4Z05A

C. bescii family 3 pectate lyase mutant e84a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
196
structure length
196
Chain Sequence
VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGADALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
molecule keywords Pectate lyase
total genus 82
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z05A00
4OJPA 5C1EA 1O8EA 3JURA 2UVFA 2PYGA 2UVEA 1RU4A 1WMRA 1EE6A 4XORA 3WWGA 4XKVA 3VMWA 1RMGA 1O8LA 4XN3A 4U49A 2NT9A 2EWEA 4W8RA 4YZQA 4Z03A 1JRGA 1X0CA 2O17A 4I84A 1K5CA 3B90A 1O8FA 1O8IA 1IA5A 1BHEA 1H80A 2NTBA 4YZXA 4AVZA 4XN0A 4XLFA 3EQOA 4MXNA 1O8JA 2VBEA 2NT6A 1OGMX 2O1DA 5C1CA 1OGOX 2ODLA 3GRHA 4XLEA 1IB4A 2BSPA 1PE9A 3B4NA 3ZSCA 1IDJA 5AMVA 2NZMA 3GQ9A 3LMWA 1JTAA 1O8KA 4Z06A 3FY3A 2QXZA 4W8QA 2VBMA 1OFMA 1PXZA 1QCXA 1VBLA 2VJIA 1O8HA 2X85A 1QJVA 4OZZA 3GQ8A 4YZ0A 4XONA 3VSVA 3EQNA 3SUCA 2PYHA 4XKWA 1IDKA 1DBOA 4OJOA 1O8DA 3VSUA 2NSPA 3GQ7A 4PMHA 4XM3A 1GQ8A 2X6YA 4C2LA 4MR0A 4XLCA 4YZAA 4XOTA 2VJJA 1KCCA 4W8TA 2QX3A 2NTQA 4NK8A 4XOPA 3ZPPA 4NK6A 1O8GA 1O88A 4XLHA 3VMVA 4W8SA 4U4BA 4HWVA 1PLUA 4XL9A 1NHCA 3UW0A 2X6XA 1O8MA 4YEJA 4OJLA 4XLAA 4XMYA 4XQFA 2O0VA 1BN8A 4Z05A 3T9GA 2PECA 1CZFA 4XR6A 1AIRA 2IQ7A 2X6WA 2INUA 2QY1A 3KRGA 2O0WA 4OJ5A 4URRA 1KCDA 1DBGA 1RWRA 2NSTA 1XG2A 4YELA 1OFLA 4XNFA 1HG8A 4EW9A 2VBKA 3B8YA 3GQAA 3VSTA 1OOCA 2Z8GA 2NTPA 4OJ6A 1KTWA 2INVA 4OZYA 2O04A 2X3HA
chains in the Genus database with same CATH superfamily
4OJPA 4YCQA 1O8EA 5C1EA 2IOUG 3JURA 2UVFA 3SY2A 2PYGA 2QYUA 2UVEA 1RU4A 1WMRA 1EE6A 4XORA 3WWGA 3AK5A 4XKVA 5DNSA 2BX6A 1RMGA 1O8LA 3VMWA 4XN3A 4U49A 4OPWA 2NT9A 2EWEA 4W8RA 4YZQA 4Z03A 3H09A 1OFEA 1JRGA 1X0CA 2O17A 2O6WA 3PSZA 4I84A 1K5CA 3B90A 2YUHA 2B0RA 1O8FA 1O8IA 2BM4A 2BM6A 1BHEA 1H80A 5JLVC 2NTBA 4YZXA 2VFPA 3NB2A 4XLFA 4XN0A 4AVZA 3EQOA 1WXRA 3SYJA 3PETA 4MXNA 1TYXA 2J8KA 2QZAA 1IA5A 1O8JA 2VBEA 2NT6A 1OGMX 2O1DA 5C1CA 1OGOX 2ODLA 2J8IA 3GRHA 4XLEA 1IB4A 2BSPA 1PE9A 3B4NA 3ZSCA 1IDJA 1OFDA 5AMVA 2VFMA 2NZMA 1TYWA 3GQ9A 3LMWA 1JTAA 1O8KA 2VFQA 4Z06A 1TYUA 2VFNA 5JMCB 3FY3A 2QXZA 4W8QA 1OFMA 1PXZA 1QCXA 2VBMA 2BM7A 1HF2A 1VBLA 2VJIA 1O8HA 2X85A 1QJVA 4OZZA 1L1IA 3GQ8A 4YZ0A 2G0YA 4XONA 3EQNA 3SUCA 3VSVA 2PYHA 4XKWA 1QA3A 3LJYA 1IDKA 3DU1X 2XC1A 1DBOA 4OJOA 1O8DA 3VSUA 2NSPA 3GQ7A 4PMHA 4XM3A 2XT4A 1GQ8A 3JX8A 2X6YA 2XTXA 4YFOA 3P4GA 4C2LA 4MR0A 4XLCA 4YZAA 4XOTA 1QRBA 3TH0A 2VJJA 1KCCA 4W8TA 2QX3A 2NTQA 4NK8A 1QA2A 4XOPA 1LLWA 3ZPPA 4NK6A 1O8GA 1O88A 4XLHA 3VMVA 4W8SA 4U4BA 4KH3A 3RIQA 1KQ5A 4HWVA 1PLUA 1QRCA 2XT2A 4XL9A 1QA1A 1NHCA 3UW0A 2X6XA 1CLWA 1O8MA 4YEJA 3LYCA 1K4ZA 4OJLA 4XLAA 4V02C 4XMYA 3SZEA 4XQFA 4OM9A 4YDTA 2O0VA 3BH7B 1BN8A 4Z05A 2XTWA 3T9GA 2PECA 3N90A 3SQVA 1QQ1A 2XTYA 1CZFA 4XR6A 1AIRA 2IQ7A 2VFOA 2INUA 1TSPA 2BM5A 2O0WA 2F3LA 2QY1A 2X6WA 3KRGA 4OJ5A 4URRA 4YC5A 1KCDA 1EA0A 1LLZA 1EZGA 4YEIA 1DBGA 1RWRA 2NSTA 3N6ZA 1LM1A 1XG2A 4YELA 1OFLA 3NAWA 4XNFA 1HG8A 1DABA 3ML3A 4JRAC 4EW9A 2VBKA 1TYVA 3B8YA 3BH6B 3GQAA 3VSTA 1OOCA 1K8FA 2V5IA 2Z8GA 2NTPA 2W7ZA 4OJ6A 3PSSA 1KTWA 2INVA 4OZYA 2O04A 2X3HA
chains in the Genus database with same CATH topology
4OJPA 5C1EA 1O8EA 3JURA 2UVFA 2PYGA 2UVEA 1RU4A 1WMRA 1EE6A 4XORA 3WWGA 4XKVA 3VMWA 1RMGA 1O8LA 4XN3A 4U49A 2NT9A 2EWEA 4W8RA 4YZQA 4Z03A 1JRGA 1X0CA 2O17A 4I84A 1K5CA 3B90A 1O8FA 1O8IA 1IA5A 1BHEA 1H80A 2NTBA 4YZXA 4AVZA 4XN0A 4XLFA 3EQOA 4MXNA 1O8JA 2VBEA 2NT6A 1OGMX 2O1DA 5C1CA 1OGOX 2ODLA 3GRHA 4XLEA 1IB4A 2BSPA 1PE9A 3B4NA 3ZSCA 1IDJA 5AMVA 2NZMA 3GQ9A 3LMWA 1JTAA 1O8KA 4Z06A 3FY3A 2QXZA 4W8QA 2VBMA 1OFMA 1PXZA 1QCXA 1VBLA 2VJIA 1O8HA 2X85A 1QJVA 4OZZA 3GQ8A 4YZ0A 4XONA 3VSVA 3EQNA 3SUCA 2PYHA 4XKWA 1IDKA 1DBOA 4OJOA 1O8DA 3VSUA 2NSPA 3GQ7A 4PMHA 4XM3A 1GQ8A 2X6YA 4C2LA 4MR0A 4XLCA 4YZAA 4XOTA 2VJJA 1KCCA 4W8TA 2QX3A 2NTQA 4NK8A 4XOPA 3ZPPA 4NK6A 1O8GA 1O88A 4XLHA 3VMVA 4W8SA 4U4BA 4HWVA 1PLUA 4XL9A 1NHCA 3UW0A 2X6XA 1O8MA 4YEJA 4OJLA 4XLAA 4XMYA 4XQFA 2O0VA 1BN8A 4Z05A 3T9GA 2PECA 1CZFA 4XR6A 1AIRA 2IQ7A 2X6WA 2INUA 2QY1A 3KRGA 2O0WA 4OJ5A 4URRA 1KCDA 1DBGA 1RWRA 2NSTA 1XG2A 4YELA 1OFLA 4XNFA 1HG8A 4EW9A 2VBKA 3B8YA 3GQAA 3VSTA 1OOCA 2Z8GA 2NTPA 4OJ6A 1KTWA 2INVA 4OZYA 2O04A 2X3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJP A;  5C1E A;  1O8E A;  3JUR A;  2UVF A;  2PYG A;  2UVE A;  1RU4 A;  1WMR A;  1EE6 A;  4XOR A;  3WWG A;  4XKV A;  3VMW A;  1RMG A;  1O8L A;  4XN3 A;  4U49 A;  2NT9 A;  2EWE A;  4W8R A;  4YZQ A;  4Z03 A;  1JRG A;  1X0C A;  2O17 A;  4I84 A;  1K5C A;  3B90 A;  1O8F A;  1O8I A;  1IA5 A;  1BHE A;  1H80 A;  2NTB A;  4YZX A;  4AVZ A;  4XN0 A;  4XLF A;  3EQO A;  4MXN A;  1O8J A;  2VBE A;  2NT6 A;  1OGM X;  2O1D A;  5C1C A;  1OGO X;  2ODL A;  3GRH A;  4XLE A;  1IB4 A;  2BSP A;  1PE9 A;  3B4N A;  3ZSC A;  1IDJ A;  5AMV A;  2NZM A;  3GQ9 A;  3LMW A;  1JTA A;  1O8K A;  4Z06 A;  3FY3 A;  2QXZ A;  4W8Q A;  2VBM A;  1OFM A;  1PXZ A;  1QCX A;  1VBL A;  2VJI A;  1O8H A;  2X85 A;  1QJV A;  4OZZ A;  3GQ8 A;  4YZ0 A;  4XON A;  3VSV A;  3EQN A;  3SUC A;  2PYH A;  4XKW A;  1IDK A;  1DBO A;  4OJO A;  1O8D A;  3VSU A;  2NSP A;  3GQ7 A;  4PMH A;  4XM3 A;  1GQ8 A;  2X6Y A;  4C2L A;  4MR0 A;  4XLC A;  4YZA A;  4XOT A;  2VJJ A;  1KCC A;  4W8T A;  2QX3 A;  2NTQ A;  4NK8 A;  4XOP A;  3ZPP A;  4NK6 A;  1O8G A;  1O88 A;  4XLH A;  3VMV A;  4W8S A;  4U4B A;  4HWV A;  1PLU A;  4XL9 A;  1NHC A;  3UW0 A;  2X6X A;  1O8M A;  4YEJ A;  4OJL A;  4XLA A;  4XMY A;  4XQF A;  2O0V A;  1BN8 A;  4Z05 A;  3T9G A;  2PEC A;  1CZF A;  4XR6 A;  1AIR A;  2IQ7 A;  2X6W A;  2INU A;  2QY1 A;  3KRG A;  2O0W A;  4OJ5 A;  4URR A;  1KCD A;  1DBG A;  1RWR A;  2NST A;  1XG2 A;  4YEL A;  1OFL A;  4XNF A;  1HG8 A;  4EW9 A;  2VBK A;  3B8Y A;  3GQA A;  3VST A;  1OOC A;  2Z8G A;  2NTP A;  4OJ6 A;  1KTW A;  2INV A;  4OZY A;  2O04 A;  2X3H A; 
#chains in the Genus database with same CATH topology
 4OJP A;  4YCQ A;  1O8E A;  5C1E A;  2IOU G;  3JUR A;  2UVF A;  3SY2 A;  2PYG A;  2QYU A;  2UVE A;  1RU4 A;  1WMR A;  1EE6 A;  4XOR A;  3WWG A;  3AK5 A;  4XKV A;  5DNS A;  2BX6 A;  1RMG A;  1O8L A;  3VMW A;  4XN3 A;  4U49 A;  4OPW A;  2NT9 A;  2EWE A;  4W8R A;  4YZQ A;  4Z03 A;  3H09 A;  1OFE A;  1JRG A;  1X0C A;  2O17 A;  2O6W A;  3PSZ A;  4I84 A;  1K5C A;  3B90 A;  2YUH A;  2B0R A;  1O8F A;  1O8I A;  2BM4 A;  2BM6 A;  1BHE A;  1H80 A;  5JLV C;  2NTB A;  4YZX A;  2VFP A;  3NB2 A;  4XLF A;  4XN0 A;  4AVZ A;  3EQO A;  1WXR A;  3SYJ A;  3PET A;  4MXN A;  1TYX A;  2J8K A;  2QZA A;  1IA5 A;  1O8J A;  2VBE A;  2NT6 A;  1OGM X;  2O1D A;  5C1C A;  1OGO X;  2ODL A;  2J8I A;  3GRH A;  4XLE A;  1IB4 A;  2BSP A;  1PE9 A;  3B4N A;  3ZSC A;  1IDJ A;  1OFD A;  5AMV A;  2VFM A;  2NZM A;  1TYW A;  3GQ9 A;  3LMW A;  1JTA A;  1O8K A;  2VFQ A;  4Z06 A;  1TYU A;  2VFN A;  5JMC B;  3FY3 A;  2QXZ A;  4W8Q A;  1OFM A;  1PXZ A;  1QCX A;  2VBM A;  2BM7 A;  1HF2 A;  1VBL A;  2VJI A;  1O8H A;  2X85 A;  1QJV A;  4OZZ A;  1L1I A;  3GQ8 A;  4YZ0 A;  2G0Y A;  4XON A;  3EQN A;  3SUC A;  3VSV A;  2PYH A;  4XKW A;  1QA3 A;  3LJY A;  1IDK A;  3DU1 X;  2XC1 A;  1DBO A;  4OJO A;  1O8D A;  3VSU A;  2NSP A;  3GQ7 A;  4PMH A;  4XM3 A;  2XT4 A;  1GQ8 A;  3JX8 A;  2X6Y A;  2XTX A;  4YFO A;  3P4G A;  4C2L A;  4MR0 A;  4XLC A;  4YZA A;  4XOT A;  1QRB A;  3TH0 A;  2VJJ A;  1KCC A;  4W8T A;  2QX3 A;  2NTQ A;  4NK8 A;  1QA2 A;  4XOP A;  1LLW A;  3ZPP A;  4NK6 A;  1O8G A;  1O88 A;  4XLH A;  3VMV A;  4W8S A;  4U4B A;  4KH3 A;  3RIQ A;  1KQ5 A;  4HWV A;  1PLU A;  1QRC A;  2XT2 A;  4XL9 A;  1QA1 A;  1NHC A;  3UW0 A;  2X6X A;  1CLW A;  1O8M A;  4YEJ A;  3LYC A;  1K4Z A;  4OJL A;  4XLA A;  4V02 C;  4XMY A;  3SZE A;  4XQF A;  4OM9 A;  4YDT A;  2O0V A;  3BH7 B;  1BN8 A;  4Z05 A;  2XTW A;  3T9G A;  2PEC A;  3N90 A;  3SQV A;  1QQ1 A;  2XTY A;  1CZF A;  4XR6 A;  1AIR A;  2IQ7 A;  2VFO A;  2INU A;  1TSP A;  2BM5 A;  2O0W A;  2F3L A;  2QY1 A;  2X6W A;  3KRG A;  4OJ5 A;  4URR A;  4YC5 A;  1KCD A;  1EA0 A;  1LLZ A;  1EZG A;  4YEI A;  1DBG A;  1RWR A;  2NST A;  3N6Z A;  1LM1 A;  1XG2 A;  4YEL A;  1OFL A;  3NAW A;  4XNF A;  1HG8 A;  1DAB A;  3ML3 A;  4JRA C;  4EW9 A;  2VBK A;  1TYV A;  3B8Y A;  3BH6 B;  3GQA A;  3VST A;  1OOC A;  1K8F A;  2V5I A;  2Z8G A;  2NTP A;  2W7Z A;  4OJ6 A;  3PSS A;  1KTW A;  2INV A;  4OZY A;  2O04 A;  2X3H A; 
#chains in the Genus database with same CATH homology
 4OJP A;  5C1E A;  1O8E A;  3JUR A;  2UVF A;  2PYG A;  2UVE A;  1RU4 A;  1WMR A;  1EE6 A;  4XOR A;  3WWG A;  4XKV A;  3VMW A;  1RMG A;  1O8L A;  4XN3 A;  4U49 A;  2NT9 A;  2EWE A;  4W8R A;  4YZQ A;  4Z03 A;  1JRG A;  1X0C A;  2O17 A;  4I84 A;  1K5C A;  3B90 A;  1O8F A;  1O8I A;  1IA5 A;  1BHE A;  1H80 A;  2NTB A;  4YZX A;  4AVZ A;  4XN0 A;  4XLF A;  3EQO A;  4MXN A;  1O8J A;  2VBE A;  2NT6 A;  1OGM X;  2O1D A;  5C1C A;  1OGO X;  2ODL A;  3GRH A;  4XLE A;  1IB4 A;  2BSP A;  1PE9 A;  3B4N A;  3ZSC A;  1IDJ A;  5AMV A;  2NZM A;  3GQ9 A;  3LMW A;  1JTA A;  1O8K A;  4Z06 A;  3FY3 A;  2QXZ A;  4W8Q A;  2VBM A;  1OFM A;  1PXZ A;  1QCX A;  1VBL A;  2VJI A;  1O8H A;  2X85 A;  1QJV A;  4OZZ A;  3GQ8 A;  4YZ0 A;  4XON A;  3VSV A;  3EQN A;  3SUC A;  2PYH A;  4XKW A;  1IDK A;  1DBO A;  4OJO A;  1O8D A;  3VSU A;  2NSP A;  3GQ7 A;  4PMH A;  4XM3 A;  1GQ8 A;  2X6Y A;  4C2L A;  4MR0 A;  4XLC A;  4YZA A;  4XOT A;  2VJJ A;  1KCC A;  4W8T A;  2QX3 A;  2NTQ A;  4NK8 A;  4XOP A;  3ZPP A;  4NK6 A;  1O8G A;  1O88 A;  4XLH A;  3VMV A;  4W8S A;  4U4B A;  4HWV A;  1PLU A;  4XL9 A;  1NHC A;  3UW0 A;  2X6X A;  1O8M A;  4YEJ A;  4OJL A;  4XLA A;  4XMY A;  4XQF A;  2O0V A;  1BN8 A;  4Z05 A;  3T9G A;  2PEC A;  1CZF A;  4XR6 A;  1AIR A;  2IQ7 A;  2X6W A;  2INU A;  2QY1 A;  3KRG A;  2O0W A;  4OJ5 A;  4URR A;  1KCD A;  1DBG A;  1RWR A;  2NST A;  1XG2 A;  4YEL A;  1OFL A;  4XNF A;  1HG8 A;  4EW9 A;  2VBK A;  3B8Y A;  3GQA A;  3VST A;  1OOC A;  2Z8G A;  2NTP A;  4OJ6 A;  1KTW A;  2INV A;  4OZY A;  2O04 A;  2X3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...