4Z0NA

Crystal structure of a periplasmic solute binding protein (ipr025997) from streptobacillus moniliformis dsm-12112 (smon_0317, target efi-511281) with bound d-galactose
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
KITLGVTYYKFDDNFLAGMRNDMIQIAKEKYPNIELLNNDSQNSQSILNDQIEVLINKGVNVLVINLVDPTAGQSVIDKAKAANIPIILFNKDPGVDALNSYDKAWYVGTTPKDSGILQGQVIEKAWLANPAYDLNGDGVIQYVMLFGEPGQPDAEARTKYSIEYLNEKGIKTEELHKDIANWDAAQAKDKMDAWLSGPNANKIEVVIANNDGMALGAVESIKAVKKELPVFGVDAIQEALTLIEKGEMVGTVLQDATGQARAILELANNIANGKEPTEGTEWKLIDKAVRVPYVGVDKDNYKEFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title Crystal Structure of a Periplasmic Solute binding protein (IPR025997) from Streptobacillus moniliformis DSM-12112 (Smon_0317, TARGET EFI-511281) with bound D-Galactose
rcsb
source organism Streptobacillus moniliformis
total genus 116
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z0nA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z0nA02
1DC7A 4H60A 4G97A 1S8NA 3RVNA 2L2QA 4MGEA 1FFGA 3OLWA 2HPHA 3QELA 3KYJB 1L5ZA 4H3HB 1NY5A 1DCKA 5HM6A 4W5TA 1IIBA 3HK2A 2V0NA 2LIVA 5B3JC 1U8TA 3MF4A 1JF8A 4XASA 2NZUG 3GV0A 3HCWA 3IP9A 1GLGA 2P4UA 4RY9A 1I3CA 1BA2A 5E3JA 4RDCA 2FMIA 1TMYA 5CNJA 4KK4A 4F8JA 1JFTA 5HSGA 4RK7A 4DQDA 3N6VA 4G0QA 4MQEA 1URPA 1ZDMA 3DLBA 1E6MA 3M9WA 2PUDA 2F8TA 5KQPA 1P6QA 1YMUA 2VK2A 1PUXA 2B1JA 3KLNA 4MLCA 4WWHA 3FGZA 4O5AA 5DCLA 3SY8A 1JL3A 1NXPA 2QZJA 2X7XA 2VYCA 4WT7A 1JX6A 1QMPA 2ZAYA 5TQJA 1DZ3A 1EWTA 2FEPA 4F11A 4Z4HA 3EULA 2W42A 4KNYA 2JB9A 3NBMA 3A0RB 3H5VA 5TQ0A 5C5CA 2MYPA 1D1PA 2IKSA 3BRSA 2PE5A 4RZSA 5EWLB 3OMWA 1BDJA 1SRRA 4MQEB 4QICA 1MVOA 3GWGA 4YR7A 4E7PA 3GT7A 4RU1A 4EYGA 1YTUA 3O75A 2ID9A 3H5IA 4OTZA 4MR8B 3NHZA 5FWYB 3E61A 2FMHA 3O2JA 5DKFA 4JA2A 1OXKB 4JB2A 2TMYA 4JOQA 4Z9BA 4EYOA 4RXMA 3URMA 1JLKA 4HNQA 4IF4A 4Z4EA 2B4AA 4H3KB 3SM9A 3EODA 5TQ0B 3QEMA 4E7OA 3C97A 5IUKC 2QW1A 5IUNC 4EGSA 3RVMA 3FDFA 3HSYA 3QLUC 4MS1B 1L5YA 3W9SA 4RWEA 4XLTA 1U04A 3K9CA 3I42A 2JBAB 3CFYA 1Z12A 1ZHHA 2L17A 1NTRA 3KKEA 4PICA 3ROTA 1KMIY 2FN9A 1QNLA 1YIOA 1Z15A 3BILA 4MR9A 4Z0NA 4S05A 1Z13A 3QEMB 2XDYA 3RH0A 1DCMA 1USKA 3LUDA 1JYFA 2FMFA 4L4UA 4EVQA 3A0UA 4EY3A 2JVIA 5BRJA 1YMVA 3GBVA 3H5WA 4FE4A 2PAFA 4RK4A 1YS6A 1VKRA 1TVMA 4JAVC 3NNSA 3MQ4A 1ZESA 5CHYA 4HNRA 4RY0A 2IDMA 4OLAA 4Z4FA 3QLVA 2PUBA 2FLKA 3B2NA 3HUTA 2FEKA 4ZJPA 1ZH4A 1DRKA 1A04A 1F4VA 2WMYA 5JNUA 5JNVA 4G0YA 3I5AA 4RK5A 1D2AA 3LUCA 4IRXA 1MB0A 3N0RA 3TD9A 4ETMA 1GUBA 3D8UA 3EQ2A 5C5EA 4NICA 1FFSA 4B09A 3M9XA 1LJUA 4Z9AA 4W5RA 2KYRA 4Q6WA 1ZGGA 1W9HA 3MYYA 4RXTA 1JYEA 4F3TA 4MAAA 2FN8A 3LUHA 4KQ9A 2PUCA 4Z4GA 3DBIA 1GCAA 3KJXA 2A9QA 3SG0A 3L6UA 4ZPJA 2FMKA 5IBQA 1U0SY 3H75A 4RV5A 3GBPA 1ZAYA 5B3JA 1NXWA 4XFKA 1DP4A 4MLDA 3HS3A 1E6LA 2QVGA 4TLLB 1PEAA 4LX8A 1QP4A 2IPMA 3FFTA 1A0OA 1TJYA 2PLNA 4RK6A 3Q15C 1USGA 2GI4A 2ID7A 1FQWA 5EWMB 1LK0A 1B00A 5FWXB 1ABEA 3OQOA 3OQMA 4QYMA 1YVUA 2FVYA 2VUHB 4RK0A 2I6FA 2YHAA 5JNSA 3HO1A 4YRZA 1OXBB 2MSLA 4KZKA 3T95A 1JDNA 3CLKA 3MIZA 1MIHA 1ISSA 4KREA 2OENG 3FFXA 2FW0A 2Q5CA 4RKQA 2HQRA 4Z99A 2R25B 1M2EA 1Z26A 4MS3A 4G0OA 1EAYA 2DRIA 3HEBA 3QELB 4NQRA 2H3HA 1D5WA 3CRNA 4YLEA 4Z4CA 2RJNA 2N9UA 4N0PA 1DBQA 5TPZD 2IPLA 1Z2DA 5JS1A 4YO7A 1C0EA 1T34A 5KC8A 4G0MA 2WWVD 2E4ZA 1KRWA 4NV3A 2L18A 5KQMA 1W25A 1Z2EA 2IPNA 3Q7TA 3N0WA 4L85A 2HSGA 3OLVA 4ETIA 5TQ2A 1QO0D 3CHYA 3LUJA 3GL9A 1BDIA 1P8AA 3KSMA 4LDZA 5HKOA 1J56A 5FBKA 1JFSA 1Z17A 2NT4A 1AB6A 3F73A 3N8IA 4OLBA 4FB4A 3OM0A 4CBVA 3DGFC 5T7BA 3D02A 4W5OA 1Y1LA 3ILHA 3VNBA 3A10A 2NZVG 3JVDA 3S99A 1M5TA 3Q41A 4MRMA 3RVPA 1PNTA 2CHFA 1RPJA 3RQIA 2E4XA 3CZ5A 4KRFA 4G0XA 1R8JA 1AB5A 2WRZA 3HDGA 4F06A 4D6YA 3EJWA 4PEVA 1E2BA 9ABPA 3KG2A 5TQ2B 3OQNA 4NCAA 1EHCA 5TPZA 2HJ9A 4HNSA 3CU5A 1RXEA 5JNTA 1UDRA 4LDAA 4Y9TA 3LKBA 1QP7A 4LZLA 4TLMB 3TO5A 4WXMA 2MYTA 3O2QB 4RSMA 5I4CA 2QR3A 1Z25A 3FMVA 3NNDA 3QEKA 2PL9A 1NXOA 4GNRA 5TPWA 2RJOA 3HDVA 3LUKA 4IGAA 3UKJA 4RY8A 1RZRD 4RK1A 1QO0A 1JH9A 1ABFA 5ED4A 1JHZA 2GKGA 5FBHA 3JS5A 3HVRA 5BRAA 3DGEC 3GRCA 4S04A 5BQ3A 4MS4A 3UK0A 3UUGA 1BDHA 1RNLA 2PUEA 3P9YA 1EWKA 1NATA 5PNTA 5JNRA 3O1IC 3QX8A 3Q7RA 4MR9B 3RVSA 2QXYA 5IC5A 1WETA 2P9HA 3HZHA 2MYNA 5TPWB 2WJWA 4PYRA 1KRXA 1JDPA 2LBPA 4G0PA 4EYQA 2PUGA 2A9OA 3R0JA 4YS6A 3LUAA 2MSWA 3LTEA 3O2SB 2GWRA 3H6GA 2IYNA 1CEYA 3QK7A 4D74A 3G1WA 3H5TA 4LRQA 3ROFA 2PUFA 5GOTA 4IMJB 3LKVA 5ABPA 3EAFA 1DG9A 2NT3A 5KQLA 2FQYA 3FFWA 4OBBA 3T38A 3ILYA 1E6KA 8ABPA 3SNKA 1RZRA 3DZDA 5DTEA 3GA5A 3K4HA 3OM1A 4KVFA 2HQBA 3LFTA 3VNAA 6CHYA 3IP7A 3EQZA 2AYZA 4QYWA 4TMYA 5IUJC 1F51E 4M88A 2A9RA 4XARA 3JY6A 3O21A 3EDCA 3TMYA 1C4WA 4EVSA 2FKAA 4WUTA 4O1HA 3OO1A 2O20A 6ABPA 3HUUA 4IMIB 1MB3A 2IPAB 2PKXA 3HXMA 1U2QA 2BGGA 3KS9A 3H1EA 5D2CA 2F8SA 4RXUA 4KK3A 4OATA 1PEYA 3KLOA 4QPJC 2WJAA 5IEBA 1M5UA 1JFVA 1NXXA 1VLZA 1JBEA 4XXHA 5IULC 1LBIA 4JASB 4XAQA 5IX8A 1D1QA 4YP9A 1A2OA 4KQCA 3H5OA 3BBLA 3RVKA 4W5QA 1GUDA 1SXHA 1ZGZA 1XHEA 2FLWA 3IPAA 3GYBA 1P2FA 4ZMRA 5KC9A 4P98A 3CKMA 5KQGA 4D6XA 2GX6A 1RXIA 3H5LA 3IP5A 4KV7A 4G86A 4Q7EA 4YGXB 4MQFA 1XWWA 3I45A 3OLYA 1TM2A 3TX6A 1ZVVA 5DLEA 3CTPA 3TB6A 2L19A 3LUGA 4PZ0A 5EWLA 4P1ZA 5JS2A 2FTKE 3F6CA 5DGCA 4MPTA 3RVOA 1FFWA 2M98A 4MS3B 4PE5B 1DC8A 4ZYLA 3BREA 4MR8A 1SD5A 1BAPA 2PMCA 3C6QA 3E3MA 4MYRA 5HQJA 2R47A 3LOPA 3JPWA 3QLUA 5FWYA 1JWLA 4KPYA 4NCBA 2JVJA 1DCFA 3OO0A 4Z4IA 3F7NA 1Z18A 3L49A 2JVKA 1APBA 1TLFA 2IOYA 2QU7A 3G85A 1QP0A 3O1JC 3KHTA 1PHRA 5IEJA 4MQFB 5KWSA 2GBPA 4ML3A 2WY2D 2ZWMA 3F6PA 3CG0A 3CS3A 5BR1A 3KYIB 2CD7A 3H1FA 2RGYA 4MS1A 3HJFA 4OG2A 4FE7A 2LPMA 4HYEA 1QQBA 3RVJA 3N75A 2JBAA 1DBPA 2H0AA 3MA0A 3NHMA 3JPYA 2E4YA 3RVRA 1QPZA 1VPWA 3Q9SA 2R48A 1CYEA 5TE9A 1QQAA 1VRVA 1ZH2A 3BRQA 4IILA 4YWHA 5GQSA 3T6KA 2E4UA 3LMKA 3JTEA 4W5NA 2E4VA 4DN6A 2WB4A 3EGCA 1LJLA 5T3YA 1M2FA 1USIA 3OMXA 3H6HA 4MRMB 4DADA 1HEYA 3I09A 2HQOA 3MMNA 4KFCA 4O1IA 4RKRA 4UHKA 2QV0A 1EWVA 4LE0A 4RS3A 1YK1A 5F64A 3IPCA 4KMRA 3SAJA 4YCSA 3C3MA 1EFAA 2MSKA 2JRLA 3IDOA 1GCGA 2CHEA 4GPAA 4WXEA 4N47A 4LE1A 1BVHA 3JVIA 1Z16A 2FEWB 4JB0A 1NXSA 3KCNA 2LUOA 3HV2A 3QLTA 5JNWA 1H9CA 3QX9A 2RDMA 5EWJA 2FQXA 2FSPA 2YHBA 1YS7A 1XHFA 1SXIA 1NXTA 2LP4Y 3C3WA 4EVRA 4ETNA 1ZY2A 4N41A 4F12A 3O1HB 3NNNA 3O74A 1LBHA 3N0XA 3IP6A 4MS4B 4EYKA 2A9PA 2QVCA 1FSPA 4N76A 3SQNA 5CNMA 2JK1A 2CWDA 2QSJA 3RVLA 2E4WA 2FXIA 4N0QA 2PUAA 4JP1A 2FQWA 2PJUA 3CZCA 5KI6A 3N53A 5EWJB 4YV7A 2R4QA 4TN5A 7ABPA 1ZITA 1MAVA 2J48A 4MR7A 1ISRA 1D4ZA 3M6MD 3KTOA 2MYUA 1NXVA 2M1ZA 1PNRA 4UHJA 3H1GA 3OLXA 4G0ZA 5EWMA 3QLVC 5CNKA 5FWXA 2JCGA 3DLHA 1DJMA 3A3KA 3Q7SA 4WZZA 1SXGA 2AYXA 4EUKA 1ZN2A 1DRJA 1CHNA 1P6UA 3T8YA 1K66A 3HM9A 4N03A 2VUIB 3OLZA 3RVQA 5CNIA 1YK0A 4LE2A 1U2PA 2PL1A 1KGSA 3LUFA 1QKKA 2OQRA 2NUBA 1DBWA 3CG4A 3MM4A 4Q6BA 4ZMSA 3CNBA 1K68A 4MR7B 3C3KA
chains in the Genus database with same CATH superfamily
3KJZA 2KE5A 4F4IA 1IZ8A 1YCGA 3DMNA 1QZ3A 3TG8A 3U7GA 2VHWA 3L41A 3Q7PA 5JSYA 1SHJA 1VG0B 1NUUA 2N42A 1F2TB 2HIMA 2P9ZA 3N2ZB 3ZG6A 5DP2A 4AX4A 3FF4A 2QSZA 1G5PA 3KKOA 5DVZA 4EWLA 2QTCA 1Y3HA 3LY9A 5A6VA 1FW8A 5ALQA 4YMGA 3LAWA 1JPNA 2QDXA 2W6JA 2EL9A 2EYUA 2P4UA 4KMMA 1VJTA 4DR1B 1GZ5A 2GM4A 2VH5R 5CAEB 4OL0A 1T36A 2QLFA 1OBOA 4RHXA 1FTSA 2GESA 1EFDN 3PQ5A 4GKJB 3DCYA 1JN0A 4MUGA 1ISFA 2OGZA 1GAEO 1J2TA 5FTNA 1KMHA 2HHCA 4AJKA 4DMCA 3WGUA 2NUPA 2ZLBA 3U19A 1F7VA 1VL5A 2P65A 2HYDA 4RPCA 5CG1A 2VYCA 4FEGA 4YMHA 1AK1A 2ORIA 3KB1A 4Q37A 4XVRA 4EGAA 1XLTA 1DJOA 2YMPA 4H3VA 3WAJA 5AVQA 4CGYA 1H93A 3FR8A 2BEKA 2AFRA 1YQGA 1GILA 2VEOA 4Z2AA 2OFFA 1ZD2P 4NPAA 4WEQA 1II9A 1TYBE 2R3SA 1E5TA 2XKAA 3B48A 3LX8A 3DLIA 4RBNA 5EWLB 3VH2A 3ZCPA 1XQVA 4I9GA 2GYVA 1G6KA 4OQDA 4H27A 3S68A 1CF9A 4YR7A 2DCUA 3RT9A 1HPLA 1C4OA 5EOVA 3H5IA 3DHEA 5ICEA 1NA5A 3HEAA 3V2IA 2FG6C 2C5LA 1EESA 3QXCA 3RSLA 4DNQA 3LX5A 1D6MA 3X2EA 4TM8A 1G3MA 2NTNA 3BN3A 4HOYA 4TGLA 3O6VA 1DUIA 4F60A 3HJTA 3SWWA 1FMFA 2FRVA 3QWIA 3URMA 4IF4A 1U4SA 5ENVA 1T3GA 3CYFA 1K3TA 4A91A 2HCTA 2RI0A 3SM9A 4F4CA 3G5MA 4NZZA 4KR9A 3GVXA 1ADGA 3DWEX 3PUKA 1ZIPA 2QW1A 5LQAA 1KDRA 3DM5A 4O3FA 1AA6A 1IEVA 3OQVA 4U2CA 3A1CA 4MS1B 1AZSC 3DZ8A 4GL4A 3NV7A 3IJEB 5H1YA 5L3QA 3ZJUA 2ZE5A 4BEBA 1ZNWA 5DN9A 5CXQA 4YRIA 3D59A 2LR0A 2EX4A 3IEXA 1QOZA 1P44A 2OZKA 1VLQA 1DKLA 1GYQA 1XFAA 1RLUA 2AJBA 1DUVG 2H54A 4IVRA 3UAYA 3J7TA 2JHPA 5GADl 2WFLB 4QASA 3G8YA 3GMSA 5BRNA 2QG9A 2B0CA 3WGHA 3ZXSA 3FE2A 3U37A 4PZEA 3V7UA 1GWNA 4Y1FA 1CNFA 4A8JC 4UDYX 2P5YA 4MWBA 4AJIA 1LI7A 3GRZA 4JP5A 1K88A 2P1RA 4CR6A 1M1YE 2HC9A 1E60A 3HP7A 2Q2WA 2ZIXB 2PAFA 3P32A 4P4SA 3AG5A 2H2HA 1WUJS 2EEZA 5F2NA 2NU7A 2VT2A 4JBIA 4PLCA 5DGXA 3C1TA 3UV3A 3EDRA 1QZZA 1QGAA 1CJCA 2WSMA 4QNRA 2B4KA 2IZ6A 4NAVA 1PGQA 4ZRDA 1A04A 4MCIA 1IHUA 1IJEA 1PT9A 2EWMA 2NUTA 4UQPA 4UDXX 1N2IA 2Q6OA 2F9FA 2RFLA 5ALUA 5EJ2A 5EXSA 5B2EA 1GPWB 2DUJA 4LOAA 3RUHA 4G5OA 1XMJA 4FPXA 4NU0A 4CLOB 2DE0X 1LJUA 4TKUA 4W5RA 3ONNA 4BN5A 1FUEA 4L3VA 3RF6A 4YALA 2O2SA 4Q16A 5BUQA 3KPVA 3DEYX 1OYWA 1UPBA 1TB4A 2EERA 1EP1B 4Q39A 4OJMX 2PJRA 4MDHA 5E9WA 1F38A 4NYIR 1AXGA 4RQBA 4DSUA 1QRAA 1A5SB 1RHMA 3Q7IA 4D5GA 3EF1A 3TIXB 5IYZB 3TS1A 2EKPA 4J16A 1MX3A 4J0CA 2EFYA 4HSGA 4O63O 2DWUA 5I7WA 1QJCA 2AR9A 2AJCA 2P5UA 3OZCA 4HX5A 4M7WA 4AVYA 5IG2A 2CCGA 3KVNA 1KH3A 2I7XA 4B34A 3AVUA 1V8FA 2ZUUA 2VPYA 4Q9IA 4B3CA 4F4FA 2B35A 1GU0A 2VRNA 4QTXA 2WSSA 4YB8A 3ELYA 2P3LA 1YS9A 3AOEA 4CQMD 2W58A 3DC7A 2FVYA 4D43A 4YLGA 4G2TA 3SS7X 5G53C 4I50A 5P8WA 1XPUA 3C43A 1T9HA 5AW3A 2DMRA 1GXSB 4X1YB 1E2DA 3M4NA 1ZM7A 4GX1A 1L1QA 2FCRA 4DLKA 4EPYA 3NBYC 1HT3A 1SUBA 2OGWA 3DHVA 2JKZA 1KMMA 2SBTA 4X8OA 1UWKA 5A3VA 2UUCB 1BXGA 3NOVA 1NF8A 2CLDX 4BZZA 4YRBA 1T4MA 1TL7C 1P2GA 3ASVA 2GZ1A 2IOFK 3B8HA 5EUCA 4O3MA 3GRKA 4X3CA 4Z4CA 3GLQA 3KR1A 4K5QA 3N2KB 1QB8A 4ZN6A 4XSHA 1NC1A 5H5JA 4W5WA 3ZR4B 3AK4A 1X42A 2V5VA 1Z2OX 5HCUA 1ZINA 2IYAA 3V1LA 1EE2A 1KHTA 4R9RA 3OC6A 1D4OA 3HWWA 3KEOA 1E0SA 1Z0ZA 2J32A 1EGMB 1I1HA 1XZNA 2OK8A 2QTMA 4N7RA 1NVUQ 1BCSB 3HGTA 1B8UA 5LR6A 4C0JA 1QO0D 1Y5RA 2Z8YA 3P9IA 5GY7A 3HY6A 3CR7A 4H0NA 3WY9A 1TIKA 5FOQA 4EUHA 3TL2A 4HXGA 1YKSA 3GFFA 4JKYA 2E1PA 3R3VA 1EVLA 4IGFA 2C5SA 5LQKA 3FYTA 3TTYA 4MGZR 4J91A 2V8OA 2REQB 2G9NA 3L8MA 4P35A 3OJLA 4IJWA 4MMZB 5GPBA 1CSEE 2LTAA 5A9SB 3H1AA 2EZ9A 3OE7D 1H9AA 2CN1A 3GW8A 3P2IA 3DVAB 3HUFA 4DC9A 3DVQX 1WDWB 2ALJA 4H31A 4R7GA 3NT2A 1YGYA 3HBFA 5J4HA 1OWOA 1QRUA 1WUYA 4IHJA 4DF3A 4KLNA 4D9JA 1EVIA 1PS9A 1H4TA 3SICE 2XHEA 3C6ZA 3SEAA 5A9TA 1X7ZB 1ZL0A 4BB6A 4DIOA 2YNMA 5GM2A 3RRBA 3V8EA 1I8TA 1ZK4A 2HA0A 3FNEA 1YT5A 1T4DA 2ZWIA 3CGWA 3E4DA 3CX3A 3JALA 3H04A 4MVJG 2PGAA 2X2FA 3B70A 3ICOA 3G2QA 1O5TA 3ZOKA 4AP6A 1RR6A 2BSXA 1FYXA 1H4QA 1XTVA 5GAJA 3TEFA 4BGDA 3FKSD 2W0MA 3VC3A 3ZWDA 1KEZA 4BO4A 4ZCIA 1CEQA 3MLAA 1YIDA 4GPBA 4RANA 5LZ8A 5KNLA 1CKEA 1N8TA 2WFZA 2E0IA 3H17A 4D4MA 5ALWA 4E51A 4DQ0A 4DLZA 1M2HA 5KOHA 4OKNA 3DYVA 1T8SA 3NKLA 3R7WA 3SZRA 1IZ0A 3PHCA 4R5HA 1T6BY 2RAPA 1R0ZA 3HZHA 1OCEA 1N1EA 4ZO9A 1U8EA 3WLRA 5JV5A 3IP8A 4CEIA 3PRJA 2YUTA 4ZV9A 1XAHA 1SVKA 3G2JA 3H2JA 3PHLA 1W4RA 3CW8X 1JJIA 2MSWA 3KRTA 5K5EA 5FKJA 2GPJA 5AJYA 3K73O 4MP3A 3R9XB 2GVDC 3G1WA 1ZX1A 4OQLA 1B2LA 1USWA 2EFJA 2ZTUA 3CPEA 3HMQA 4N8SA 5T8KA 1JKIA 1Q7EA 3AR8A 4YUYA 4WJKB 3IAS1 4ZIRA 1TOAA 3IB6A 2P2GA 4WECA 3DZDA 4IUYA 1UPCA 1GFWA 1QIJA 2B7BA 1Y9ZA 2RGNA 1QO7A 3N05A 1Q57A 4UCWA 1VYUA 3QG5A 4AMGA 1I0ZA 2W2KB 3E3NA 5IUJC 1TYAE 1U0NA 3FYUB 4PAMA 4PYOA 3UG7A 3WKEA 4CHGA 3O90A 1P2VA 5DHRA 4IFTA 5TY0A 4BNDB 2AZDA 5FTMA 5SYAA 4ZVKA 4A27A 1QFXA 1F0YA 1CY2A 1J8QA 1E1DA 1EXNA 1W35A 2HY7A 2YXNA 4OEHA 3I1FA 3QF4B 4FMDF 1ZCJA 4WBNA 2CF5A 3DCNA 3R0QA 4UVGA 2Z08A 3II6X 3WLIA 2OXFA 4C4SA 1T5SA 5I7AA 1OV4A 1ONSA 3GMIA 1K4YA 3KD3A 2BKLA 5BWOA 4TZ0A 2EKLA 4IJKA 4HWRA 4Q4JA 4EMSA 4Q9JA 3EVGA 2CWWA 3EXIA 3H2YA 4H7EA 4B9EA 5GZ6A 3P0HA 3BK1A 3CLUD 1VXRA 3FHTA 3LXMA 4C43A 3DKIA 3RRMA 4GOKA 3LS2A 3WLOA 2IWRA 2ZRDA 5KNDD 3OOYA 3Q7EA 4LBYA 4RGBA 5IDVA 4DWJA 1BWPA 3N8HA 4DHWA 2R5WA 1PYOA 2E85A 2BFMA 4PHCA 1EX7A 2WM3A 4P98A 3DF7A 3UICA 3TKYA 3UT5B 3QXSA 1KDVA 1I4EB 3PPIA 3GZJA 4FLFA 4IUCS 4MQFA 2YWCA 4EG0A 5I9TA 5IKXA 4YRLA 1KORA 1ORDA 3O4JA 4LJ6A 1KJWA 2H11A 3IA7A 2DOKA 3AUAA 2IE8A 1CJKC 5LZ9A 3K0EA 1B6GA 1AUQA 1UPTA 1FFWA 1WB5A 3GLIE 1K6JA 721PA 3DVLA 2AS0A 4AWBA 1KQ3A 1RTTA 2GTPA 2NZWA 3WC4A 1UMKA 4MYSA 1NW8A 3GJYA 2Z2IA 4GSKA 4IVNA 1XU7A 2AOUB 4RD1A 2IH2A 2QJWA 1T3ZA 4IIUA 5LXTA 2W37A 3U4DA 3BMCB 2DBVO 1WW8A 3ISJA 3MHPA 3PXBA 4R2JA 1V8OA 5AJVB 3L1VA 5EUQB 3ZV4A 4DG8A 5F3WB 5DDIP 2YQ4A 3KKKA 2F3SA 4X7PA 4U63A 5B4TA 3WB0A 1GQYA 4MW5A 1S6YA 2ZSUA 2YYZA 1Y8CA 2GGSA 1WBDA 3GQVA 3W3AH 3GFRA 3FOEC 2C3YA 4B2YA 1D09A 3AH8A 2B7LA 3H1BA 2Q3JA 1R0XA 5DX8A 2BGWA 1QRTA 1PVDA 2E4YA 4YCBA 1KO8A 5IN4A 2NYAA 3WB9A 2Z6QA 4J1TA 2BP7B 4QAJA 3S70A 3GY0A 2NSLA 4DR7B 3PQCA 3T6KA 3VPFA 2F2TA 1YAJA 4UXIA 5CUQA 4RHUA 5KDOA 1UWLA 3M0EA 3U7QB 2RIPA 4MHTA 1U94A 1EFKA 4D4KA 2JFNA 2VKQA 4M1WA 3LHIA 1DJNA 3LRPA 4CMBA 2JLRA 2X2OA 4UHFA 4XD2A 4CETA 3QKUA 4B84A 5I9BA 1X80B 1P19A 2I4RA 4KQHA 2V5UA 4A0HA 2V58A 1OGYA 3OQIB 4DTCA 3PGA1 3UJ8A 3HVHA 4CMJA 2OFXA 1KWKA 1E2JA 3LK6A 1ISPA 4AUMA 1H1LB 3PGXA 4S1TA 1FPQA 4X65B 1GAXA 2ZRJA 4C7MA 4EMTA 2JBHA 4M99A 1DO8A 4R1OA 2QN3A 2VWHA 3H7IA 4JB0A 5A3RA 2ZCJA 3QLTA 1WDTA 1CC1S 4TT8A 1WZNA 4WK0B 3OJCA 4X94A 1Z5VA 5FNZA 1AGNA 1NXTA 4LFAB 2HA6A 3W9UA 3AHGA 3O1HB 3PGMA 4H7KA 1E18A 3ZK8A 1JU4A 2BKUA 2MR5A 4PC6A 3PL1A 2IWHA 4YT4A 2GTIA 3FLBA 2FB9A 4IS2A 2CLSA 1T5HX 2Q5FA 2AZXA 1VL0A 3PCXA 4PSCA 5I8PA 2CDNA 3H9EO 3QPVA 4P82A 5KREA 1AGYA 2TSYB 2PLWA 3UT0A 3ZQJA 1WXDA 2GAJA 4COKA 1JEAA 5F9FA 4XWOA 2I1VB 1Z7GA 2BUBA 2I33A 4J4TA 3BGSA 5CURA 4BO3A 1Q0TA 2H8KA 1QIFA 3ITEA 5EJFA 3TD6A 4GW3A 2IS2A 5KIAA 1V3UA 2OV6A 2HW8A 2HWXA 5TF4A 4QT0A 3P9CA 3RRFA 5K6AA 2DKNA 1E4EB 1N6HA 1QF6A 1MFPA 2ZRMA 1JG3A 1PZEA 4NDAA 3ABQB 2C88A 4NHEA 4RESA 2JJMA 1ZD5A 3PTZA 4FDTA 2AYXA 4MITA 1VHDA 1XVAA 1Z4NA 3TX2A 3QSYA 4LK3A 1Q77A 2W70A 1TJ5A 4K03A 3QG1A 5GWXA 1C2YA 5FOVA 4NFHA 3UWDA 4WCDA 2AMLA 4EGQA 4F1WA 2ZIWB 3PEEA 4KX5A 3HLKA 3SSMA 4EPXA 4NS4A 3D6MA 1CUAA 2CSUA 2PL1A 2VP6A 1QS0A 3QFSA 4O4HB 4Q82A 2YZ2A 4WXYB 3O83A 2JZNA 2WHRA 4MXDA 1JKMA 2V1UA 4CF6A 5BUZA 2FLVA 1XNHA 2EOAA 1DXYA 2JD1A 3K0HA 2NV0A 1SUEA 4JSYA 3I0ZA 5ED0A 3ZWCA 1Y9AA 1GD1O 3K8OE 4LY6A 4R2HA 3CZRA 3RVNA 2W6PA 4C7XA 2QE7D 4BTEA 1PDVA 1FFGA 4D6PA 3HFGA 2VH2A 2C9BA 3I8OA 3L4BA 3MW8A 2G08A 1U3TA 2HU8A 3RC2A 1IIBA 5G1PA 5JI2E 1AGRA 1JQDA 5BXQC 3GGCA 2VQDA 4E2WA 3KTFA 2XB4A 1QHFA 3OCJA 4MW7A 1JIJA 4HHEA 3EWAA 3P1JA 5FDFA 4B47A 1VA5A 3N5KA 7MDHA 4YDQA 2QAGC 3SQMA 4ND1A 2C31A 1Q0PA 2Q1SA 2R7LA 4H1VA 4M0PA 3TRDA 1YU6A 3DEHA 3P4YA 1QQ7A 4PG4A 3SDZA 3GJRA 1C50A 3CVXA 1VJ1A 1URPA 3KJQA 3E0QA 3QA3E 5I45A 1U0BB 1V5WA 1J00A 2VK2A 4IQGA 5EG5A 2GERA 4JC0A 2EW1A 1E2QA 1WCWA 5MN5A 5C51B 1GUFA 4QVGA 4O4JA 1LPNA 5EQFA 4UFOA 3L1KA 3ADOA 3PD7A 5D51S 3TNFA 5L51A 3K2EA 1DBIA 1PRYA 3R6WA 4V3BA 1WPQA 4UNNA 1Z68A 5JOQA 5EXEA 4TWAA 2OSVA 3A0RB 2I9KA 3TJZA 1H2WA 3EAGA 3QBVA 1OIXA 4KVAA 3ON5A 3N39C 5LDGA 5LOVF 1QKIA 1SXJB 2I6XA 1P4HA 1Q44A 2FWPA 3BUSA 3ZS9A 1R9MA 3H4VA 5K45A 4L57A 3GT7A 3K0BA 2RAFA 1ESDA 4IXNA 1XK6A 4H7IA 3DE3X 4OTZA 1A1SA 1XAGA 4D9GA 4BPBA 5EIBD 2UYCA 4JA2A 3BF7A 3KTAA 3KE8A 1G7SA 1R9NA 1YCFA 2W93A 3F71A 1RAFA 4MQBA 4DUGD 1BVRA 1QHHA 4PINA 4IXDA 4MAMA 4M0CA 3QV2A 4V0RA 5AJZA 2BTOA 1XJCA 4MUNA 1T24A 4ZVQA 2PKQP 4RDXA 1XXHB 2JAQA 4AYXA 3BWBA 1VTKA 5D3QA 5M5BA 1YVDA 2XMRA 4FZRA 2BR5A 3DEZA 3I42A 4I1IA 3V8QA 3WZMA 1T1IA 4BX8A 1GZVA 3WHIA 4B0OA 4R4JA 1YDFA 2XA9A 4KSCA 3T3OA 2I4LA 5IVDA 3WQHA 3ROTA 2Q4TA 3TGWA 4YQFA 3FJOA 1ZH6A 1NN0A 1GT6A 3CSUA 1JIKA 3FZEA 2KPOA 3H2SA 2SKEA 3RSQA 4CVNA 2M6KA 2PX0A 4E09A 5CEFA 2B20A 2GRJA 1OI3A 3B6JA 3NDJA 4L5AA 2REXB 4NBRA 1DU4A 2BEWB 3IPXA 2PH3A 1Z13A 4ZDIA 1QFZA 4L76A 3ZHOA 3BBPA 2FX2A 3VJKA 2ZAGA 3ROMA 3DCJA 1V2HE 2JVIA 1YMVA 3NEAA 4TLEA 2FW6A 4FOTA 1P77A 5YASA 2WM8A 3E2IA 2HNKA 1N9GA 3IUEA 3RSHA 4D79A 1CUUA 3KT8A 4KN9S 4EG6A 4NBNA 4JY7A 2DLCX 2FSHA 3EGDB 5EPEA 3D6TB 3IKJA 3MSCA 1ZH4A 4AKEA 4D99A 3C8HA 3VR1A 4B3HA 1P72A 3AV0B 3DLCA 4DDUA 1BC5A 4G01B 2YJTD 5JLAA 3DO5A 3RUAA 3WB1A 5IANA 1NIPA 3IAHA 1WCV1 3HA2A 4NMMA 3RFUA 3TL6A 1KMQA 5BNFA 1YAHA 2ZQ5A 4EI9A 2AG0A 5CYGA 5IKEA 5C5EA 4TRRA 4UTZA 4BV3A 4NICA 5TMPA 2GVZC 4Z9AA 1WHSB 3I3SR 1ZGGA 4Q6WA 4YRJA 2CUKA 4FBLA 4ZVTA 4MYDA 2ZRPA 3I2JA 6LDHA 3GP8A 2PGNA 1EK2A 5CITA 3KB2A 1JHVA 4WAUA 1A27A 4ND5A 1K8ZB 1H05A 2WEKA 4RORA 2OORA 4Y18A 4ZRMA 3U44A 5DM70 1ULAA 1NBIA 1T8UA 3VUEA 2JHAA 4C0XA 1OY1A 4DR6B 5LQRA 3KEFA 5FL3A 5IJ0A 1FMLA 4WFJA 1PEAA 1N36B 2G06A 4TZKA 3FLMA 1G21E 2ZT7A 3AJ9A 4WN9A 3VUFA 3O82A 4PPQA 4C6TA 4JXZA 3NI2A 2CUTA 3JSAA 2FZLA 3QQ5A 4EJSC 3ZPXA 1HQKA 2GD1O 2ZWOA 2I87A 2BDTA 2XR1A 3H97A 1FYWA 3PA8A 3T3IA 1U7UA 1QPGA 2HRQA 1L7PA 1ONNA 2G80A 1NFFA 1JVBA 1U0RA 1FXSA 1O58A 5DLDA 2Z04A 5DI9A 1H66A 1NVFA 1TZBA 3KQQA 2QY9A 3FFXA 5FPKA 1UR5A 4GUAA 1J9EA 3T7IA 5I4KA 1UFOA 2BI8A 2G5PA 1V26A 1CU1A 1U0JA 2A1IA 1COWD 1V16B 3OF3A 3ZWOA 1GUYA 3BZUA 1O95A 3GGPA 3PKZA 2O3UA 4RPGA 4Y7CA 3GJ3A 4D46A 2O5RA 1EAYA 4EAAA 2I6GA 4I9UA 5B4UA 2DRIA 2BCEA 3K5IA 1QM5A 3U56A 4H35A 2BDEA 1EQAA 4HDQB 4MULA 1Z6QA 4OB6A 2ST1A 3E22A 5F1OA 4F38A 5FWDA 3PTAA 4DLRA 2WPDD 3DJYA 4U9UA 4BWGA 2H08A 4KXNA 4D0NA 2XYVA 3PE6A 5J4YA 2GBLC 2QNRA 5JBQA 3E9YA 4GPIB 1C8LA 1II8A 1SB9A 1K5DA 1Q1ZA 2C9MA 2PV0A 4YRDA 5G3YA 4RTNA 1KNQA 4H77A 4ZAWA 3BX1A 2AFVA 1U02A 1V95A 2GPTA 3DP7A 3NS7A 4HPXB 4I7EA 5DNCA 4GX0A 2QJOA 4C7OB 1EDDA 4OH7A 1BDIA 5BV8A 3Q10A 1T91A 1KAGA 5I7VA 3F2VA 4DJEC 5H4GA 3N8IA 2R79A 5CJJA 4E5KA 1XWFA 1JH8A 3TKLA 1LLCA 3RT1A 3MG9A 3B3JA 3BRWA 1M83A 4FFWA 4Q9KA 2GS9A 2C42A 3FDJA 3LBIA 4A1OA 3I4CA 3OX1A 4ZC8A 3JYQA 4KFSA 2HHAA 4BCCA 3IDAA 1IXRC 3DQPA 3EXEB 1M5TA 4Z0HO 4MRMA 4QNMA 3AEUB 4GPZA 1VHLA 3BZWA 4QU0A 3UAVA 1HK7A 2PFKA 2YJZA 3ZBPA 4E4YA 4IKOA 3EZFA 3CUSA 5AVTA 4LF7B 1U7ZA 2FXVA 1FSZA 5TQ2B 3DO8A 4TT3A 1GL6A 3OTWA 1GPBA 2J07A 2HJ9A 3TRJA 5EHZA 3R0VA 3SNHA 2R7MA 1UDRA 2J6IA 3OH8A 2QXTA 3E7FA 4LZLA 1SGWA 1Y3AA 2ODQA 4RV4A 1GRVA 1L5QA 2OCBA 4JT9A 4MWGA 4NR0A 5C8YA 2NU9A 4LGMA 4DGSA 1L4KA 3P2YA 4BB9A 4FVTA 2XNHA 4G5QA 4PYLA 1A95A 2DHDA 3HYTA 4BLVA 2O8VA 3BIFA 2OCPA 4EBFA 4HZIA 1WKVA 1AQLA 3PICA 5B30A 3HVRA 1IXZA 4BWYA 1T6ZA 1ULTA 3SF0A 3PFGA 2HOQA 1HO3A 2Q07A 4XWKA 4EUSA 2QVZX 1YVEI 1KJIA 1TEHA 1UC8A 1VGRA 5EUBA 2Y9MB 1QH8A 2WBLC 1OA1A 3CX4A 2R62A 4U6NA 3VYVA 5HUJA 1QSGA 3CUVA 1U11A 3HY4A 3A7DA 1SQ5A 4QEZA 3SJCA 1EWKA 1FU7A 1E4OA 2ZRLA 5FP0A 2ZBPA 5EIAA 4EKIA 5BSVA 1VYVA 3AESA 3RVSA 4BE4A 4EP1A 4CCAA 4IEFB 1RMQA 4B6FA 5JARA 4PSAA 3EG9B 4BUJA 4FE3A 4O0MA 4EMUA 2XOKA 1TD9A 1QG2A 1M7GA 4JNKA 3D6HA 1AC5A 1YB5A 4PNHA 3JAMA 1KVUA 2VC2B 3HNOA 2GWRA 4HDRA 4N5NA 3JRNA 5KNCA 4I1PA 4KX3A 4TV9F 4YA6A 2RK3A 2MU1A 1LWOA 5ABPA 2G9UA 3RD5A 5C7IO 1PZHA 1RRPA 1V1MA 8ABPA 2GK4A 1H5QA 2C0CA 1YD7A 2IYPA 3WBJA 2ZM5A 1C30A 3V7YA 1KZYC 2C4NA 3AR5A 3CE9A 1J9ZA 3L9XA 4DCVA 3EH2A 5DRTA 2XXAA 1QVAA 1LW7A 4JV5B 1BMTA 2QJFA 3OHMA 4DIKA 3K5HA 1UMDB 2JASA 4ZOEA 4M88A 4CLXA 1IY0A 1NP7A 3D64A 1SQGA 1OQAA 3TM5A 3UPTA 2QYTA 2Z1MA 2VA8A 4RMIA 4QDKA 1YUMA 4YAWA 1NVKA 1VMIA 4F5DA 4ZGGA 2D13A 4J29A 5CFZA 1C7QA 4ESVA 1UMBB 4R83A 3CF2A 4J9UE 1Y1QA 2F1KA 4JEIA 3HXMA 1V48A 2PGIA 1Z83A 2VLBA 3UANA 3VISA 4BLPA 3GFVA 2ZIFA 2QR2A 2R87A 2YJNA 3RT7A 2D8AA 4CKWB 4AQ7A 1HEIA 5AI9A 1MUUA 4D02A 1NOJA 3K70B 3RROA 5DBFA 5TJ9A 1ISJA 1JTVA 1LBIA 1CDZA 1VE7A 2NXWA 3DE7X 3G17A 2EBUA 3STWA 4CEJB 1K6EA 2WJ6A 4TWJA 3EWNA 1A4XA 1DOHA 4K9PA 1N2XA 2C61A 4HX9A 4OHVA 4DSZA 5I3CA 1MO6A 1P2FA 4L9AA 2DVMA 2PXXA 3QE0A 4R3UC 3NHBA 4QE3A 3RNOA 1I4WA 5D87A 4F45A 5BQFA 3TOSA 3WYBA 2HRCA 2IEGA 1ZD9A 3H4IA 1EDOA 3EQ8A 3LUGA 3SCZA 4K0RA 2GVNA 4QUJA 3DHYA 2F90A 2Q3FA 4EW2A 2HT6A 5JS2A 3L46A 4ZAZA 1A77A 2OZPA 3AOEC 1CUZA 1C3OB 1MC1A 3OJOA 4HGPA 3NQ41 4C76A 5HVNA 1Z56C 3C6QA 4CEHA 3B6MA 1V7PC 3HWX1 4NECA 4XIIA 1RCUA 4G1VA 2J30A 3DHWC 1GOTA 2IOYA 2OD9A 3DOUA 4ZCSA 4RTMA 2RGDA 3H16A 1G8YA 2AL7A 1OWMA 2GBPA 4D3ZA 2H0RA 2DSTA 5B7PA 2NTJA 2H1VA 4ND8A 2R2AA 1R4NA 4LZAA 3AHFA 2DWPA 1M34E 2PKWA 2RGYA 4PO9A 3HJFA 2VXBA 3GVHA 3N8GA 3OQPA 1B8PA 3FBGA 2C5HA 4QGFA 1PFWA 4UUQA 1VQ1A 3PNOA 1S3SA 3QYPA 4XI9A 3WMXA 4OHBA 4Q7MB 2OOKA 3GHHA 2I4MA 2LDXA 3ZHZA 3T1YB 2FWAA 5CYFA 1Z8DA 2ZREA 1YDEA 1ABBA 1VRCA 3HN2A 3EGCA 4ZEOA 4LMBA 5IJ9A 2OYSA 3QZUA 1XZGA 4EELA 2E49A 4OXNA 4F9TA 4FMDB 1KKUA 1XQ6A 1Q0LA 1U0OC 4L2IA 3TLCA 3QOXA 4BE9A 4C4AA 5CFQA 1YQWA 2ZJ5A 1XX6A 4UAVA 2AKEA 4DQLA 4Q3KA 1M10A 2A58A 1BHO1 4C5BA 5FR1A 4TMWA 1N5KA 1SEVA 3ZDQA 1QOQB 1YDWA 4JYAB 3ACDA 2OSBA 3QEJA 4HQNA 4K2HA 1BE8A 2Z4TA 3VC2A 1Z16A 3WNZA 2FR8C 2OGSA 1XZBA 2C5EA 2X8LA 1V37A 1PK8A 3T7EA 4ETWA 4ZHQF 5B12A 2UYQA 1GZSA 2O23A 2Y0EA 5KYYB 2IHNA 1BD3A 4C4YA 2G0TA 1KJQA 2JLYA 2ZBGA 3MIIA 3T7JA 2PRJA 3IL2A 2A78A 3VYUB 1V25A 2QRJA 5FEMA 3CZ9A 3IBTA 2X0EA 1E1CA 4KG7A 3GNLA 2PMEA 1PLLA 4LI0A 5K2MA 4M8NE 3DEFA 1RC8A 4N18A 3KP1A 2JRCA 3WKCA 3NBZC 3GLIA 2YNMC 2KSQA 2OE2A 3QWBA 1I80A 5IXYA 4MS4B 5EXPA 1DQZA 1NG1A 1O08A 2FFBA 3AB8A 1Z4JA 3W5JA 4BE7B 4OQFA 1MDFA 4OHWA 1CP2A 2JGDB 1IRXA 3VTAA 4O4IF 4K1XA 3MWEB 4PSKA 4TSFA 2E4WA 5H7XA 3RVLA 3PTLA 3WIUA 4DB4A 1V1JA 1FRFS 1UQRA 1DWQA 1R0LA 2BGMA 1R64A 2BE7A 5A71A 2QWXA 2VP9A 5AD1A 1R0CA 1JAXA 1FUYB 2B37A 2O2JA 3DXXA 4EA6A 4KMSA 1QDUA 4JJ7A 1ISRA 3VDQA 4BAZA 4OIMA 3F8SA 1BXRA 4OHCA 5IJXA 1U1IA 5BQ5A 1BROA 3RHSA 1C41A 2BHTA 3NU1A 3C5VA 1KARA 3ITDA 3C1UA 5EWMA 1S2IA 2QX7A 5AKKA 2V1XA 4WZZA 4ZVOA 5J58A 1SXGA 1JVNA 2H4FA 4NL4H 4D4HA 3T3NA 3FVRA 2H85A 5ECDA 5EIWA 5IVIA 4FJ1A 4YY3B 3OLZA 1QHGA 4R69A 1P45A 3RYCA 5I48A 3ICCA 2JJ2A 2YOGA 2X23A 1SY7A 1U6IA 1PN3A 2JHGA 3BXHA 3K1JA 4JA0A 3R5HA 5G0UA 5C34B 1KRHA 1NL3A 4EG8A 4H7DA 3FTQA 2ZANA 3LPAA 1IVNA 3V1MA 3VO8A 2OM2A 3ZZ1A 4DM4A 5FRDA 1S8NA 1OWLA 5T8KC 5A7FA 1RJWA 5DULA 2IYSA 1H42A 1PTJC 1XZPA 3OPYA 4NV0A 1MMFB 1ZN7A 3GNQA 3T1HB 4CYMA 1RQ7A 1V3VA 4EEXA 5JASA 2HMVA 1PO7A 2RGNC 3CNHA 4R9UC 4R0NA 4EVIA 1UWCA 1E77A 1MX9A 4KO2S 2ILVA 2VHTA 3K9LA 1JLRA 3GV0A 4IZ6A 4MZXA 4QBIA 3I2YX 4KYVA 4PX5A 4U1RA 3ZNNA 5F7OA 1SELA 2PZKA 1FNNA 4AXBA 3D4PA 3QFFA 3R4CA 1XTSA 3LUBA 2B34A 2O3RA 3ORYA 1TYEB 1M6YA 3IDZA 4JVSB 3ZWNA 4KK4A 4B73A 3AIMA 3MJVA 5KTYA 3FJ1A 4IWYA 2OL4A 3U7FB 1WMSA 4K3VA 1XXLA 3E35A 3K2QA 4L22A 2WYVA 2CV1A 1L4YA 3PJFA 4M0DA 3S6JA 1X6VA 1PUXA 3EYWA 4UE3S 4H7JA 2B1JA 3NTUA 2IFTA 1FFAA 2P2DA 4ZV4A 4HXFB 1E9BA 4UZFA 2QZ4A 3QVXA 4ZAXA 4REQA 5TQJA 4Z4HA 1QG6A 4B2LA 4Q3LA 3L8HA 3EULA 1BEUB 3V55A 1J7KA 4PZ9A 3PXGA 2I4IA 2IHVA 4JELA 4WACA 1QTQA 3JQ7B 1ZOOA 4DY4A 3CJQA 3NORA 3RTDA 1R10A 1JEOA 1ZKMA 3NOOA 2PDAA 4GM4A 5ICFA 2HV9A 3T0IA 4RPHA 5A5VA 2YMQA 1AK9A 3OMWA 4X7MA 2PM8A 3OY2A 2FAXA 4IFBA 3LXXA 3VR4D 2RGWA 5BMVF 4EYGA 1FY2A 1O6FA 3O75A 1KBZA 3WV5A 5JS8A 2I1LA 4HH4A 4Z0TA 5FF9A 1CQJA 2P40A 1SWVA 2OD2A 2BIFA 3I3OA 3TLBA 1PR0A 5K2OA 2FMHA 4F3KA 1IDOA 1MBZA 1O94C 2Q5OA 4X41A 3G5UA 9LDBA 3GUHA 1NNSA 3FD8A 1DJLA 5E3HA 1T3SA 1JZSA 4CKEB 3RGGA 3T12A 2P7IA 3NWBA 2JFOA 3O8QA 4KUEA 4MVJE 2PR7A 4IZHA 1UM9B 2NXEA 2ACEA 2Y68A 4WOBA 4BNTA 8AT1A 2R00C 1U5BB 2WSYB 3OSZA 3AIIA 4BUCA 4RIGA 4DY6A 1FB5A 2B4QA 3A4YA 3HDYA 1OIVA 4KWIA 3WNBA 3ETHA 1GRCA 4JQYA 4C05A 4I36A 4G9GA 1D0VA 4FNAA 3JU3A 2QBYB 1B15A 1KMIY 1GJRA 4S1NA 3EPHA 121PA 1PR2A 1UBLS 1HNZB 1K6MA 2YN2A 2QRNA 2XZDA 1XYYA 1R5NA 2P9YA 4YPFA 1NLZA 1U31A 5NLLA 5LLDA 3JQCA 1KEKA 1SUWA 4JXJA 1P7PA 1O6CA 1KOLA 2O7RA 2WTUA 4I1UA 4ZT6A 1Y5IA 2D1RA 1UMCB 3AM5A 4YEDA 4CMEA 1Y8QA 2BEUB 4QAQA 5A03A 1D2NA 3G2MA 3ZCSA 3L8DA 1RQ2A 1ST2A 2NM0A 4GMXA 4KQMA 1Q1BA 1YS6A 2PO7A 5BW8A 1J4AA 1QJ4A 2BFEB 2V7WA 4NEQA 4PNZA 4CMHA 5BOSA 4JNCA 3A2NA 4G8BA 3S7TA 3SJ7A 4FSHA 2VKTA 3DBHB 1DAHA 4OLAA 2V59A 2VSYA 3KXDA 2FLKA 2I6SA 1D2GA 3HSKA 2FEKA 3QLVA 4GT1A 5AXDA 3T5TA 3WWOA 4FR2A 2RGBA 2X2PA 1KI6B 4II3A 1PFYA 2GYUA 2QTVB 1F0NA 4RGVA 4UMVA 1N5OX 5CMLA 4O8ZA 1P5ZB 2HSEA 4HQRA 4MZDA 3M5PA 4QJ4A 4QIHA 3AOGA 2PANA 4KO1S 1VBFA 4JT8A 4RK5A 1EBBA 1GIAA 4R71A 3GGDA 4DCSA 3D3KA 4PR3A 5JIBA 3D8UA 5AJWA 1LZLA 3GQBA 3GDFA 4F84A 1W73A 2EJCA 5JW6A 2O07A 1K27A 3K53A 4LYGA 1W9HA 1XTIA 7REQB 2P4SA 3MJCA 3NZEA 4TUYF 2BMDA 5LOVB 1OW3B 1UJ6A 1NX6A 2OHHA 4CNQA 4XB2A 1FFBA 1MJGM 3EXHA 1EJBA 2IHZA 1AS2A 1NJSA 2K87A 2WIKA 4WPGA 2UZ1B 3SC4A 3PT5A 5EE3A 1JQAA 1EGVB 5H81A 3AI7A 1E6LA 4XSGA 2CMGA 4IDFA 4LSMA 5EYPA 5KVAA 2VDLB 4QM6A 1TJYA 4HB0A 4U0KA 4BNUA 4YJGB 3WLEA 3B20A 5AVXA 3LFHA 2WZCA 3K1AA 5C2JB 1VJCA 1Z4QA 3D1LA 4OLHA 2IS6A 4BFVA 5A5FA 4IH4A 3UWKA 2FK7A 5HQ3A 5IZ4A 2W6ZA 5CLHA 1MAUA 4JGGA 1ECJA 3A58B 1ZRNA 3S2GA 4IDAA 2H8GA 1GDDA 3FVWA 2YHAA 2Q4BA 2EP5A 3COJA 1JHQA 4WX2B 3HCPA 4MIOA 1JDNA 3PEUA 3MIZA 4NYJQ 1RQGA 2FZ5A 1H2XA 2IYWA 4DLTA 1PT6A 5CW2A 2BFBB 2ZBRA 4OL9A 1K8YB 3M8KA 4JUIA 4P80A 5EP2A 1ULBA 2ZIUB 1SU4A 1KI1A 3KL2A 2BTQB 4RDIA 1HG0A 3ZXIA 3MMSA 4FIZA 3PUXA 2ZUSA 1KI7A 3FOCA 2MINB 2VJKA 3PR2B 5D1HA 2XZTA 4HS9A 3W6NA 3ZY4A 5DP1A 1YGPA 1YQUA 2N9UA 1H6AA 2D4AA 2P7HA 3WRVA 5KYKA 3OTOB 1PYDA 3MK31 2ZBVA 1EGAA 3BORA 3RK0A 3F9RA 2YXLA 5AK6A 1HE4A 1AMUA 3KU4A 3QKRA 1IN7A 2EATA 1FIUA 2ASEA 4MWOA 3PD0A 4AG6A 2HR1A 1W93A 4ER6A 4C2AA 2PPVA 1UPXA 4CM5A 3O84A 4WINA 2J9FB 1PL7A 1RC0A 1RT9A 3L4BC 4XEHA 4QEDA 5J9FA 5AK4A 1J24A 3VSCA 1PHPA 4F5WA 1CJVC 3HCDA 5JCPA 1X0XA 3AUKA 5DNEA 4CV0A 4RYDA 2Z4SA 4WA7A 3CNQS 4CBVA 1UBCA 2HYIC 3ND5A 1U9JA 1ZSVA 1U9YA 2QN1A 4IBOA 2B7CA 3UJNA 5E4TA 3DWIA 4JKIA 1I7SB 4AX8A 1AY0A 1GQSA 2J9GA 2BC9A 2G70A 4JLDA 2H7XA 3PPWA 1B6TA 4KO3S 5EEGA 3ZLUA 3JD4A 4D6YA 3DVRX 3OQNA 1LW6E 3LPLA 4KL8S 2WIAA 1U2ZA 1X8KA 5TPZA 4HZUB 3R7AA 4PQFA 2O3QA 1EUDB 3IAXA 1GGEA 3HV0A 3OFND 3CU5A 4EDFA 5GMOA 4O2BF 3NMUF 2BL4A 2PS0A 4L07A 3HKDA 4Y2YA 2HCFA 2A0UA 2JLAA 3WQQA 4AW9A 4EF4A 5IXSA 1YR7A 1JDBB 1XD2B 4LXQA 1WDLA 2J4CA 4S0ZA 5I4CA 2INGX 1E6CA 1Z25A 3C7TA 3KQMA 3QEKA 2ODBA 3TB4A 3VTZA 4B6OA 3FMFA 4ZCMA 3O8RA 2ETXA 2VWPA 5AUPB 4AFNA 4J3JA 3TSYA 4IG4A 4R01A 4LXUA 2PBRA 5FBHA 3JS5A 3F5MA 1VJRA 3CBGA 4YROA 4QYXA 1GA4A 2Z43A 1NVXQ 2EBWA 3R5SA 2VJPA 4V3CA 3PXDA 1DSSG 1QC5B 4V0KA 4JOCA 2X3FA 4BMOB 4OSEA 1HZZC 1WCIA 4R84A 1HYHA 5TJHA 1KVQA 1NF2A 1HFJA 2KS6A 4BOYA 5H9WA 4NOMA 3ENKA 4JXXA 1FMTA 3OMLA 4CCWA 1SRQA 2WJWA 4FMCF 1JIUA 1GSHA 2RK4A 4M60A 1XZDA 1YR6A 3FOWA 3LVBA 4KYUA 1HDEA 2PUGA 1FNSA 2HPAA 2RI1A 2I6QA 2YYAA 5FWNA 3KQWA 2YZGA 1PFVA 1GQOA 4I6GA 4IVPA 3CLRC 1IY1A 3KB8A 2GFQA 4JBYA 5AK5A 4CPDA 3IDQA 1W88B 3T15A 3PI6A 4XQGA 4OBBA 2W6ID 3TLZA 5LPNA 1IBLB 4K46A 4AO8A 2VSXA 5JZVA 1J0AA 3GZNA 3GCXA 4FHZA 3CUYA 4JC5A 1U8UA 1O4WA 2WM2A 3GX1A 3NAMA 1HE3A 4HNGA 1ONPA 2FSIA 5JYEA 2X42A 2XD4A 3LHFA 2ZG6A 1RHKA 4PLTA 2IHKA 1ULUA 2ZB4A 1U7WA 2JJ1A 4ENRA 2E18A 1F51E 2GN9A 4HSEA 1PYGA 4IY1A 1CY1A 3V1NA 1D3AA 2JH3A 4LQ4A 1LQTA 2J46A 1EP9A 1GL9B 1ZBDA 2NADA 3EZNA 1M1XB 5DHSA 3HBMA 4EVSA 1DQSA 4CJXA 1ODIA 1Q92A 2ZQZA 3VPHA 2C7VA 5BVGA 5C5DA 2CNOA 3TIGA 3WMWA 3NEPX 2ZJ1A 1CJSA 1SBTA 2VPQA 5CP8A 4PYIA 3UAXA 1IMOA 4BX3A 4RXUA 3QHQA 4BFSA 3IERA 4HWOA 1KTVA 1HLPA 1NASA 3NWOA 4FUTA 4NBKA 4UUPA 6PFKA 2QG6A 4E1AA 2O0JA 2R84A 3NASA 3HR4A 5CLIA 4C30A 3THXB 3FA2A 1NHWA 3UK2A 4F56A 5IULC 4DWOA 4LF8B 3BXZA 2VTEA 1KYVA 1THMA 4LISA 1ETHA 4GGOA 3Q3VA 2G83A 3LZDA 4A0SA 1TTQB 4BC1A 5A4FS 3H5OA 1F6WA 3NR2A 4GP7A 1US8B 2OZEA 1GNRA 2OORC 3EC2A 3GBSA 1XEFA 3GGOA 3JAKB 3SIPA 3EOAI 4CF3A 3I58A 4F8YA 4B80A 2AA3A 1ZO8A 3IEKA 3CKMA 2VP2A 5KYTA 2GX6A 2OWEA 1YONA 1Z5PA 2NX2A 5JZBA 1UEIA 1RVDA 2JGAA 4G86A 4X71A 3C6MA 5FAXA 1L7MA 4OLJA 3FUXA 3TB6A 3WRXA 4CLHA 5CB4F 4A4DA 3LWNA 3R6DA 1BDMA 3RIMA 3F6CA 3ZU3A 3B9RA 4MPTA 3EPLA 1WMDA 2TYSB 4J94A 3QKSA 5AI0A 1UUFA 4MR8A 1I0IA 4U2DA 4MYRA 3QVWA 1FA9A 2H92A 4TMFA 1YH3A 4OQMA 1UFVA 5KDLA 1YZUA 2YRXA 2G77B 2ZR9A 3OZWA 1GCOA 3PCTA 2ZAIA 3AHEA 3UWOA 3C4QA 1RVV1 5KYUB 2HXSA 3G85A 1JHXA 1ST3A 2D0DA 4Y0NA 2DPGA 1PHRA 5ITSA 1OKKA 3EXFA 3GCZA 4QJIA 3BH7A 4TV9B 3D4OA 1KFKB 5IF3A 4OGFA 3F6PA 1G5IA 1XJQA 1DC3A 2HO5A 4J3FA 4JJGA 1EZZA 4NC9A 1HR0B 1M6VB 1RRMA 3K6JA 5LIRA 1OH8A 2WLSA 2P3OA 2QVLA 2NTVA 1O03A 2B99A 4PLPA 3RVJA 1MF7A 5FLYA 4AWAA 3MA0A 2YZNA 5BN5A 4KN6A 1D0IA 2DYKA 3NUQA 4M1TA 4MX8A 4N8EA 2R48A 3DR3A 4RADA 1H6DA 1RI2A 3B7WA 4M54A 3RABA 1TAUA 3RIGA 4F9EA 3QUCA 5C4MA 4KR7A 2WWGA 4NENA 3NTQA 3U7JA 4DV6B 1SCJA 5HW0A 1IK4A 3AHDA 1UODA 4KAJA 4C22A 2OHOA 1JPUA 2Z30A 2QF7A 4B45A 3W8DA 4M1KA 4CM7A 4Z54A 4DADA 1HEYA 3NYQA 5JALA 3HO8A 2Y3IA 3PC7A 1NW6A 4NHOA 4AUNA 2E6UX 2QAIA 1SVOA 1GUAA 3B9PA 4IQ8A 4OMCA 3PKIA 2DEUA 2JLSA 1UH5A 3GOQA 2NYRA 3AINA 3GH3A 4FFBA 4S2UA 4DIEA 2EAUA 3HB1A 2PUWA 4YLYA 3GLVA 2BLLA 2HA2A 1RJEA 2GAFA 1BOFA 1RBMA 3G7SA 2CHEA 3MRXA 1E32A 1Y0BA 4IPTA 4S35A 2ILTA 3K16A 4GLLA 4MW4A 3AZPA 3L82B 1C4XA 1XSEA 4ONEA 4CV3A 1ORHA 4LKRA 3HV2A 5IKPA 2PUVA 4V1CI 2VXYA 3FGPA 2W11A 2ECOA 2RHDA 3GIWA 3HR7A 4Q9AA 3S40A 1YS7A 1W0JD 1SXJE 2RAUA 1N57A 3MOGA 2EGUA 3TGLA 4OQEA 1ZY2A 2F9LA 1FX0A 1LJ8A 4ICIA 1J8VA 4UOQA 4X1OA 2A7XA 3T3GA 3QITA 4ZAFA 4BV8A 3PGKA 4LJ5A 4LGCA 2P79A 3S2UA 2V45A 5JAPA 4ALIA 4N12A 4MW6A 4RSGA 2XRMA 1RFLA 2JK1A 3U3RA 2QSJA 3RKUA 3LYLA 5EJIA 3MWDB 4FYMA 4LNHA 4TL6A 1UDBA 4C0AC 2VTBA 2PTHA 4WCVA 3N53A 4RM2A 4XQEA 2ATIA 2V9PA 1Q0SA 4ZVVA 3M7IA 4LYDA 3VJMA 1L1EA 1M34A 1XXHE 3RJTA 5FQNA 2YJGA 2GD2A 1M8PA 1SC4A 2M9MA 5AOCA 5F2OA 3ZIUA 4C4XA 3WV4A 1BN6A 1GZ6A 3MS4A 5HM8A 1W1IA 2G1UA 1FL9A 3ZE2B 2UZ4A 1N2OA 1AV6A 1U7XA 3GLHB 2WD8A 3TLXA 2YVKA 2VOEA 2VSQA 2YWXA 4LE2A 2AR0A 4V24A 4CE6A 1VE6A 1Q19A 2VQEB 4D9HA 3QOYA 4NSNA 3L8GA 1VBKA 1XI2A 4QU8A 2OXIA 3BL6A 3MWGA 5AVJA 2GETA 5T3UA 3UOAB 3TZHA 2AKAB 4DBLE 3REFA 2OCKA 1JHMA 3MT7A 2Y6VA 3AMVA 4LRQA 1NAHA 1T6NA 2IHTA 2HA5A 4PIVA 221PA 2GFIA 1EZ1A 3HABA 4QYIA 3U17A 3IRVA 3NEYA 1EFRA 4WIAA 2FPPB 5E2IA 4G5HA 2WUDA 1AK2A 3UAGA 4M86A 1AMNA 3DMDA 4BTLA 4XASA 3UXHA 2VZ0A 3RSFA 1RYNA 3WWDA 4EG1A 2G1KA 4L7QA 3BB1A 4GR9A 4DMHA 3BSWA 3O26A 4ZHSA 2J5QA 3K1TA 2X9GA 1TMYA 4O4LF 2P0YA 5M29A 1W85A 3PEYA 3MPOA 4PVDA 4CKCA 4ZHQB 1X1DA 1W5EA 1ZDMA 2UYYA 2YMMA 1E6MA 2BKVA 3GRFA 4IYRA 2PUDA 3R3ZA 4ZZ1A 1GZ7A 2R85A 4L9WA 3LNCA 3A32A 5EKUA 5C7YA 2X1HA 3EFBA 1FS5A 4C04A 5L53A 1NMXA 1SCNE 1EWQA 1ZXLA 4INZA 1GRQA 2GUGA 1WY5A 4QQRA 3VOTA 4OK3A 1GT91 1EE1A 1QMPA 4H4EA 4I0WB 5FULA 4ECEA 4U00A 2X1VA 3U7RA 5JPDA 1YRLA 4GI3A 1YWGO 3DBLA 3I9V6 1EX1A 2CLEB 1PL6A 3GUUA 2PBLA 2CKDA 4JJIA 2QPLA 4ZAGA 1O89A 1OVMA 4GXNA 1BTOA 1U9IA 2A3NA 4O4IB 5HZKA 1ND6A 4WY5A 1BDJA 2XUDA 1Q0ZA 2WG1A 3HCRA 3STUA 1VFNA 4RHCA 1A2QA 1TF7A 5ILOA 4TMTA 1X8XA 3QV1A 4QQNA 3FNIA 4OB8A 4B4VA 2RHBA 1QK3A 1R66A 3CH6A 2QU8A 5FWYB 1I2AA 1XTUA 5AR1A 2VDRB 3FCAA 4GX2A 3MSXA 1T9AA 4JR2A 3EHDA 4JI7B 1N3BA 2RHRA 3CZ4A 1VIYA 3BJEA 2OCIA 2M6RA 3D3WB 4J4HA 4J76A 1I1QB 4YRPA 4J9VA 2JKVA 3C98A 5DLYA 5K51A 4FQ8A 4TTTS 4JOSA 3WNVA 5BORA 7GPBA 4OX9B 2JGIA 4E3ZA 3CE6A 4OGWA 4WZAB 1ZL2A 1YE3A 1TU4A 5FWAA 2QTLA 4QOGA 4LXGA 2QX8A 4K86A 1A2KC 4MV7A 3SZMA 3TRIA 2GXQA 1WMEA 1XZQA 3UENA 2QJRA 1EBFA 1U04A 3S2ZA 4ARAA 2LGJA 1Q1EA 4E22A 2HX1A 4PICA 3C5EA 1X7HA 2V7QA 2D1YA 2YICA 2WF9A 3HL4A 4GS5A 4V1CA 3E9MA 3RAFC 1Q0HA 4RVFA 2XUJA 2YL2A 4K8RB 5G40A 3DBRA 2P9JA 3A9UA 4Z0NA 1PFQA 2A88A 3UVEA 3ISVA 1OILA 1FTGA 2JAHA 4I4CA 5IJZA 3DMRA 1P4GA 2X6RA 4CQLB 4URXR 1A69A 2IY7A 1G8HA 4NWIA 1YRQA 4KFRA 5T5QA 1USKA 4BMCA 4F5ZA 7MHTA 4OQPA 1R6AA 4HXYA 4EY3A 5BV0A 1EG2A 2NXNA 3W04A 5JSZB 1SKMA 1E2GA 3KJIA 3GGSA 3OZFA 1L7BA 5FUQA 2R6AA 4MV3A 3GNTA 3D2AA 4BC0A 13PKA 1XALA 2RGGA 5H59A 3FWPA 1B76A 2RAVA 1JR3D 3W2IA 3EFEA 1OT3A 1JZTA 2DFNA 1F1JA 1QVWA 1Y3IA 2CDAA 1SD2A 3CCFA 3PPXA 1REQB 1YZ3A 5ALHA 3UAWA 4C2UA 5JNUA 2Y92A 4TMVA 2VT7A 4YJHB 3TZ6A 4RTJA 5IYZA 3EYAA 3LL4A 1T8RA 1ZM3A 4IICA 2RHCA 3BXXA 4B4OA 1VDMA 3IOCA 1GKYA 5L3ZA 3RB8A 3LCCA 3L7KA 1R1DA 3KVYA 3TIIA 2AOTB 4W1PA 4BO0A 3MYYA 4UUNA 1FFDA 1G8KA 4Y6PA 1UK8A 1W6UA 2G3YA 2N75A 3B9QA 3NDPA 4ZEXA 2K2WA 4H1UA 3DBIA 1RLTA 2ATXA 1D1SA 1BMDA 1GZHB 1XLVA 3BA6A 4QUBA 2YQ5A 5JROA 3G2OA 1F14A 4PLWA 5C4IA 4RYLA 1T6XA 5F76A 4EB6B 5BMVB 4EHFA 4BX2A 5T4EA 1I3KA 1FYDA 4OK6A 4GYWA 3RSSA 1E5LA 4YP1A 2QVGA 2GQ0A 4F2DA 5E6RB 4MVJA 5J2UF 1QP4A 3MS2A 3AY0A 3IUBA 4MIYA 1WVIA 3L5KA 1D2HA 3PFWO 3T7AA 2C5FA 4CR8A 2P2LA 3QHPA 2ID7A 1T2CA 1F2VA 2VDQB 2XA1A 3B3GA 4UD6A 3WIBA 2YBEA 5LVAA 4Z8XA 2H2IA 4KLCA 3G3EA 3FYHA 3N2KA 2XCTB 4OAQA 2C00A 3LO8A 3O8LA 5IDQA 1PP4A 1YVUA 2WE7A 3FG9A 3OM8A 3USES 4GLFA 1EK5A 5IMSA 2M6SA 5CPFA 5JNSA 3EMDA 2IGTA 3ZLTA 2HJSA 2VDWA 1TNDA 1DELA 1G8PA 2PU5A 3JD1A 4LXHA 3IIIA 5ADWA 1BN7A 2G9RA 4LHVA 1KY4A 1DV2A 1BEEA 2Q5CA 4M1YA 4PBRA 4AKIA 1Y4UA 3PFKA 4HGYA 3NTRA 4NV1A 3CVUA 4E08A 2POCA 1P3JA 3A27A 2X0IA 2Y4NA 3IALA 4II2A 1ZYUA 5EJAA 3CTMA 2RHHA 4UU7A 2YS6A 2CXTA 2JFWA 4BYMA 3JR3A 4YQYA 1W96A 1B74A 2QM7A 1FBNA 1X2BA 4GVPA 4IOLA 3FDXA 2D4HA 4K81B 1CD5A 3EXAA 3C1OA 4DUPA 2G0NA 1NRWA 3WK6A 2WF8A 2LKCA 2REQA 1L3CA 2VBIA 5FX2A 4D8TA 4RGQA 3ORRA 2Q7OE 1OA0A 3EVZA 1IATA 1ECGA 1IJKA 2PQ0A 3JR7A 5KSPA 4G85A 2O8CB 1FTNA 5BQOA 2VJBA 1C4KA 2VOJA 1E0KA 4M2LA 5K3OA 2XYRA 4BU1A 1FDUA 3F78A 2XLCA 3R7DA 3PDJA 5IC6A 1GLVA 3EBOA 2ZIZA 5FBKA 1X7ZA 1WMFA 1YL7A 1AB6A 3OEEA 3UK7A 2R6DA 2IZOA 3KR2A 1Z37A 1YR3A 3E9QA 1HMYA 1VJGA 3ET4A 2BBSA 1GPDG 3I34X 3OM9A 4R31A 1N3LA 1W1UA 5D7NA 5FYQA 1DQRA 5F7XA 1UBKS 5T67A 1LTHR 1WAMA 5FI5A 3JVDA 1N4DA 2DPHA 1BQ3A 3EHEA 3EMVA 4EO4A 1DKQA 2OVBA 4TUYB 2XT9A 1Q1GA 1ZEJA 5IH7A 1S89A 3IEUA 2PD3A 3HKCA 4BMVA 1M6HA 4G0XA 3TYXA 3SXUB 1AB5A 3FTNA 2W6MA 5JWOA 3L7DA 1U7OA 1KFEB 5BR8B 1FVXA 4FBGA 1UINA 2CXOA 4DBZA 1Y6FA 4NCAA 4W9NA 5H16A 3GDHA 3AM3A 1I7PA 1YJXA 1FVHA 3DTNA 3ODPA 4MRRA 4W7HA 1JKFA 4E11A 3U5ZB 2GOYA 2X19A 3FGNA 4BTVA 1VBNA 3T0GA 2R7NA 3M4XA 4LY3A 1FXWA 1Z5ZA 4QJ3A 4ZVMA 3KDAA 2HFKA 4FX2A 3A3NA 1P7VA 3CMCO 3TAUA 3GFOA 2MCFA 3C70A 2DPXA 3L79A 4L78A 5FEUA 4Q1FA 3CEHA 5ED4A 2WPNA 2AI1A 4JDUA 4KKVA 2JL1A 4O25A 3AF3A 4EKGA 3EDQA 2QK4A 1JG7A 4PNPA 2NNWB 2Q6LA 2WWWA 3DZBA 3EQ6A 3L0ZA 1BDHA 1QX3A 3MERA 1V3TA 4TYQA 4E5VA 3M82A 1GEGA 2FG7C 4DG5A 1SOWA 2C2MA 1JFFB 2QXYA 4KXVA 3OIVA 2P9HA 2MYNA 4PRYA 5TPWB 3WHLA 4FHDA 2R6R1 4LBZA 1C9EA 4XB6B 1QYXA 2LBPA 1L6IA 2EQBA 3FYUA 4YXWD 2VPZA 3A7EA 3COZA 3DTYA 1X8JA 3R9KA 5JO0A 2RE8A 1I6KA 1GADO 5LUAA 3H6GA 4F71A 4JVNA 4KV9A 5BQPA 3THOA 4CMIB 1TTTA 1C1DB 1J20A 3RG8A 4YJKA 1GTSA 5TRTA 5DHFA 5EPUA 3GPBA 3KLBA 1JQKA 5A06A 5BUCA 1S02A 1XCPA 3S2IA 1NQAO 1XK7A 1IB6A 2I7VA 2JGRA 1THGA 1H5UA 2WYIA 2FG5A 4KVFA 5GP1A 5TXGA 1G38A 1BW9A 2PGOA 3HP1A 3QNMA 3VNAA 4P33A 3V2GA 1UL1X 1M6EX 3KOMA 4B0PA 4MYCA 4W9MC 1YZNA 2QLLA 1U0HC 4B3TB 4CCYB 3JAWB 1WE2A 4GECA 4JL6A 4N54A 4DEXA 3PDUA 3I76A 2BR4A 5HDBB 4WRRA 2NO9A 2OOSA 4P31A 3UHJA 1HOXA 5E7IA 1FRZA 4CN9A 5IT4A 3D1JA 2VUUA 3SBXA 1BRMA 2ON6A 3H1EA 2VIIA 4PRKA 2CXPA 3TF5A 2OB1A 3FVVA 1U7HA 3AJEA 2WJAA 5HWSA 2W7TA 3U9LA 3X1MA 3WGVA 1XU4A 4BAUA 3LY8A 1JFVA 1MN6A 1RAGA 1T13A 1VLZA 4O2BB 1D6SA 4XM1A 3ZHXA 1DCTA 2D2EA 4HAWA 2VTVA 5TVGA 1PBNA 4PU0A 3AR9A 1E3WB 3ED1A 3FSGD 3ZHSA 3CO0S 4RPIA 1BA3A 4NZ9A 1JFLA 5TB5A 1PJSA 1W29A 3M81A 2IJGX 4L4SA 1I01A 3PJDA 3DZFA 4LXYA 3USZA 4DFDA 1YBFA 4OSPA 2AOUA 2ZWVA 1QGYA 4A6EA 4MPRA 4YECA 3ZUGA 5JZMA 2DPLA 3BMCA 5SZIA 4BJHB 1RXIA 4FS3A 2DHCA 1RAEA 3EOBI 5IWAB 5BV1A 1TMGE 4LC9A 4MICA 4ZYUA 4RCVA 1ZVVA 1W8IA 2ZJOA 2BR3A 4QDTA 1WU7A 1WABA 1OAAA 4NI5A 2O8FB 1CDEA 3AKYA 1JDZA 1Y6ZA 3E48A 4FKBA 5KVVA 4FXOA 4P86A 2H1RA 2B2CA 4L8GA 3GWZA 1C1XB 1IIRA 1W4LA 2NVOA 3HKBB 4UBIA 1YA6A 1PT5A 4JB3A 4J7UA 2OKCA 2XUQA 4FMCB 2KJQA 3LK7A 2R6JA 4MUBA 1U65A 1ZR2A 2RGUA 3QXJA 3F96A 2HCJB 2OC9A 3F7NA 5TDHA 2G9ZA 3L4KA 4MJ3A 1JEEA 2J3IA 4FFNA 5DGDA 3TGPA 2GSWA 3AWDA 4WCFB 2JIZD 5EJGA 4HVAA 3ACCA 3WTBA 2XEDA 5JE8A 3CR3C 5BR1A 5K0TA 3OQIA 5F9HA 4HFRA 1XB2A 2CXRA 2FVXA 3OIDA 4IEEA 4OG2A 1JE0A 2GEDA 3H84A 4BIIA 3EZYA 1I10A 1DBPA 2JBAA 1F4PA 1H1LA 4HAYA 1J90A 3MTQA 1XDDA 2XNDA 3ZLJA 3K72B 4K6FA 4JXKA 1T8YA 4G8JA 5D3MB 4BECA 2OHVA 4GOLD 4IL5A 2E4UA 2JJQA 1T5LA 1SCAA 2E4VA 2PX6A 3G6WA 4BBZA 1P1JA 1U1DA 3IMGA 4Z0PA 4G1UC 3GVCA 2VJQA 4QQKA 3OECA 5AOBA 2WHEA 2JD0A 2Y4OA 1P7CA 1KH1A 4O1IA 3KKNA 4R1MA 3N86A 3SFVA 4K9LA 4UM9D 1FUUA 3Q8LA 2UZAA 4J07A 3KUXA 3MB8A 4PLZA 5CFMA 1D4AA 1O5IA 4P8RA 5FOSA 1YBVA 1JG1A 3KWFA 2C3MA 1NVWQ 1XZ8A 3GDWA 3T7DA 2DWCA 2FEWB 4R7ZA 5JXGA 5D5HA 5JJ5A 1S7GA 5A6SB 4Y0VA 4Z1MA 2G5GX 4UEOA 1YCHA 2SHKA 5JAIA 5AW6A 4BKOA 3COWA 2OAGA 2XB6A 4TKMA 4WERA 5HOQA 1QDLB 2X8BA 3H9QA 3HDTA 4QARA 3ER6A 4HYYA 1JTFA 2CDCA 5ITZB 3B5JA 3O74A 1E4EA 4V02A 3G0IA 4DLAA 3WP1B 1C8KA 2DLNA 2IZ0A 2V4MA 5EVCA 2BWJA 3LIPA 4CZ2A 3CH5A 3GJ0A 3CX6A 1CZOA 4O6VA 5FPHA 4URZR 5CB4B 1M33A 2GNPA 3EOZA 4AMZA 3WYCA 1EK0A 2ZSDA 3OBIA 1N25A 2C2GA 3NRJA 1KWGA 3I9MA 4BX0A 3KT6A 4URHA 2IW3A 1IZZA 4O4HA 5REQA 5LD2C 3SVTA 2NQTA 4P4UA 5ALZA 3CZCA 2GKOA 4D8XA 3F90A 4KHPB 3PNVA 4Y98A 1YF3A 1IY2A 2YY7A 5A05A 4EJ0A 4FHEA 2OYCA 2W6JD 2XY4A 1TTPB 3LP5A 4C7KA 1WSWA 4LG1A 2M1ZA 3P8ZA 4UHJA 3WQSB 2H2GA 5FWXA 2GPBA 4M0FA 5C0OE 3TVYA 2GSDA 3UCXA 3A4NA 4LN1A 5K6TA 5C53B 4H7PA 1SUPA 3WZLA 3ZCQA 2C7OA 4FFRA 2DUNA 1X9GA 3GYGA 3TWOA 3ZGXA 2JLXA 3LT1A 1ATIA 3C3DA 1MRZA 2I22A 2J3KA 5MHTA 4C29A 3CG4A 3ASYA 4QUIA 3A2MA 3MM4A 3AVTA 1T26A 3G2HA 1KK2A 2VBGA 3JATB 1EUCB 4RHTA 4BNGA 4CGZA 1SG9A 3DKPA 2I6UA 1ZMOA 3DOIA 4N8DA 1YE5A 3D2CA 3LLUA 3I61A 1QE5A 2I3BA 4ZOCA 3T4EA 1HV8A 5ALXA 1T0HB 4G1BA 2VZ8A 1CIPA 1MEOA 4OJTA 4URVR 2XWPA 3HLTA 5JVDF 1GPKA 4JMLA 1HZJA 1EG7A 3VU0A 4DSNA 4E46A 4B3MB 3OZIA 3W78A 5TGZA 3VOAA 2PWBA 3VA7A 2CFCA 5B1EA 2VAXA 3PA6A 2FMIA 3CCBA 2FP3A 2HEIA 3QFHA 4KR6A 1LNZA 4NMXB 2NO4A 1ZMBA 1RWXA 3EQ7A 2X0FA 3T41A 4ASUA 2DHRA 4CI9A 4BVEA 3KQUA 2ABWA 2V7GA 4GP9A 3RYHA 3W05A 2F8TA 5A7GA 2VHXA 1BS1A 1IJBA 2YFQA 4C5CA 3IAFA 5ETJA 3OOHA 5KSWB 4FSXA 2X7XA 1XRQA 1ZUD1 2I5PO 4PZAA 4MUMA 3PJEA 4PPNA 1E7MA 3TLMA 4NPCA 2P41A 1DE0A 1IZ9A 1D8AA 1XMPA 4GMHA 3G13A 3SIWA 1YA8A 3F49S 4KSYA 3VM6A 4MP6A 5AH0A 4ZODA 1NVVR 2NO1A 3NFYA 3BFKA 1XXHA 5CB0A 2OV2A 2YV1A 4M3NA 4EFDA 3C3EA 3W4KA 4JEHA 1DFIA 2QRKA 1WCXA 5AHXA 2RCYA 3V4RA 2EQ5A 2OBBA 1QIEA 5AQEA 1BE6A 1K86A 4WLNA 3E61A 3OETA 1JEYA 1OXSC 4K9RA 2NXCA 2BY4A 2ZSKA 1XZKA 1E8DA 4JB2A 1L4FA 5CX1A 1NJ6A 4ENWA 3V00A 5J23A 2P77A 1ADFA 3CUEF 3R7FA 1WHTB 4HNQA 2PXHA 2ZVPX 2C8KA 5EXDA 3VR6H 2VHEA 3V2HA 1NOKA 3N1UA 1NP6A 4IO0A 4LAFA 4A0RA 5IU6A 1ZN8A 3AEXA 3RFCA 1U5AA 2JCBA 4RDHA 1CRLA 3UA4A 3W9SA 4J0DA 3K30A 3ZVLA 4U7HA 2ZBEA 4Q1CA 4I4NA 4DNFA 1E3SA 1PR6A 3IR5A 4HWSA 4K9SA 3KFVA 5LZ5A 1Z12A 2A0FA 3EBLA 3AP2A 3AUUA 3EGDA 4M89A 1V11B 1TO6A 4OHZA 4WXPA 3V8BA 2O7SA 1CQWA 1Z15A 2XUAA 3H9JA 4LHEA 1E79A 1SK9A 4XA8A 2Q7DA 5ERGB 3GT0A 1NC3A 4ZOQI 5EUMA 1YR2A 3ICVA 1ZUHA 2OEPA 3L7AA 2ENWA 1TJ4A 4LOIA 4DNPA 5HPYB 1XVLA 2XDYA 3D2BA 4NFLA 2RC5A 2KBEA 1ULSA 1BGVA 3TQHA 2P67A 4L4UA 2OBXA 2IH4A 2AQIA 4L3OA 4D82A 1Y6QA 3MT8A 1I7LA 1W87A 1YOBA 2GO1A 2OXRA 3IPYA 4IUDS 4BX9A 2RBGA 3AB7A 4F3CA 5GZ3A 2ZOSA 2HF7A 3P2MA 4RY0A 5CHYA 2CSXA 4NBLA 1QO9A 4O4LB 3WRWA 4F21A 4FGSA 5AO9A 4Z4FA 2H06A 4PO8A 1V9LA 3G89A 4XQ9A 3HXLA 1ZONA 2FJPA 2WSSD 3U9SA 1F4VA 2G82A 4ZJUA 4NK5A 3T9BA 1ACJA 1HXHA 3G8DA 2BBTA 3DDHA 3L4JA 2ZRGA 3HRKA 2B8EA 1OXMA 4DARA 1UJ4A 1JALA 3M6UA 3WLJA 1Y9DA 3LZCA 1CE8B 5BYAA 5EE5B 4AXXA 4PLHA 1JHDA 1DEKA 2A6PA 1XNRB 3COVA 1B93A 3KE9A 1J09A 4Z4GA 3ONVA 5H70A 1R88A 4ZOLF 1A50B 5JSKA 2FWIA 2DTDA 3SSNA 3AXTA 5JHHB 5EQDA 2X6QA 1EP2B 4EHLA 3NJ4A 5IDYA 3CUKA 4JKOA 1OC4A 3V48A 4X5OA 1FDWA 2J9ZB 1V16A 4JX8A 1IUKA 1RRVA 2Q3DA 4P0PB 3IKMB 1XNQB 1F8UA 4L5BA 5GIOE 2HJRA 2EZ8A 3EASA 3BDVA 1F1BA 3EGVA 4DXDA 1LK0A 4WEOA 4Q48A 4JDPA 4J2TA 4Q9HA 5JAMA 1L7QA 1O8BA 1YR1A 4WV3A 5DTQA 2YDYA 3ZWKA 5K8CA 2P8SA 4Z7QB 1XOIA 4I9NA 1NM5A 2GJ4A 5G0VA 4P81A 3FMOB 4B1FA 4BNZA 3RAEC 4UUOA 2BHLA 3MJSA 2N3ZA 5D6NA 3WLPA 4YRZA 4IIGA 2PZGA 1HNXB 5DBIA 2PSSA 4DLXA 1JTEA 2FGKA 4DRXB 1J2UA 5L9AA 3OCYA 2HQRA 5HF8A 4W9RA 1KO4A 2C9YA 2CXQA 3GAAA 4MA5A 4CEHB 1WEKA 3SPXA 1CF4A 2Z5FA 3JTMA 3U0VA 1TPZA 3AEQA 3MAAC 3SX2A 1L5HA 1LXCA 4FGZA 2VWQA 1MW9X 4NBTA 4GBGA 4EARA 5HOEA 4G1CA 2F3RA 1G1AA 1TFUA 1I4OA 2GBFA 2XYPA 3AW8A 4PC7A 1PUJA 2I34A 1G5RA 1Z2DA 3FLAA 3OT1A 5FBWB 4XYLA 3OUUA 4ZGWA 4HJRA 1XKTA 1N0VC 4YUVA 4EECA 5DI3B 2YNMD 5I3ZA 3EXEA 3BSFA 2EFHB 3AEUA 4GBED 4BPRA 1ISMA 2D62A 4KH0A 1DV1A 1I32A 1IZ7A 2HSZA 2OM6A 2ZAOA 2GAOA 3FMPB 3E7XA 4NAUA 3LRTA 3TN7A 4JU8A 2VJAA 4AF8A 1Y34E 1FJHA 5TQ2A 3OOEA 3RC8A 2P11A 3GL9A 1Z06A 3ABZA 1J56A 1VPLA 1JFSA 3QPCA 4X6UA 4LV8B 4PONA 1YNOA 2JHCA 4FB4A 5INTA 4P3XA 3W2TA 4UM7A 5A9RA 2H5LA 4G56A 3IPRA 3FWZA 5D8DA 4LRTB 1U3FA 1XF1A 2PVSA 4OBXA 4W5OA 1DJMA 1XROA 4K26A 3KL4A 1XTTA 3PCRB 5D1NA 5CLGA 3GC6A 3VDXA 1Y6JA 4O2AF 3R75A 3S99A 1KVRA 5JAZA 5D84A 2ZP1A 1HGXA 1RPNA 3TRHA 2AGVA 1PWXA 2BLNA 3JQGB 2WIBA 2WB2A 1DIAA 4Z53A 3P2JA 4PZLA 5EXTA 1T2AA 2XADA 5AK0A 2RKBA 3CA8A 3F5DA 1C9KA 4ZRNA 4TQAA 1GPMA 2HSWA 4Y2UA 1TADA 4GXTA 5J2UB 3DULA 4F72A 2BGJA 1XT6A 4N7JA 4G09A 2FPGB 2CFRA 1ZVQA 5BSGA 4YJ2A 1U9IC 2Q5QA 3WGNA 3IFSA 5K0EA 4L15A 4GNRA 2O8BA 3NOXA 3HXPA 4FI3C 3DKRA 4ALLA 1KC1A 2WHXA 2HSJA 2O8EA 2Q1XA 1GITA 2OLEA 2GHIA 1HSZA 2PQ2A 5PGMA 2Z0MA 2BM9A 2QIPA 1OIWA 1F20A 4YFVA 1YULA 2GJSA 1II0A 2LKDA 3T9EA 1Y8AA 5IW8A 3L01A 2VDNB 3VPGA 3ADPA 3SD7A 3GJ6A 2BVNA 4J90A 1OBCA 3AVOA 3Q8XB 3GD5A 2P27A 4KH1A 5FPSA 3FUCA 2WMOB 5F5LA 3RC1A 5JH7F 2ZRHA 4L8YA 4MR9B 2QLMA 2BGLA 1MPTA 2C99A 2J6BA 5H83A 1DXOA 2QRLA 2PYDA 1JHPA 3H19A 4OU5A 3E18A 1AUVA 1UMDA 1RIIA 2EIXA 1H0RA