4Z0MA

Echa5 mycobacterium tuberculosis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
241
Chain Sequence
DLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRDDAASVAVLWGAGGTFCAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVPADEALAMGLANRVVPKGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAALDLEFASIARVAGEALEGARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unsaturated Lipid Assimilation by Mycobacteria Requires Auxiliary cis-trans Enoyl CoA Isomerase
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase
total genus 81
structure length 241
sequence length 241
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4z0mA01
4IZBA 3PE8A 4GM2A 4JCTA 3FDUA 3KTHA 5E0NX 3SLLA 2VSSF 4ZDCA 5MGBA 3R0OA 3QYRA 2F9IB 3TT6A 2CBYA 2J5GD 4JFCA 4B3JA 3GF3A 4K3WA 1ON3A 2ZQRA 5E0SH 4WCZA 3BPPA 4JYLA 4GHNA 2VSSE 1RJNA 2UZFA 4U18A 4JYJA 1FC9A 5INIA 3BEZA 5G1QA 2NP9A 2ZL2A 2VSUE 3TVWA 3KTGA 4WYOB 5DTPA 2Q34A 5KDRB 3NJBA 3GKBA 5G1RA 3VIVA 1EF8A 4ZDFA 4NEKA 2FBMA 3PZKA 3TLFA 1DCIA 1TYFA 4I4ZA 3ZWAA 1SG4A 3K50A 2J5GA 3QMJA 3Q7HA 3PGQA 1XNYA 1Q52A 3QXZA 1PJHA 1YG6A 5DTWA 3QXIA 2F9YA 3MOYA 3N6RB 1YG8A 4B3HA 1W2XA 4U0GA 5JBXA 4NNQA 1J7XA 1X0UA 3RSIA 3R9SA 3OT6A 4OMRA 3G64A 3STAA 1WDMA 4KPKA 2VSSA 2VX2A 3DORA 1WZ8A 1K32A 3DJAA 3KTIA 5CTCA 1FC7A 3Q0JA 1DUBA 4FNDA 4L8KA 1Q51A 3P85A 2CE3A 2QQ3A 2J5IB 3K8XA 2J5IA 3QK8A 3KTKA 3I47A 3L3SA 3GLMA 4FB8A 3P5MA 4Z0MA 2EJ5A 3QWDA 4MXIA 2VSUC 1XX4A 3U9SB 4JCQA 2IEXA 3TV5A 1HZDA 4U0GH 1FCFA 3IAVA 3QREA 3V5EA 4IZDA 4JJTA 4ZDBA 3RRVA 2PBPA 3MT6A 1UYSA 4JVTA 3MYBA 2J5SA 2VSUF 3TRRA 1VRGA 2VSUA 4IZCA 4EMPA 4F47A 3H0SA 4ELXA 3KQFA 5DL1A 4OLQA 4FZWC 1UYRA 3H02A 2Q35A 3HINA 5KJPA 1O8UA 5FUSA 4B3IA 4FN8A 3HRXA 4FN7A 3ZW8A 4K2NA 2J5II 2ZL3A 2DUBA 2W3PA 5DU6A 1EF9A 5DU4A 2HW5A 4FZWA 4U1AA 3IB9A 4OG1A 3M6NA 3ZWCA 2FW2A 4MI2A 2WTBA 5DKPA 4JOTA 4U19A 3SWXA 3P2LA 3LKEA 2A7SA 1K39A 3M6MA 3T3WA 2D3TA 4KNPA 3U9RB 2Q2XA 1WDKA 4L6WA 4KWBA 3R9QA 2ZL0A 4MOUA 4JWVA 3ISAA 5G1SA 1N6EA 4RYFH 3MFMA 4ZDEA 4LK5A 5DU8A 3WG5A 3BF0A 3HP0A 4DI1A 2F6QA 5E0SA 3H0JA 4JCRA 4QFEA 4FNBA 2BZRA 4EMLA 2F6IA 3NJDA 3HE2A 3KTJA 1SZOA 2ZQQA 3T8BA 3IBBA 1UIYA 1HNOA 2DEOA 3ZWBA 5IKLB 4JCSA 3H0UA 3HLN1 3GMAA 3JU1A 1EY3A 5DUCA 4QIIA 2FZSA 1OD4A 2F9IA 1FC6A 5INGA 4Q1IA 4ZU2A 4RYFA 4EMMA 3ZW9A 1UYVA 1UYTA 2PG8A 2X24A 4WZ8B 4ELSA 2PPYA 3QKAA 4JSBA 4ZDDA 4K29A 2VREA 3U9TB 1JXZA 4I52A 5C90A 1WDLA 2GTRA 1ON9A 1NZYA 3V5IA 5JBWA 3LAOA 1OD2A 3TT7A 1XNVA 2F9YB 3PEAA 3T8AA 3H81A 4U0HA 3FF6A 5KDRA 1TG6A 3H0QA 4QIJA 2C8TA 1RJMA 3OC7A 3ST9A 4Q0GA 4ELWA 5DUFA 3Q1TA 1XO6A 3TZ3A 1NZYB 3GF7A 1N6DA 1HNUA 4HNKA 4KD6A 3TVUA 3OMEA 1Y7OA 4YLHA 4I42A 1N6FA 4ASIA 2A81A 3R6HA 4HC8A 3RSTA 4FJWD 5INFA 3TDCA 3T89A 4G2RA 5FIFA 5CTBA 1PIXA 5C9GA 5DZKA 3T88A 2A7KA 1XNWA 1MJ3A 3Q0GA 4RCNA 5DZKH 2X58A 2ZL4A 3R9TA
chains in the Genus database with same CATH superfamily
4IZBA 3PE8A 4GM2A 4JCTA 3FDUA 3KTHA 5E0NX 3SLLA 2VSSF 4ZDCA 5MGBA 3R0OA 3QYRA 2F9IB 3TT6A 2CBYA 2J5GD 4JFCA 4B3JA 3GF3A 4K3WA 1ON3A 2ZQRA 5E0SH 4WCZA 3BPPA 4JYLA 4GHNA 2VSSE 1RJNA 2UZFA 4U18A 4JYJA 1FC9A 5INIA 3BEZA 5G1QA 2NP9A 2ZL2A 2VSUE 3TVWA 3KTGA 4WYOB 5DTPA 2Q34A 5KDRB 3NJBA 3GKBA 5G1RA 3VIVA 1EF8A 4ZDFA 4NEKA 2FBMA 3PZKA 3TLFA 1DCIA 1TYFA 4I4ZA 3ZWAA 1SG4A 3K50A 2J5GA 3QMJA 3Q7HA 3PGQA 1XNYA 1Q52A 3QXZA 1PJHA 1YG6A 5DTWA 3QXIA 2F9YA 3MOYA 3N6RB 1YG8A 4B3HA 4J2UA 1W2XA 4U0GA 5JBXA 4NNQA 1J7XA 1X0UA 3RSIA 3R9SA 3OT6A 4OMRA 3G64A 3STAA 1WDMA 4KPKA 2VSSA 2VX2A 3DORA 1WZ8A 1K32A 3DJAA 3KTIA 5CTCA 1FC7A 3Q0JA 1DUBA 4FNDA 2YJGA 4L8KA 1Q51A 3P85A 2CE3A 2QQ3A 2J5IB 3K8XA 2J5IA 3QK8A 3KTKA 3I47A 3L3SA 3GLMA 4FB8A 3P5MA 4Z0MA 2EJ5A 3QWDA 4MXIA 2VSUC 1XX4A 3U9SB 4JCQA 2IEXA 3TV5A 1HZDA 3BPTA 4U0GH 1FCFA 3IAVA 3QREA 3V5EA 4IZDA 4JJTA 4ZDBA 3RRVA 2PBPA 3MT6A 1UYSA 4JVTA 3MYBA 2J5SA 2VSUF 3TRRA 1VRGA 2VSUA 4IZCA 4EMPA 4F47A 3H0SA 4ELXA 3KQFA 5HUQA 5DL1A 4OLQA 4FZWC 1UYRA 3H02A 2Q35A 3HINA 5KJPA 1O8UA 5FUSA 4B3IA 4FN8A 3HRXA 4FN7A 3ZW8A 4K2NA 2J5II 2ZL3A 2DUBA 2W3PA 5DU6A 1EF9A 5DU4A 2HW5A 4FZWA 4U1AA 3IB9A 4OG1A 3M6NA 3ZWCA 2FW2A 4MI2A 2WTBA 5DKPA 4JOTA 4U19A 3SWXA 3P2LA 3LKEA 2A7SA 1K39A 3M6MA 3T3WA 2D3TA 4KNPA 3U9RB 2Q2XA 1WDKA 4L6WA 4KWBA 3R9QA 2ZL0A 4MOUA 4HDTA 4JWVA 3ISAA 5G1SA 1N6EA 4RYFH 3MFMA 4ZDEA 4LK5A 5DU8A 3WG5A 3BF0A 3HP0A 4DI1A 2F6QA 5E0SA 3H0JA 4JCRA 4QFEA 4FNBA 2BZRA 4EMLA 2F6IA 3NJDA 3HE2A 3KTJA 1SZOA 2ZQQA 3T8BA 3IBBA 1UIYA 1HNOA 2DEOA 3ZWBA 5IKLB 4JCSA 3H0UA 3HLN1 3GMAA 3JU1A 1EY3A 5DUCA 4QIIA 2FZSA 1OD4A 2F9IA 1FC6A 5INGA 4Q1IA 4ZU2A 4RYFA 4EMMA 3ZW9A 1UYVA 4NARA 1UYTA 2PG8A 2X24A 4WZ8B 4ELSA 2PPYA 3QKAA 4JSBA 4ZDDA 4K29A 2VREA 3U9TB 1JXZA 4I52A 5C90A 1WDLA 2GTRA 1ON9A 1NZYA 3V5IA 5JBWA 3LAOA 1OD2A 3TT7A 1XNVA 2F9YB 3PEAA 3T8AA 3H81A 4U0HA 3FF6A 5KDRA 1TG6A 3H0QA 4QIJA 2C8TA 1RJMA 3OC7A 3ST9A 4Q0GA 4ELWA 5DUFA 3Q1TA 1XO6A 3TZ3A 1NZYB 3GF7A 1N6DA 1HNUA 4HNKA 4KD6A 3TVUA 3OMEA 1Y7OA 4YLHA 4I42A 1N6FA 4ASIA 2A81A 3R6HA 4HC8A 3RSTA 4FJWD 5INFA 3TDCA 3T89A 4G2RA 5FIFA 5CTBA 1PIXA 5C9GA 5DZKA 3T88A 2A7KA 1XNWA 1MJ3A 3Q0GA 4RCNA 5DZKH 2X58A 2ZL4A 3R9TA
chains in the Genus database with same CATH topology
4IZBA 3PE8A 4GM2A 4JCTA 3FDUA 3KTHA 5E0NX 3SLLA 2VSSF 4ZDCA 5MGBA 3R0OA 3QYRA 2F9IB 3TT6A 2CBYA 2J5GD 4JFCA 4B3JA 3GF3A 4K3WA 1ON3A 2ZQRA 5E0SH 4WCZA 3BPPA 4JYLA 4GHNA 2VSSE 1RJNA 2UZFA 4U18A 4JYJA 1FC9A 5INIA 3BEZA 5G1QA 2NP9A 2ZL2A 2VSUE 3TVWA 3KTGA 4WYOB 5DTPA 2Q34A 5KDRB 3NJBA 3GKBA 5G1RA 3VIVA 1EF8A 4ZDFA 4NEKA 2FBMA 3PZKA 3TLFA 1DCIA 1TYFA 4I4ZA 3ZWAA 1SG4A 3K50A 2J5GA 3QMJA 3Q7HA 3PGQA 1XNYA 1Q52A 3QXZA 1PJHA 1YG6A 5DTWA 3QXIA 2F9YA 3MOYA 3N6RB 1YG8A 4B3HA 4J2UA 1W2XA 4U0GA 5JBXA 4NNQA 1J7XA 1X0UA 3RSIA 3R9SA 3OT6A 4OMRA 3G64A 3STAA 1WDMA 4KPKA 2VSSA 2VX2A 3DORA 1WZ8A 1K32A 3DJAA 3KTIA 5CTCA 1FC7A 3Q0JA 1DUBA 4FNDA 2YJGA 4L8KA 1Q51A 3P85A 2CE3A 2QQ3A 2J5IB 3K8XA 2J5IA 3QK8A 3KTKA 3I47A 3L3SA 3GLMA 4FB8A 3P5MA 4Z0MA 2EJ5A 3QWDA 4MXIA 2VSUC 1XX4A 3U9SB 4JCQA 2IEXA 3TV5A 1HZDA 3BPTA 4U0GH 1FCFA 3IAVA 3QREA 3V5EA 4IZDA 4JJTA 4ZDBA 3RRVA 2PBPA 3MT6A 1UYSA 4JVTA 3MYBA 2J5SA 2VSUF 3TRRA 1VRGA 2VSUA 4IZCA 4EMPA 4F47A 3H0SA 4ELXA 3KQFA 5HUQA 5DL1A 4OLQA 4FZWC 1UYRA 3H02A 2Q35A 3HINA 5KJPA 1O8UA 5FUSA 4B3IA 4FN8A 3HRXA 4FN7A 3ZW8A 4K2NA 2J5II 2ZL3A 2DUBA 2W3PA 5DU6A 1EF9A 5DU4A 2HW5A 4FZWA 4U1AA 3IB9A 4OG1A 3M6NA 3ZWCA 2FW2A 4MI2A 2WTBA 5DKPA 4JOTA 4U19A 3SWXA 3P2LA 3LKEA 2A7SA 1K39A 3M6MA 3T3WA 2D3TA 4KNPA 3U9RB 2Q2XA 1WDKA 4L6WA 4KWBA 3R9QA 2ZL0A 4MOUA 4HDTA 4JWVA 3ISAA 5G1SA 1N6EA 4RYFH 3MFMA 4ZDEA 4LK5A 5DU8A 3WG5A 3BF0A 3HP0A 4DI1A 2F6QA 5E0SA 3H0JA 4JCRA 4QFEA 4FNBA 2BZRA 4EMLA 2F6IA 3NJDA 3HE2A 3KTJA 1SZOA 2ZQQA 3T8BA 3IBBA 1UIYA 1HNOA 2DEOA 3ZWBA 5IKLB 4JCSA 3H0UA 3HLN1 3GMAA 3JU1A 1EY3A 5DUCA 4QIIA 2FZSA 1OD4A 2F9IA 1FC6A 5INGA 4Q1IA 4ZU2A 4RYFA 4EMMA 3ZW9A 1UYVA 4NARA 1UYTA 2PG8A 2X24A 4WZ8B 4ELSA 2PPYA 3QKAA 4JSBA 4ZDDA 4K29A 2VREA 3U9TB 1JXZA 4I52A 5C90A 1WDLA 2GTRA 1ON9A 1NZYA 3V5IA 5JBWA 3LAOA 1OD2A 3TT7A 1XNVA 2F9YB 3PEAA 3T8AA 3H81A 4U0HA 3FF6A 5KDRA 1TG6A 3H0QA 4QIJA 2C8TA 1RJMA 3OC7A 3ST9A 4Q0GA 4ELWA 5DUFA 3Q1TA 1XO6A 3TZ3A 1NZYB 3GF7A 1N6DA 1HNUA 4HNKA 4KD6A 3TVUA 3OMEA 1Y7OA 4YLHA 4I42A 1N6FA 4ASIA 2A81A 3R6HA 4HC8A 3RSTA 4FJWD 5INFA 3TDCA 3T89A 4G2RA 5FIFA 5CTBA 1PIXA 5C9GA 5DZKA 3T88A 2A7KA 1XNWA 1MJ3A 3Q0GA 4RCNA 5DZKH 2X58A 2ZL4A 3R9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZB A;  3PE8 A;  4GM2 A;  4JCT A;  3FDU A;  3KTH A;  5E0N X;  3SLL A;  2VSS F;  4ZDC A;  5MGB A;  3R0O A;  3QYR A;  2F9I B;  3TT6 A;  2CBY A;  2J5G D;  4JFC A;  4B3J A;  3GF3 A;  4K3W A;  1ON3 A;  2ZQR A;  5E0S H;  4WCZ A;  3BPP A;  4JYL A;  4GHN A;  2VSS E;  1RJN A;  2UZF A;  4U18 A;  4JYJ A;  1FC9 A;  5INI A;  3BEZ A;  5G1Q A;  2NP9 A;  2ZL2 A;  2VSU E;  3TVW A;  3KTG A;  4WYO B;  5DTP A;  2Q34 A;  5KDR B;  3NJB A;  3GKB A;  5G1R A;  3VIV A;  1EF8 A;  4ZDF A;  4NEK A;  2FBM A;  3PZK A;  3TLF A;  1DCI A;  1TYF A;  4I4Z A;  3ZWA A;  1SG4 A;  3K50 A;  2J5G A;  3QMJ A;  3Q7H A;  3PGQ A;  1XNY A;  1Q52 A;  3QXZ A;  1PJH A;  1YG6 A;  5DTW A;  3QXI A;  2F9Y A;  3MOY A;  3N6R B;  1YG8 A;  4B3H A;  1W2X A;  4U0G A;  5JBX A;  4NNQ A;  1J7X A;  1X0U A;  3RSI A;  3R9S A;  3OT6 A;  4OMR A;  3G64 A;  3STA A;  1WDM A;  4KPK A;  2VSS A;  2VX2 A;  3DOR A;  1WZ8 A;  1K32 A;  3DJA A;  3KTI A;  5CTC A;  1FC7 A;  3Q0J A;  1DUB A;  4FND A;  4L8K A;  1Q51 A;  3P85 A;  2CE3 A;  2QQ3 A;  2J5I B;  3K8X A;  2J5I A;  3QK8 A;  3KTK A;  3I47 A;  3L3S A;  3GLM A;  4FB8 A;  3P5M A;  4Z0M A;  2EJ5 A;  3QWD A;  4MXI A;  2VSU C;  1XX4 A;  3U9S B;  4JCQ A;  2IEX A;  3TV5 A;  1HZD A;  4U0G H;  1FCF A;  3IAV A;  3QRE A;  3V5E A;  4IZD A;  4JJT A;  4ZDB A;  3RRV A;  2PBP A;  3MT6 A;  1UYS A;  4JVT A;  3MYB A;  2J5S A;  2VSU F;  3TRR A;  1VRG A;  2VSU A;  4IZC A;  4EMP A;  4F47 A;  3H0S A;  4ELX A;  3KQF A;  5DL1 A;  4OLQ A;  4FZW C;  1UYR A;  3H02 A;  2Q35 A;  3HIN A;  5KJP A;  1O8U A;  5FUS A;  4B3I A;  4FN8 A;  3HRX A;  4FN7 A;  3ZW8 A;  4K2N A;  2J5I I;  2ZL3 A;  2DUB A;  2W3P A;  5DU6 A;  1EF9 A;  5DU4 A;  2HW5 A;  4FZW A;  4U1A A;  3IB9 A;  4OG1 A;  3M6N A;  3ZWC A;  2FW2 A;  4MI2 A;  2WTB A;  5DKP A;  4JOT A;  4U19 A;  3SWX A;  3P2L A;  3LKE A;  2A7S A;  1K39 A;  3M6M A;  3T3W A;  2D3T A;  4KNP A;  3U9R B;  2Q2X A;  1WDK A;  4L6W A;  4KWB A;  3R9Q A;  2ZL0 A;  4MOU A;  4JWV A;  3ISA A;  5G1S A;  1N6E A;  4RYF H;  3MFM A;  4ZDE A;  4LK5 A;  5DU8 A;  3WG5 A;  3BF0 A;  3HP0 A;  4DI1 A;  2F6Q A;  5E0S A;  3H0J A;  4JCR A;  4QFE A;  4FNB A;  2BZR A;  4EML A;  2F6I A;  3NJD A;  3HE2 A;  3KTJ A;  1SZO A;  2ZQQ A;  3T8B A;  3IBB A;  1UIY A;  1HNO A;  2DEO A;  3ZWB A;  5IKL B;  4JCS A;  3H0U A;  3HLN 1;  3GMA A;  3JU1 A;  1EY3 A;  5DUC A;  4QII A;  2FZS A;  1OD4 A;  2F9I A;  1FC6 A;  5ING A;  4Q1I A;  4ZU2 A;  4RYF A;  4EMM A;  3ZW9 A;  1UYV A;  1UYT A;  2PG8 A;  2X24 A;  4WZ8 B;  4ELS A;  2PPY A;  3QKA A;  4JSB A;  4ZDD A;  4K29 A;  2VRE A;  3U9T B;  1JXZ A;  4I52 A;  5C90 A;  1WDL A;  2GTR A;  1ON9 A;  1NZY A;  3V5I A;  5JBW A;  3LAO A;  1OD2 A;  3TT7 A;  1XNV A;  2F9Y B;  3PEA A;  3T8A A;  3H81 A;  4U0H A;  3FF6 A;  5KDR A;  1TG6 A;  3H0Q A;  4QIJ A;  2C8T A;  1RJM A;  3OC7 A;  3ST9 A;  4Q0G A;  4ELW A;  5DUF A;  3Q1T A;  1XO6 A;  3TZ3 A;  1NZY B;  3GF7 A;  1N6D A;  1HNU A;  4HNK A;  4KD6 A;  3TVU A;  3OME A;  1Y7O A;  4YLH A;  4I42 A;  1N6F A;  4ASI A;  2A81 A;  3R6H A;  4HC8 A;  3RST A;  4FJW D;  5INF A;  3TDC A;  3T89 A;  4G2R A;  5FIF A;  5CTB A;  1PIX A;  5C9G A;  5DZK A;  3T88 A;  2A7K A;  1XNW A;  1MJ3 A;  3Q0G A;  4RCN A;  5DZK H;  2X58 A;  2ZL4 A;  3R9T A; 
#chains in the Genus database with same CATH topology
 4IZB A;  3PE8 A;  4GM2 A;  4JCT A;  3FDU A;  3KTH A;  5E0N X;  3SLL A;  2VSS F;  4ZDC A;  5MGB A;  3R0O A;  3QYR A;  2F9I B;  3TT6 A;  2CBY A;  2J5G D;  4JFC A;  4B3J A;  3GF3 A;  4K3W A;  1ON3 A;  2ZQR A;  5E0S H;  4WCZ A;  3BPP A;  4JYL A;  4GHN A;  2VSS E;  1RJN A;  2UZF A;  4U18 A;  4JYJ A;  1FC9 A;  5INI A;  3BEZ A;  5G1Q A;  2NP9 A;  2ZL2 A;  2VSU E;  3TVW A;  3KTG A;  4WYO B;  5DTP A;  2Q34 A;  5KDR B;  3NJB A;  3GKB A;  5G1R A;  3VIV A;  1EF8 A;  4ZDF A;  4NEK A;  2FBM A;  3PZK A;  3TLF A;  1DCI A;  1TYF A;  4I4Z A;  3ZWA A;  1SG4 A;  3K50 A;  2J5G A;  3QMJ A;  3Q7H A;  3PGQ A;  1XNY A;  1Q52 A;  3QXZ A;  1PJH A;  1YG6 A;  5DTW A;  3QXI A;  2F9Y A;  3MOY A;  3N6R B;  1YG8 A;  4B3H A;  4J2U A;  1W2X A;  4U0G A;  5JBX A;  4NNQ A;  1J7X A;  1X0U A;  3RSI A;  3R9S A;  3OT6 A;  4OMR A;  3G64 A;  3STA A;  1WDM A;  4KPK A;  2VSS A;  2VX2 A;  3DOR A;  1WZ8 A;  1K32 A;  3DJA A;  3KTI A;  5CTC A;  1FC7 A;  3Q0J A;  1DUB A;  4FND A;  2YJG A;  4L8K A;  1Q51 A;  3P85 A;  2CE3 A;  2QQ3 A;  2J5I B;  3K8X A;  2J5I A;  3QK8 A;  3KTK A;  3I47 A;  3L3S A;  3GLM A;  4FB8 A;  3P5M A;  4Z0M A;  2EJ5 A;  3QWD A;  4MXI A;  2VSU C;  1XX4 A;  3U9S B;  4JCQ A;  2IEX A;  3TV5 A;  1HZD A;  3BPT A;  4U0G H;  1FCF A;  3IAV A;  3QRE A;  3V5E A;  4IZD A;  4JJT A;  4ZDB A;  3RRV A;  2PBP A;  3MT6 A;  1UYS A;  4JVT A;  3MYB A;  2J5S A;  2VSU F;  3TRR A;  1VRG A;  2VSU A;  4IZC A;  4EMP A;  4F47 A;  3H0S A;  4ELX A;  3KQF A;  5HUQ A;  5DL1 A;  4OLQ A;  4FZW C;  1UYR A;  3H02 A;  2Q35 A;  3HIN A;  5KJP A;  1O8U A;  5FUS A;  4B3I A;  4FN8 A;  3HRX A;  4FN7 A;  3ZW8 A;  4K2N A;  2J5I I;  2ZL3 A;  2DUB A;  2W3P A;  5DU6 A;  1EF9 A;  5DU4 A;  2HW5 A;  4FZW A;  4U1A A;  3IB9 A;  4OG1 A;  3M6N A;  3ZWC A;  2FW2 A;  4MI2 A;  2WTB A;  5DKP A;  4JOT A;  4U19 A;  3SWX A;  3P2L A;  3LKE A;  2A7S A;  1K39 A;  3M6M A;  3T3W A;  2D3T A;  4KNP A;  3U9R B;  2Q2X A;  1WDK A;  4L6W A;  4KWB A;  3R9Q A;  2ZL0 A;  4MOU A;  4HDT A;  4JWV A;  3ISA A;  5G1S A;  1N6E A;  4RYF H;  3MFM A;  4ZDE A;  4LK5 A;  5DU8 A;  3WG5 A;  3BF0 A;  3HP0 A;  4DI1 A;  2F6Q A;  5E0S A;  3H0J A;  4JCR A;  4QFE A;  4FNB A;  2BZR A;  4EML A;  2F6I A;  3NJD A;  3HE2 A;  3KTJ A;  1SZO A;  2ZQQ A;  3T8B A;  3IBB A;  1UIY A;  1HNO A;  2DEO A;  3ZWB A;  5IKL B;  4JCS A;  3H0U A;  3HLN 1;  3GMA A;  3JU1 A;  1EY3 A;  5DUC A;  4QII A;  2FZS A;  1OD4 A;  2F9I A;  1FC6 A;  5ING A;  4Q1I A;  4ZU2 A;  4RYF A;  4EMM A;  3ZW9 A;  1UYV A;  4NAR A;  1UYT A;  2PG8 A;  2X24 A;  4WZ8 B;  4ELS A;  2PPY A;  3QKA A;  4JSB A;  4ZDD A;  4K29 A;  2VRE A;  3U9T B;  1JXZ A;  4I52 A;  5C90 A;  1WDL A;  2GTR A;  1ON9 A;  1NZY A;  3V5I A;  5JBW A;  3LAO A;  1OD2 A;  3TT7 A;  1XNV A;  2F9Y B;  3PEA A;  3T8A A;  3H81 A;  4U0H A;  3FF6 A;  5KDR A;  1TG6 A;  3H0Q A;  4QIJ A;  2C8T A;  1RJM A;  3OC7 A;  3ST9 A;  4Q0G A;  4ELW A;  5DUF A;  3Q1T A;  1XO6 A;  3TZ3 A;  1NZY B;  3GF7 A;  1N6D A;  1HNU A;  4HNK A;  4KD6 A;  3TVU A;  3OME A;  1Y7O A;  4YLH A;  4I42 A;  1N6F A;  4ASI A;  2A81 A;  3R6H A;  4HC8 A;  3RST A;  4FJW D;  5INF A;  3TDC A;  3T89 A;  4G2R A;  5FIF A;  5CTB A;  1PIX A;  5C9G A;  5DZK A;  3T88 A;  2A7K A;  1XNW A;  1MJ3 A;  3Q0G A;  4RCN A;  5DZK H;  2X58 A;  2ZL4 A;  3R9T A; 
#chains in the Genus database with same CATH homology
 4IZB A;  3PE8 A;  4GM2 A;  4JCT A;  3FDU A;  3KTH A;  5E0N X;  3SLL A;  2VSS F;  4ZDC A;  5MGB A;  3R0O A;  3QYR A;  2F9I B;  3TT6 A;  2CBY A;  2J5G D;  4JFC A;  4B3J A;  3GF3 A;  4K3W A;  1ON3 A;  2ZQR A;  5E0S H;  4WCZ A;  3BPP A;  4JYL A;  4GHN A;  2VSS E;  1RJN A;  2UZF A;  4U18 A;  4JYJ A;  1FC9 A;  5INI A;  3BEZ A;  5G1Q A;  2NP9 A;  2ZL2 A;  2VSU E;  3TVW A;  3KTG A;  4WYO B;  5DTP A;  2Q34 A;  5KDR B;  3NJB A;  3GKB A;  5G1R A;  3VIV A;  1EF8 A;  4ZDF A;  4NEK A;  2FBM A;  3PZK A;  3TLF A;  1DCI A;  1TYF A;  4I4Z A;  3ZWA A;  1SG4 A;  3K50 A;  2J5G A;  3QMJ A;  3Q7H A;  3PGQ A;  1XNY A;  1Q52 A;  3QXZ A;  1PJH A;  1YG6 A;  5DTW A;  3QXI A;  2F9Y A;  3MOY A;  3N6R B;  1YG8 A;  4B3H A;  4J2U A;  1W2X A;  4U0G A;  5JBX A;  4NNQ A;  1J7X A;  1X0U A;  3RSI A;  3R9S A;  3OT6 A;  4OMR A;  3G64 A;  3STA A;  1WDM A;  4KPK A;  2VSS A;  2VX2 A;  3DOR A;  1WZ8 A;  1K32 A;  3DJA A;  3KTI A;  5CTC A;  1FC7 A;  3Q0J A;  1DUB A;  4FND A;  2YJG A;  4L8K A;  1Q51 A;  3P85 A;  2CE3 A;  2QQ3 A;  2J5I B;  3K8X A;  2J5I A;  3QK8 A;  3KTK A;  3I47 A;  3L3S A;  3GLM A;  4FB8 A;  3P5M A;  4Z0M A;  2EJ5 A;  3QWD A;  4MXI A;  2VSU C;  1XX4 A;  3U9S B;  4JCQ A;  2IEX A;  3TV5 A;  1HZD A;  3BPT A;  4U0G H;  1FCF A;  3IAV A;  3QRE A;  3V5E A;  4IZD A;  4JJT A;  4ZDB A;  3RRV A;  2PBP A;  3MT6 A;  1UYS A;  4JVT A;  3MYB A;  2J5S A;  2VSU F;  3TRR A;  1VRG A;  2VSU A;  4IZC A;  4EMP A;  4F47 A;  3H0S A;  4ELX A;  3KQF A;  5HUQ A;  5DL1 A;  4OLQ A;  4FZW C;  1UYR A;  3H02 A;  2Q35 A;  3HIN A;  5KJP A;  1O8U A;  5FUS A;  4B3I A;  4FN8 A;  3HRX A;  4FN7 A;  3ZW8 A;  4K2N A;  2J5I I;  2ZL3 A;  2DUB A;  2W3P A;  5DU6 A;  1EF9 A;  5DU4 A;  2HW5 A;  4FZW A;  4U1A A;  3IB9 A;  4OG1 A;  3M6N A;  3ZWC A;  2FW2 A;  4MI2 A;  2WTB A;  5DKP A;  4JOT A;  4U19 A;  3SWX A;  3P2L A;  3LKE A;  2A7S A;  1K39 A;  3M6M A;  3T3W A;  2D3T A;  4KNP A;  3U9R B;  2Q2X A;  1WDK A;  4L6W A;  4KWB A;  3R9Q A;  2ZL0 A;  4MOU A;  4HDT A;  4JWV A;  3ISA A;  5G1S A;  1N6E A;  4RYF H;  3MFM A;  4ZDE A;  4LK5 A;  5DU8 A;  3WG5 A;  3BF0 A;  3HP0 A;  4DI1 A;  2F6Q A;  5E0S A;  3H0J A;  4JCR A;  4QFE A;  4FNB A;  2BZR A;  4EML A;  2F6I A;  3NJD A;  3HE2 A;  3KTJ A;  1SZO A;  2ZQQ A;  3T8B A;  3IBB A;  1UIY A;  1HNO A;  2DEO A;  3ZWB A;  5IKL B;  4JCS A;  3H0U A;  3HLN 1;  3GMA A;  3JU1 A;  1EY3 A;  5DUC A;  4QII A;  2FZS A;  1OD4 A;  2F9I A;  1FC6 A;  5ING A;  4Q1I A;  4ZU2 A;  4RYF A;  4EMM A;  3ZW9 A;  1UYV A;  4NAR A;  1UYT A;  2PG8 A;  2X24 A;  4WZ8 B;  4ELS A;  2PPY A;  3QKA A;  4JSB A;  4ZDD A;  4K29 A;  2VRE A;  3U9T B;  1JXZ A;  4I52 A;  5C90 A;  1WDL A;  2GTR A;  1ON9 A;  1NZY A;  3V5I A;  5JBW A;  3LAO A;  1OD2 A;  3TT7 A;  1XNV A;  2F9Y B;  3PEA A;  3T8A A;  3H81 A;  4U0H A;  3FF6 A;  5KDR A;  1TG6 A;  3H0Q A;  4QIJ A;  2C8T A;  1RJM A;  3OC7 A;  3ST9 A;  4Q0G A;  4ELW A;  5DUF A;  3Q1T A;  1XO6 A;  3TZ3 A;  1NZY B;  3GF7 A;  1N6D A;  1HNU A;  4HNK A;  4KD6 A;  3TVU A;  3OME A;  1Y7O A;  4YLH A;  4I42 A;  1N6F A;  4ASI A;  2A81 A;  3R6H A;  4HC8 A;  3RST A;  4FJW D;  5INF A;  3TDC A;  3T89 A;  4G2R A;  5FIF A;  5CTB A;  1PIX A;  5C9G A;  5DZK A;  3T88 A;  2A7K A;  1XNW A;  1MJ3 A;  3Q0G A;  4RCN A;  5DZK H;  2X58 A;  2ZL4 A;  3R9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...