4Z05A

C. bescii family 3 pectate lyase mutant e84a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
196
structure length
196
Chain Sequence
VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGADALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 82
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z05A00
1NHCA 2IQ7A 4XOPA 1IB4A 4XKVA 3KRGA 1OOCA 2NTPA 1RMGA 2PYHA 2VBMA 2NTBA 1CZFA 4HWVA 1K5CA 2O0VA 4W8QA 1RWRA 1OGOX 2O17A 1GQ8A 2INUA 2NSPA 1O8IA 1OFLA 3GQ8A 2NTQA 1AIRA 1O8JA 2X3HA 3ZPPA 2O1DA 2ODLA 2BSPA 4YZXA 3VSVA 2UVFA 1DBOA 3GQ7A 4XQFA 4YZ0A 4XOTA 5AMVA 1XG2A 2PECA 4W8SA 2O0WA 2QY1A 4URRA 3T9GA 1DBGA 4PMHA 2X6XA 4YZAA 4I84A 1O8HA 1O8LA 4XKWA 3VMVA 4OJOA 1OGMX 3VSTA 3SUCA 4OJ6A 1OFMA 2NSTA 4XM3A 3UW0A 4YEJA 4AVZA 1HG8A 1QCXA 4YZQA 1O8GA 3GRHA 3ZSCA 1JRGA 4EW9A 4U4BA 1IA5A 4MXNA 1KTWA 1RU4A 1X0CA 2VBKA 4XLHA 3JURA 2NT6A 3VMWA 1O88A 1O8EA 2UVEA 1BHEA 3WWGA 4NK6A 3FY3A 4NK8A 4OJPA 3B4NA 2NZMA 4XLCA 3EQNA 2QXZA 4XMYA 4OZZA 2VBEA 2VJIA 2X6YA 3B8YA 4C2LA 1KCDA 4OJ5A 3GQAA 4XLAA 4XR6A 4XN3A 3VSUA 1BN8A 1O8KA 3EQOA 1QJVA 4MR0A 4YELA 1O8FA 2NT9A 5C1EA 1EE6A 4W8RA 4XLFA 2PYGA 2X85A 1O8DA 1PE9A 1PLUA 2X6WA 3LMWA 4W8TA 4Z05A 2VJJA 1WMRA 4Z03A 1VBLA 1PXZA 4XONA 5C1CA 4U49A 4XN0A 4XORA 4OJLA 2QX3A 2O04A 4XNFA 4XLEA 1KCCA 1H80A 1IDJA 1JTAA 3B90A 2EWEA 2INVA 4OZYA 4XL9A 2Z8GA 3GQ9A 4Z06A 1O8MA 1IDKA
chains in the Genus database with same CATH superfamily
2VFPA 2W7ZA 1NHCA 3PSZA 2IQ7A 2VFMA 4XOPA 4Z06A 1IB4A 4XKVA 4JRAC 2BM4A 3KRGA 4V02C 1OOCA 3SYJA 2NTPA 2XC1A 1RMGA 1TSPA 1QA2A 2PYHA 1WXRA 2VBMA 4YC5A 2NTBA 1CZFA 4HWVA 1K5CA 2O0VA 3NAWA 3TH0A 4OPWA 2J8KA 4W8QA 1RWRA 2VFQA 1OGOX 2O17A 1GQ8A 2INUA 2NSPA 1O8IA 1OFLA 3GQ8A 2NTQA 3JX8A 3LYCA 1LM1A 1AIRA 1O8JA 2VFOA 2X3HA 2XT2A 3ZPPA 2O1DA 2ODLA 2BM5A 1K4ZA 2BSPA 4YZXA 3VSVA 2UVFA 1DBOA 3GQ7A 4XQFA 4YZ0A 2G0YA 4XOTA 1OFDA 5AMVA 4YEIA 3DU1X 1XG2A 2PECA 4W8SA 1HF2A 2BM6A 2O0WA 2QY1A 4URRA 2BX6A 3T9GA 1DBGA 4PMHA 2IOUG 2X6XA 4YZAA 4I84A 1O8HA 4OM9A 3SQVA 2YUHA 1O8LA 3BH6B 4XKWA 4OJOA 1OGMX 3PSSA 3SUCA 3VMVA 3VSTA 2XT4A 1OFMA 2NSTA 4OJ6A 4XM3A 2VFNA 3UW0A 4YEJA 4AVZA 1HG8A 5JMCB 1QCXA 4YZQA 1O8GA 3GRHA 3ZSCA 1JRGA 1OFEA 4U4BA 3N6ZA 4EW9A 2F3LA 1IA5A 3AK5A 4MXNA 3RIQA 1KTWA 1RU4A 1X0CA 2VBKA 4XLHA 1LLZA 4YFOA 3JURA 2NT6A 3VMWA 1O88A 1O8EA 2UVEA 1BHEA 1QA3A 4YDTA 3WWGA 4NK6A 3SZEA 2B0RA 3N90A 3FY3A 4NK8A 4OJPA 3B4NA 1QRBA 2NZMA 4XLCA 3EQNA 4YCQA 2QXZA 1QRCA 4XMYA 4OZZA 2VBEA 2VJIA 2X6YA 3B8YA 4C2LA 1KCDA 1L1IA 4OJ5A 3GQAA 4XLAA 4XR6A 4XN3A 3VSUA 1BN8A 1O8KA 1DABA 3ML3A 1LLWA 1KQ5A 2BM7A 3EQOA 1CLWA 1QJVA 3PETA 4MR0A 4YELA 1O8FA 2NT9A 2V5IA 5C1EA 5JLVC 1EE6A 2O6WA 4W8RA 1EZGA 4XLFA 1QA1A 2PYGA 2X85A 1EA0A 1O8DA 1PE9A 1PLUA 2X6WA 3LMWA 4W8TA 3H09A 3LJYA 4Z05A 2VJJA 1WMRA 2J8IA 4Z03A 1TYXA 2QZAA 3SY2A 1VBLA 1PXZA 2XTWA 3BH7B 4XONA 3NB2A 5C1CA 4U49A 4XN0A 4KH3A 4XORA 1K8FA 2XTYA 2QX3A 4OJLA 2O04A 4XNFA 4XLEA 1KCCA 1H80A 1IDJA 1TYWA 3P4GA 1JTAA 3B90A 1TYVA 2INVA 2EWEA 4OZYA 4XL9A 1TYUA 2Z8GA 2XTXA 1QQ1A 1O8MA 2QYUA 3GQ9A 1IDKA 5DNSA
chains in the Genus database with same CATH topology
1NHCA 2IQ7A 4XOPA 1IB4A 4XKVA 3KRGA 1OOCA 2NTPA 1RMGA 2PYHA 2VBMA 2NTBA 1CZFA 4HWVA 1K5CA 2O0VA 4W8QA 1RWRA 1OGOX 2O17A 1GQ8A 2INUA 2NSPA 1O8IA 1OFLA 3GQ8A 2NTQA 1AIRA 1O8JA 2X3HA 3ZPPA 2O1DA 2ODLA 2BSPA 4YZXA 3VSVA 2UVFA 1DBOA 3GQ7A 4XQFA 4YZ0A 4XOTA 5AMVA 1XG2A 2PECA 4W8SA 2O0WA 2QY1A 4URRA 3T9GA 1DBGA 4PMHA 2X6XA 4YZAA 4I84A 1O8HA 1O8LA 4XKWA 3VMVA 4OJOA 1OGMX 3VSTA 3SUCA 4OJ6A 1OFMA 2NSTA 4XM3A 3UW0A 4YEJA 4AVZA 1HG8A 1QCXA 4YZQA 1O8GA 3GRHA 3ZSCA 1JRGA 4EW9A 4U4BA 1IA5A 4MXNA 1KTWA 1RU4A 1X0CA 2VBKA 4XLHA 3JURA 2NT6A 3VMWA 1O88A 1O8EA 2UVEA 1BHEA 3WWGA 4NK6A 3FY3A 4NK8A 4OJPA 3B4NA 2NZMA 4XLCA 3EQNA 2QXZA 4XMYA 4OZZA 2VBEA 2VJIA 2X6YA 3B8YA 4C2LA 1KCDA 4OJ5A 3GQAA 4XLAA 4XR6A 4XN3A 3VSUA 1BN8A 1O8KA 3EQOA 1QJVA 4MR0A 4YELA 1O8FA 2NT9A 5C1EA 1EE6A 4W8RA 4XLFA 2PYGA 2X85A 1O8DA 1PE9A 1PLUA 2X6WA 3LMWA 4W8TA 4Z05A 2VJJA 1WMRA 4Z03A 1VBLA 1PXZA 4XONA 5C1CA 4U49A 4XN0A 4XORA 4OJLA 2QX3A 2O04A 4XNFA 4XLEA 1KCCA 1H80A 1IDJA 1JTAA 3B90A 2EWEA 2INVA 4OZYA 4XL9A 2Z8GA 3GQ9A 4Z06A 1O8MA 1IDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHC A;  2IQ7 A;  4XOP A;  1IB4 A;  4XKV A;  3KRG A;  1OOC A;  2NTP A;  1RMG A;  2PYH A;  2VBM A;  2NTB A;  1CZF A;  4HWV A;  1K5C A;  2O0V A;  4W8Q A;  1RWR A;  1OGO X;  2O17 A;  1GQ8 A;  2INU A;  2NSP A;  1O8I A;  1OFL A;  3GQ8 A;  2NTQ A;  1AIR A;  1O8J A;  2X3H A;  3ZPP A;  2O1D A;  2ODL A;  2BSP A;  4YZX A;  3VSV A;  2UVF A;  1DBO A;  3GQ7 A;  4XQF A;  4YZ0 A;  4XOT A;  5AMV A;  1XG2 A;  2PEC A;  4W8S A;  2O0W A;  2QY1 A;  4URR A;  3T9G A;  1DBG A;  4PMH A;  2X6X A;  4YZA A;  4I84 A;  1O8H A;  1O8L A;  4XKW A;  3VMV A;  4OJO A;  1OGM X;  3VST A;  3SUC A;  4OJ6 A;  1OFM A;  2NST A;  4XM3 A;  3UW0 A;  4YEJ A;  4AVZ A;  1HG8 A;  1QCX A;  4YZQ A;  1O8G A;  3GRH A;  3ZSC A;  1JRG A;  4EW9 A;  4U4B A;  1IA5 A;  4MXN A;  1KTW A;  1RU4 A;  1X0C A;  2VBK A;  4XLH A;  3JUR A;  2NT6 A;  3VMW A;  1O88 A;  1O8E A;  2UVE A;  1BHE A;  3WWG A;  4NK6 A;  3FY3 A;  4NK8 A;  4OJP A;  3B4N A;  2NZM A;  4XLC A;  3EQN A;  2QXZ A;  4XMY A;  4OZZ A;  2VBE A;  2VJI A;  2X6Y A;  3B8Y A;  4C2L A;  1KCD A;  4OJ5 A;  3GQA A;  4XLA A;  4XR6 A;  4XN3 A;  3VSU A;  1BN8 A;  1O8K A;  3EQO A;  1QJV A;  4MR0 A;  4YEL A;  1O8F A;  2NT9 A;  5C1E A;  1EE6 A;  4W8R A;  4XLF A;  2PYG A;  2X85 A;  1O8D A;  1PE9 A;  1PLU A;  2X6W A;  3LMW A;  4W8T A;  4Z05 A;  2VJJ A;  1WMR A;  4Z03 A;  1VBL A;  1PXZ A;  4XON A;  5C1C A;  4U49 A;  4XN0 A;  4XOR A;  4OJL A;  2QX3 A;  2O04 A;  4XNF A;  4XLE A;  1KCC A;  1H80 A;  1IDJ A;  1JTA A;  3B90 A;  2EWE A;  2INV A;  4OZY A;  4XL9 A;  2Z8G A;  3GQ9 A;  4Z06 A;  1O8M A;  1IDK A; 
#chains in the Genus database with same CATH topology
 2VFP A;  2W7Z A;  1NHC A;  3PSZ A;  2IQ7 A;  2VFM A;  4XOP A;  4Z06 A;  1IB4 A;  4XKV A;  4JRA C;  2BM4 A;  3KRG A;  4V02 C;  1OOC A;  3SYJ A;  2NTP A;  2XC1 A;  1RMG A;  1TSP A;  1QA2 A;  2PYH A;  1WXR A;  2VBM A;  4YC5 A;  2NTB A;  1CZF A;  4HWV A;  1K5C A;  2O0V A;  3NAW A;  3TH0 A;  4OPW A;  2J8K A;  4W8Q A;  1RWR A;  2VFQ A;  1OGO X;  2O17 A;  1GQ8 A;  2INU A;  2NSP A;  1O8I A;  1OFL A;  3GQ8 A;  2NTQ A;  3JX8 A;  3LYC A;  1LM1 A;  1AIR A;  1O8J A;  2VFO A;  2X3H A;  2XT2 A;  3ZPP A;  2O1D A;  2ODL A;  2BM5 A;  1K4Z A;  2BSP A;  4YZX A;  3VSV A;  2UVF A;  1DBO A;  3GQ7 A;  4XQF A;  4YZ0 A;  2G0Y A;  4XOT A;  1OFD A;  5AMV A;  4YEI A;  3DU1 X;  1XG2 A;  2PEC A;  4W8S A;  1HF2 A;  2BM6 A;  2O0W A;  2QY1 A;  4URR A;  2BX6 A;  3T9G A;  1DBG A;  4PMH A;  2IOU G;  2X6X A;  4YZA A;  4I84 A;  1O8H A;  4OM9 A;  3SQV A;  2YUH A;  1O8L A;  3BH6 B;  4XKW A;  4OJO A;  1OGM X;  3PSS A;  3SUC A;  3VMV A;  3VST A;  2XT4 A;  1OFM A;  2NST A;  4OJ6 A;  4XM3 A;  2VFN A;  3UW0 A;  4YEJ A;  4AVZ A;  1HG8 A;  5JMC B;  1QCX A;  4YZQ A;  1O8G A;  3GRH A;  3ZSC A;  1JRG A;  1OFE A;  4U4B A;  3N6Z A;  4EW9 A;  2F3L A;  1IA5 A;  3AK5 A;  4MXN A;  3RIQ A;  1KTW A;  1RU4 A;  1X0C A;  2VBK A;  4XLH A;  1LLZ A;  4YFO A;  3JUR A;  2NT6 A;  3VMW A;  1O88 A;  1O8E A;  2UVE A;  1BHE A;  1QA3 A;  4YDT A;  3WWG A;  4NK6 A;  3SZE A;  2B0R A;  3N90 A;  3FY3 A;  4NK8 A;  4OJP A;  3B4N A;  1QRB A;  2NZM A;  4XLC A;  3EQN A;  4YCQ A;  2QXZ A;  1QRC A;  4XMY A;  4OZZ A;  2VBE A;  2VJI A;  2X6Y A;  3B8Y A;  4C2L A;  1KCD A;  1L1I A;  4OJ5 A;  3GQA A;  4XLA A;  4XR6 A;  4XN3 A;  3VSU A;  1BN8 A;  1O8K A;  1DAB A;  3ML3 A;  1LLW A;  1KQ5 A;  2BM7 A;  3EQO A;  1CLW A;  1QJV A;  3PET A;  4MR0 A;  4YEL A;  1O8F A;  2NT9 A;  2V5I A;  5C1E A;  5JLV C;  1EE6 A;  2O6W A;  4W8R A;  1EZG A;  4XLF A;  1QA1 A;  2PYG A;  2X85 A;  1EA0 A;  1O8D A;  1PE9 A;  1PLU A;  2X6W A;  3LMW A;  4W8T A;  3H09 A;  3LJY A;  4Z05 A;  2VJJ A;  1WMR A;  2J8I A;  4Z03 A;  1TYX A;  2QZA A;  3SY2 A;  1VBL A;  1PXZ A;  2XTW A;  3BH7 B;  4XON A;  3NB2 A;  5C1C A;  4U49 A;  4XN0 A;  4KH3 A;  4XOR A;  1K8F A;  2XTY A;  2QX3 A;  4OJL A;  2O04 A;  4XNF A;  4XLE A;  1KCC A;  1H80 A;  1IDJ A;  1TYW A;  3P4G A;  1JTA A;  3B90 A;  1TYV A;  2INV A;  2EWE A;  4OZY A;  4XL9 A;  1TYU A;  2Z8G A;  2XTX A;  1QQ1 A;  1O8M A;  2QYU A;  3GQ9 A;  1IDK A;  5DNS A; 
#chains in the Genus database with same CATH homology
 1NHC A;  2IQ7 A;  4XOP A;  1IB4 A;  4XKV A;  3KRG A;  1OOC A;  2NTP A;  1RMG A;  2PYH A;  2VBM A;  2NTB A;  1CZF A;  4HWV A;  1K5C A;  2O0V A;  4W8Q A;  1RWR A;  1OGO X;  2O17 A;  1GQ8 A;  2INU A;  2NSP A;  1O8I A;  1OFL A;  3GQ8 A;  2NTQ A;  1AIR A;  1O8J A;  2X3H A;  3ZPP A;  2O1D A;  2ODL A;  2BSP A;  4YZX A;  3VSV A;  2UVF A;  1DBO A;  3GQ7 A;  4XQF A;  4YZ0 A;  4XOT A;  5AMV A;  1XG2 A;  2PEC A;  4W8S A;  2O0W A;  2QY1 A;  4URR A;  3T9G A;  1DBG A;  4PMH A;  2X6X A;  4YZA A;  4I84 A;  1O8H A;  1O8L A;  4XKW A;  3VMV A;  4OJO A;  1OGM X;  3VST A;  3SUC A;  4OJ6 A;  1OFM A;  2NST A;  4XM3 A;  3UW0 A;  4YEJ A;  4AVZ A;  1HG8 A;  1QCX A;  4YZQ A;  1O8G A;  3GRH A;  3ZSC A;  1JRG A;  4EW9 A;  4U4B A;  1IA5 A;  4MXN A;  1KTW A;  1RU4 A;  1X0C A;  2VBK A;  4XLH A;  3JUR A;  2NT6 A;  3VMW A;  1O88 A;  1O8E A;  2UVE A;  1BHE A;  3WWG A;  4NK6 A;  3FY3 A;  4NK8 A;  4OJP A;  3B4N A;  2NZM A;  4XLC A;  3EQN A;  2QXZ A;  4XMY A;  4OZZ A;  2VBE A;  2VJI A;  2X6Y A;  3B8Y A;  4C2L A;  1KCD A;  4OJ5 A;  3GQA A;  4XLA A;  4XR6 A;  4XN3 A;  3VSU A;  1BN8 A;  1O8K A;  3EQO A;  1QJV A;  4MR0 A;  4YEL A;  1O8F A;  2NT9 A;  5C1E A;  1EE6 A;  4W8R A;  4XLF A;  2PYG A;  2X85 A;  1O8D A;  1PE9 A;  1PLU A;  2X6W A;  3LMW A;  4W8T A;  4Z05 A;  2VJJ A;  1WMR A;  4Z03 A;  1VBL A;  1PXZ A;  4XON A;  5C1C A;  4U49 A;  4XN0 A;  4XOR A;  4OJL A;  2QX3 A;  2O04 A;  4XNF A;  4XLE A;  1KCC A;  1H80 A;  1IDJ A;  1JTA A;  3B90 A;  2EWE A;  2INV A;  4OZY A;  4XL9 A;  2Z8G A;  3GQ9 A;  4Z06 A;  1O8M A;  1IDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...