTA 2E5QA 3M9QA 3OYCA 2P0KA 4PL6A 3MEWA 3OB9A 4C5GA 4A4GA 4ZTFA 4E7KA 2M0OA 5FROA 2BIVA 4IUUA 2RHXA 1RI0A 3MP1A 4IUPA 2RHYA 3PNWC 3FDRA 3OYLA 1OYXA 3MEUA 3OYEA 1H3ZA 4QW2A 3MP6A 2RJCA 4QQ6A 4N4IA 2RI5A 4UC4A 4IUVA 3FC3A 4GY5A 2FHDA 2M16A 2X35A 3S3OA 5FRMA 4QQGA 3DLMA 2R5AA 2D9TA 3P8DA 5M9OA 3OYBA 3O8VA 3OYKA 2RJFA 2X4YA 3L2VA 2BKDN 2DIGA 3QJ6A 4X34A 3OS0A 5FRNA 4BE0A 3EAEA 2LVMA 5KCOA 3OYNA 2EQJA 3OA6A 3H8ZA 3NTHA 4L59A 2QQSA 1MHNA 3PMTA 5C0MA 3LGLA 3MO8A 3OY9A 3LGFA 1WGSA 2RJEA 4IURA 3S6WA 4EDUA 4IKFA 3OYIA 4FL6A 4IUQA 1WJRA 2LRQA 2LCCA 2DAQA 2EQKA 2F5KA 2JZ2A 2IG0A 3OMCA 2EQUA 2RHZA 2WACA 1OZ2A 4A4HA 5D6WA 2L89A 4Q5WA 4HCZA 4RG2A 2DIQA 4E7JA 4QQDA 4BDYA 3L42A 4BE2A 4A4EA 3OYAA 2YRVA 2R5MA 2VYTA 2M1HA 2X4XA 2O4XA 5J39A 3S3NA 3ZEHA 2RO0A 3OS2A 4PLIA 5D6XA 4BDZA 4C5EA 3FEOA 3OMGA 2EQMA 5KCHA 3OYGA 4B9WA 2G3RA 5KE2A
chains in the Genus database with same CATH superfamily
2CDTA 1QQJA 4KGXB 3EGDB 1YWOA 3VS4A 4ZGEB 2CP5A 3G1JA 4BD3A 3F70A 4PJNA 3I56Q 4JZ4A 4KBMB 4O6JA 2CS7A 3JCMe 1YJNT 1SRLA 2XDPA 2KGTA 2PZ1A 5HCKA 4OMNA 4HVUA 1UEBA 4HCBA 2RQWA 2DL7A 1YN8A 1OX9A 1YCYA 2KQWA 2QDYB 1M4ZA 2X3XD 3REAB 3M0SA 2MMPA 2MAMA 1GRIA 2K79A 2KT8A 3VS6A 1VQMA 1Q81R 1MNDA 1KFZA 2O88A 4L5GA 4J9BA 1M1KR 2YUOA 2E1HA 4JJNK 2RHYA 4P5NA 3A98A 4AFQC 2M51A 4JUVA 2QYZA 5D7UA 1UHCA 1RL2A 2ESWA 4FSSA 3P8DA 1UGSB 3EG3A 4F04B 3O8VA 2CH4W 1D3BB 1VQNQ 1QP2A 5KCOA 4J9CA 2QDLA 1VQ6A 5C0MA 5GAOr 1U8RA 2DXUA 4JS5A 1X43A 2FYKA 4PJOC 2EQKA 1AWOA 1BI2A 3BFMA 1IRXA 1ZUKA 4HCZA 4RG2A 3G7ZA 3L42A 5CKEA 1K73C 2R5MA 4DOWA 1O9SA 2JM8A 5KE2A 3J7AF 1Q7YU 2QQRA 4DBFA 1IHWA 4D8DA 1K8AC 1B34A 2R58A 2K3YA 2K2MA 2RB6A 3CPFA 4LDUA 4M78C 4ME7A 5DLQE 3VS7A 5KYUB 3CCLQ 2P0QA 3M53A 2GFUA 4E2FB 2EJ9A 3JAME 2IIMA 3MEVA 3SHWA 2KDSA 1HK9A 4RCCA 1NYFA 1KQSS 4LUDA 2NUTB 4FCYA 3OYMA 2EBPA 3CCMQ 2LTOA 2HAXA 3LLRA 1LVKA 2MWOA 2YUQA 3PMIA 1BIAA 1HYOA 2LCLA 2P4RA 4F7UB 3L2QA 1G3TA 3PE0A 3MHXA 1U5SA 3CC7A 5LJ3f 4CC7A 1LNXA 2I2LA 3G6ET 5DLOA 2W10A 5KYWA 3CCUA 4AG1C 2GBQA 3VYGA 1BIBA 4PL6A 5LL6S 4F17A 2RK1A 2DRKA 3GLXA 2AIRB 1K4US 3OS5A 1RI0A 1UJ0A 1ZQ1A 2KBTA 3V7SA 4C92E 1I0CA 2R5AA 2D9TA 4R56A 1HSQA 3HSBA 3ZFJA 2DIGA 1RI9A 3V8KA 1YHQA 3V7CA 3H0HA 4DQ2A 3NTHA 3EGDA 1VQ9Q 1YIJQ 3JV3A 4KUDK 3CCJA 3CBOA 1VQ5Q 1YI2A 1S72A 3TREA 4FL6A 2EIFA 1WHGA 1TS9A 4EMGA 2XICA 1X75C 2V1RA 3QZ5B 3MCAB 2A08A 5GAN4 3CCVT 1OPLA 4JJCA 1D1BA 3ZEHA 2VGNA 5D6XA 1YITQ 1PNJA 3FEOA 1FWZA 4E7SA 3CD6A 2JUFA 3UA6A 1QCNA 2HEQA 3QHSA 4FU6A 4N0AC 3JRZA 2OX7A 2RHIA 2DFUA 5GAMd 3SEMA 4C5IA 3CEYA 2DL5A 5HK0A 2DBKA 2HBWA 2KR3A 3QJYA 5AYFA 3JB9I 1Q82U 1WA7A 2RI3A 5IHKA 4C92D 1JJ2S 2ZPGB 2MWPA 4CC4B 1GFDA 4HVWA 4M75B 1WLPB 1AOJA 4DOVA 2F5TX 3KUFA 1M90U 2V8IA 1IGQA 1M27C 1OX8A 2H8HA 5C6SA 2V8KA 3A8MB 3P8HA 2PUOB 4N4HA 1T0JA 1NLPC 4KT0E 2LCSA 1KQ2A 1ZSZB 1VQPT 4QVZA 3I9QA 4Y92A 2YRCA 4RCBA 2QK0A 4C0DC 4J9EA 5L8RE 2LQKA 3SWNC 3OYLA 2DJQA 3CCEQ 2RJCA 4BB7A 1TUGB 1YBYA 1KD1U 3LW5E 1M2OA 1YWPA 1YFNA 2K7AA 3OS0A 3CCST 2DO3A 5GMKh 2I0NA 4C92G 4L59A 1UE9A 5KYUA 4FIBA 2QTXA 3LGFA 3E1SA 2E41A 3NPFA 4HA8A 1G83A 1RAIB 1T0HA 3EFOB 4EMKA 1GCPA 2A37A 1OZ2A 2WACA 2L0AA 2NUTA 2KRSA 4A4EA 2YRVA 3EHQA 3I56T 5GAMe 4C8QE 1GXIE 2K5FA 5I22A 1VQ8Q 2DRMA 4OVAA 1Y07A 3OS1A 4J6YA 2NWMA 1R77A 5CKHA 3GP8A 2CREA 3AT1B 1SF9A 1RAAB 1ABQA 3GOXA 3ZL7C 3QIIA 1FYNA 1WHJA 2K4YA 2O2OA 3DLLA 1UTIA 3LX7A 1WYXA 5CQXA 6AT1B 5GANj 3FLGA 2FEIA 1VUBA 2JJ9A 1LCKA 1CKAA 1I4K1 3VU3C 4EPCA 1BI0A 2K3BA 1X2QA 1Q7YR 2DNUA 4ATOA 2D8HA 3CCRQ 2QA4Q 3M0TA 1MMGA 3CC4Q 2J6FA 3U23A 4QVCA 2E5QA 1VIFA 2A3LA 1OOTA 2DE0X 4M7AE 4E7KA 1VQOA 2A0FB 1Q86C 4FT2A 2DXTA 3C0CA 1KC8C 2AHJB 2FZCB 1KQSA 4WF2A 2CZ6B 4RMOA 3S3OA 4QQGA 1QVGS 2PVOB 2GCXA 2EQIA 1MHNA 2MCNA 2JM9A 4X1VA 1NYGA 3CC2T 2KROA 3LGLA 4A53A 4EDUA 1K9MC 4F7UE 1AZGB 3PTAA 2DZ9A 2YXYA 3KXTA 3JB9H 2G6FX 3CCLT 4XU3A 1N8RU 1HD3A 1QP3A 4QQDA 1WXUA 4XU1A 2E64A 3G6EQ 2E12A 2YSQA 4J7FA 1WZOA 3OYAA 2DILA 4AT1B 2ABLA 2X4XA 3CBMA 4PLIA 2KXCA 2CSQA 4EMHA 2FPDA 4M75A 2DK3A 1YI2T 5LJ3g 2F2VA 3J81E 3OBYA 3CMAA 3EGXB 3D7SB 4C8QG 4ELYC 1IXDA 4PJOB 3META 2D0QB 2LQWA 5GMKi 2MOXA 4LD6A 3CQTA 3CCQA 2KY9A 2HKQB 5GAMj 1VQ7A 5LJ5e 2LNVA 1N5ZA 2HCKA 4M77E 1S1NA 5FWBA 4HCCA 2EFIA 1ZHIA 5FU6C 3G4SQ 2YDLA 3PFSA 4J6WA 3HKSA 2JS2A 2PQWA 1M1GA 4MMLA 2X9HA 5GAOq 4M78B 1YJ9A 3BE3A 5J26A 1Y0MA 1DJ7B 1WJQA 5GMKm 3OYJA 5CKBA 2DKGA 2L8DA 1FMWA 3RERA 3FJPA 1JXMA 4BY6C 3FIFA 1UUEA 1Q82R 4ZN3A 2M0OA 1VQ9T 1YIJT 2XMFA 1VQ5T 2BE7D 4CI0C 1ZBXA 4JLGA 1RLQC 4J6XA 4M7AG 2VVKA 4HXJA 1JJ2A 1Y71A 1GCQC 3AHUA 5FRNA 4FW1A 2LVMA 1NLOC 1PC0A 4M75E 2QQSA 4HCKA 1LOJA 1OU9A 2ZPHB 1ZA1B 1RUWA 1WJRA 2JS0A 2CH4A 2HBPA 3JCMW 2DAQA 2WSEE 4VUBA 3OMCA 3EH1A 3PVLA 2L89A 1UHFA 1U1TA 1T3LA 4F7UG 5FLXE 1C1AA 1WQ7A 1ZUUA 4K11A 1OQKA 3MKDA 2KE9A 3V8LA 2EQMA 1UGRB 1KD1R 5HY6A 2OTLA 3X20B 3TVTA 4E7LA 2GFAA 3LWIA 4WCIA 4RTTA 1ACMB 2DD5A 3VUBA 1G3YA 4JJDA 3OQ5A 3GNGA 2FL7A 2K5IA 3M58A 5GAN8 1OU8A 4LDVA 4PFPA 3QYGB 2DD4A 4M77G 4LXCA 4M75D 2LDMA 2A7YA 3MPUB 4QT7A 5LJ5j 2YWWA 3L2UA 3CCET 1N9SA 4J9DA 2HQEA 1XJWB 1VQ6Q 2EAYA 1W1FA 4JDSA 4OMOA 3RDVA 2C0OA 1IZ6A 2AZVA 3M9QA 2XIDA 2ZZDA 5CVIA 4A4GA 2BIVA 2RHXA 4OGCA 5LJ3d 4M7DC 2AK5A 2E5KA 4IUPA 2RH2A 1MMDA 4KRTA 1OYXA 2DTOA 4X9DA 2CZ1B 4QVDA 1UDLA 2LT1A 1Z9ZA 1D0ZA 1PG5B 2HZYA 4PNOA 3DLMA 2H3JA 3URGA 4C8QB 2XI9A 1B07A 4C0DB 1VQ8T 1NEGA 1FXXA 3EGXA 4AMCA 1I5OB 1RAEB 2RJEA 4MDWA 4IKFA 4MDXA 4IUQA 2LRQA 1IB8A 5KYXB 2F5KA 3P8BB 3CMEA 3A8HB 1I5LA 3SWNB 4M75G 4AG2C 2V1QA 3JCMX 3JCMf 8AT1B 3BW1A 1CSKA 2XKOC 4J9IA 1JB0E 2OI3A 3OYGA 4BUGA 2ZPIB 5CKFA 2M9UA 3TSWA 1YJWA 2YHTA 1X01A 3T9NA 5KYYB 4M78A 2VGMA 3G71A 2OTJA 3CC7Q 3A1PA 4LD9K 1TUDA 4M4ZA 1PKSA 3IQLA 2LQNA 4C92A 2QQBA 1E7OA 5GAOp 3CCUQ 1SG5A 2XHCA 2E6NA 1QVGA 3CCRT 2QA4T 1ABOA 2FPFA 3CC4T 1N8RR 1OPKA 2K3XA 3EH2A 2W0ZA 3BDUA 3RBBB 4OMMA 3CC2Q 2HQHA 2YLCA 4M75F 3SDZA 2ROLA 5GMKl 4M7AB 2H3EB 1MUZA 5CIUA 2NUPA 1TWBA 1OV3A 1KK7A 1WHHA 2PNIA 3A8GB 4IIMA 2CUBA 1K0XA 1W2BS 1RABB 3CCJQ 1I81A 1NJIC 1IO6A 1YI2Q 1S72Q 1KQSP 2ZAEA 2EGCA 5FROA 1PRMC 2SRCA 2XU8A 2AT1B 4PJOE 2NUZA 3HHTB 2EJGA 3C12A 1O75A 1WXBA 2M16A 5FRMA 3L2ZA 3CD6Q 1N9RA 5LJ3h 1BBZA 1H641 3J80E 1VQLA 3EAEA 3JB9G 4DEYA 3I55T 4IIOA 2IVWA 2E3IA 1VQNA 3EG9B 4LN2A 2DF6A 4M78E 2EYXA 4ZGJB 4LE9A 5D6WA 1C0MA 5GAOn 4M77B 2YLBA 3X28B 2HSEB 4JLIA 3OMGA 4FYXB 4N0AA 4CRIA 3G4ST 2VUBA 2Y90A 2BZXA 1E6HA 1VQ4T 1H8KA 4PJOD 2RMOA 3M54A 5IH2A 4FSXA 4J9GA 3X26B 4RTVA 3R6NA 2LJ0A 1EIFA 4RTXA 3OYYA 2WSFE 3LH0A 2RN8A 1NM7A 3NMZC 5GAN5 2DTHA 2VXEA 1D09B 4A63B 4M78D 1H3HA 2AKLA 3UF4A 1D0YA 3L2RA 2B86A 1QLYA 1NPRA 1Q81C 4C8QA 4OMFB 5HK3A 2GQIA 1Y57A 2X3WD 1TSFA 2IPOB 3I35A 1JEGA 1M1KC 1JJ2P 1F1BB 4MZMA 1K73U 1VQKA 1PSFA 3MP6A 3OSVA 4FYVB 4JS4A 1OULA 1X69A 1I8FA 1TTHB 1D3BA 4PJOG 2ED0A 3OYKA 3OW2A 3VKIA 1K8AU 4XU2A 3JCMJ 2CP7A 3HPWA 5KYYA 5GMKe 4NL3A 2EQJA 3EGUA 2CUDA 5GANf 2A28A 3OY9A 1WGSA 4R0KA 1KSWA 1BU1A 1T3SA 3R6OA 4C0GA 1VQMT 1RAFB 2Y4YA 4M78G 4QKUA 3VV0A 1TU0B 2RO0A 3OS2A 3FRNA 1PCXA 1QVFS 4B9WA 2EGAA 1YITA 4M7AA 4LDWA 1WFWA 2MK5A 1EX4A 2QEXA 2JVVA 2RI2A 3CPWS 4V2SA 1PM3A 3UWNA 4C0ZA 1MMAA 4OB0B 1VQ6T 1KG1A 3JCMc 5IXFA 3C4SA 1NEBA 1Y96B 2LJ3A 2CKKA 2OTJT 2FG0A 2FPEA 2KEAA 5FU7C 4OMQA 4F7UA 2GTJA 2O9SA 2QASA 5GAN3 3QYHB 3QPHA 3NTKA 4M78F 5FWCA 2DL4A 3C95A 1XOVA 5CCAA 3MJXA 1M8MA 4C92F 2KRMA 1KHCA 2R57A 3VS5A 3EG9A 1ARKA 1KJWA 3I5SA 1X6BA 2CT3A 3QO3A 3JCMg 3VUZA 1PWTA 1JXOA 1WI7A 3FDRA 2J7IA 4OMLA 4EMKC 4DEXA 4KUIA 5GAMf 4M77A 2X35A 4DBQA 2DBMA 5I2MA 5M9OA 1TG0A 1V76A 2X4YA 4XQ3A 7AT1B 4L6V5 5GJWB 2RM4A 2DERA 2ECZA 3CMAQ 1BCOA 1YJNA 4C8QD 2PVGB 2KYMA 3CCQQ 2YT6A 2JOYA 4M7DB 1VQ7Q 2DVEA 2RF0A 2KVQG 3CC7T 2KAFA 3JB9J 2E4HA 3EG0A 2FVUA 1UGVA 2CP3A 4BE2A 1W2BA 3VRYA 5GMKj 3CCUT 1SSHA 3PVQA 2ZGWA 1K9AA 9ATCB 2CP6A 2G3RA 3HP9A 3QWYA 2DZCA 2YRDA 3O5ZA 1QVGP 4BI8B 2XDDA 3QUIA 5IAYA 1A0NB 2GTOA 2GF7A 2QQAA 5KH6A 5CAIA 2JTFA 2LNHB 1GBQA 1WHLA 1NG2A 1CKBA 3H6ZA 2QGGA 1YHQT 3I55Q 4E47A 2XDBA 2C06A 1EZZB 1PHTA 3CCJT 2ZCFB 1S72T 3WVEB 4GBQA 2EKOA 2HQXA 2C0IA 2X4WA 1J3TA 3NHNA 1M8VA 1BB9A 2L3RA 2V8JA 2KYBA 4LDYA 4M7AD 3OYDA 3CXCS 4ZGDB 1ZSZA 2HMAA 4II1A 1V1CA 2ZPBB 4OF1A 3S3MA 3CD6T 3E2UA 2HNIA 1FMVA 2JTMA 2A36A 3WVDB 1PKTA 2O31A 3OYCA 2KRNA 3VS3A 2HDAA 4ZTFA 3RUXA 1WHMA 2NYSA 4JPBW 4DA4A 1ZLMA 1VQ4Q 1H3ZA 1NZ9A 4ZNXA 1Z9QA 2VASA 3FC3A 4ELZC 2LC4A 3OSSC 1GCQA 4X9CA 2RA2A 1BCMA 2F69A 3THKA 2OTLQ 2QI2A 1TXQA 2M0YA 5I21A 1W4SA 4C8QF 4M75C 5GAN6 2ENMA 1MGQA 2PTKA 2C0TA 4FM4B 4RKUE 4KGZB 3RESA 2L3SA 3OYIA 1Y7XA 2JMAA 3EFOA 1V29B 3HFOA 3M0PA 2CP0A 1UGPB 2ROTA 5LJ5f 2D6FA 4C0FA 4BDYA 2J06A 1M90R 1K73R 2LT4A 3QSUA 2D1XA 2DM1A 1Y96A 3G6EA 1TUCA 1D0XA 4B6MA 1LPLA 4E7ZA 2JNGA 1WNLA 4M77D 1MV0B 5D6YA 1XTDA 2RPNA 3H0IA 4TVRA 1PSEA 2CP2A 2EKHA 1K8AR 3RKWA 1EFNA 1K0SA 1VIEA 2J6OA 1B34B 3JCMd 1QMCA 3HL8A 4JRIA 2EYWA 2L2PA 4J83A 2CYZB 1W70A 1M9SA 4R55A 3QKJA 2YUPA 3PIOA 2PUKB 1UJYA 3UT1A 2D8JA 1Q86U 3UPUA 1KC8U 1BYMA 3HRSA 2E6ZA 4GLKA 5IT9E 4NL2A 2EYZA 3PGGA 2KT1A 3QZ9B 1XQHA 2QEXT 4PLLA 1JRIA 3EHRA 4NOYA 1G3WA 4M7AF 1VQMQ 1Q7YC 1U3OA 3M55A 3BY7A 4ESRA 1P92A 5GANg 4ANJA 2JW4A 2QAZA 1SSFA 3CCVA 3E9GA 1QVFA 1K9MU 5EC7A 4E7HA 3A5ZB 2ZPFB 4Z02A 3BDLA 1UFFA 1Q95G 5KYWB 4J9HA 3OW2S 3CMEQ 2CT4A 2HSPA 2K2VA 2QG9B 4M7DA 1U1SA 1VYTA 1NBEB 3MP1A 3OW2P 2QGFB 1GFCA 2JN0A 1NE8A 3MEUA 4F7UF 1SRMA 2RI5A 3CPWA 5EG2A 4Y28E 2FHDA 1YJWQ 3L2VA 4X34A 4BE0A 2OTJQ 4RTZA 3V8JA 4BI3A 1QKWA 4JRPA 3PMTA 3LWHA 2X4JA 1SKUB 3L1AA 2IG0A 4KH1B 3LH5A 4XTWA 5GJVB 4ORZA 1FX7A 4GLMA 1K76A 2MI6A 1BKBA 2BZ8A 2EPDA 2JXBA 4BDZA 4M77F 1VQPA 3NGPA 4XK8E 2DEQA 2L3QA 3GNFB 1VQOT 1WQWA 1G5VA 2KXDA 4RUGA 3RMSA 4PJOA 2DMOA 4NS5A 3VYHB 1M2VB 4XTYA 3TSZA 3RKYA 2VV5A 1YP5A 2FRWA 8ATCB 1M30A 2HL5C 4AFZC 3ULRB 3M0RA 3EG2A 2EW3A 3DB3A 4MZPA 2LX7A 5L23A 1VYUA 3JCMh 3JCMV 1BI3A 2O4XB 2RNAA 4LDXA 5GAMg 3CCSA 4WTOB 4M7DE 3M0UA 2ZPEB 4J5YA 1G3SA 2DETA 1QCOA 1VQLQ 1JQQA 4HT9A 1WXTA 1AWJA 1M3CA 1QWEA 2L5QA 3E9FA 3JB9D 2DL8A 2XD0A 1QWFA 1OEBA 3I56A 3SB2A 5A0LA 5FW9A 3CMAT 5FU7B 2X51A 1Q82C 4A54A 1QKXA 3QXEB 1AEYA 4DBHA 1H92A 3JCMb 3CCQT 2J05A 2DYBA 3EG1A 2FB7A 4PKCC 1VQ7T 2PVDB 4Z88A 4N4IA 3DKMA 4OB3B 3QDFA 1M90C 3VS2A 5LJ3e 1YHQQ 2RJFA 3KBGA 3X25B 4Z8AA 3QWXX 2COZA 2RQRA 4OGEA 1W2BP 3A8OB 2KNBB 3HRUA 4IURA 3M4YA 3S6WA 2MIOA 1YJ9T 3JCMP 2LCCA 1IHVA 2JT4A 2JZ2A 3CXCA 2BZYA 2EQUA 2RHZA 4M7DD 4EMKB 4E7JA 5GAOm 4C92C 4RTWA 3M0QA 3PT9A 5GANd 5CR2A 2FO0A 4OMPA 5IHNA 1KD1C 2HD0A 1OZ3A 1AHJB 1X6GA 2K6DA 1SEMA 1WJSA 3H0FA 2O9VA 2B8AA 4Y91A 3TU4K 3ER0A 2JMCA 3RMQA 5DM7R 3KFVA 5A0GA 3DB4A 1RLPC 1AWWA 1JU5C 3FB9A 1IREB 2L3PA 1M3AA 4B9XA 4BI4A 3INZA 1ZSGA 4N4GA 1VQKQ 2COYA 4D8KA 3CC2A 1R0BG 3RNJA 1OI1A 3CCLA 4J8OA 2DLPA 3JB9F 2P84A 4M7DG 3E19A 4PJMA 1WPYA 1RAHB 4PFOA 4E7IA 2OTLT 4IUTA 3NTIA 5LJ5g 2DX1A 1M1FA 4KH0B 4XTVA 3M5AA 1Q86R 3CCMA 1KC8R 2DVJA 3OYEA 2LZ6B 4QQ6A 4J9FA 5DY9A 3GPLA 4GY5A 2MPXC 5A2QE 3TCJA 3UATA 5CQYA 2DA9A 2PU9B 1NPPA 2CZ7B 5FU6B 2DPPB 1TOVA 2MYSA 1M2VA 1K1ZA 2KMTA 1K9MR 5GANe 3FJ5A 5KYXA 2QEXQ 1G2BA 3SWNA 3WXMB 2DXCA 4M7DF 4Z89A 4Q5WA 5LJ3j 2DIQA 2M02A 3H41A 2O4XA 1VYVA 1WX6A 1E6GA 4HKEA 4AFSC 1IGUA 2DXBA 4BY6B 3OYFA 2EGEA 2VC8A 4RTUA 4XTXA 2OAWA 4A4KA 2HKNA 5GANh 4OP0A 1VQ9A 1YIJA 5AT1B 1JO8A 1VQ5A 3C94A 1NJIU 1TH7A 1VOMA 2ATCB 1KIKA 1G8XA 3ASKA 4C8QC 5HKCA 4RG8A 4FYWB 2OJ2A 2GQVA 4FT4A 1N8RC 3GIBA 2VKNA 1BK2A 1UG1A 1SHGA 2EWNA 1UB4A 3Q1JA 3VRZA 1MV3A 2J6KA 5IHIA 3CMET 2BE9B 1C6VX 3HRTA 5KE3A 1QVFP 3M4GA 1KHIA 2Z0WA 3ZBDA 3QBYA 3CBPA 4PJOF 3UDCA 1D1AA 2BUDA 3PIPA 1YJNQ 5IXBA 3LYIA 4FYYB 1YJWT 1VQOQ 3G71T 3TEEA 1I07A 3CPWP 2RK2A 3MEWA 4KGVB 1X27A 2VXFA 2KK4A 2OAUA 2KSSA 1R8OB 3GBQA 1RAGB 4OB1B 3QG1A 5CKDA 2E70A 3RIRA 3JCMQ 4XU0A 4EIKA 4IUVA 2LP5A 1YNZA 2YUNA 4OB2B 2CSIA 2KI7A 3EFRA 2BKDN 4CC3A 4F16A 3OA6A 2VB6A 1ZUYA 5GAOl 4YTLA 2K9GA 4M7AC 3GF5A 1HXDA 4PK4A 4PJJA 4A4HA 3HFNA 1AVZC 1R0CB 3CCEA 2QQ9A 5J39A 5GAMh 1SHFA 4CC2A 1KQ1A 2O01E 4FW2A 3M59A 5LJ5d 4BE1A 2RQTA 3VS1A 1Q81U 2GNCA 2SEMA 1ZA2B 1BI1A 4JZ3A 2XK0A 4RTYA 1B7TA 4A4FA 1VQLT 5I11A 3QDRB 1M1KU 1PRLC 3N5BB 2MF2A 2DJZA 3ME9A 4KULA 2VWFA 1VQNT 2RJDA 1N27A 2FZKB 2EYYA 3VJPA 4PFZA 2COWA 1YJ9Q 1VQ8A 2CGHA 4XTUA 1W6XA 4ZTJA 4HT8A 3I5RA 5CO7A 4LNPA 2K5LA 1U06A 2JTEA 4F14A 4M77C 4O5VA 1ZBJA 5GAN7 1QW1A 2P0KA 2E10A 2EVRA 2LQ8A 3PNWC 4QW2A 5I2SA 3OYBA 3REBB 2DL3A 2LMJA 3CXCP 2LX9A 3NFCA 2E3HA 1AT1B 4PJLA 3CCRA 5CK9A 2QA4A 3OYNA 3CC4A 1QCFA 3H8ZA 3CCMT 3VS0A 2Y4XA 4JRKA 4DBRA 4MZTA 4AFUC 2CZ0B 3UA7A 4JJBA 2AKKA 1FMKA 2EYQA 1SPKA 2M1HA 3S3NA 4C5EA 1HJDA 5KCHA 5KYNA 1ZX6A 4E6RA 2RD1A 2QTVA 1MNEA 4JRQA 1D1CA 2RQUA 3MP8A 2XG8D 1VQKT 4D6WA 3MEAA 5J3BA 1QVPA 2FZGB 1AD5A 2P4TA 2FRYA 1UECA 3RKXA 3CCVQ 1B3QA 2DYIA 3M56A 2DEUA 4C92B 1PD0A 1XNIA 1ZSZC 2F2WA 5LJ5h 4C5HA 3SD4A 4J7IA 3HTRA 3V7RA 3OYHA 4BACA 2D0NA 2QXFA 1AWXA 2ED1A 2P0PA 3I55A 2K57A 2E65A 3L2WA 1UGQB 1GL5A 1WHKA 5ECAA 3OBWA 2NLUA 2F1LA 2NUPB 3X24B 1M5Q1 2BTTA 1N6AA 5IN1A 3M57A 1JBMA 1LJOA 2RHUA 1YITT 1NJIR 1X2KA 5GAN2 4LUEA 5A0DA 3OB9A 4C5GA 1MMNA 2V26A 4IUUA 4XAXB 3G4SA 2AZSA 3TQ7P 3RR6A 4HVVA 1RADB 4UC4A 1VQ4A 1VQPQ 1X6OA 2WSCE 2GGRA 3JSCA 3QJ6A 1RACB 1WDXA 1YCSB 2RQVA 2HL3A 2F2XA 3MO8A 4XTZA 3EFSA 1VA7A 1I1JA 3SFMA 4ZN1A 4MMKA 2LJ1A 3H9NA 3A8LB 2EJFA 1WIEA 2DTIA 1M3BA 1GBRA 2VYTA 1AZEA 3CCSQ 3G71Q 1PD1A
chains in the Genus database with same CATH topology
5LJ3g 2HD0A 1YITA 1OZ3A 4M7AA 4LDWA 4A53A 3J81E 3OBYA 3CMAA 1AHJB 4C8QG 4ELYC 4ZGEB 4PJOB 3META 2D0QB 5GMKi 4LD6A 3CCQA 2KY9A 1WJSA 4BD3A 2QEXA 2JVVA 3F70A 5GAMj 1VQ7A 5LJ5e 2B8AA 2LNVA 4M77E 2RI2A 4Y91A 3TU4K 4KBMB 3ER0A 3CPWS 4V2SA 3UWNA 4O6JA 3RMQA 5DM7R 4C0ZA 2CS7A 3DB4A 4OB0B 5A0GA 3JCMe 4HCCA 3JCMc 1VQ6T 1KG1A 1YJNT 2XDPA 3C4SA 1Y96B 2CKKA 2EFIA 3FB9A 2OTJT 1IREB 1ZHIA 1UEBA 5FU6C 3PFSA 4HCBA 4J6WA 4B9XA 3INZA 4BI4A 3HKSA 5FU7C 2PQWA 4N4GA 1M1GA 4F7UA 5GAN3 4MMLA 5GAOq 3QYHB 1YCYA 2KQWA 2QDYB 1M4ZA 4M78B 3CC2A 3QPHA 3NTKA 4M78F 1YJ9A 2MMPA 2MAMA 5J26A 1OI1A 3C95A 3CCLA 4J8OA 3JB9F 1XOVA 1VQMA 5CCAA 1DJ7B 4M7DG 1WJQA 3E19A 5GMKm 3OYJA 5CKBA 4C92F 1WPYA 2DKGA 1KHCA 2L8DA 3RERA 2R57A 3FJPA 4E7IA 2OTLT 4IUTA 3NTIA 4BY6C 5LJ5g 4L5GA 3FIFA 1M1FA 4ZN3A 4XTVA 3QO3A 3JCMg 3M5AA 2M0OA 3VUZA 1VQ9T 4JJNK 2E1HA 3CCMA 1YIJT 2RHYA 1VQ5T 3FDRA 4CI0C 4P5NA 1ZBXA 4JLGA 3OYEA 4EMKC 4QQ6A 4JUVA 4J6XA 4KUIA 5GAMf 5DY9A 3GPLA 4M7AG 4M77A 4GY5A 1RL2A 2X35A 5A2QE 3TCJA 1Y71A 3P8DA 5CQYA 1UGSB 1JJ2A 5I2MA 5M9OA 3AHUA 3O8VA 1D3BB 2PU9B 2X4YA 4XQ3A 4L6V5 5FRNA 1QP2A 2RM4A 2LVMA 5KCOA 1NPPA 1VQ6A 1YJNA 4M75E 2CZ7B 5FU6B 2QQSA 2DPPB 4C8QD 5C0MA 1LOJA 2PVGB 2ZPHB 5GAOr 2KMTA 1U8RA 5GANe 2DXUA 4JS5A 2FYKA 1WJRA 2JOYA 2HBPA 3SWNA 3JCMW 4M7DB 2DAQA 2EQKA 2DVEA 2WSEE 1BI2A 2DXCA 2KVQG 4VUBA 3OMCA 3WXMB 3BFMA 3CC7T 2KAFA 4M7DF 3JB9J 2L89A 4Q5WA 4HCZA 4RG2A 2DIQA 5LJ3j 2FVUA 3G7ZA 3L42A 1U1TA 4BE2A 1W2BA 5CKEA 1K73C 4F7UG 2R5MA 5FLXE 5GMKj 2O4XA 3CCUT 4DOWA 1WQ7A 2ZGWA 1O9SA 3V8LA 2EQMA 1UGRB 4HKEA 2G3RA 2DXBA 5KE2A 5HY6A 3J7AF 4BY6B 3OYFA 1Q7YU 2QQRA 2VC8A 2OTLA 3CD6A 3HP9A 3X20B 2DZCA 4XTXA 1K8AC 1B34A 2R58A 2K3YA 2RB6A 4M78C 3CPFA 4LDUA 4ME7A 5DLQE 4A4KA 2GFAA 4BI8B 3QUIA 5GANh 2XDDA 2P0QA 3M53A 5IAYA 4OP0A 3LWIA 1VQ9A 2GFUA 1YIJA 1VQ5A 3C94A 2DD5A 2EJ9A 2GF7A 1TH7A 2QQAA 3VUBA 1G3YA 2JTFA 3MEVA 5CAIA 5KH6A 1NJIU 2KDSA 1HK9A 4RCCA 3OQ5A 1KQSS 1QVFS 3ASKA 4C8QC 5HKCA 3H6ZA 4RG8A 1YHQT 3GNGA 2FL7A 2GQVA 4FT4A 4E47A 2K5IA 1N8RC 2XDBA 3GIBA 3M58A 2EWNA 3OYMA 2C06A 5GAN8 1UB4A 3Q1JA 3CCJT 2LTOA 2ZCFB 4LDVA 1S72T 3QYGB 2DD4A 3LLRA 3WVEB 2HAXA 2EKOA 4M77G 2HQXA 2X4WA 3CMET 2MWOA 3PMIA 1BIAA 2LCLA 3HRTA 1M8VA 4M75D 4F7UB 2LDMA 5KE3A 3M4GA 3L2QA 2L3RA 1KHIA 2V8JA 4LDYA 1G3TA 2A7YA 3ZBDA 3QBYA 3CBPA 5LJ5j 4M7AD 3MHXA 4PJOF 3OYDA 3CXCS 3UDCA 4ZGDB 3CC7A 3L2UA 3CCET 5LJ3f 1N9SA 1LNXA 2HQEA 2I2LA 3G6ET 2BUDA 4II1A 2ZPBB 3PIPA 4OF1A 2EAYA 5DLOA 4JDSA 3S3MA 3CD6T 3LYIA 2HNIA 2JTMA 1YJWT 3CCUA 1IZ6A 3G71T 3TEEA 3WVDB 3VYGA 3M9QA 1BIBA 2XIDA 4PL6A 3OYCA 2ZZDA 2RK2A 3MEWA 2RK1A 5CVIA 5LL6S 3GLXA 4A4GA 4ZTFA 2VXFA 2KK4A 2OAUA 3RUXA 2BIVA 2RHXA 2KSSA 1RI0A 3OS5A 4OGCA 5LJ3d 4M7DC 1ZQ1A 1R8OB 2RH2A 4IUPA 4DA4A 1OYXA 2DTOA 4X9DA 2CZ1B 3V7SA 4OB1B 3QG1A 4PJOC 1H3ZA 5CKDA 2E70A 3RIRA 1NZ9A 4QVDA 3JCMQ 4XU0A 2LT1A 4C92E 4IUVA 2LC4A 4ELZC 3FC3A 3OSSC 3OY9A 4PNOA 4X9CA 3DLMA 2R5AA 2D9TA 2RA2A 4OB2B 2F69A 4R56A 2H3JA 3HSBA 3ZFJA 2QI2A 3EFRA 2BKDN 2DIGA 3URGA 4C8QB 3V8KA 5I21A 1W4SA 2XI9A 4C8QF 4M75C 1YHQA 3V7CA 4DQ2A 5GAN6 3OA6A 3NTHA 1MGQA 4C0DB 1VQ8T 1FXXA 4YTLA 4FM4B 5GAOl 4RKUE 4M7AC 4KUDK 3GF5A 2RJEA 3CBOA 1HXDA 3CCJA 1YI2A 4MDWA 3RESA 3TREA 3OYIA 4FL6A 4IUQA 1Y7XA 2EIFA 2LRQA 4IKFA 4MDXA 3CMEA 2F5KA 1V29B 3HFOA 3P8BB 4EMGA 3A8HB 1I5LA 3SWNB 2XICA 1X75C 4A4HA 1UGPB 3MCAB 3QZ5B 5LJ5f 3HFNA 2D6FA 4M75G 4C0FA 3JCMX 5GAN4 4BDYA 3CCVT 3JCMf 3CCEA 2LT4A 2QQ9A 3QSUA 1Y96A 5J39A 3BW1A 5GAMh 3G6EA 3ZEHA 2VGNA 5D6XA 2XKOC 3FEOA 1FWZA 2JNGA 1JB0E 1KQ1A 2O01E 1WNLA 2JUFA 2ZPIB 4M77D 3QHSA 2M9UA 5CKFA 5D6YA 4FU6A 1YJWA 1XTDA 1X01A 2YHTA 4N0AC 4TVRA 3T9NA 1PSEA 3M59A 4M78A 2VGMA 3JRZA 5LJ5d 3G71A 4BE1A 2OTJA 3RKWA 2RHIA 1VIEA 4LD9K 1B34B 5GAMd 1Q81U 3JCMd 4JRIA 3HL8A 4C5IA 3CEYA 4J83A 5HK0A 2CYZB 1BI1A 2XK0A 1M9SA 4C92A 2QQBA 3QKJA 3QJYA 4R55A 3PIOA 2PUKB 5GAOp 4A4FA 5AYFA 3JAME 1VQLT 3JB9I 2XHCA 2E6NA 3UT1A 1Q82U 3QDRB 1QVGA 1M1KU 3CCRT 2QA4T 2RI3A 1Q86U 4C92D 3CC4T 3UPUA 3N5BB 2MF2A 2DJZA 2ZPGB 3ME9A 4KULA 1KC8U 1JJ2S 1BYMA 2MWPA 2K3XA 3HRSA 1VQNT 2E6ZA 4GLKA 2RJDA 5IT9E 1N27A 4NL2A 3BDUA 4M75B 3PGGA 4DOVA 2YLCA 3VJPA 2F5TX 3KUFA 4M75F 3SDZA 2CGHA 2V8IA 4XTUA 1M90U 1VQ8A 5GMKl 3QZ9B 4M7AB 1XQHA 4ZTJA 5CIUA 2QEXT 4PLLA 1JRIA 4NOYA 4HT8A 1G3WA 5C6SA 4M7AF 2V8KA 3A8MB 3P8HA 2PUOB 4N4HA 2K5LA 5CO7A 1Q7YC 1KD1C 3M55A 3BY7A 1P92A 5GANg 4KT0E 1SSFA 1KQ2A 4M77C 3A8GB 1VQPT 1W2BS 3CCVA 4O5VA 3E9GA 4QVZA 1QVFA 1K9MU 4E7HA 3A5ZB 2ZPFB 1I81A 3BDLA 4RCBA 4Z02A 1NJIC 5GAN7 4C0DC 3OW2S 1QW1A 2P0KA 2K2VA 2E10A 4M7DA 1U1SA 5FROA 5L8RE 2XU8A 2LQ8A 1S72A 3MP1A 4PJOE 3PNWC 2LQKA 2JN0A 3SWNC 3OYLA 1NE8A 3MEUA 4F7UF 3HHTB 2EJGA 4QW2A 2RJCA 4BB7A 2RI5A 3C12A 5I2SA 1YBYA 3CPWA 1O75A 5EG2A 4Y28E 1KD1U 2FHDA 2M16A 3LW5E 5FRMA 3L2ZA 1N9RA 3OYBA 5LJ3h 1H641 3J80E 3L2VA 4X34A 1VQLA 2LX9A 3NFCA 3OS0A 4BE0A 3EAEA 3JB9G 3I55T 3CCRA 2QA4A 5CK9A 2IVWA 3OYNA 3CCST 2DO3A 5GMKh 3V8JA 4BI3A 3CC4A 3H8ZA 4JRPA 4C92G 4L59A 3CCMT 1VQNA 3PMTA 4FIBA 2QTXA 3LGFA 2Y4XA 3E1SA 2X4JA 3LWHA 3L1AA 4M78E 2E41A 4JRKA 4MZTA 4HA8A 2CZ0B 2IG0A 4EMKA 4ZGJB 2WACA 1OZ2A 5D6WA 4XTWA 1FX7A 4A4EA 2EYQA 2MI6A 1BKBA 2YRVA 5GAOn 2M1HA 5GAMe 3I56T 4M77B 4C8QE 3S3NA 2YLBA 3X28B 1GXIE 2K5FA 4M77F 4BDZA 1VQPA 4C5EA 4JLIA 3OMGA 4XK8E 5KCHA 4N0AA 2DEQA 3GNFB 4OVAA 1Y07A 1VQOT 1WQWA 4CRIA 2RD1A 3G4ST 2VUBA 3OS1A 4J6YA 1G5VA 2Y90A 4JRQA 3MP8A 2XG8D 5CKHA 3RMSA 4PJOA 3GP8A 4NS5A 1VQKT 4D6WA 3MEAA 5J3BA 3VYHB 1QVPA 4XTYA 3OYGA 3RKYA 2P4TA 3GOXA 1VQ4T 2VV5A 3RKXA 4PJOD 3QIIA 3M56A 3M54A 4C92B 1XNIA 4FSXA 3X26B 5LJ5h 4C5HA 3SD4A 4J7IA 2K4YA 3DB3A 4MZPA 3V7RA 3OYHA 4BACA 3JCMh 3JCMV 3DLLA 1BI3A 1EIFA 3LX7A 2O4XB 3OYYA 2QXFA 2WSFE 2P0PA 5CQXA 3I55A 2K57A 5GANj 4LDXA 5GAMg 2E65A 3FLGA 3LH0A 3L2WA 3CCSA 1UGQB 5GAN5 4M7DE 1VUBA 2DTHA 2ZPEB 2VXEA 1I4K1 3OBWA 3VU3C 2NLUA 4EPCA 4J5YA 1BI0A 1G3SA 4M78D 3X24B 4ATOA 1M5Q1 3L2RA 4HT9A 1N6AA 1NPRA 3E9FA 2L5QA 3M57A 1JBMA 5IN1A 4C8QA 3JB9D 1Q81C 1LJOA 2RHUA 2XD0A 4OMFB 3I56A 1YITT 4E7LA 4QVCA 5HK3A 2E5QA 3SB2A 5A0LA 5GAN2 1VIFA 3CMAT 5A0DA 3OB9A 2A3LA 5FU7B 4C5GA 1Q82C 4M7AE 1M1KC 4A54A 3QXEB 4E7KA 1VQOA 4IUUA 4XAXB 1Q86C 3G4SA 4FT2A 4MZMA 2DXTA 3JCMb 1KC8C 1K73U 3CCQT 2AHJB 2FB7A 4PKCC 1VQ7T 1VQKA 2PVDB 1PSFA 3MP6A 3OSVA 1KQSA 4N4IA 3DKMA 4OB3B 4BUGA 4JS4A 4UC4A 4WF2A 1M90C 1VQ4A 2CZ6B 1I8FA 4RMOA 3S3OA 4QQGA 1D3BA 5LJ3e 1X6OA 4PJOG 2WSCE 3JSCA 3OYKA 2RJFA 3OW2A 3VKIA 3KBGA 3QJ6A 3X25B 1K8AU 4XU2A 3JCMJ 1QVGS 2PVOB 3HPWA 2GCXA 5GMKe 4NL3A 2EQJA 4OGEA 5GANf 1MHNA 3CC2T 3LGLA 3A8OB 3HRUA 3MO8A 1WGSA 4XTZA 4IURA 3M4YA 3EFSA 3S6WA 4EDUA 4F7UE 1YJ9T 1K9MC 3JCMP 2LCCA 2JZ2A 3SFMA 3CXCA 4ZN1A 3PTAA 2DZ9A 3KXTA 3JB9H 2EQUA 2RHZA 4MMKA 3CCLT 4XU3A 1N8RU 3R6OA 4C0GA 1QP3A 3A8LB 4EMKB 1VQMT 4M7DD 4E7JA 2EJFA 4QQDA 2Y4YA 4XU1A 2E64A 4C92C 5GAOm 2E12A 4J7FA 2DTIA 3OYAA 4M78G 3VV0A 2VYTA 3PT9A 2X4XA 5GANd 3CBMA 5CR2A 2RO0A 3OS2A 3FRNA 4PLIA 4EMHA 4M75A 2DK3A 4B9WA 1YI2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVA A;  4FU6 A;  4CRI A;  3OYF A;  1OZ3 A;  2QQR A;  3OS1 A;  1G5V A;  4BE1 A;  3MP8 A;  2R58 A;  2RHI A;  2K3Y A;  4NS5 A;  4E7L A;  2GFA A;  3MEA A;  5IAY A;  4C5I A;  3MET A;  3CEY A;  2GFU A;  4LD6 A;  3GOX A;  1WJS A;  2XK0 A;  2GF7 A;  4BD3 A;  5KH6 A;  3QII A;  3QKJ A;  3F70 A;  2JTF A;  3MEV A;  4A4F A;  2B8A A;  3OQ5 A;  1XNI A;  2RI2 A;  4C5H A;  2E6N A;  3SD4 A;  3UT1 A;  3UWN A;  3ASK A;  3H6Z A;  2RI3 A;  3DB3 A;  3DB4 A;  3OYH A;  4BAC A;  3ME9 A;  2XDP A;  3C4S A;  3LX7 A;  2K3X A;  2MWP A;  2CKK A;  2EFI A;  2O4X B;  2RJD A;  3OYM A;  3PFS A;  1N27 A;  3Q1J A;  4B9X A;  2LTO A;  3LLR A;  3LH0 A;  2PQW A;  3FLG A;  2EKO A;  5D6Y A;  2HQX A;  3L2W A;  4N4G A;  2X4W A;  3KUF A;  2MWO A;  3PMI A;  5KE3 A;  2LDM A;  4ZTJ A;  5CIU A;  3L2Q A;  4PLL A;  2L3R A;  2NLU A;  5C6S A;  3NTK A;  3QBY A;  3P8H A;  4N4H A;  1OI1 A;  5J26 A;  3OYD A;  3L2U A;  3L2R A;  2HQE A;  1SSF A;  2BUD A;  4II1 A;  3E9F A;  1WJQ A;  5IN1 A;  3OYJ A;  4QVZ A;  3E9G A;  2RHU A;  3S3M A;  1KHC A;  2L8D A;  3LYI A;  4E7H A;  2R57 A;  4Z02 A;  4E7I A;  3BDL A;  3NTI A;  4IUT A;  2E5Q A;  3M9Q A;  3OYC A;  2P0K A;  4PL6 A;  3MEW A;  3OB9 A;  4C5G A;  4A4G A;  4ZTF A;  4E7K A;  2M0O A;  5FRO A;  2BIV A;  4IUU A;  2RHX A;  1RI0 A;  3MP1 A;  4IUP A;  2RHY A;  3PNW C;  3FDR A;  3OYL A;  1OYX A;  3MEU A;  3OYE A;  1H3Z A;  4QW2 A;  3MP6 A;  2RJC A;  4QQ6 A;  4N4I A;  2RI5 A;  4UC4 A;  4IUV A;  3FC3 A;  4GY5 A;  2FHD A;  2M16 A;  2X35 A;  3S3O A;  5FRM A;  4QQG A;  3DLM A;  2R5A A;  2D9T A;  3P8D A;  5M9O A;  3OYB A;  3O8V A;  3OYK A;  2RJF A;  2X4Y A;  3L2V A;  2BKD N;  2DIG A;  3QJ6 A;  4X34 A;  3OS0 A;  5FRN A;  4BE0 A;  3EAE A;  2LVM A;  5KCO A;  3OYN A;  2EQJ A;  3OA6 A;  3H8Z A;  3NTH A;  4L59 A;  2QQS A;  1MHN A;  3PMT A;  5C0M A;  3LGL A;  3MO8 A;  3OY9 A;  3LGF A;  1WGS A;  2RJE A;  4IUR A;  3S6W A;  4EDU A;  4IKF A;  3OYI A;  4FL6 A;  4IUQ A;  1WJR A;  2LRQ A;  2LCC A;  2DAQ A;  2EQK A;  2F5K A;  2JZ2 A;  2IG0 A;  3OMC A;  2EQU A;  2RHZ A;  2WAC A;  1OZ2 A;  4A4H A;  5D6W A;  2L89 A;  4Q5W A;  4HCZ A;  4RG2 A;  2DIQ A;  4E7J A;  4QQD A;  4BDY A;  3L42 A;  4BE2 A;  4A4E A;  3OYA A;  2YRV A;  2R5M A;  2VYT A;  2M1H A;  2X4X A;  2O4X A;  5J39 A;  3S3N A;  3ZEH A;  2RO0 A;  3OS2 A;  4PLI A;  5D6X A;  4BDZ A;  4C5E A;  3FEO A;  3OMG A;  2EQM A;  5KCH A;  3OYG A;  4B9W A;  2G3R A;  5KE2 A; 
#chains in the Genus database with same CATH topology
 2CDT A;  1QQJ A;  4KGX B;  3EGD B;  1YWO A;  3VS4 A;  4ZGE B;  2CP5 A;  3G1J A;  4BD3 A;  3F70 A;  4PJN A;  3I56 Q;  4JZ4 A;  4KBM B;  4O6J A;  2CS7 A;  3JCM e;  1YJN T;  1SRL A;  2XDP A;  2KGT A;  2PZ1 A;  5HCK A;  4OMN A;  4HVU A;  1UEB A;  4HCB A;  2RQW A;  2DL7 A;  1YN8 A;  1OX9 A;  1YCY A;  2KQW A;  2QDY B;  1M4Z A;  2X3X D;  3REA B;  3M0S A;  2MMP A;  2MAM A;  1GRI A;  2K79 A;  2KT8 A;  3VS6 A;  1VQM A;  1Q81 R;  1MND A;  1KFZ A;  2O88 A;  4L5G A;  4J9B A;  1M1K R;  2YUO A;  2E1H A;  4JJN K;  2RHY A;  4P5N A;  3A98 A;  4AFQ C;  2M51 A;  4JUV A;  2QYZ A;  5D7U A;  1UHC A;  1RL2 A;  2ESW A;  4FSS A;  3P8D A;  1UGS B;  3EG3 A;  4F04 B;  3O8V A;  2CH4 W;  1D3B B;  1VQN Q;  1QP2 A;  5KCO A;  4J9C A;  2QDL A;  1VQ6 A;  5C0M A;  5GAO r;  1U8R A;  2DXU A;  4JS5 A;  1X43 A;  2FYK A;  4PJO C;  2EQK A;  1AWO A;  1BI2 A;  3BFM A;  1IRX A;  1ZUK A;  4HCZ A;  4RG2 A;  3G7Z A;  3L42 A;  5CKE A;  1K73 C;  2R5M A;  4DOW A;  1O9S A;  2JM8 A;  5KE2 A;  3J7A F;  1Q7Y U;  2QQR A;  4DBF A;  1IHW A;  4D8D A;  1K8A C;  1B34 A;  2R58 A;  2K3Y A;  2K2M A;  2RB6 A;  3CPF A;  4LDU A;  4M78 C;  4ME7 A;  5DLQ E;  3VS7 A;  5KYU B;  3CCL Q;  2P0Q A;  3M53 A;  2GFU A;  4E2F B;  2EJ9 A;  3JAM E;  2IIM A;  3MEV A;  3SHW A;  2KDS A;  1HK9 A;  4RCC A;  1NYF A;  1KQS S;  4LUD A;  2NUT B;  4FCY A;  3OYM A;  2EBP A;  3CCM Q;  2LTO A;  2HAX A;  3LLR A;  1LVK A;  2MWO A;  2YUQ A;  3PMI A;  1BIA A;  1HYO A;  2LCL A;  2P4R A;  4F7U B;  3L2Q A;  1G3T A;  3PE0 A;  3MHX A;  1U5S A;  3CC7 A;  5LJ3 f;  4CC7 A;  1LNX A;  2I2L A;  3G6E T;  5DLO A;  2W10 A;  5KYW A;  3CCU A;  4AG1 C;  2GBQ A;  3VYG A;  1BIB A;  4PL6 A;  5LL6 S;  4F17 A;  2RK1 A;  2DRK A;  3GLX A;  2AIR B;  1K4U S;  3OS5 A;  1RI0 A;  1UJ0 A;  1ZQ1 A;  2KBT A;  3V7S A;  4C92 E;  1I0C A;  2R5A A;  2D9T A;  4R56 A;  1HSQ A;  3HSB A;  3ZFJ A;  2DIG A;  1RI9 A;  3V8K A;  1YHQ A;  3V7C A;  3H0H A;  4DQ2 A;  3NTH A;  3EGD A;  1VQ9 Q;  1YIJ Q;  3JV3 A;  4KUD K;  3CCJ A;  3CBO A;  1VQ5 Q;  1YI2 A;  1S72 A;  3TRE A;  4FL6 A;  2EIF A;  1WHG A;  1TS9 A;  4EMG A;  2XIC A;  1X75 C;  2V1R A;  3QZ5 B;  3MCA B;  2A08 A;  5GAN 4;  3CCV T;  1OPL A;  4JJC A;  1D1B A;  3ZEH A;  2VGN A;  5D6X A;  1YIT Q;  1PNJ A;  3FEO A;  1FWZ A;  4E7S A;  3CD6 A;  2JUF A;  3UA6 A;  1QCN A;  2HEQ A;  3QHS A;  4FU6 A;  4N0A C;  3JRZ A;  2OX7 A;  2RHI A;  2DFU A;  5GAM d;  3SEM A;  4C5I A;  3CEY A;  2DL5 A;  5HK0 A;  2DBK A;  2HBW A;  2KR3 A;  3QJY A;  5AYF A;  3JB9 I;  1Q82 U;  1WA7 A;  2RI3 A;  5IHK A;  4C92 D;  1JJ2 S;  2ZPG B;  2MWP A;  4CC4 B;  1GFD A;  4HVW A;  4M75 B;  1WLP B;  1AOJ A;  4DOV A;  2F5T X;  3KUF A;  1M90 U;  2V8I A;  1IGQ A;  1M27 C;  1OX8 A;  2H8H A;  5C6S A;  2V8K A;  3A8M B;  3P8H A;  2PUO B;  4N4H A;  1T0J A;  1NLP C;  4KT0 E;  2LCS A;  1KQ2 A;  1ZSZ B;  1VQP T;  4QVZ A;  3I9Q A;  4Y92 A;  2YRC A;  4RCB A;  2QK0 A;  4C0D C;  4J9E A;  5L8R E;  2LQK A;  3SWN C;  3OYL A;  2DJQ A;  3CCE Q;  2RJC A;  4BB7 A;  1TUG B;  1YBY A;  1KD1 U;  3LW5 E;  1M2O A;  1YWP A;  1YFN A;  2K7A A;  3OS0 A;  3CCS T;  2DO3 A;  5GMK h;  2I0N A;  4C92 G;  4L59 A;  1UE9 A;  5KYU A;  4FIB A;  2QTX A;  3LGF A;  3E1S A;  2E41 A;  3NPF A;  4HA8 A;  1G83 A;  1RAI B;  1T0H A;  3EFO B;  4EMK A;  1GCP A;  2A37 A;  1OZ2 A;  2WAC A;  2L0A A;  2NUT A;  2KRS A;  4A4E A;  2YRV A;  3EHQ A;  3I56 T;  5GAM e;  4C8Q E;  1GXI E;  2K5F A;  5I22 A;  1VQ8 Q;  2DRM A;  4OVA A;  1Y07 A;  3OS1 A;  4J6Y A;  2NWM A;  1R77 A;  5CKH A;  3GP8 A;  2CRE A;  3AT1 B;  1SF9 A;  1RAA B;  1ABQ A;  3GOX A;  3ZL7 C;  3QII A;  1FYN A;  1WHJ A;  2K4Y A;  2O2O A;  3DLL A;  1UTI A;  3LX7 A;  1WYX A;  5CQX A;  6AT1 B;  5GAN j;  3FLG A;  2FEI A;  1VUB A;  2JJ9 A;  1LCK A;  1CKA A;  1I4K 1;  3VU3 C;  4EPC A;  1BI0 A;  2K3B A;  1X2Q A;  1Q7Y R;  2DNU A;  4ATO A;  2D8H A;  3CCR Q;  2QA4 Q;  3M0T A;  1MMG A;  3CC4 Q;  2J6F A;  3U23 A;  4QVC A;  2E5Q A;  1VIF A;  2A3L A;  1OOT A;  2DE0 X;  4M7A E;  4E7K A;  1VQO A;  2A0F B;  1Q86 C;  4FT2 A;  2DXT A;  3C0C A;  1KC8 C;  2AHJ B;  2FZC B;  1KQS A;  4WF2 A;  2CZ6 B;  4RMO A;  3S3O A;  4QQG A;  1QVG S;  2PVO B;  2GCX A;  2EQI A;  1MHN A;  2MCN A;  2JM9 A;  4X1V A;  1NYG A;  3CC2 T;  2KRO A;  3LGL A;  4A53 A;  4EDU A;  1K9M C;  4F7U E;  1AZG B;  3PTA A;  2DZ9 A;  2YXY A;  3KXT A;  3JB9 H;  2G6F X;  3CCL T;  4XU3 A;  1N8R U;  1HD3 A;  1QP3 A;  4QQD A;  1WXU A;  4XU1 A;  2E64 A;  3G6E Q;  2E12 A;  2YSQ A;  4J7F A;  1WZO A;  3OYA A;  2DIL A;  4AT1 B;  2ABL A;  2X4X A;  3CBM A;  4PLI A;  2KXC A;  2CSQ A;  4EMH A;  2FPD A;  4M75 A;  2DK3 A;  1YI2 T;  5LJ3 g;  2F2V A;  3J81 E;  3OBY A;  3CMA A;  3EGX B;  3D7S B;  4C8Q G;  4ELY C;  1IXD A;  4PJO B;  3MET A;  2D0Q B;  2LQW A;  5GMK i;  2MOX A;  4LD6 A;  3CQT A;  3CCQ A;  2KY9 A;  2HKQ B;  5GAM j;  1VQ7 A;  5LJ5 e;  2LNV A;  1N5Z A;  2HCK A;  4M77 E;  1S1N A;  5FWB A;  4HCC A;  2EFI A;  1ZHI A;  5FU6 C;  3G4S Q;  2YDL A;  3PFS A;  4J6W A;  3HKS A;  2JS2 A;  2PQW A;  1M1G A;  4MML A;  2X9H A;  5GAO q;  4M78 B;  1YJ9 A;  3BE3 A;  5J26 A;  1Y0M A;  1DJ7 B;  1WJQ A;  5GMK m;  3OYJ A;  5CKB A;  2DKG A;  2L8D A;  1FMW A;  3RER A;  3FJP A;  1JXM A;  4BY6 C;  3FIF A;  1UUE A;  1Q82 R;  4ZN3 A;  2M0O A;  1VQ9 T;  1YIJ T;  2XMF A;  1VQ5 T;  2BE7 D;  4CI0 C;  1ZBX A;  4JLG A;  1RLQ C;  4J6X A;  4M7A G;  2VVK A;  4HXJ A;  1JJ2 A;  1Y71 A;  1GCQ C;  3AHU A;  5FRN A;  4FW1 A;  2LVM A;  1NLO C;  1PC0 A;  4M75 E;  2QQS A;  4HCK A;  1LOJ A;  1OU9 A;  2ZPH B;  1ZA1 B;  1RUW A;  1WJR A;  2JS0 A;  2CH4 A;  2HBP A;  3JCM W;  2DAQ A;  2WSE E;  4VUB A;  3OMC A;  3EH1 A;  3PVL A;  2L89 A;  1UHF A;  1U1T A;  1T3L A;  4F7U G;  5FLX E;  1C1A A;  1WQ7 A;  1ZUU A;  4K11 A;  1OQK A;  3MKD A;  2KE9 A;  3V8L A;  2EQM A;  1UGR B;  1KD1 R;  5HY6 A;  2OTL A;  3X20 B;  3TVT A;  4E7L A;  2GFA A;  3LWI A;  4WCI A;  4RTT A;  1ACM B;  2DD5 A;  3VUB A;  1G3Y A;  4JJD A;  3OQ5 A;  3GNG A;  2FL7 A;  2K5I A;  3M58 A;  5GAN 8;  1OU8 A;  4LDV A;  4PFP A;  3QYG B;  2DD4 A;  4M77 G;  4LXC A;  4M75 D;  2LDM A;  2A7Y A;  3MPU B;  4QT7 A;  5LJ5 j;  2YWW A;  3L2U A;  3CCE T;  1N9S A;  4J9D A;  2HQE A;  1XJW B;  1VQ6 Q;  2EAY A;  1W1F A;  4JDS A;  4OMO A;  3RDV A;  2C0O A;  1IZ6 A;  2AZV A;  3M9Q A;  2XID A;  2ZZD A;  5CVI A;  4A4G A;  2BIV A;  2RHX A;  4OGC A;  5LJ3 d;  4M7D C;  2AK5 A;  2E5K A;  4IUP A;  2RH2 A;  1MMD A;  4KRT A;  1OYX A;  2DTO A;  4X9D A;  2CZ1 B;  4QVD A;  1UDL A;  2LT1 A;  1Z9Z A;  1D0Z A;  1PG5 B;  2HZY A;  4PNO A;  3DLM A;  2H3J A;  3URG A;  4C8Q B;  2XI9 A;  1B07 A;  4C0D B;  1VQ8 T;  1NEG A;  1FXX A;  3EGX A;  4AMC A;  1I5O B;  1RAE B;  2RJE A;  4MDW A;  4IKF A;  4MDX A;  4IUQ A;  2LRQ A;  1IB8 A;  5KYX B;  2F5K A;  3P8B B;  3CME A;  3A8H B;  1I5L A;  3SWN B;  4M75 G;  4AG2 C;  2V1Q A;  3JCM X;  3JCM f;  8AT1 B;  3BW1 A;  1CSK A;  2XKO C;  4J9I A;  1JB0 E;  2OI3 A;  3OYG A;  4BUG A;  2ZPI B;  5CKF A;  2M9U A;  3TSW A;  1YJW A;  2YHT A;  1X01 A;  3T9N A;  5KYY B;  4M78 A;  2VGM A;  3G71 A;  2OTJ A;  3CC7 Q;  3A1P A;  4LD9 K;  1TUD A;  4M4Z A;  1PKS A;  3IQL A;  2LQN A;  4C92 A;  2QQB A;  1E7O A;  5GAO p;  3CCU Q;  1SG5 A;  2XHC A;  2E6N A;  1QVG A;  3CCR T;  2QA4 T;  1ABO A;  2FPF A;  3CC4 T;  1N8R R;  1OPK A;  2K3X A;  3EH2 A;  2W0Z A;  3BDU A;  3RBB B;  4OMM A;  3CC2 Q;  2HQH A;  2YLC A;  4M75 F;  3SDZ A;  2ROL A;  5GMK l;  4M7A B;  2H3E B;  1MUZ A;  5CIU A;  2NUP A;  1TWB A;  1OV3 A;  1KK7 A;  1WHH A;  2PNI A;  3A8G B;  4IIM A;  2CUB A;  1K0X A;  1W2B S;  1RAB B;  3CCJ Q;  1I81 A;  1NJI C;  1IO6 A;  1YI2 Q;  1S72 Q;  1KQS P;  2ZAE A;  2EGC A;  5FRO A;  1PRM C;  2SRC A;  2XU8 A;  2AT1 B;  4PJO E;  2NUZ A;  3HHT B;  2EJG A;  3C12 A;  1O75 A;  1WXB A;  2M16 A;  5FRM A;  3L2Z A;  3CD6 Q;  1N9R A;  5LJ3 h;  1BBZ A;  1H64 1;  3J80 E;  1VQL A;  3EAE A;  3JB9 G;  4DEY A;  3I55 T;  4IIO A;  2IVW A;  2E3I A;  1VQN A;  3EG9 B;  4LN2 A;  2DF6 A;  4M78 E;  2EYX A;  4ZGJ B;  4LE9 A;  5D6W A;  1C0M A;  5GAO n;  4M77 B;  2YLB A;  3X28 B;  2HSE B;  4JLI A;  3OMG A;  4FYX B;  4N0A A;  4CRI A;  3G4S T;  2VUB A;  2Y90 A;  2BZX A;  1E6H A;  1VQ4 T;  1H8K A;  4PJO D;  2RMO A;  3M54 A;  5IH2 A;  4FSX A;  4J9G A;  3X26 B;  4RTV A;  3R6N A;  2LJ0 A;  1EIF A;  4RTX A;  3OYY A;  2WSF E;  3LH0 A;  2RN8 A;  1NM7 A;  3NMZ C;  5GAN 5;  2DTH A;  2VXE A;  1D09 B;  4A63 B;  4M78 D;  1H3H A;  2AKL A;  3UF4 A;  1D0Y A;  3L2R A;  2B86 A;  1QLY A;  1NPR A;  1Q81 C;  4C8Q A;  4OMF B;  5HK3 A;  2GQI A;  1Y57 A;  2X3W D;  1TSF A;  2IPO B;  3I35 A;  1JEG A;  1M1K C;  1JJ2 P;  1F1B B;  4MZM A;  1K73 U;  1VQK A;  1PSF A;  3MP6 A;  3OSV A;  4FYV B;  4JS4 A;  1OUL A;  1X69 A;  1I8F A;  1TTH B;  1D3B A;  4PJO G;  2ED0 A;  3OYK A;  3OW2 A;  3VKI A;  1K8A U;  4XU2 A;  3JCM J;  2CP7 A;  3HPW A;  5KYY A;  5GMK e;  4NL3 A;  2EQJ A;  3EGU A;  2CUD A;  5GAN f;  2A28 A;  3OY9 A;  1WGS A;  4R0K A;  1KSW A;  1BU1 A;  1T3S A;  3R6O A;  4C0G A;  1VQM T;  1RAF B;  2Y4Y A;  4M78 G;  4QKU A;  3VV0 A;  1TU0 B;  2RO0 A;  3OS2 A;  3FRN A;  1PCX A;  1QVF S;  4B9W A;  2EGA A;  1YIT A;  4M7A A;  4LDW A;  1WFW A;  2MK5 A;  1EX4 A;  2QEX A;  2JVV A;  2RI2 A;  3CPW S;  4V2S A;  1PM3 A;  3UWN A;  4C0Z A;  1MMA A;  4OB0 B;  1VQ6 T;  1KG1 A;  3JCM c;  5IXF A;  3C4S A;  1NEB A;  1Y96 B;  2LJ3 A;  2CKK A;  2OTJ T;  2FG0 A;  2FPE A;  2KEA A;  5FU7 C;  4OMQ A;  4F7U A;  2GTJ A;  2O9S A;  2QAS A;  5GAN 3;  3QYH B;  3QPH A;  3NTK A;  4M78 F;  5FWC A;  2DL4 A;  3C95 A;  1XOV A;  5CCA A;  3MJX A;  1M8M A;  4C92 F;  2KRM A;  1KHC A;  2R57 A;  3VS5 A;  3EG9 A;  1ARK A;  1KJW A;  3I5S A;  1X6B A;  2CT3 A;  3QO3 A;  3JCM g;  3VUZ A;  1PWT A;  1JXO A;  1WI7 A;  3FDR A;  2J7I A;  4OML A;  4EMK C;  4DEX A;  4KUI A;  5GAM f;  4M77 A;  2X35 A;  4DBQ A;  2DBM A;  5I2M A;  5M9O A;  1TG0 A;  1V76 A;  2X4Y A;  4XQ3 A;  7AT1 B;  4L6V 5;  5GJW B;  2RM4 A;  2DER A;  2ECZ A;  3CMA Q;  1BCO A;  1YJN A;  4C8Q D;  2PVG B;  2KYM A;  3CCQ Q;  2YT6 A;  2JOY A;  4M7D B;  1VQ7 Q;  2DVE A;  2RF0 A;  2KVQ G;  3CC7 T;  2KAF A;  3JB9 J;  2E4H A;  3EG0 A;  2FVU A;  1UGV A;  2CP3 A;  4BE2 A;  1W2B A;  3VRY A;  5GMK j;  3CCU T;  1SSH A;  3PVQ A;  2ZGW A;  1K9A A;  9ATC B;  2CP6 A;  2G3R A;  3HP9 A;  3QWY A;  2DZC A;  2YRD A;  3O5Z A;  1QVG P;  4BI8 B;  2XDD A;  3QUI A;  5IAY A;  1A0N B;  2GTO A;  2GF7 A;  2QQA A;  5KH6 A;  5CAI A;  2JTF A;  2LNH B;  1GBQ A;  1WHL A;  1NG2 A;  1CKB A;  3H6Z A;  2QGG A;  1YHQ T;  3I55 Q;  4E47 A;  2XDB A;  2C06 A;  1EZZ B;  1PHT A;  3CCJ T;  2ZCF B;  1S72 T;  3WVE B;  4GBQ A;  2EKO A;  2HQX A;  2C0I A;  2X4W A;  1J3T A;  3NHN A;  1M8V A;  1BB9 A;  2L3R A;  2V8J A;  2KYB A;  4LDY A;  4M7A D;  3OYD A;  3CXC S;  4ZGD B;  1ZSZ A;  2HMA A;  4II1 A;  1V1C A;  2ZPB B;  4OF1 A;  3S3M A;  3CD6 T;  3E2U A;  2HNI A;  1FMV A;  2JTM A;  2A36 A;  3WVD B;  1PKT A;  2O31 A;  3OYC A;  2KRN A;  3VS3 A;  2HDA A;  4ZTF A;  3RUX A;  1WHM A;  2NYS A;  4JPB W;  4DA4 A;  1ZLM A;  1VQ4 Q;  1H3Z A;  1NZ9 A;  4ZNX A;  1Z9Q A;  2VAS A;  3FC3 A;  4ELZ C;  2LC4 A;  3OSS C;  1GCQ A;  4X9C A;  2RA2 A;  1BCM A;  2F69 A;  3THK A;  2OTL Q;  2QI2 A;  1TXQ A;  2M0Y A;  5I21 A;  1W4S A;  4C8Q F;  4M75 C;  5GAN 6;  2ENM A;  1MGQ A;  2PTK A;  2C0T A;  4FM4 B;  4RKU E;  4KGZ B;  3RES A;  2L3S A;  3OYI A;  1Y7X A;  2JMA A;  3EFO A;  1V29 B;  3HFO A;  3M0P A;  2CP0 A;  1UGP B;  2ROT A;  5LJ5 f;  2D6F A;  4C0F A;  4BDY A;  2J06 A;  1M90 R;  1K73 R;  2LT4 A;  3QSU A;  2D1X A;  2DM1 A;  1Y96 A;  3G6E A;  1TUC A;  1D0X A;  4B6M A;  1LPL A;  4E7Z A;  2JNG A;  1WNL A;  4M77 D;  1MV0 B;  5D6Y A;  1XTD A;  2RPN A;  3H0I A;  4TVR A;  1PSE A;  2CP2 A;  2EKH A;  1K8A R;  3RKW A;  1EFN A;  1K0S A;  1VIE A;  2J6O A;  1B34 B;  3JCM d;  1QMC A;  3HL8 A;  4JRI A;  2EYW A;  2L2P A;  4J83 A;  2CYZ B;  1W70 A;  1M9S A;  4R55 A;  3QKJ A;  2YUP A;  3PIO A;  2PUK B;  1UJY A;  3UT1 A;  2D8J A;  1Q86 U;  3UPU A;  1KC8 U;  1BYM A;  3HRS A;  2E6Z A;  4GLK A;  5IT9 E;  4NL2 A;  2EYZ A;  3PGG A;  2KT1 A;  3QZ9 B;  1XQH A;  2QEX T;  4PLL A;  1JRI A;  3EHR A;  4NOY A;  1G3W A;  4M7A F;  1VQM Q;  1Q7Y C;  1U3O A;  3M55 A;  3BY7 A;  4ESR A;  1P92 A;  5GAN g;  4ANJ A;  2JW4 A;  2QAZ A;  1SSF A;  3CCV A;  3E9G A;  1QVF A;  1K9M U;  5EC7 A;  4E7H A;  3A5Z B;  2ZPF B;  4Z02 A;  3BDL A;  1UFF A;  1Q95 G;  5KYW B;  4J9H A;  3OW2 S;  3CME Q;  2CT4 A;  2HSP A;  2K2V A;  2QG9 B;  4M7D A;  1U1S A;  1VYT A;  1NBE B;  3MP1 A;  3OW2 P;  2QGF B;  1GFC A;  2JN0 A;  1NE8 A;  3MEU A;  4F7U F;  1SRM A;  2RI5 A;  3CPW A;  5EG2 A;  4Y28 E;  2FHD A;  1YJW Q;  3L2V A;  4X34 A;  4BE0 A;  2OTJ Q;  4RTZ A;  3V8J A;  4BI3 A;  1QKW A;  4JRP A;  3PMT A;  3LWH A;  2X4J A;  1SKU B;  3L1A A;  2IG0 A;  4KH1 B;  3LH5 A;  4XTW A;  5GJV B;  4ORZ A;  1FX7 A;  4GLM A;  1K76 A;  2MI6 A;  1BKB A;  2BZ8 A;  2EPD A;  2JXB A;  4BDZ A;  4M77 F;  1VQP A;  3NGP A;  4XK8 E;  2DEQ A;  2L3Q A;  3GNF B;  1VQO T;  1WQW A;  1G5V A;  2KXD A;  4RUG A;  3RMS A;  4PJO A;  2DMO A;  4NS5 A;  3VYH B;  1M2V B;  4XTY A;  3TSZ A;  3RKY A;  2VV5 A;  1YP5 A;  2FRW A;  8ATC B;  1M30 A;  2HL5 C;  4AFZ C;  3ULR B;  3M0R A;  3EG2 A;  2EW3 A;  3DB3 A;  4MZP A;  2LX7 A;  5L23 A;  1VYU A;  3JCM h;  3JCM V;  1BI3 A;  2O4X B;  2RNA A;  4LDX A;  5GAM g;  3CCS A;  4WTO B;  4M7D E;  3M0U A;  2ZPE B;  4J5Y A;  1G3S A;  2DET A;  1QCO A;  1VQL Q;  1JQQ A;  4HT9 A;  1WXT A;  1AWJ A;  1M3C A;  1QWE A;  2L5Q A;  3E9F A;  3JB9 D;  2DL8 A;  2XD0 A;  1QWF A;  1OEB A;  3I56 A;  3SB2 A;  5A0L A;  5FW9 A;  3CMA T;  5FU7 B;  2X51 A;  1Q82 C;  4A54 A;  1QKX A;  3QXE B;  1AEY A;  4DBH A;  1H92 A;  3JCM b;  3CCQ T;  2J05 A;  2DYB A;  3EG1 A;  2FB7 A;  4PKC C;  1VQ7 T;  2PVD B;  4Z88 A;  4N4I A;  3DKM A;  4OB3 B;  3QDF A;  1M90 C;  3VS2 A;  5LJ3 e;  1YHQ Q;  2RJF A;  3KBG A;  3X25 B;  4Z8A A;  3QWX X;  2COZ A;  2RQR A;  4OGE A;  1W2B P;  3A8O B;  2KNB B;  3HRU A;  4IUR A;  3M4Y A;  3S6W A;  2MIO A;  1YJ9 T;  3JCM P;  2LCC A;  1IHV A;  2JT4 A;  2JZ2 A;  3CXC A;  2BZY A;  2EQU A;  2RHZ A;  4M7D D;  4EMK B;  4E7J A;  5GAO m;  4C92 C;  4RTW A;  3M0Q A;  3PT9 A;  5GAN d;  5CR2 A;  2FO0 A;  4OMP A;  5IHN A;  1KD1 C;  2HD0 A;  1OZ3 A;  1AHJ B;  1X6G A;  2K6D A;  1SEM A;  1WJS A;  3H0F A;  2O9V A;  2B8A A;  4Y91 A;  3TU4 K;  3ER0 A;  2JMC A;  3RMQ A;  5DM7 R;  3KFV A;  5A0G A;  3DB4 A;  1RLP C;  1AWW A;  1JU5 C;  3FB9 A;  1IRE B;  2L3P A;  1M3A A;  4B9X A;  4BI4 A;  3INZ A;  1ZSG A;  4N4G A;  1VQK Q;  2COY A;  4D8K A;  3CC2 A;  1R0B G;  3RNJ A;  1OI1 A;  3CCL A;  4J8O A;  2DLP A;  3JB9 F;  2P84 A;  4M7D G;  3E19 A;  4PJM A;  1WPY A;  1RAH B;  4PFO A;  4E7I A;  2OTL T;  4IUT A;  3NTI A;  5LJ5 g;  2DX1 A;  1M1F A;  4KH0 B;  4XTV A;  3M5A A;  1Q86 R;  3CCM A;  1KC8 R;  2DVJ A;  3OYE A;  2LZ6 B;  4QQ6 A;  4J9F A;  5DY9 A;  3GPL A;  4GY5 A;  2MPX C;  5A2Q E;  3TCJ A;  3UAT A;  5CQY A;  2DA9 A;  2PU9 B;  1NPP A;  2CZ7 B;  5FU6 B;  2DPP B;  1TOV A;  2MYS A;  1M2V A;  1K1Z A;  2KMT A;  1K9M R;  5GAN e;  3FJ5 A;  5KYX A;  2QEX Q;  1G2B A;  3SWN A;  3WXM B;  2DXC A;  4M7D F;  4Z89 A;  4Q5W A;  5LJ3 j;  2DIQ A;  2M02 A;  3H41 A;  2O4X A;  1VYV A;  1WX6 A;  1E6G A;  4HKE A;  4AFS C;  1IGU A;  2DXB A;  4BY6 B;  3OYF A;  2EGE A;  2VC8 A;  4RTU A;  4XTX A;  2OAW A;  4A4K A;  2HKN A;  5GAN h;  4OP0 A;  1VQ9 A;  1YIJ A;  5AT1 B;  1JO8 A;  1VQ5 A;  3C94 A;  1NJI U;  1TH7 A;  1VOM A;  2ATC B;  1KIK A;  1G8X A;  3ASK A;  4C8Q C;  5HKC A;  4RG8 A;  4FYW B;  2OJ2 A;  2GQV A;  4FT4 A;  1N8R C;  3GIB A;  2VKN A;  1BK2 A;  1UG1 A;  1SHG A;  2EWN A;  1UB4 A;  3Q1J A;  3VRZ A;  1MV3 A;  2J6K A;  5IHI A;  3CME T;  2BE9 B;  1C6V X;  3HRT A;  5KE3 A;  1QVF P;  3M4G A;  1KHI A;  2Z0W A;  3ZBD A;  3QBY A;  3CBP A;  4PJO F;  3UDC A;  1D1A A;  2BUD A;  3PIP A;  1YJN Q;  5IXB A;  3LYI A;  4FYY B;  1YJW T;  1VQO Q;  3G71 T;  3TEE A;  1I07 A;  3CPW P;  2RK2 A;  3MEW A;  4KGV B;  1X27 A;  2VXF A;  2KK4 A;  2OAU A;  2KSS A;  1R8O B;  3GBQ A;  1RAG B;  4OB1 B;  3QG1 A;  5CKD A;  2E70 A;  3RIR A;  3JCM Q;  4XU0 A;  4EIK A;  4IUV A;  2LP5 A;  1YNZ A;  2YUN A;  4OB2 B;  2CSI A;  2KI7 A;  3EFR A;  2BKD N;  4CC3 A;  4F16 A;  3OA6 A;  2VB6 A;  1ZUY A;  5GAO l;  4YTL A;  2K9G A;  4M7A C;  3GF5 A;  1HXD A;  4PK4 A;  4PJJ A;  4A4H A;  3HFN A;  1AVZ C;  1R0C B;  3CCE A;  2QQ9 A;  5J39 A;  5GAM h;  1SHF A;  4CC2 A;  1KQ1 A;  2O01 E;  4FW2 A;  3M59 A;  5LJ5 d;  4BE1 A;  2RQT A;  3VS1 A;  1Q81 U;  2GNC A;  2SEM A;  1ZA2 B;  1BI1 A;  4JZ3 A;  2XK0 A;  4RTY A;  1B7T A;  4A4F A;  1VQL T;  5I11 A;  3QDR B;  1M1K U;  1PRL C;  3N5B B;  2MF2 A;  2DJZ A;  3ME9 A;  4KUL A;  2VWF A;  1VQN T;  2RJD A;  1N27 A;  2FZK B;  2EYY A;  3VJP A;  4PFZ A;  2COW A;  1YJ9 Q;  1VQ8 A;  2CGH A;  4XTU A;  1W6X A;  4ZTJ A;  4HT8 A;  3I5R A;  5CO7 A;  4LNP A;  2K5L A;  1U06 A;  2JTE A;  4F14 A;  4M77 C;  4O5V A;  1ZBJ A;  5GAN 7;  1QW1 A;  2P0K A;  2E10 A;  2EVR A;  2LQ8 A;  3PNW C;  4QW2 A;  5I2S A;  3OYB A;  3REB B;  2DL3 A;  2LMJ A;  3CXC P;  2LX9 A;  3NFC A;  2E3H A;  1AT1 B;  4PJL A;  3CCR A;  5CK9 A;  2QA4 A;  3OYN A;  3CC4 A;  1QCF A;  3H8Z A;  3CCM T;  3VS0 A;  2Y4X A;  4JRK A;  4DBR A;  4MZT A;  4AFU C;  2CZ0 B;  3UA7 A;  4JJB A;  2AKK A;  1FMK A;  2EYQ A;  1SPK A;  2M1H A;  3S3N A;  4C5E A;  1HJD A;  5KCH A;  5KYN A;  1ZX6 A;  4E6R A;  2RD1 A;  2QTV A;  1MNE A;  4JRQ A;  1D1C A;  2RQU A;  3MP8 A;  2XG8 D;  1VQK T;  4D6W A;  3MEA A;  5J3B A;  1QVP A;  2FZG B;  1AD5 A;  2P4T A;  2FRY A;  1UEC A;  3RKX A;  3CCV Q;  1B3Q A;  2DYI A;  3M56 A;  2DEU A;  4C92 B;  1PD0 A;  1XNI A;  1ZSZ C;  2F2W A;  5LJ5 h;  4C5H A;  3SD4 A;  4J7I A;  3HTR A;  3V7R A;  3OYH A;  4BAC A;  2D0N A;  2QXF A;  1AWX A;  2ED1 A;  2P0P A;  3I55 A;  2K57 A;  2E65 A;  3L2W A;  1UGQ B;  1GL5 A;  1WHK A;  5ECA A;  3OBW A;  2NLU A;  2F1L A;  2NUP B;  3X24 B;  1M5Q 1;  2BTT A;  1N6A A;  5IN1 A;  3M57 A;  1JBM A;  1LJO A;  2RHU A;  1YIT T;  1NJI R;  1X2K A;  5GAN 2;  4LUE A;  5A0D A;  3OB9 A;  4C5G A;  1MMN A;  2V26 A;  4IUU A;  4XAX B;  3G4S A;  2AZS A;  3TQ7 P;  3RR6 A;  4HVV A;  1RAD B;  4UC4 A;  1VQ4 A;  1VQP Q;  1X6O A;  2WSC E;  2GGR A;  3JSC A;  3QJ6 A;  1RAC B;  1WDX A;  1YCS B;  2RQV A;  2HL3 A;  2F2X A;  3MO8 A;  4XTZ A;  3EFS A;  1VA7 A;  1I1J A;  3SFM A;  4ZN1 A;  4MMK A;  2LJ1 A;  3H9N A;  3A8L B;  2EJF A;  1WIE A;  2DTI A;  1M3B A;  1GBR A;  2VYT A;  1AZE A;  3CCS Q;  3G71 Q;  1PD1 A; 
#chains in the Genus database with same CATH homology
 5LJ3 g;  2HD0 A;  1YIT A;  1OZ3 A;  4M7A A;  4LDW A;  4A53 A;  3J81 E;  3OBY A;  3CMA A;  1AHJ B;  4C8Q G;  4ELY C;  4ZGE B;  4PJO B;  3MET A;  2D0Q B;  5GMK i;  4LD6 A;  3CCQ A;  2KY9 A;  1WJS A;  4BD3 A;  2QEX A;  2JVV A;  3F70 A;  5GAM j;  1VQ7 A;  5LJ5 e;  2B8A A;  2LNV A;  4M77 E;  2RI2 A;  4Y91 A;  3TU4 K;  4KBM B;  3ER0 A;  3CPW S;  4V2S A;  3UWN A;  4O6J A;  3RMQ A;  5DM7 R;  4C0Z A;  2CS7 A;  3DB4 A;  4OB0 B;  5A0G A;  3JCM e;  4HCC A;  3JCM c;  1VQ6 T;  1KG1 A;  1YJN T;  2XDP A;  3C4S A;  1Y96 B;  2CKK A;  2EFI A;  3FB9 A;  2OTJ T;  1IRE B;  1ZHI A;  1UEB A;  5FU6 C;  3PFS A;  4HCB A;  4J6W A;  4B9X A;  3INZ A;  4BI4 A;  3HKS A;  5FU7 C;  2PQW A;  4N4G A;  1M1G A;  4F7U A;  5GAN 3;  4MML A;  5GAO q;  3QYH B;  1YCY A;  2KQW A;  2QDY B;  1M4Z A;  4M78 B;  3CC2 A;  3QPH A;  3NTK A;  4M78 F;  1YJ9 A;  2MMP A;  2MAM A;  5J26 A;  1OI1 A;  3C95 A;  3CCL A;  4J8O A;  3JB9 F;  1XOV A;  1VQM A;  5CCA A;  1DJ7 B;  4M7D G;  1WJQ A;  3E19 A;  5GMK m;  3OYJ A;  5CKB A;  4C92 F;  1WPY A;  2DKG A;  1KHC A;  2L8D A;  3RER A;  2R57 A;  3FJP A;  4E7I A;  2OTL T;  4IUT A;  3NTI A;  4BY6 C;  5LJ5 g;  4L5G A;  3FIF A;  1M1F A;  4ZN3 A;  4XTV A;  3QO3 A;  3JCM g;  3M5A A;  2M0O A;  3VUZ A;  1VQ9 T;  4JJN K;  2E1H A;  3CCM A;  1YIJ T;  2RHY A;  1VQ5 T;  3FDR A;  4CI0 C;  4P5N A;  1ZBX A;  4JLG A;  3OYE A;  4EMK C;  4QQ6 A;  4JUV A;  4J6X A;  4KUI A;  5GAM f;  5DY9 A;  3GPL A;  4M7A G;  4M77 A;  4GY5 A;  1RL2 A;  2X35 A;  5A2Q E;  3TCJ A;  1Y71 A;  3P8D A;  5CQY A;  1UGS B;  1JJ2 A;  5I2M A;  5M9O A;  3AHU A;  3O8V A;  1D3B B;  2PU9 B;  2X4Y A;  4XQ3 A;  4L6V 5;  5FRN A;  1QP2 A;  2RM4 A;  2LVM A;  5KCO A;  1NPP A;  1VQ6 A;  1YJN A;  4M75 E;  2CZ7 B;  5FU6 B;  2QQS A;  2DPP B;  4C8Q D;  5C0M A;  1LOJ A;  2PVG B;  2ZPH B;  5GAO r;  2KMT A;  1U8R A;  5GAN e;  2DXU A;  4JS5 A;  2FYK A;  1WJR A;  2JOY A;  2HBP A;  3SWN A;  3JCM W;  4M7D B;  2DAQ A;  2EQK A;  2DVE A;  2WSE E;  1BI2 A;  2DXC A;  2KVQ G;  4VUB A;  3OMC A;  3WXM B;  3BFM A;  3CC7 T;  2KAF A;  4M7D F;  3JB9 J;  2L89 A;  4Q5W A;  4HCZ A;  4RG2 A;  2DIQ A;  5LJ3 j;  2FVU A;  3G7Z A;  3L42 A;  1U1T A;  4BE2 A;  1W2B A;  5CKE A;  1K73 C;  4F7U G;  2R5M A;  5FLX E;  5GMK j;  2O4X A;  3CCU T;  4DOW A;  1WQ7 A;  2ZGW A;  1O9S A;  3V8L A;  2EQM A;  1UGR B;  4HKE A;  2G3R A;  2DXB A;  5KE2 A;  5HY6 A;  3J7A F;  4BY6 B;  3OYF A;  1Q7Y U;  2QQR A;  2VC8 A;  2OTL A;  3CD6 A;  3HP9 A;  3X20 B;  2DZC A;  4XTX A;  1K8A C;  1B34 A;  2R58 A;  2K3Y A;  2RB6 A;  4M78 C;  3CPF A;  4LDU A;  4ME7 A;  5DLQ E;  4A4K A;  2GFA A;  4BI8 B;  3QUI A;  5GAN h;  2XDD A;  2P0Q A;  3M53 A;  5IAY A;  4OP0 A;  3LWI A;  1VQ9 A;  2GFU A;  1YIJ A;  1VQ5 A;  3C94 A;  2DD5 A;  2EJ9 A;  2GF7 A;  1TH7 A;  2QQA A;  3VUB A;  1G3Y A;  2JTF A;  3MEV A;  5CAI A;  5KH6 A;  1NJI U;  2KDS A;  1HK9 A;  4RCC A;  3OQ5 A;  1KQS S;  1QVF S;  3ASK A;  4C8Q C;  5HKC A;  3H6Z A;  4RG8 A;  1YHQ T;  3GNG A;  2FL7 A;  2GQV A;  4FT4 A;  4E47 A;  2K5I A;  1N8R C;  2XDB A;  3GIB A;  3M58 A;  2EWN A;  3OYM A;  2C06 A;  5GAN 8;  1UB4 A;  3Q1J A;  3CCJ T;  2LTO A;  2ZCF B;  4LDV A;  1S72 T;  3QYG B;  2DD4 A;  3LLR A;  3WVE B;  2HAX A;  2EKO A;  4M77 G;  2HQX A;  2X4W A;  3CME T;  2MWO A;  3PMI A;  1BIA A;  2LCL A;  3HRT A;  1M8V A;  4M75 D;  4F7U B;  2LDM A;  5KE3 A;  3M4G A;  3L2Q A;  2L3R A;  1KHI A;  2V8J A;  4LDY A;  1G3T A;  2A7Y A;  3ZBD A;  3QBY A;  3CBP A;  5LJ5 j;  4M7A D;  3MHX A;  4PJO F;  3OYD A;  3CXC S;  3UDC A;  4ZGD B;  3CC7 A;  3L2U A;  3CCE T;  5LJ3 f;  1N9S A;  1LNX A;  2HQE A;  2I2L A;  3G6E T;  2BUD A;  4II1 A;  2ZPB B;  3PIP A;  4OF1 A;  2EAY A;  5DLO A;  4JDS A;  3S3M A;  3CD6 T;  3LYI A;  2HNI A;  2JTM A;  1YJW T;  3CCU A;  1IZ6 A;  3G71 T;  3TEE A;  3WVD B;  3VYG A;  3M9Q A;  1BIB A;  2XID A;  4PL6 A;  3OYC A;  2ZZD A;  2RK2 A;  3MEW A;  2RK1 A;  5CVI A;  5LL6 S;  3GLX A;  4A4G A;  4ZTF A;  2VXF A;  2KK4 A;  2OAU A;  3RUX A;  2BIV A;  2RHX A;  2KSS A;  1RI0 A;  3OS5 A;  4OGC A;  5LJ3 d;  4M7D C;  1ZQ1 A;  1R8O B;  2RH2 A;  4IUP A;  4DA4 A;  1OYX A;  2DTO A;  4X9D A;  2CZ1 B;  3V7S A;  4OB1 B;  3QG1 A;  4PJO C;  1H3Z A;  5CKD A;  2E70 A;  3RIR A;  1NZ9 A;  4QVD A;  3JCM Q;  4XU0 A;  2LT1 A;  4C92 E;  4IUV A;  2LC4 A;  4ELZ C;  3FC3 A;  3OSS C;  3OY9 A;  4PNO A;  4X9C A;  3DLM A;  2R5A A;  2D9T A;  2RA2 A;  4OB2 B;  2F69 A;  4R56 A;  2H3J A;  3HSB A;  3ZFJ A;  2QI2 A;  3EFR A;  2BKD N;  2DIG A;  3URG A;  4C8Q B;  3V8K A;  5I21 A;  1W4S A;  2XI9 A;  4C8Q F;  4M75 C;  1YHQ A;  3V7C A;  4DQ2 A;  5GAN 6;  3OA6 A;  3NTH A;  1MGQ A;  4C0D B;  1VQ8 T;  1FXX A;  4YTL A;  4FM4 B;  5GAO l;  4RKU E;  4M7A C;  4KUD K;  3GF5 A;  2RJE A;  3CBO A;  1HXD A;  3CCJ A;  1YI2 A;  4MDW A;  3RES A;  3TRE A;  3OYI A;  4FL6 A;  4IUQ A;  1Y7X A;  2EIF A;  2LRQ A;  4IKF A;  4MDX A;  3CME A;  2F5K A;  1V29 B;  3HFO A;  3P8B B;  4EMG A;  3A8H B;  1I5L A;  3SWN B;  2XIC A;  1X75 C;  4A4H A;  1UGP B;  3MCA B;  3QZ5 B;  5LJ5 f;  3HFN A;  2D6F A;  4M75 G;  4C0F A;  3JCM X;  5GAN 4;  4BDY A;  3CCV T;  3JCM f;  3CCE A;  2LT4 A;  2QQ9 A;  3QSU A;  1Y96 A;  5J39 A;  3BW1 A;  5GAM h;  3G6E A;  3ZEH A;  2VGN A;  5D6X A;  2XKO C;  3FEO A;  1FWZ A;  2JNG A;  1JB0 E;  1KQ1 A;  2O01 E;  1WNL A;  2JUF A;  2ZPI B;  4M77 D;  3QHS A;  2M9U A;  5CKF A;  5D6Y A;  4FU6 A;  1YJW A;  1XTD A;  1X01 A;  2YHT A;  4N0A C;  4TVR A;  3T9N A;  1PSE A;  3M59 A;  4M78 A;  2VGM A;  3JRZ A;  5LJ5 d;  3G71 A;  4BE1 A;  2OTJ A;  3RKW A;  2RHI A;  1VIE A;  4LD9 K;  1B34 B;  5GAM d;  1Q81 U;  3JCM d;  4JRI A;  3HL8 A;  4C5I A;  3CEY A;  4J83 A;  5HK0 A;  2CYZ B;  1BI1 A;  2XK0 A;  1M9S A;  4C92 A;  2QQB A;  3QKJ A;  3QJY A;  4R55 A;  3PIO A;  2PUK B;  5GAO p;  4A4F A;  5AYF A;  3JAM E;  1VQL T;  3JB9 I;  2XHC A;  2E6N A;  3UT1 A;  1Q82 U;  3QDR B;  1QVG A;  1M1K U;  3CCR T;  2QA4 T;  2RI3 A;  1Q86 U;  4C92 D;  3CC4 T;  3UPU A;  3N5B B;  2MF2 A;  2DJZ A;  2ZPG B;  3ME9 A;  4KUL A;  1KC8 U;  1JJ2 S;  1BYM A;  2MWP A;  2K3X A;  3HRS A;  1VQN T;  2E6Z A;  4GLK A;  2RJD A;  5IT9 E;  1N27 A;  4NL2 A;  3BDU A;  4M75 B;  3PGG A;  4DOV A;  2YLC A;  3VJP A;  2F5T X;  3KUF A;  4M75 F;  3SDZ A;  2CGH A;  2V8I A;  4XTU A;  1M90 U;  1VQ8 A;  5GMK l;  3QZ9 B;  4M7A B;  1XQH A;  4ZTJ A;  5CIU A;  2QEX T;  4PLL A;  1JRI A;  4NOY A;  4HT8 A;  1G3W A;  5C6S A;  4M7A F;  2V8K A;  3A8M B;  3P8H A;  2PUO B;  4N4H A;  2K5L A;  5CO7 A;  1Q7Y C;  1KD1 C;  3M55 A;  3BY7 A;  1P92 A;  5GAN g;  4KT0 E;  1SSF A;  1KQ2 A;  4M77 C;  3A8G B;  1VQP T;  1W2B S;  3CCV A;  4O5V A;  3E9G A;  4QVZ A;  1QVF A;  1K9M U;  4E7H A;  3A5Z B;  2ZPF B;  1I81 A;  3BDL A;  4RCB A;  4Z02 A;  1NJI C;  5GAN 7;  4C0D C;  3OW2 S;  1QW1 A;  2P0K A;  2K2V A;  2E10 A;  4M7D A;  1U1S A;  5FRO A;  5L8R E;  2XU8 A;  2LQ8 A;  1S72 A;  3MP1 A;  4PJO E;  3PNW C;  2LQK A;  2JN0 A;  3SWN C;  3OYL A;  1NE8 A;  3MEU A;  4F7U F;  3HHT B;  2EJG A;  4QW2 A;  2RJC A;  4BB7 A;  2RI5 A;  3C12 A;  5I2S A;  1YBY A;  3CPW A;  1O75 A;  5EG2 A;  4Y28 E;  1KD1 U;  2FHD A;  2M16 A;  3LW5 E;  5FRM A;  3L2Z A;  1N9R A;  3OYB A;  5LJ3 h;  1H64 1;  3J80 E;  3L2V A;  4X34 A;  1VQL A;  2LX9 A;  3NFC A;  3OS0 A;  4BE0 A;  3EAE A;  3JB9 G;  3I55 T;  3CCR A;  2QA4 A;  5CK9 A;  2IVW A;  3OYN A;  3CCS T;  2DO3 A;  5GMK h;  3V8J A;  4BI3 A;  3CC4 A;  3H8Z A;  4JRP A;  4C92 G;  4L59 A;  3CCM T;  1VQN A;  3PMT A;  4FIB A;  2QTX A;  3LGF A;  2Y4X A;  3E1S A;  2X4J A;  3LWH A;  3L1A A;  4M78 E;  2E41 A;  4JRK A;  4MZT A;  4HA8 A;  2CZ0 B;  2IG0 A;  4EMK A;  4ZGJ B;  2WAC A;  1OZ2 A;  5D6W A;  4XTW A;  1FX7 A;  4A4E A;  2EYQ A;  2MI6 A;  1BKB A;  2YRV A;  5GAO n;  2M1H A;  5GAM e;  3I56 T;  4M77 B;  4C8Q E;  3S3N A;  2YLB A;  3X28 B;  1GXI E;  2K5F A;  4M77 F;  4BDZ A;  1VQP A;  4C5E A;  4JLI A;  3OMG A;  4XK8 E;  5KCH A;  4N0A A;  2DEQ A;  3GNF B;  4OVA A;  1Y07 A;  1VQO T;  1WQW A;  4CRI A;  2RD1 A;  3G4S T;  2VUB A;  3OS1 A;  4J6Y A;  1G5V A;  2Y90 A;  4JRQ A;  3MP8 A;  2XG8 D;  5CKH A;  3RMS A;  4PJO A;  3GP8 A;  4NS5 A;  1VQK T;  4D6W A;  3MEA A;  5J3B A;  3VYH B;  1QVP A;  4XTY A;  3OYG A;  3RKY A;  2P4T A;  3GOX A;  1VQ4 T;  2VV5 A;  3RKX A;  4PJO D;  3QII A;  3M56 A;  3M54 A;  4C92 B;  1XNI A;  4FSX A;  3X26 B;  5LJ5 h;  4C5H A;  3SD4 A;  4J7I A;  2K4Y A;  3DB3 A;  4MZP A;  3V7R A;  3OYH A;  4BAC A;  3JCM h;  3JCM V;  3DLL A;  1BI3 A;  1EIF A;  3LX7 A;  2O4X B;  3OYY A;  2QXF A;  2WSF E;  2P0P A;  5CQX A;  3I55 A;  2K57 A;  5GAN j;  4LDX A;  5GAM g;  2E65 A;  3FLG A;  3LH0 A;  3L2W A;  3CCS A;  1UGQ B;  5GAN 5;  4M7D E;  1VUB A;  2DTH A;  2ZPE B;  2VXE A;  1I4K 1;  3OBW A;  3VU3 C;  2NLU A;  4EPC A;  4J5Y A;  1BI0 A;  1G3S A;  4M78 D;  3X24 B;  4ATO A;  1M5Q 1;  3L2R A;  4HT9 A;  1N6A A;  1NPR A;  3E9F A;  2L5Q A;  3M57 A;  1JBM A;  5IN1 A;  4C8Q A;  3JB9 D;  1Q81 C;  1LJO A;  2RHU A;  2XD0 A;  4OMF B;  3I56 A;  1YIT T;  4E7L A;  4QVC A;  5HK3 A;  2E5Q A;  3SB2 A;  5A0L A;  5GAN 2;  1VIF A;  3CMA T;  5A0D A;  3OB9 A;  2A3L A;  5FU7 B;  4C5G A;  1Q82 C;  4M7A E;  1M1K C;  4A54 A;  3QXE B;  4E7K A;  1VQO A;  4IUU A;  4XAX B;  1Q86 C;  3G4S A;  4FT2 A;  4MZM A;  2DXT A;  3JCM b;  1KC8 C;  1K73 U;  3CCQ T;  2AHJ B;  2FB7 A;  4PKC C;  1VQ7 T;  1VQK A;  2PVD B;  1PSF A;  3MP6 A;  3OSV A;  1KQS A;  4N4I A;  3DKM A;  4OB3 B;  4BUG A;  4JS4 A;  4UC4 A;  4WF2 A;  1M90 C;  1VQ4 A;  2CZ6 B;  1I8F A;  4RMO A;  3S3O A;  4QQG A;  1D3B A;  5LJ3 e;  1X6O A;  4PJO G;  2WSC E;  3JSC A;  3OYK A;  2RJF A;  3OW2 A;  3VKI A;  3KBG A;  3QJ6 A;  3X25 B;  1K8A U;  4XU2 A;  3JCM J;  1QVG S;  2PVO B;  3HPW A;  2GCX A;  5GMK e;  4NL3 A;  2EQJ A;  4OGE A;  5GAN f;  1MHN A;  3CC2 T;  3LGL A;  3A8O B;  3HRU A;  3MO8 A;  1WGS A;  4XTZ A;  4IUR A;  3M4Y A;  3EFS A;  3S6W A;  4EDU A;  4F7U E;  1YJ9 T;  1K9M C;  3JCM P;  2LCC A;  2JZ2 A;  3SFM A;  3CXC A;  4ZN1 A;  3PTA A;  2DZ9 A;  3KXT A;  3JB9 H;  2EQU A;  2RHZ A;  4MMK A;  3CCL T;  4XU3 A;  1N8R U;  3R6O A;  4C0G A;  1QP3 A;  3A8L B;  4EMK B;  1VQM T;  4M7D D;  4E7J A;  2EJF A;  4QQD A;  2Y4Y A;  4XU1 A;  2E64 A;  4C92 C;  5GAO m;  2E12 A;  4J7F A;  2DTI A;  3OYA A;  4M78 G;  3VV0 A;  2VYT A;  3PT9 A;  2X4X A;  5GAN d;  3CBM A;  5CR2 A;  2RO0 A;  3OS2 A;  3FRN A;  4PLI A;  4EMH A;  4M75 A;  2DK3 A;  4B9W A;  1YI2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...