4Z0MA

Echa5 mycobacterium tuberculosis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
241
Chain Sequence
b'DLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRDDAASVAVLWGAGGTFCAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVPADEALAMGLANRVVPKGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAALDLEFASIARVAGEALEGARRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase
publication title Unsaturated Lipid Assimilation by Mycobacteria Requires Auxiliary cis-trans Enoyl CoA Isomerase
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
molecule tags Lyase
total genus 81
structure length 241
sequence length 241
chains with identical sequence B, C
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 4z0mA01
3MOYA 5DU4A 3Q0GA 5G1QA 1TG6A 4LK5A 3H81A 3P5MA 2C8TA 4DI1A 1YG8A 5DZKA 1PJHA 4FN8A 3G64A 3PEAA 1W2XA 3MYBA 3HLN1 4MOUA 3KTJA 4WCZA 3QMJA 5DUCA 3K8XA 2QQ3A 3M6NA 3GF3A 2X58A 2J5II 1EY3A 4U19A 2EJ5A 3QXIA 4FB8A 3DORA 1FC6A 3PE8A 4U0GH 1N6EA 2CBYA 5E0NX 3N6RB 4RYFA 3ZW8A 4OMRA 4B3JA 4KNPA 3SWXA 4Z0MA 1UYTA 2HW5A 5KDRB 4EMMA 3ISAA 4OG1A 3KTHA 3R9TA 3RSIA 5C9GA 1YG6A 3TRRA 3TV5A 5FUSA 3BPPA 2A7SA 2ZQQA 2A81A 1XO6A 5CTCA 5G1RA 1SZOA 3GLMA 1TYFA 3QWDA 5DL1A 3SLLA 4IZBA 1NZYB 4I52A 4JOTA 4L8KA 4ZDCA 4ZDDA 1XNYA 2PG8A 3JU1A 1UIYA 4ZU2A 2F9YA 3P85A 2VSSF 5DUFA 4ELWA 4JSBA 3R6HA 3U9RB 4B3IA 3QXZA 2BZRA 4GHNA 5DU8A 2F9IB 4Q0GA 2X24A 2DUBA 2VREA 2F6IA 4L6WA 4JYJA 3TT7A 2UZFA 1FCFA 2GTRA 2Q35A 2D3TA 1Q52A 3H0JA 5E0SH 4ZDEA 2Q2XA 3IAVA 2VSUC 3R0OA 3U9TB 1Y7OA 1HNOA 1FC7A 4HNKA 3BF0A 1RJNA 1OD4A 1ON3A 2A7KA 1XX4A 3R9SA 3ST9A 1XNVA 2VSUF 4JCQA 3KTGA 3T89A 1MJ3A 2VX2A 3Q1TA 3HP0A 5IKLB 2F6QA 5KDRA 4FN7A 1X0UA 4QIIA 2ZL0A 4ELXA 3H0UA 4K3WA 5DZKH 2FW2A 1XNWA 3T8AA 1N6FA 3P2LA 3V5IA 1ON9A 2PPYA 5JBXA 3L3SA 4WZ8B 3V5EA 3Q7HA 4JYLA 1DCIA 3ZWAA 1NZYA 1HZDA 3TDCA 5JBWA 4FJWD 1UYVA 2VSSE 3HINA 4RYFH 1EF9A 2PBPA 3QKAA 3T88A 4JCRA 2CE3A 4MI2A 1FC9A 3ZWBA 3HRXA 4I42A 1O8UA 2VSSA 3MFMA 3R9QA 1DUBA 1WDKA 2WTBA 2J5SA 5INFA 2F9IA 4NEKA 1WZ8A 5DKPA 4U1AA 4FNDA 2NP9A 2IEXA 3BEZA 4ELSA 4JJTA 3IB9A 2W3PA 4G2RA 3ZWCA 3KTIA 3WG5A 4QIJA 3TT6A 3LKEA 5CTBA 4U0HA 4U0GA 4ASIA 5DU6A 1J7XA 3STAA 1UYRA 4I4ZA 5DTPA 4YLHA 4ZDBA 3NJDA 3RSTA 4JVTA 2VSUE 4JWVA 1WDMA 4KWBA 3U9SB 2VSUA 2DEOA 3TVWA 3H0SA 3T8BA 4KPKA 4MXIA 4KD6A 2ZL3A 4GM2A 4Q1IA 1Q51A 3GMAA 2ZL2A 2J5GA 3FDUA 4U18A 2ZL4A 1WDLA 3PGQA 5INGA 3T3WA 3MT6A 1K39A 2J5IA 4JCSA 5FIFA 5MGBA 1VRGA 3K50A 2J5IB 4IZDA 5DTWA 3NJBA 3FF6A 4B3HA 4NNQA 3LAOA 3OC7A 1N6DA 3TLFA 4K29A 4JFCA 4WYOB 3QREA 1K32A 2ZQRA 4EMPA 1SG4A 3GF7A 3VIVA 3RRVA 3PZKA 3TVUA 3QK8A 5G1SA 5C90A 3OT6A 2FZSA 3KQFA 3TZ3A 4EMLA 4F47A 4OLQA 4FNBA 5E0SA 3OMEA 3KTKA 3H02A 4IZCA 1PIXA 4FZWC 1HNUA 3Q0JA 3GKBA 2J5GD 3I47A 4QFEA 1RJMA 2Q34A 3DJAA 1EF8A 2F9YB 3M6MA 2FBMA 1OD2A 3HE2A 4RCNA 5KJPA 4FZWA 4ZDFA 1UYSA 3ZW9A 5INIA 1JXZA 4K2NA 3H0QA 4JCTA 3QYRA 3IBBA 4HC8A
chains in the Genus database with same CATH superfamily
3MOYA 5DU4A 3Q0GA 5G1QA 1TG6A 4LK5A 3H81A 3P5MA 2C8TA 4DI1A 1YG8A 5DZKA 1PJHA 4FN8A 3G64A 3PEAA 1W2XA 3MYBA 3HLN1 4MOUA 3KTJA 4WCZA 3QMJA 5DUCA 3K8XA 2QQ3A 3M6NA 3GF3A 2X58A 2J5II 4HDTA 1EY3A 4U19A 2EJ5A 3QXIA 4FB8A 3DORA 1FC6A 3PE8A 4U0GH 1N6EA 2CBYA 5E0NX 3N6RB 4RYFA 3ZW8A 4OMRA 4B3JA 4KNPA 3SWXA 4Z0MA 1UYTA 2HW5A 5KDRB 4EMMA 3ISAA 4NARA 4OG1A 3KTHA 3R9TA 3RSIA 5C9GA 1YG6A 3TRRA 3TV5A 5FUSA 3BPPA 2A7SA 2ZQQA 2A81A 1XO6A 5CTCA 5G1RA 1SZOA 3GLMA 1TYFA 3QWDA 5DL1A 3SLLA 4IZBA 1NZYB 4I52A 4JOTA 4L8KA 4ZDCA 4ZDDA 1XNYA 2PG8A 3JU1A 4J2UA 1UIYA 4ZU2A 2F9YA 3P85A 2VSSF 5DUFA 4ELWA 4JSBA 3R6HA 3U9RB 4B3IA 3QXZA 2BZRA 4GHNA 5DU8A 2F9IB 4Q0GA 2X24A 2DUBA 2VREA 2F6IA 4L6WA 4JYJA 3TT7A 2UZFA 1FCFA 2GTRA 2Q35A 2D3TA 1Q52A 3H0JA 5E0SH 4ZDEA 2Q2XA 3IAVA 2VSUC 3R0OA 3U9TB 1Y7OA 1HNOA 1FC7A 4HNKA 3BF0A 1RJNA 1OD4A 1ON3A 2A7KA 1XX4A 3R9SA 3ST9A 1XNVA 2VSUF 4JCQA 3KTGA 3T89A 1MJ3A 2VX2A 3Q1TA 3HP0A 5IKLB 2F6QA 5KDRA 4FN7A 1X0UA 4QIIA 2ZL0A 4ELXA 3H0UA 4K3WA 5DZKH 2FW2A 1XNWA 3T8AA 1N6FA 3P2LA 3V5IA 1ON9A 2PPYA 5JBXA 3L3SA 4WZ8B 3V5EA 3Q7HA 4JYLA 1DCIA 3ZWAA 1NZYA 1HZDA 3TDCA 5JBWA 4FJWD 1UYVA 2VSSE 3HINA 5HUQA 4RYFH 1EF9A 2PBPA 3QKAA 3BPTA 4JCRA 3T88A 2CE3A 4MI2A 1FC9A 3ZWBA 3HRXA 4I42A 1O8UA 2VSSA 3MFMA 2YJGA 3R9QA 1DUBA 1WDKA 2WTBA 2J5SA 5INFA 2F9IA 4NEKA 1WZ8A 5DKPA 4U1AA 4FNDA 2NP9A 2IEXA 3BEZA 4ELSA 4JJTA 3IB9A 2W3PA 4G2RA 3ZWCA 3KTIA 3WG5A 4QIJA 3TT6A 3LKEA 5CTBA 4U0HA 4U0GA 4ASIA 5DU6A 1J7XA 3STAA 1UYRA 4I4ZA 5DTPA 4YLHA 4ZDBA 3NJDA 3RSTA 4JVTA 2VSUE 4JWVA 1WDMA 4KWBA 3U9SB 2VSUA 2DEOA 3TVWA 3H0SA 3T8BA 4KPKA 4MXIA 4KD6A 2ZL3A 4GM2A 4Q1IA 1Q51A 3GMAA 2ZL2A 2J5GA 3FDUA 4U18A 2ZL4A 1WDLA 3PGQA 5INGA 3T3WA 3MT6A 1K39A 2J5IA 4JCSA 5FIFA 5MGBA 1VRGA 3K50A 2J5IB 4IZDA 5DTWA 3NJBA 3FF6A 4B3HA 4NNQA 3LAOA 3OC7A 1N6DA 3TLFA 4K29A 4JFCA 4WYOB 3QREA 1K32A 2ZQRA 4EMPA 1SG4A 3GF7A 3VIVA 3RRVA 3PZKA 3TVUA 3QK8A 5G1SA 5C90A 3OT6A 2FZSA 3KQFA 3TZ3A 4EMLA 4F47A 4OLQA 4FNBA 5E0SA 3OMEA 3KTKA 3H02A 4IZCA 1PIXA 4FZWC 1HNUA 3Q0JA 3GKBA 2J5GD 3I47A 4QFEA 1RJMA 2Q34A 3DJAA 1EF8A 2F9YB 3M6MA 2FBMA 1OD2A 3HE2A 4RCNA 5KJPA 4FZWA 4ZDFA 1UYSA 3ZW9A 5INIA 1JXZA 4K2NA 3H0QA 4JCTA 3QYRA 3IBBA 4HC8A
chains in the Genus database with same CATH topology
3MOYA 5DU4A 3Q0GA 5G1QA 1TG6A 4LK5A 3H81A 3P5MA 2C8TA 4DI1A 1YG8A 5DZKA 1PJHA 4FN8A 3G64A 3PEAA 1W2XA 3MYBA 3HLN1 4MOUA 3KTJA 4WCZA 3QMJA 5DUCA 3K8XA 2QQ3A 3M6NA 3GF3A 2X58A 2J5II 4HDTA 1EY3A 4U19A 2EJ5A 3QXIA 4FB8A 3DORA 1FC6A 3PE8A 4U0GH 1N6EA 2CBYA 5E0NX 3N6RB 4RYFA 3ZW8A 4OMRA 4B3JA 4KNPA 3SWXA 4Z0MA 1UYTA 2HW5A 5KDRB 4EMMA 3ISAA 4NARA 4OG1A 3KTHA 3R9TA 3RSIA 5C9GA 1YG6A 3TRRA 3TV5A 5FUSA 3BPPA 2A7SA 2ZQQA 2A81A 1XO6A 5CTCA 5G1RA 1SZOA 3GLMA 1TYFA 3QWDA 5DL1A 3SLLA 4IZBA 1NZYB 4I52A 4JOTA 4L8KA 4ZDCA 4ZDDA 1XNYA 2PG8A 3JU1A 4J2UA 1UIYA 4ZU2A 2F9YA 3P85A 2VSSF 5DUFA 4ELWA 4JSBA 3R6HA 3U9RB 4B3IA 3QXZA 2BZRA 4GHNA 5DU8A 2F9IB 4Q0GA 2X24A 2DUBA 2VREA 2F6IA 4L6WA 4JYJA 3TT7A 2UZFA 1FCFA 2GTRA 2Q35A 2D3TA 1Q52A 3H0JA 5E0SH 4ZDEA 2Q2XA 3IAVA 2VSUC 3R0OA 3U9TB 1Y7OA 1HNOA 1FC7A 4HNKA 3BF0A 1RJNA 1OD4A 1ON3A 2A7KA 1XX4A 3R9SA 3ST9A 1XNVA 2VSUF 4JCQA 3KTGA 3T89A 1MJ3A 2VX2A 3Q1TA 3HP0A 5IKLB 2F6QA 5KDRA 4FN7A 1X0UA 4QIIA 2ZL0A 4ELXA 3H0UA 4K3WA 5DZKH 2FW2A 1XNWA 3T8AA 1N6FA 3P2LA 3V5IA 1ON9A 2PPYA 5JBXA 3L3SA 4WZ8B 3V5EA 3Q7HA 4JYLA 1DCIA 3ZWAA 1NZYA 1HZDA 3TDCA 5JBWA 4FJWD 1UYVA 2VSSE 3HINA 5HUQA 4RYFH 1EF9A 2PBPA 3QKAA 3BPTA 4JCRA 3T88A 2CE3A 4MI2A 1FC9A 3ZWBA 3HRXA 4I42A 1O8UA 2VSSA 3MFMA 2YJGA 3R9QA 1DUBA 1WDKA 2WTBA 2J5SA 5INFA 2F9IA 4NEKA 1WZ8A 5DKPA 4U1AA 4FNDA 2NP9A 2IEXA 3BEZA 4ELSA 4JJTA 3IB9A 2W3PA 4G2RA 3ZWCA 3KTIA 3WG5A 4QIJA 3TT6A 3LKEA 5CTBA 4U0HA 4U0GA 4ASIA 5DU6A 1J7XA 3STAA 1UYRA 4I4ZA 5DTPA 4YLHA 4ZDBA 3NJDA 3RSTA 4JVTA 2VSUE 4JWVA 1WDMA 4KWBA 3U9SB 2VSUA 2DEOA 3TVWA 3H0SA 3T8BA 4KPKA 4MXIA 4KD6A 2ZL3A 4GM2A 4Q1IA 1Q51A 3GMAA 2ZL2A 2J5GA 3FDUA 4U18A 2ZL4A 1WDLA 3PGQA 5INGA 3T3WA 3MT6A 1K39A 2J5IA 4JCSA 5FIFA 5MGBA 1VRGA 3K50A 2J5IB 4IZDA 5DTWA 3NJBA 3FF6A 4B3HA 4NNQA 3LAOA 3OC7A 1N6DA 3TLFA 4K29A 4JFCA 4WYOB 3QREA 1K32A 2ZQRA 4EMPA 1SG4A 3GF7A 3VIVA 3RRVA 3PZKA 3TVUA 3QK8A 5G1SA 5C90A 3OT6A 2FZSA 3KQFA 3TZ3A 4EMLA 4F47A 4OLQA 4FNBA 5E0SA 3OMEA 3KTKA 3H02A 4IZCA 1PIXA 4FZWC 1HNUA 3Q0JA 3GKBA 2J5GD 3I47A 4QFEA 1RJMA 2Q34A 3DJAA 1EF8A 2F9YB 3M6MA 2FBMA 1OD2A 3HE2A 4RCNA 5KJPA 4FZWA 4ZDFA 1UYSA 3ZW9A 5INIA 1JXZA 4K2NA 3H0QA 4JCTA 3QYRA 3IBBA 4HC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MOY A;  5DU4 A;  3Q0G A;  5G1Q A;  1TG6 A;  4LK5 A;  3H81 A;  3P5M A;  2C8T A;  4DI1 A;  1YG8 A;  5DZK A;  1PJH A;  4FN8 A;  3G64 A;  3PEA A;  1W2X A;  3MYB A;  3HLN 1;  4MOU A;  3KTJ A;  4WCZ A;  3QMJ A;  5DUC A;  3K8X A;  2QQ3 A;  3M6N A;  3GF3 A;  2X58 A;  2J5I I;  1EY3 A;  4U19 A;  2EJ5 A;  3QXI A;  4FB8 A;  3DOR A;  1FC6 A;  3PE8 A;  4U0G H;  1N6E A;  2CBY A;  5E0N X;  3N6R B;  4RYF A;  3ZW8 A;  4OMR A;  4B3J A;  4KNP A;  3SWX A;  4Z0M A;  1UYT A;  2HW5 A;  5KDR B;  4EMM A;  3ISA A;  4OG1 A;  3KTH A;  3R9T A;  3RSI A;  5C9G A;  1YG6 A;  3TRR A;  3TV5 A;  5FUS A;  3BPP A;  2A7S A;  2ZQQ A;  2A81 A;  1XO6 A;  5CTC A;  5G1R A;  1SZO A;  3GLM A;  1TYF A;  3QWD A;  5DL1 A;  3SLL A;  4IZB A;  1NZY B;  4I52 A;  4JOT A;  4L8K A;  4ZDC A;  4ZDD A;  1XNY A;  2PG8 A;  3JU1 A;  1UIY A;  4ZU2 A;  2F9Y A;  3P85 A;  2VSS F;  5DUF A;  4ELW A;  4JSB A;  3R6H A;  3U9R B;  4B3I A;  3QXZ A;  2BZR A;  4GHN A;  5DU8 A;  2F9I B;  4Q0G A;  2X24 A;  2DUB A;  2VRE A;  2F6I A;  4L6W A;  4JYJ A;  3TT7 A;  2UZF A;  1FCF A;  2GTR A;  2Q35 A;  2D3T A;  1Q52 A;  3H0J A;  5E0S H;  4ZDE A;  2Q2X A;  3IAV A;  2VSU C;  3R0O A;  3U9T B;  1Y7O A;  1HNO A;  1FC7 A;  4HNK A;  3BF0 A;  1RJN A;  1OD4 A;  1ON3 A;  2A7K A;  1XX4 A;  3R9S A;  3ST9 A;  1XNV A;  2VSU F;  4JCQ A;  3KTG A;  3T89 A;  1MJ3 A;  2VX2 A;  3Q1T A;  3HP0 A;  5IKL B;  2F6Q A;  5KDR A;  4FN7 A;  1X0U A;  4QII A;  2ZL0 A;  4ELX A;  3H0U A;  4K3W A;  5DZK H;  2FW2 A;  1XNW A;  3T8A A;  1N6F A;  3P2L A;  3V5I A;  1ON9 A;  2PPY A;  5JBX A;  3L3S A;  4WZ8 B;  3V5E A;  3Q7H A;  4JYL A;  1DCI A;  3ZWA A;  1NZY A;  1HZD A;  3TDC A;  5JBW A;  4FJW D;  1UYV A;  2VSS E;  3HIN A;  4RYF H;  1EF9 A;  2PBP A;  3QKA A;  3T88 A;  4JCR A;  2CE3 A;  4MI2 A;  1FC9 A;  3ZWB A;  3HRX A;  4I42 A;  1O8U A;  2VSS A;  3MFM A;  3R9Q A;  1DUB A;  1WDK A;  2WTB A;  2J5S A;  5INF A;  2F9I A;  4NEK A;  1WZ8 A;  5DKP A;  4U1A A;  4FND A;  2NP9 A;  2IEX A;  3BEZ A;  4ELS A;  4JJT A;  3IB9 A;  2W3P A;  4G2R A;  3ZWC A;  3KTI A;  3WG5 A;  4QIJ A;  3TT6 A;  3LKE A;  5CTB A;  4U0H A;  4U0G A;  4ASI A;  5DU6 A;  1J7X A;  3STA A;  1UYR A;  4I4Z A;  5DTP A;  4YLH A;  4ZDB A;  3NJD A;  3RST A;  4JVT A;  2VSU E;  4JWV A;  1WDM A;  4KWB A;  3U9S B;  2VSU A;  2DEO A;  3TVW A;  3H0S A;  3T8B A;  4KPK A;  4MXI A;  4KD6 A;  2ZL3 A;  4GM2 A;  4Q1I A;  1Q51 A;  3GMA A;  2ZL2 A;  2J5G A;  3FDU A;  4U18 A;  2ZL4 A;  1WDL A;  3PGQ A;  5ING A;  3T3W A;  3MT6 A;  1K39 A;  2J5I A;  4JCS A;  5FIF A;  5MGB A;  1VRG A;  3K50 A;  2J5I B;  4IZD A;  5DTW A;  3NJB A;  3FF6 A;  4B3H A;  4NNQ A;  3LAO A;  3OC7 A;  1N6D A;  3TLF A;  4K29 A;  4JFC A;  4WYO B;  3QRE A;  1K32 A;  2ZQR A;  4EMP A;  1SG4 A;  3GF7 A;  3VIV A;  3RRV A;  3PZK A;  3TVU A;  3QK8 A;  5G1S A;  5C90 A;  3OT6 A;  2FZS A;  3KQF A;  3TZ3 A;  4EML A;  4F47 A;  4OLQ A;  4FNB A;  5E0S A;  3OME A;  3KTK A;  3H02 A;  4IZC A;  1PIX A;  4FZW C;  1HNU A;  3Q0J A;  3GKB A;  2J5G D;  3I47 A;  4QFE A;  1RJM A;  2Q34 A;  3DJA A;  1EF8 A;  2F9Y B;  3M6M A;  2FBM A;  1OD2 A;  3HE2 A;  4RCN A;  5KJP A;  4FZW A;  4ZDF A;  1UYS A;  3ZW9 A;  5INI A;  1JXZ A;  4K2N A;  3H0Q A;  4JCT A;  3QYR A;  3IBB A;  4HC8 A; 
#chains in the Genus database with same CATH topology
 3MOY A;  5DU4 A;  3Q0G A;  5G1Q A;  1TG6 A;  4LK5 A;  3H81 A;  3P5M A;  2C8T A;  4DI1 A;  1YG8 A;  5DZK A;  1PJH A;  4FN8 A;  3G64 A;  3PEA A;  1W2X A;  3MYB A;  3HLN 1;  4MOU A;  3KTJ A;  4WCZ A;  3QMJ A;  5DUC A;  3K8X A;  2QQ3 A;  3M6N A;  3GF3 A;  2X58 A;  2J5I I;  4HDT A;  1EY3 A;  4U19 A;  2EJ5 A;  3QXI A;  4FB8 A;  3DOR A;  1FC6 A;  3PE8 A;  4U0G H;  1N6E A;  2CBY A;  5E0N X;  3N6R B;  4RYF A;  3ZW8 A;  4OMR A;  4B3J A;  4KNP A;  3SWX A;  4Z0M A;  1UYT A;  2HW5 A;  5KDR B;  4EMM A;  3ISA A;  4NAR A;  4OG1 A;  3KTH A;  3R9T A;  3RSI A;  5C9G A;  1YG6 A;  3TRR A;  3TV5 A;  5FUS A;  3BPP A;  2A7S A;  2ZQQ A;  2A81 A;  1XO6 A;  5CTC A;  5G1R A;  1SZO A;  3GLM A;  1TYF A;  3QWD A;  5DL1 A;  3SLL A;  4IZB A;  1NZY B;  4I52 A;  4JOT A;  4L8K A;  4ZDC A;  4ZDD A;  1XNY A;  2PG8 A;  3JU1 A;  4J2U A;  1UIY A;  4ZU2 A;  2F9Y A;  3P85 A;  2VSS F;  5DUF A;  4ELW A;  4JSB A;  3R6H A;  3U9R B;  4B3I A;  3QXZ A;  2BZR A;  4GHN A;  5DU8 A;  2F9I B;  4Q0G A;  2X24 A;  2DUB A;  2VRE A;  2F6I A;  4L6W A;  4JYJ A;  3TT7 A;  2UZF A;  1FCF A;  2GTR A;  2Q35 A;  2D3T A;  1Q52 A;  3H0J A;  5E0S H;  4ZDE A;  2Q2X A;  3IAV A;  2VSU C;  3R0O A;  3U9T B;  1Y7O A;  1HNO A;  1FC7 A;  4HNK A;  3BF0 A;  1RJN A;  1OD4 A;  1ON3 A;  2A7K A;  1XX4 A;  3R9S A;  3ST9 A;  1XNV A;  2VSU F;  4JCQ A;  3KTG A;  3T89 A;  1MJ3 A;  2VX2 A;  3Q1T A;  3HP0 A;  5IKL B;  2F6Q A;  5KDR A;  4FN7 A;  1X0U A;  4QII A;  2ZL0 A;  4ELX A;  3H0U A;  4K3W A;  5DZK H;  2FW2 A;  1XNW A;  3T8A A;  1N6F A;  3P2L A;  3V5I A;  1ON9 A;  2PPY A;  5JBX A;  3L3S A;  4WZ8 B;  3V5E A;  3Q7H A;  4JYL A;  1DCI A;  3ZWA A;  1NZY A;  1HZD A;  3TDC A;  5JBW A;  4FJW D;  1UYV A;  2VSS E;  3HIN A;  5HUQ A;  4RYF H;  1EF9 A;  2PBP A;  3QKA A;  3BPT A;  4JCR A;  3T88 A;  2CE3 A;  4MI2 A;  1FC9 A;  3ZWB A;  3HRX A;  4I42 A;  1O8U A;  2VSS A;  3MFM A;  2YJG A;  3R9Q A;  1DUB A;  1WDK A;  2WTB A;  2J5S A;  5INF A;  2F9I A;  4NEK A;  1WZ8 A;  5DKP A;  4U1A A;  4FND A;  2NP9 A;  2IEX A;  3BEZ A;  4ELS A;  4JJT A;  3IB9 A;  2W3P A;  4G2R A;  3ZWC A;  3KTI A;  3WG5 A;  4QIJ A;  3TT6 A;  3LKE A;  5CTB A;  4U0H A;  4U0G A;  4ASI A;  5DU6 A;  1J7X A;  3STA A;  1UYR A;  4I4Z A;  5DTP A;  4YLH A;  4ZDB A;  3NJD A;  3RST A;  4JVT A;  2VSU E;  4JWV A;  1WDM A;  4KWB A;  3U9S B;  2VSU A;  2DEO A;  3TVW A;  3H0S A;  3T8B A;  4KPK A;  4MXI A;  4KD6 A;  2ZL3 A;  4GM2 A;  4Q1I A;  1Q51 A;  3GMA A;  2ZL2 A;  2J5G A;  3FDU A;  4U18 A;  2ZL4 A;  1WDL A;  3PGQ A;  5ING A;  3T3W A;  3MT6 A;  1K39 A;  2J5I A;  4JCS A;  5FIF A;  5MGB A;  1VRG A;  3K50 A;  2J5I B;  4IZD A;  5DTW A;  3NJB A;  3FF6 A;  4B3H A;  4NNQ A;  3LAO A;  3OC7 A;  1N6D A;  3TLF A;  4K29 A;  4JFC A;  4WYO B;  3QRE A;  1K32 A;  2ZQR A;  4EMP A;  1SG4 A;  3GF7 A;  3VIV A;  3RRV A;  3PZK A;  3TVU A;  3QK8 A;  5G1S A;  5C90 A;  3OT6 A;  2FZS A;  3KQF A;  3TZ3 A;  4EML A;  4F47 A;  4OLQ A;  4FNB A;  5E0S A;  3OME A;  3KTK A;  3H02 A;  4IZC A;  1PIX A;  4FZW C;  1HNU A;  3Q0J A;  3GKB A;  2J5G D;  3I47 A;  4QFE A;  1RJM A;  2Q34 A;  3DJA A;  1EF8 A;  2F9Y B;  3M6M A;  2FBM A;  1OD2 A;  3HE2 A;  4RCN A;  5KJP A;  4FZW A;  4ZDF A;  1UYS A;  3ZW9 A;  5INI A;  1JXZ A;  4K2N A;  3H0Q A;  4JCT A;  3QYR A;  3IBB A;  4HC8 A; 
#chains in the Genus database with same CATH homology
 3MOY A;  5DU4 A;  3Q0G A;  5G1Q A;  1TG6 A;  4LK5 A;  3H81 A;  3P5M A;  2C8T A;  4DI1 A;  1YG8 A;  5DZK A;  1PJH A;  4FN8 A;  3G64 A;  3PEA A;  1W2X A;  3MYB A;  3HLN 1;  4MOU A;  3KTJ A;  4WCZ A;  3QMJ A;  5DUC A;  3K8X A;  2QQ3 A;  3M6N A;  3GF3 A;  2X58 A;  2J5I I;  4HDT A;  1EY3 A;  4U19 A;  2EJ5 A;  3QXI A;  4FB8 A;  3DOR A;  1FC6 A;  3PE8 A;  4U0G H;  1N6E A;  2CBY A;  5E0N X;  3N6R B;  4RYF A;  3ZW8 A;  4OMR A;  4B3J A;  4KNP A;  3SWX A;  4Z0M A;  1UYT A;  2HW5 A;  5KDR B;  4EMM A;  3ISA A;  4NAR A;  4OG1 A;  3KTH A;  3R9T A;  3RSI A;  5C9G A;  1YG6 A;  3TRR A;  3TV5 A;  5FUS A;  3BPP A;  2A7S A;  2ZQQ A;  2A81 A;  1XO6 A;  5CTC A;  5G1R A;  1SZO A;  3GLM A;  1TYF A;  3QWD A;  5DL1 A;  3SLL A;  4IZB A;  1NZY B;  4I52 A;  4JOT A;  4L8K A;  4ZDC A;  4ZDD A;  1XNY A;  2PG8 A;  3JU1 A;  4J2U A;  1UIY A;  4ZU2 A;  2F9Y A;  3P85 A;  2VSS F;  5DUF A;  4ELW A;  4JSB A;  3R6H A;  3U9R B;  4B3I A;  3QXZ A;  2BZR A;  4GHN A;  5DU8 A;  2F9I B;  4Q0G A;  2X24 A;  2DUB A;  2VRE A;  2F6I A;  4L6W A;  4JYJ A;  3TT7 A;  2UZF A;  1FCF A;  2GTR A;  2Q35 A;  2D3T A;  1Q52 A;  3H0J A;  5E0S H;  4ZDE A;  2Q2X A;  3IAV A;  2VSU C;  3R0O A;  3U9T B;  1Y7O A;  1HNO A;  1FC7 A;  4HNK A;  3BF0 A;  1RJN A;  1OD4 A;  1ON3 A;  2A7K A;  1XX4 A;  3R9S A;  3ST9 A;  1XNV A;  2VSU F;  4JCQ A;  3KTG A;  3T89 A;  1MJ3 A;  2VX2 A;  3Q1T A;  3HP0 A;  5IKL B;  2F6Q A;  5KDR A;  4FN7 A;  1X0U A;  4QII A;  2ZL0 A;  4ELX A;  3H0U A;  4K3W A;  5DZK H;  2FW2 A;  1XNW A;  3T8A A;  1N6F A;  3P2L A;  3V5I A;  1ON9 A;  2PPY A;  5JBX A;  3L3S A;  4WZ8 B;  3V5E A;  3Q7H A;  4JYL A;  1DCI A;  3ZWA A;  1NZY A;  1HZD A;  3TDC A;  5JBW A;  4FJW D;  1UYV A;  2VSS E;  3HIN A;  5HUQ A;  4RYF H;  1EF9 A;  2PBP A;  3QKA A;  3BPT A;  4JCR A;  3T88 A;  2CE3 A;  4MI2 A;  1FC9 A;  3ZWB A;  3HRX A;  4I42 A;  1O8U A;  2VSS A;  3MFM A;  2YJG A;  3R9Q A;  1DUB A;  1WDK A;  2WTB A;  2J5S A;  5INF A;  2F9I A;  4NEK A;  1WZ8 A;  5DKP A;  4U1A A;  4FND A;  2NP9 A;  2IEX A;  3BEZ A;  4ELS A;  4JJT A;  3IB9 A;  2W3P A;  4G2R A;  3ZWC A;  3KTI A;  3WG5 A;  4QIJ A;  3TT6 A;  3LKE A;  5CTB A;  4U0H A;  4U0G A;  4ASI A;  5DU6 A;  1J7X A;  3STA A;  1UYR A;  4I4Z A;  5DTP A;  4YLH A;  4ZDB A;  3NJD A;  3RST A;  4JVT A;  2VSU E;  4JWV A;  1WDM A;  4KWB A;  3U9S B;  2VSU A;  2DEO A;  3TVW A;  3H0S A;  3T8B A;  4KPK A;  4MXI A;  4KD6 A;  2ZL3 A;  4GM2 A;  4Q1I A;  1Q51 A;  3GMA A;  2ZL2 A;  2J5G A;  3FDU A;  4U18 A;  2ZL4 A;  1WDL A;  3PGQ A;  5ING A;  3T3W A;  3MT6 A;  1K39 A;  2J5I A;  4JCS A;  5FIF A;  5MGB A;  1VRG A;  3K50 A;  2J5I B;  4IZD A;  5DTW A;  3NJB A;  3FF6 A;  4B3H A;  4NNQ A;  3LAO A;  3OC7 A;  1N6D A;  3TLF A;  4K29 A;  4JFC A;  4WYO B;  3QRE A;  1K32 A;  2ZQR A;  4EMP A;  1SG4 A;  3GF7 A;  3VIV A;  3RRV A;  3PZK A;  3TVU A;  3QK8 A;  5G1S A;  5C90 A;  3OT6 A;  2FZS A;  3KQF A;  3TZ3 A;  4EML A;  4F47 A;  4OLQ A;  4FNB A;  5E0S A;  3OME A;  3KTK A;  3H02 A;  4IZC A;  1PIX A;  4FZW C;  1HNU A;  3Q0J A;  3GKB A;  2J5G D;  3I47 A;  4QFE A;  1RJM A;  2Q34 A;  3DJA A;  1EF8 A;  2F9Y B;  3M6M A;  2FBM A;  1OD2 A;  3HE2 A;  4RCN A;  5KJP A;  4FZW A;  4ZDF A;  1UYS A;  3ZW9 A;  5INI A;  1JXZ A;  4K2N A;  3H0Q A;  4JCT A;  3QYR A;  3IBB A;  4HC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...