4Z05A

C. bescii family 3 pectate lyase mutant e84a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
196
structure length
196
Chain Sequence
b'VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGADALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title The catalytic mechanism and unique low pH optimum of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii (strain atcc baa-1888 / dsm 6725 / z-1320)
molecule tags Lyase
total genus 82
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4z05A00
1OGOX 4OJ5A 3SUCA 3WWGA 4MXNA 3GQAA 4OJOA 4XN3A 4XLHA 1K5CA 2UVFA 3GQ9A 4XKWA 2INUA 1WMRA 1XG2A 1VBLA 2VJIA 1DBOA 3VSUA 3ZSCA 1IDJA 2QY1A 4Z05A 4YEJA 4XORA 2QXZA 1BHEA 3T9GA 4XM3A 1O8EA 1O8LA 2Z8GA 4U4BA 1O8MA 1NHCA 4OZZA 1O8JA 1O8FA 1IDKA 4XKVA 1BN8A 2VJJA 4XR6A 2NZMA 4XQFA 1KCCA 2PYHA 2PYGA 4EW9A 1OFLA 2UVEA 1O8HA 1IB4A 2VBKA 2NTBA 4NK8A 4HWVA 4XN0A 4NK6A 5C1EA 3GQ8A 1OGMX 1AIRA 2BSPA 1O8DA 1RU4A 3UW0A 1X0CA 2INVA 2PECA 3B8YA 1JRGA 1PE9A 1GQ8A 2NTPA 4W8QA 4XLAA 2O0WA 3EQOA 2X6XA 2VBMA 3B90A 1IA5A 1EE6A 4XL9A 4W8RA 4OJLA 2O04A 4I84A 1KCDA 4XLCA 1H80A 1HG8A 1PLUA 1O8GA 2NT6A 2QX3A 2NT9A 3B4NA 3FY3A 4OJ6A 1O8IA 2EWEA 3JURA 4YZQA 4YZXA 2NSTA 4OJPA 2X6WA 3LMWA 1KTWA 4XOTA 2O1DA 2VBEA 4XMYA 2ODLA 1OOCA 4PMHA 4XLEA 1OFMA 4XOPA 5AMVA 1O8KA 5C1CA 3VSTA 1DBGA 4YZAA 2NSPA 3GRHA 4AVZA 4U49A 4XNFA 2O17A 3ZPPA 4C2LA 4MR0A 4YZ0A 1PXZA 1QJVA 2IQ7A 4Z03A 3KRGA 2X6YA 1QCXA 4YELA 3VSVA 2O0VA 1O88A 1RWRA 3EQNA 1CZFA 3VMWA 1JTAA 4OZYA 3GQ7A 4XLFA 4W8TA 4URRA 2X3HA 1RMGA 4W8SA 2X85A 4XONA 4Z06A 2NTQA 3VMVA
chains in the Genus database with same CATH superfamily
3FY3A 1OGOX 5JMCB 4OJ5A 3SUCA 3WWGA 4MXNA 3GQAA 3JX8A 4OJOA 3BH6B 4XN3A 3N6ZA 4XLHA 1K5CA 2UVFA 2XC1A 3GQ9A 4XKWA 1HF2A 2INUA 1TYUA 1QA2A 1WMRA 2BM7A 1QA1A 1XG2A 1VBLA 3AK5A 4OPWA 2VJIA 1DBOA 3VSUA 3ZSCA 1IDJA 2QY1A 2VFMA 4Z05A 2O6WA 4YEJA 4XORA 2QXZA 4V02C 1BHEA 3T9GA 4XM3A 1O8EA 1LLZA 1O8LA 2Z8GA 2B0RA 4U4BA 1WXRA 1O8MA 1NHCA 4OZZA 1O8JA 1QRCA 4JRAC 3LJYA 1O8FA 2XTYA 2J8IA 1IDKA 3RIQA 4XKVA 1BN8A 2XTXA 2VJJA 4XR6A 1EZGA 3SY2A 4YEIA 2NZMA 4XQFA 1KCCA 2PYHA 2PYGA 4EW9A 1OFLA 3NB2A 2UVEA 1TYWA 1O8HA 1OFDA 1IB4A 4YCQA 1CLWA 2VBKA 2NTBA 1TSPA 2QYUA 4HWVA 4NK8A 4XN0A 3BH7B 4NK6A 3DU1X 3ML3A 5C1EA 3GQ8A 1OGMX 3TH0A 1KQ5A 1TYVA 1AIRA 2BSPA 3SQVA 1LLWA 1O8DA 1RU4A 4KH3A 4YC5A 1X0CA 3UW0A 2BM5A 2INVA 2PECA 2BX6A 3B8YA 3PSZA 1JRGA 2XT4A 1PE9A 1GQ8A 1QRBA 1TYXA 2NTPA 4W8QA 4XLAA 3SZEA 2O0WA 3EQOA 2X6XA 2VBMA 2W7ZA 3B90A 1EA0A 1IA5A 5DNSA 1EE6A 4XL9A 4W8RA 1K8FA 4OJLA 5JLVC 2O04A 4I84A 1KCDA 1QQ1A 4XLCA 3NAWA 2F3LA 1H80A 1HG8A 1PLUA 1O8GA 2NT6A 2QX3A 2NT9A 2VFQA 2VFPA 3B4NA 1O8IA 2EWEA 3JURA 4OJ6A 4YZQA 4YZXA 2NSTA 4OJPA 2X6WA 2XT2A 2J8KA 1KTWA 3LMWA 4OM9A 2YUHA 2O1DA 2VBEA 4XMYA 4XOTA 2ODLA 1OOCA 2VFNA 4PMHA 4XLEA 1OFMA 4XOPA 5AMVA 1K4ZA 1O8KA 5C1CA 3VSTA 1L1IA 2V5IA 3LYCA 1DBGA 3SYJA 4YZAA 2NSPA 3GRHA 4AVZA 2VFOA 4U49A 4XNFA 3H09A 2O17A 3P4GA 3ZPPA 2BM6A 4C2LA 4MR0A 4YZ0A 2IOUG 1LM1A 1PXZA 1QJVA 1OFEA 2IQ7A 4Z03A 1DABA 3KRGA 2X6YA 1QCXA 4YELA 2G0YA 3VSVA 2O0VA 1O88A 1RWRA 2XTWA 3EQNA 1CZFA 3VMWA 1JTAA 3PSSA 4YDTA 4OZYA 3GQ7A 3PETA 4W8TA 4XLFA 4URRA 2X3HA 1RMGA 2BM4A 2QZAA 3N90A 1QA3A 4W8SA 2X85A 4XONA 4Z06A 2NTQA 4YFOA 3VMVA
chains in the Genus database with same CATH topology
1OGOX 4OJ5A 3SUCA 3WWGA 4MXNA 3GQAA 4OJOA 4XN3A 4XLHA 1K5CA 2UVFA 3GQ9A 4XKWA 2INUA 1WMRA 1XG2A 1VBLA 2VJIA 1DBOA 3VSUA 3ZSCA 1IDJA 2QY1A 4Z05A 4YEJA 4XORA 2QXZA 1BHEA 3T9GA 4XM3A 1O8EA 1O8LA 2Z8GA 4U4BA 1O8MA 1NHCA 4OZZA 1O8JA 1O8FA 1IDKA 4XKVA 1BN8A 2VJJA 4XR6A 2NZMA 4XQFA 1KCCA 2PYHA 2PYGA 4EW9A 1OFLA 2UVEA 1O8HA 1IB4A 2VBKA 2NTBA 4NK8A 4HWVA 4XN0A 4NK6A 5C1EA 3GQ8A 1OGMX 1AIRA 2BSPA 1O8DA 1RU4A 3UW0A 1X0CA 2INVA 2PECA 3B8YA 1JRGA 1PE9A 1GQ8A 2NTPA 4W8QA 4XLAA 2O0WA 3EQOA 2X6XA 2VBMA 3B90A 1IA5A 1EE6A 4XL9A 4W8RA 4OJLA 2O04A 4I84A 1KCDA 4XLCA 1H80A 1HG8A 1PLUA 1O8GA 2NT6A 2QX3A 2NT9A 3B4NA 3FY3A 4OJ6A 1O8IA 2EWEA 3JURA 4YZQA 4YZXA 2NSTA 4OJPA 2X6WA 3LMWA 1KTWA 4XOTA 2O1DA 2VBEA 4XMYA 2ODLA 1OOCA 4PMHA 4XLEA 1OFMA 4XOPA 5AMVA 1O8KA 5C1CA 3VSTA 1DBGA 4YZAA 2NSPA 3GRHA 4AVZA 4U49A 4XNFA 2O17A 3ZPPA 4C2LA 4MR0A 4YZ0A 1PXZA 1QJVA 2IQ7A 4Z03A 3KRGA 2X6YA 1QCXA 4YELA 3VSVA 2O0VA 1O88A 1RWRA 3EQNA 1CZFA 3VMWA 1JTAA 4OZYA 3GQ7A 4XLFA 4W8TA 4URRA 2X3HA 1RMGA 4W8SA 2X85A 4XONA 4Z06A 2NTQA 3VMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGO X;  4OJ5 A;  3SUC A;  3WWG A;  4MXN A;  3GQA A;  4OJO A;  4XN3 A;  4XLH A;  1K5C A;  2UVF A;  3GQ9 A;  4XKW A;  2INU A;  1WMR A;  1XG2 A;  1VBL A;  2VJI A;  1DBO A;  3VSU A;  3ZSC A;  1IDJ A;  2QY1 A;  4Z05 A;  4YEJ A;  4XOR A;  2QXZ A;  1BHE A;  3T9G A;  4XM3 A;  1O8E A;  1O8L A;  2Z8G A;  4U4B A;  1O8M A;  1NHC A;  4OZZ A;  1O8J A;  1O8F A;  1IDK A;  4XKV A;  1BN8 A;  2VJJ A;  4XR6 A;  2NZM A;  4XQF A;  1KCC A;  2PYH A;  2PYG A;  4EW9 A;  1OFL A;  2UVE A;  1O8H A;  1IB4 A;  2VBK A;  2NTB A;  4NK8 A;  4HWV A;  4XN0 A;  4NK6 A;  5C1E A;  3GQ8 A;  1OGM X;  1AIR A;  2BSP A;  1O8D A;  1RU4 A;  3UW0 A;  1X0C A;  2INV A;  2PEC A;  3B8Y A;  1JRG A;  1PE9 A;  1GQ8 A;  2NTP A;  4W8Q A;  4XLA A;  2O0W A;  3EQO A;  2X6X A;  2VBM A;  3B90 A;  1IA5 A;  1EE6 A;  4XL9 A;  4W8R A;  4OJL A;  2O04 A;  4I84 A;  1KCD A;  4XLC A;  1H80 A;  1HG8 A;  1PLU A;  1O8G A;  2NT6 A;  2QX3 A;  2NT9 A;  3B4N A;  3FY3 A;  4OJ6 A;  1O8I A;  2EWE A;  3JUR A;  4YZQ A;  4YZX A;  2NST A;  4OJP A;  2X6W A;  3LMW A;  1KTW A;  4XOT A;  2O1D A;  2VBE A;  4XMY A;  2ODL A;  1OOC A;  4PMH A;  4XLE A;  1OFM A;  4XOP A;  5AMV A;  1O8K A;  5C1C A;  3VST A;  1DBG A;  4YZA A;  2NSP A;  3GRH A;  4AVZ A;  4U49 A;  4XNF A;  2O17 A;  3ZPP A;  4C2L A;  4MR0 A;  4YZ0 A;  1PXZ A;  1QJV A;  2IQ7 A;  4Z03 A;  3KRG A;  2X6Y A;  1QCX A;  4YEL A;  3VSV A;  2O0V A;  1O88 A;  1RWR A;  3EQN A;  1CZF A;  3VMW A;  1JTA A;  4OZY A;  3GQ7 A;  4XLF A;  4W8T A;  4URR A;  2X3H A;  1RMG A;  4W8S A;  2X85 A;  4XON A;  4Z06 A;  2NTQ A;  3VMV A; 
#chains in the Genus database with same CATH topology
 3FY3 A;  1OGO X;  5JMC B;  4OJ5 A;  3SUC A;  3WWG A;  4MXN A;  3GQA A;  3JX8 A;  4OJO A;  3BH6 B;  4XN3 A;  3N6Z A;  4XLH A;  1K5C A;  2UVF A;  2XC1 A;  3GQ9 A;  4XKW A;  1HF2 A;  2INU A;  1TYU A;  1QA2 A;  1WMR A;  2BM7 A;  1QA1 A;  1XG2 A;  1VBL A;  3AK5 A;  4OPW A;  2VJI A;  1DBO A;  3VSU A;  3ZSC A;  1IDJ A;  2QY1 A;  2VFM A;  4Z05 A;  2O6W A;  4YEJ A;  4XOR A;  2QXZ A;  4V02 C;  1BHE A;  3T9G A;  4XM3 A;  1O8E A;  1LLZ A;  1O8L A;  2Z8G A;  2B0R A;  4U4B A;  1WXR A;  1O8M A;  1NHC A;  4OZZ A;  1O8J A;  1QRC A;  4JRA C;  3LJY A;  1O8F A;  2XTY A;  2J8I A;  1IDK A;  3RIQ A;  4XKV A;  1BN8 A;  2XTX A;  2VJJ A;  4XR6 A;  1EZG A;  3SY2 A;  4YEI A;  2NZM A;  4XQF A;  1KCC A;  2PYH A;  2PYG A;  4EW9 A;  1OFL A;  3NB2 A;  2UVE A;  1TYW A;  1O8H A;  1OFD A;  1IB4 A;  4YCQ A;  1CLW A;  2VBK A;  2NTB A;  1TSP A;  2QYU A;  4HWV A;  4NK8 A;  4XN0 A;  3BH7 B;  4NK6 A;  3DU1 X;  3ML3 A;  5C1E A;  3GQ8 A;  1OGM X;  3TH0 A;  1KQ5 A;  1TYV A;  1AIR A;  2BSP A;  3SQV A;  1LLW A;  1O8D A;  1RU4 A;  4KH3 A;  4YC5 A;  1X0C A;  3UW0 A;  2BM5 A;  2INV A;  2PEC A;  2BX6 A;  3B8Y A;  3PSZ A;  1JRG A;  2XT4 A;  1PE9 A;  1GQ8 A;  1QRB A;  1TYX A;  2NTP A;  4W8Q A;  4XLA A;  3SZE A;  2O0W A;  3EQO A;  2X6X A;  2VBM A;  2W7Z A;  3B90 A;  1EA0 A;  1IA5 A;  5DNS A;  1EE6 A;  4XL9 A;  4W8R A;  1K8F A;  4OJL A;  5JLV C;  2O04 A;  4I84 A;  1KCD A;  1QQ1 A;  4XLC A;  3NAW A;  2F3L A;  1H80 A;  1HG8 A;  1PLU A;  1O8G A;  2NT6 A;  2QX3 A;  2NT9 A;  2VFQ A;  2VFP A;  3B4N A;  1O8I A;  2EWE A;  3JUR A;  4OJ6 A;  4YZQ A;  4YZX A;  2NST A;  4OJP A;  2X6W A;  2XT2 A;  2J8K A;  1KTW A;  3LMW A;  4OM9 A;  2YUH A;  2O1D A;  2VBE A;  4XMY A;  4XOT A;  2ODL A;  1OOC A;  2VFN A;  4PMH A;  4XLE A;  1OFM A;  4XOP A;  5AMV A;  1K4Z A;  1O8K A;  5C1C A;  3VST A;  1L1I A;  2V5I A;  3LYC A;  1DBG A;  3SYJ A;  4YZA A;  2NSP A;  3GRH A;  4AVZ A;  2VFO A;  4U49 A;  4XNF A;  3H09 A;  2O17 A;  3P4G A;  3ZPP A;  2BM6 A;  4C2L A;  4MR0 A;  4YZ0 A;  2IOU G;  1LM1 A;  1PXZ A;  1QJV A;  1OFE A;  2IQ7 A;  4Z03 A;  1DAB A;  3KRG A;  2X6Y A;  1QCX A;  4YEL A;  2G0Y A;  3VSV A;  2O0V A;  1O88 A;  1RWR A;  2XTW A;  3EQN A;  1CZF A;  3VMW A;  1JTA A;  3PSS A;  4YDT A;  4OZY A;  3GQ7 A;  3PET A;  4W8T A;  4XLF A;  4URR A;  2X3H A;  1RMG A;  2BM4 A;  2QZA A;  3N90 A;  1QA3 A;  4W8S A;  2X85 A;  4XON A;  4Z06 A;  2NTQ A;  4YFO A;  3VMV A; 
#chains in the Genus database with same CATH homology
 1OGO X;  4OJ5 A;  3SUC A;  3WWG A;  4MXN A;  3GQA A;  4OJO A;  4XN3 A;  4XLH A;  1K5C A;  2UVF A;  3GQ9 A;  4XKW A;  2INU A;  1WMR A;  1XG2 A;  1VBL A;  2VJI A;  1DBO A;  3VSU A;  3ZSC A;  1IDJ A;  2QY1 A;  4Z05 A;  4YEJ A;  4XOR A;  2QXZ A;  1BHE A;  3T9G A;  4XM3 A;  1O8E A;  1O8L A;  2Z8G A;  4U4B A;  1O8M A;  1NHC A;  4OZZ A;  1O8J A;  1O8F A;  1IDK A;  4XKV A;  1BN8 A;  2VJJ A;  4XR6 A;  2NZM A;  4XQF A;  1KCC A;  2PYH A;  2PYG A;  4EW9 A;  1OFL A;  2UVE A;  1O8H A;  1IB4 A;  2VBK A;  2NTB A;  4NK8 A;  4HWV A;  4XN0 A;  4NK6 A;  5C1E A;  3GQ8 A;  1OGM X;  1AIR A;  2BSP A;  1O8D A;  1RU4 A;  3UW0 A;  1X0C A;  2INV A;  2PEC A;  3B8Y A;  1JRG A;  1PE9 A;  1GQ8 A;  2NTP A;  4W8Q A;  4XLA A;  2O0W A;  3EQO A;  2X6X A;  2VBM A;  3B90 A;  1IA5 A;  1EE6 A;  4XL9 A;  4W8R A;  4OJL A;  2O04 A;  4I84 A;  1KCD A;  4XLC A;  1H80 A;  1HG8 A;  1PLU A;  1O8G A;  2NT6 A;  2QX3 A;  2NT9 A;  3B4N A;  3FY3 A;  4OJ6 A;  1O8I A;  2EWE A;  3JUR A;  4YZQ A;  4YZX A;  2NST A;  4OJP A;  2X6W A;  3LMW A;  1KTW A;  4XOT A;  2O1D A;  2VBE A;  4XMY A;  2ODL A;  1OOC A;  4PMH A;  4XLE A;  1OFM A;  4XOP A;  5AMV A;  1O8K A;  5C1C A;  3VST A;  1DBG A;  4YZA A;  2NSP A;  3GRH A;  4AVZ A;  4U49 A;  4XNF A;  2O17 A;  3ZPP A;  4C2L A;  4MR0 A;  4YZ0 A;  1PXZ A;  1QJV A;  2IQ7 A;  4Z03 A;  3KRG A;  2X6Y A;  1QCX A;  4YEL A;  3VSV A;  2O0V A;  1O88 A;  1RWR A;  3EQN A;  1CZF A;  3VMW A;  1JTA A;  4OZY A;  3GQ7 A;  4XLF A;  4W8T A;  4URR A;  2X3H A;  1RMG A;  4W8S A;  2X85 A;  4XON A;  4Z06 A;  2NTQ A;  3VMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...