4Z0NA

Crystal structure of a periplasmic solute binding protein (ipr025997) from streptobacillus moniliformis dsm-12112 (smon_0317, target efi-511281) with bound d-galactose
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
KITLGVTYYKFDDNFLAGMRNDMIQIAKEKYPNIELLNNDSQNSQSILNDQIEVLINKGVNVLVINLVDPTAGQSVIDKAKAANIPIILFNKDPGVDALNSYDKAWYVGTTPKDSGILQGQVIEKAWLANPAYDLNGDGVIQYVMLFGEPGQPDAEARTKYSIEYLNEKGIKTEELHKDIANWDAAQAKDKMDAWLSGPNANKIEVVIANNDGMALGAVESIKAVKKELPVFGVDAIQEALTLIEKGEMVGTVLQDATGQARAILELANNIANGKEPTEGTEWKLIDKAVRVPYVGVDKDNYKEFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title Crystal Structure of a Periplasmic Solute binding protein (IPR025997) from Streptobacillus moniliformis DSM-12112 (Smon_0317, TARGET EFI-511281) with bound D-Galactose
rcsb
source organism Streptobacillus moniliformis
molecule tags Transcription
total genus 116
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z0nA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z0nA02
3Q15C 3O1IC 2NZUG 5B3JA 2A9QA 4N0QA 2FKAA 2PUGA 3NBMA 3LTEA 5DCLA 3C97A 4MQEA 4Z0NA 2P9HA 4N76A 1U0SY 4DQDA 1C4WA 5CNJA 4RU1A 2WB4A 1P6UA 3MF4A 4MPTA 1ABFA 1VKRA 5DKFA 1BDHA 2H0AA 3URMA 4EYKA 3FDFA 1UDRA 1P2FA 3DZDA 4RK7A 3RVLA 4DADA 3EULA 2QU7A 1Z12A 1ZVVA 4NCBA 4RKQA 4YGXB 2CD7A 2FVYA 1TM2A 3HO1A 4G0MA 2IPLA 1U8TA 1Z15A 1LBHA 1YTUA 4Y9TA 1F4VA 1FFSA 2MYNA 3OLZA 4WXEA 4EVQA 3TX6A 1RXIA 1ZAYA 4YV7A 2GWRA 4WWHA 4IRXA 3HVRA 3Q41A 1QPZA 5FWXB 4YP9A 4W5OA 4G97A 1JLKA 1DG9A 2FMHA 3IDOA 4CBVA 3L6UA 2BGGA 3H1EA 2O20A 3MQ4A 2FEWB 4EY3A 1C0EA 1NXVA 1E6KA 4KVFA 1MIHA 1D2AA 3OQOA 1GLGA 2R25B 2FXIA 3CU5A 3MA0A 1DC7A 1XHFA 5T3YA 3VNAA 1K68A 5C5CA 4ETIA 1P6QA 4MS4B 4F8JA 1RPJA 3EDCA 5HKOA 3N6VA 6CHYA 4KK4A 1VRVA 4P98A 1YVUA 3I45A 1IIBA 1YK1A 3GWGA 3LUAA 3QEMA 5E3JA 2ZAYA 4LE2A 2KYRA 4G0QA 4MYRA 3HV2A 3B2NA 4RWEA 1TLFA 3JVIA 3OO0A 1GUDA 3CG0A 5JNUA 5TPWA 1KRWA 3FFTA 1L5YA 1JWLA 4W5NA 4WT7A 4XASA 2HJ9A 4KREA 2YHAA 2TMYA 4JAVC 3A0UA 2R4QA 2FN9A 3CG4A 1DBQA 3HDGA 3O75A 2PAFA 2CWDA 3SG0A 1NXOA 2ID7A 5FWYA 2L19A 4TN5A 3QELB 4NICA 1A0OA 4L4UA 4MR9B 1W25A 2E4XA 2R47A 3EQZA 5KWSA 4Z4IA 3F73A 3LUGA 1ZITA 1DZ3A 1ZGZA 4F12A 3OLVA 3HM9A 5TQJA 4KRFA 2PUBA 2OENG 3O2QB 3F6PA 3OQNA 2FN8A 1JH9A 1JX6A 4W5QA 1Z26A 3K4HA 2FQWA 5FWYB 1EWVA 3H5LA 3ROFA 4G86A 4MRMA 3SY8A 2HSGA 2OQRA 1Z16A 3Q9SA 5JS2A 3H6GA 5FBHA 5JNVA 4EVRA 3H1FA 3TB6A 3UK0A 2ZWMA 4JP1A 4F3TA 4NV3A 2M98A 3KYJB 4DN6A 4JASB 4JB0A 3JY6A 5DGCA 1ZGGA 3CRNA 4G0PA 1TJYA 1JFVA 1XHEA 1LJUA 1K66A 4WXMA 3N75A 2JB9A 2FLKA 4RY0A 5TQ2A 4YRZA 4MQFA 1NXSA 4G0OA 3A3KA 1ZH4A 3KG2A 4RK1A 4MS3A 1L5ZA 2PUFA 3FFWA 2PL1A 1NATA 2FTKE 5BRJA 2JVIA 3C3WA 1AB6A 4N47A 1SD5A 1YMVA 2DRIA 1KGSA 4GPAA 4RDCA 4XXHA 2AYXA 4MS1B 1ISSA 1CHNA 5TQ2B 4L85A 3N0RA 4JOQA 2JVKA 3IPCA 4O1IA 2JCGA 1JL3A 3QLVA 5ED4A 3LUJA 3NHMA 4PICA 3JPYA 4KQCA 3LOPA 3M9WA 3ROTA 4Z4HA 2HQOA 3A0RB 2PUDA 4S05A 2QR3A 3QLVC 1URPA 3OMWA 3DGEC 4KQ9A 4ETMA 2FSPA 2VUHB 3DLHA 4MR7A 4ZYLA 4KMRA 5TQ0A 1M2EA 1PEYA 1M5UA 4D6YA 3O1JC 3CHYA 2V0NA 2QXYA 2JRLA 1OXBB 3BRQA 1Z13A 3KLOA 4RKRA 3LUCA 4LE0A 4Z99A 3HXMA 4E7OA 4M88A 2LUOA 4G0XA 4O5AA 5BR1A 2PUEA 4H3KB 3GV0A 1D4ZA 1JDPA 3OQMA 1GCGA 1MB0A 4MQEB 5TQ0B 3RVKA 3HEBA 1QP7A 6ABPA 3FMVA 5KQLA 2IPMA 3GBPA 5IUJC 1A2OA 1EWKA 3C3MA 2RGYA 1ZH2A 4PZ0A 4HNQA 4KNYA 4TMYA 3LUDA 1JHZA 3OLWA 4IMJB 3T38A 1JDNA 4WUTA 3MYYA 3H1GA 4LZLA 4QYWA 4ML3A 2MYTA 2JK1A 2E4WA 3M9XA 2QVCA 3G85A 2MSLA 4KPYA 3DLBA 3O1HB 3ILHA 5TPZA 5JNSA 2GI4A 4H3HB 3TO5A 1QP0A 2HQRA 4YLEA 5IUKC 1FFGA 1JYFA 2QV0A 1T34A 5D2CA 5EWMA 3UUGA 3H6HA 2NT4A 3QLTA 1DRKA 2VK2A 3H5IA 3OO1A 3I5AA 4Z4FA 4E7PA 5GOTA 4HNSA 2E4YA 1JFSA 1ZN2A 1MVOA 1BAPA 1NXXA 4Z9BA 1QMPA 3BILA 1LK0A 3OLXA 2QVGA 3HCWA 4RK0A 4UHKA 4QICA 1B00A 3NNNA 2P4UA 1NTRA 3GYBA 2X7XA 2XDYA 3QEMB 4Z4CA 2A9OA 1QQAA 4S04A 2IPNA 5KQMA 3QLUA 4MGEA 2WWVD 4XFKA 5TPWB 2VYCA 3F6CA 4Z4EA 4ZMSA 3LUKA 1NXTA 3OM1A 3TMYA 3HZHA 4PE5B 3O2JA 1DCMA 3QLUC 4EUKA 2MSWA 2MSKA 2IDMA 7ABPA 3QK7A 2JBAA 1Z18A 2IPAB 3VNBA 1USGA 3EJWA 1DBPA 4EYQA 2WY2D 4QPJC 2NUBA 5EWJA 4OATA 4YWHA 1DRJA 1JF8A 5DLEA 4QYMA 5CHYA 1Y1LA 4FE4A 4G0ZA 2B4AA 2FMKA 3N8IA 2FQXA 5EWLA 3M6MD 2Q5CA 3UKJA 3SNKA 2B1JA 5IEBA 1USIA 2QSJA 3C3KA 4MR8A 5HQJA 3IPAA 3HS3A 1JFTA 1JBEA 5IULC 3DGFC 5EWJB 3HJFA 3MM4A 3BBLA 3HK2A 3D02A 5GQSA 3GT7A 4P1ZA 3RVRA 4MRMB 1YS7A 4UHJA 2FEKA 5TPZD 4YS6A 4RK5A 1SXGA 2QW1A 2RDMA 3A10A 3FGZA 2FMIA 3F7NA 5IC5A 5HM6A 2I6FA 1KRXA 4RK6A 2LIVA 4LE1A 1QO0A 3CKMA 2HQBA 5DTEA 4D74A 1USKA 1Z2EA 4RK4A 2GX6A 4XLTA 1TMYA 2IOYA 1ZY2A 4MQFB 4F06A 4KZKA 2GKGA 3K9CA 4MS3B 3JPWA 1QNLA 3KS9A 2FW0A 4RXUA 4TLLB 1MAVA 1DJMA 3ILYA 2L17A 3H75A 1WETA 1ABEA 2FMFA 2PL9A 2PMCA 1PEAA 4OBBA 1Z17A 1RXEA 1TVMA 2N9UA 2A9RA 2YHBA 2E4ZA 3IP5A 1ISRA 4EYOA 3CLKA 2RJOA 3RVPA 3N0WA 1SXHA 4O1HA 1GCAA 2FLWA 2NT3A 1E2BA 2CHEA 2RJNA 4MR7B 1NXPA 3I42A 1PNRA 4LDZA 3RQIA 1VLZA 2A9PA 2WRZA 3IP6A 8ABPA 2PUAA 4RY8A 3HUTA 3T8YA 1APBA 1FSPA 1A04A 1LJLA 3KHTA 3HDVA 2L2QA 3LUHA 5CNMA 3D8UA 2E4VA 3LKBA 4Q6BA 5B3JC 4W5RA 3O21A 2WJWA 4GNRA 3T6KA 4MLDA 3S99A 4FE7A 5KQPA 1DC8A 3RH0A 3CFYA 1BDJA 4XAQA 4W5TA 3SQNA 4IF4A 4YO7A 4Z9AA 1EHCA 1S8NA 1XWWA 3CTPA 2PLNA 2L18A 2LBPA 3GA5A 2NZVG 3NHZA 3OMXA 1YS6A 4IILA 4RZSA 2F8TA 2J48A 1NY5A 3O74A 4JB2A 5FWXA 1CYEA 4OG2A 1QO0D 5KC9A 3GL9A 3EODA 1DCFA 4EVSA 1BDIA 1QKKA 1P8AA 3C6QA 1YIOA 5BRAA 5JNRA 4MS4A 5IEJA 4RS3A 5F64A 3CNBA 3CZCA 3H5WA 1OXKB 4Q6WA 1LBIA 1RZRA 2VUIB 9ABPA 5JS1A 1EWTA 5IX8A 3BRSA 4LRQA 5CNKA 4YR7A 3EQ2A 2MYPA 4G0YA 4RSMA 3H5TA 3E3MA 5EWMB 1FQWA 4JA2A 1SXIA 5KC8A 3R0JA 2FEPA 3DBIA 2PUCA 2JVJA 2IYNA 2PKXA 4RV5A 3H5OA 4ZJPA 2PJUA 4F11A 1F51E 3SAJA 3E61A 1ZHHA 4OLBA 1DCKA 4WZZA 5TE9A 3RVNA 5IUNC 4Q7EA 3IP7A 3O2SB 1Z2DA 4Z4GA 1BVHA 3EAFA 5FBKA 3W9SA 3GBVA 1M5TA 4LDAA 4N03A 1E6LA 1FFWA 3I09A 3JTEA 3LFTA 1PNTA 1U2PA 1U2QA 2H3HA 5ABPA 3OM0A 3SM9A 3KTOA 1VPWA 1PUXA 2IKSA 2MYUA 1NXWA 3QELA 5CNIA 3G1WA 2W42A 3MMNA 3IP9A 2LPMA 2QZJA 1R8JA 4MR9A 3NNDA 4XARA 4KK3A 3N53A 3LMKA 1E6MA 1J56A 3JVDA 3RVSA 3KYIB 4HNRA 2ID9A 3KJXA 1SRRA 1Z25A 1U04A 3QX8A 1D1PA 1DBWA 2JBAB 4PEVA 5JNWA 4NCAA 2M1ZA 1RNLA 3L49A 1EFAA 2FQYA 4IGAA 3Q7TA 5PNTA 3RVMA 1ZESA 2GBPA 4TLMB 1I3CA 2AYZA 1GUBA 3FFXA 3CZ5A 5EWLB 1D5WA 3Q7RA 4YCSA 4FB4A 3MIZA 4MAAA 4MLCA 5C5EA 5JNTA 4MR8B 4OTZA 3RVQA 1JYEA 3HSYA 3BREA 3QEKA 4KV7A 4B09A 3LKVA 3T95A 5IBQA 4RXMA 1KMIY 5KI6A 3TD9A 3JS5A 1EAYA 4ZMRA 2LP4Y 2R48A 1RZRD 5BQ3A 4LX8A 5T7BA 4N0PA 1QP4A 3QX9A 3LUFA 4EYGA 4HYEA 2PE5A 1BA2A 1W9HA 4N41A 3GRCA 3KKEA 4KFCA 4MS1A 4NQRA 1YK0A 2WJAA 1D1QA 2HPHA 3NNSA 3RVJA 2WMYA 3H5VA 3Q7SA 4RY9A 1AB5A 5KQGA 1DP4A 3KLNA 3EGCA 1ZDMA 1CEYA 1QQBA 3N0XA 5I4CA 3KSMA 1HEYA 2CHFA 3HUUA 1MB3A 5HSGA 4D6XA 4ZPJA 1PHRA 2F8SA 4ETNA 1YMUA 4H60A 4RXTA 2E4UA 1H9CA 3KCNA 4EGSA 3OLYA 1M2FA 3RVOA 3CS3A 3P9YA 4OLAA 4PYRA 4IMIB
chains in the Genus database with same CATH superfamily
1RQ2A 3A3OA 4PQEA 1K6IA 1Y3IA 3HA3A 1QO9A 3H84A 4QT0A 3EPJA 2QRGA 1Z83A 4U6SA 5HJ7A 2ZS9A 3SJZA 5CXXA 2HB6A 4JEHA 3RPEA 4C2BA 1FW6A 4XVQA 4YR9A 1RVDA 1VGVA 3SX2A 1GPKA 2B4KA 1KE2A 4DYHA 5IKMA 2XTNA 3UT0A 2QZ4A 5JR3A 2QPAA 2WUDA 5H8WA 2VTKA 1N0IA 1ZLXA 5B1SA 1BDHA 1BH6A 1Z0FA 3K8ZA 1CRQA 5IC6A 4JB8A 2FPGA 2WPNA 3TW8B 2O3UA 2ZRLA 3F47A 5DTQA 4FFLA 5FOQA 1WP4A 2GEBA 2VL7A 3HBJA 3L07A 4C7MA 4DDKA 2R5NA 2OO7A 2GZMA 1OHHD 1QGUB 1ICIA 1KI7A 2KM1A 2VP5A 2WLTA 4ENQA 2EDCA 1MA3A 3NHPA 2D1SA 2FW1A 3LT1A 2NZ8A 5AXDA 4NE2A 2CNNA 3TVTA 2HEIA 2MYNA 2FPGB 4WXEA 4EVQA 2OFOA 4MDYA 4CKEB 2G1PA 2NX2A 3G9ZA 1S96A 1NJ6A 2Y0PA 2H63A 2FK7A 1I4TD 1IBRA 4BV2A 4MMXB 1Z68A 3PC2A 1XC7A 3PGVA 4OY3A 1VYVA 1PWHA 1QIGA 4F92B 1M2VA 2JPDA 4RMIA 1EXMA 3K9BA 2R25B 4BQRA 4FD2A 2CCJA 3H1TA 2DQYA 2JLSA 1QTRA 1JKMA 1XEFA 4X24A 1E1NA 2B99A 3EY9A 2BT4A 4NONA 4BMVA 1WCIA 4B1FA 4BN5A 5ISMA 1BHSA 2JLCA 5DV9A 5H70A 1AC5A 1M66A 1DKNA 4DA6A 1XROA 3H18A 4UHCA 2DWUA 4G09A 1S7CA 2QMHA 1CZLA 5FI5A 3ZVMA 2BSXA 2FUCA 1G66A 1FNBA 1HSOA 1OKKD 2YOGA 1EGMB 3VPCA 5JU6A 3MT0A 4UEOA 2PEZA 4HSGA 4OSPA 4KHPB 2DHRA 3QFCA 1IBCA 5DYNA 3LC7O 3NHUA 1IULA 4FI3F 3MVEA 2EKPA 3RT1A 4GPD1 2O2DA 4GXNA 3KVVA 4QTXA 3UWPA 4JB3A 3IUEA 3QYPA 2MR5A 2Z5LA 2OVFA 1U1CA 2O3TA 4ZOAA 4R3UC 3B53X 5AOAA 1JQKA 4KDCA 4DIUA 4E15A 3PQ7A 1P3DA 3G2MA 2I66A 4ILKA 4D57A 1ZBDA 3F4LA 4AKHA 2D74A 3IESA 1D7AA 3NBYC 2FWRA 4PNZA 4HMQA 3OFSA 1DKQA 5CTJA 2NMVA 3OLVA 2XVMA 4P7JA 4I4TA 4TRRA 5T8KA 3X43A 2XWPA 4EPVA 1G1MA 1TIPA 2F67A 4WPGA 3AFNA 3F6PA 1CS4C 3BD8A 1YI8A 1IWOA 3QJ5A 4W5QA 2MMGA 1OAKA 1XTUA 4N3BA 2DUMA 4X60A 1E6UA 1EP9A 1WCXA 3GRYA 3SY8A 1UKAA 1TA4A 2Q9CA 4OB7A 4D0GA 1Z0KA 3GPDG 3IVCA 3ONEA 1QVZA 4G4GA 2BMAA 4I50F 1GAEO 3BB4A 1F38A 1NW5A 3H1FA 2BKVA 3KQWA 5DYTA 3T94A 4Q3LA 1V47A 4IDQA 3SJCA 2HL6A 1Z33A 2XE4A 1Y5LA 4UBNA 4G0PA 1TD1A 3K1YA 2WWHA 5E6RA 5C53B 2IXBA 4GSLA 5DISB 4YRJA 3LP5A 2OILA 4HXEB 1KSFX 5CD9A 2P3LA 3L93A 4I1PA 3RAFC 2WTMA 1XMIA 4HAXA 1ZMTA 3MZ0A 1U9CA 2D5AA 3HP4A 4IHQA 2I91A 1QPBA 3E4DA 4N47A 1AB6A 1MHPA 4JEUA 4B6OA 2APJA 3QXHA 4Q34A 4AO6A 3HKCA 1X1CA 1NBHA 2QL6A 2AZMA 3DKIA 1J0DA 4IEEA 3D3EA 4ZCSA 1WP9A 4JODA 3JQPA 3AUSA 3DBRA 3ULKA 2PANA 2VO1A 2JCGA 7REQA 5L95A 5ED4A 1P91A 2UAGA 3VR4H 3WLRA 8OHMA 4FN4A 3VYWA 5D6NA 5IAKA 3TIGA 1XDGA 4K8OA 4DJTA 3HKCB 1TQ6A 2HQOA 2X8LA 4H6PA 4J4HA 4Q4CA 5K51A 1QHGA 1UC9A 2FJ0A 3DGEC 3BKXA 1YZVA 4CZ2A 1HQYE 4O4LB 1BHO1 3OX3A 7GPBA 1T3ZA 1SUFA 1TA9A 4OK6A 2MJLA 3O5AA 1DWPA 1L4EA 3BRQA 4X1KB 3ZJUA 1O0SA 2OXFA 4X84A 3LAWA 1ORRA 3FMPB 5L51A 3VZBA 3ZHYA 4HAYA 3IQDB 1D4ZA 3PFBA 4RENA 4WKNA 3OQMA 3LXXA 4MV9A 4OHVA 4HFNA 5GM1A 1YB7A 3QW4B 3WDLA 3O92A 1WNTA 1S1MA 5DE3A 1GTJ1 1O94A 1GGJA 1GTMA 3ZE6A 5HKKD 4Q3AA 5JWHA 1X80A 4PG8A 3FFBA 3RFTA 1JAHA 3X1YA 1N7IA 5DEIA 1V7PC 3PXDA 3SIXA 4AIRA 2Q50A 1MAWA 3LUDA 3OKPA 4WESB 4MIKA 2DBRA 1PZEA 4WUTA 1GN8A 2WM9B 3H2GA 5ALVA 4QYWA 1GPLA 2JK1A 4RKEA 1X80B 3OUUA 4P34A 3RHFA 3BE5A 4AO8A 3L05A 3ETJA 2PWYA 1P2SA 2EKDA 4ACAA 2Z9CA 3PG5A 2GT1A 3CF4G 3V8EA 2JFFA 4DR2B 4IX9A 3NVDA 4C05A 4YX9A 1NIJA 4ZJYA 1G7TA 4WCFA 3RJ9A 2JASA 1JR3E 3VJRA 3H6HA 4KN6A 3O82A 3ZOKA 3H5IA 5BW6B 3EMDA 4Z4FA 1XCJA 4MB2A 2EFEB 3DWFA 2NUAB 4WCFC 4AU1A 1NBOA 4WEOA 4YN3A 4AW9A 1OX4A 1PR6A 2ZR0A 1L8XA 1WW8A 3Q3IA 4W8GA 4R8SA 4YRPA 4P4UA 3S1LA 4C0LA 5C8ZA 2BFDA 1UL1X 2WSSA 4PRKA 5AQEA 3T15A 5DN9A 2IHNA 1ZLYA 1A8UA 3DTVB 4V39A 1ID8A 5JH7B 4YJ2B 4IFEA 2H92A 1EWYA 3L0PA 5EESA 4EGFA 2QGNA 1EKXA 4IH1A 4XLZA 5BNIA 3C3YA 2JZOA 2P0AA 1OX4B 1YDHA 3CF2A 1RAIA 3FPSA 4D4LA 2XCTB 1M10A 1ZONA 2LDXA 2JLYA 4EBFA 4ZOLF 5KVAA 3G2IA 4H7FA 1DGQA 4IJKA 1Z2AA 4BEVA 1DARA 3BGIA 1OPRA 3L7LA 3KOZA 1ZJWA 2JHCA 3ZBTA 3SYLA 3N58A 2I4OA 3QKIA 3RYIB 2Q07A 4HLCA 2X8JA 4UM5A 1QFSA 1SU7A 1O4WA 4QTZA 5E1MA 1QTIA 3L7MA 3HGTA 1I4WA 4HDOB 2A5FA 2ZKIA 1Z4MA 1FNSA 2WLSA 2ZYIA 4QXAA 4UJ3A 3ZW9A 4YHHB 2R7AA 4JGBA 5EYPA 2XUQA 4FE4A 2FMKA 1CR4A 1Z0JA 4I5EA 4BCCA 2GLXA 3HLKA 4G4SO 1G64A 2O2GA 1U0RA 2X8JB 2HCRA 3NYRA 1HG0A 3TWOA 5JI3E 1T6NA 3HJFA 5E0OA 3E9QA 3PPWA 2F1HA 2Q2WA 3DD5A 5LPNA 1W4LA 4BFWA 2BR5A 4GOOD 2J33A 2YR0A 5EYPB 5HTOA 5F5XA 1JMYA 5KDDA 4RK5A 2H1IA 1UMCA 3AONB 3R2JA 5KTPA 2FMIA 2MCFA 5C9ZA 3SHWA 3F9IA 4RK6A 1QO0A 3B52X 3Q7EA 1P5RA 2UZIR 3BD6A 3GUVA 3MD0A 4LC1A 1K8XB 4YCDA 4E11A 4JQZA 1USKA 1G21E 3EGWA 1D9XA 2Q3EA 1VMKA 4RK4A 3AJ8A 1T36A 4TS3A 1LSSA 1Y89A 5DWVA 5EUCA 4BLPA 1ZY2A 1T1SA 3LDUA 2FZKA 2UVPA 1HYEA 1NQAO 1B0PA 4M7RA 3OPYA 3KZMA 4DM7A 4NXMB 3PHBE 3AGPA 3WXBA 4JT8A 4OQFA 4RXUA 1Q1AA 4JQOA 5DT2A 3OE4A 2QMZA 5AIAA 3LLVA 2HPVA 3KJGA 4MYTA 4OFBA 3G82C 5ESXA 4I66A 5A71A 4AFNA 4CQLB 2C83A 4PO9A 4RPJA 5A1TA 4DV7B 5TQVA 2XNKA 5BXYA 4CKWA 2UVPB 1JFFB 4AI6A 2P91A 4H3SA 3OPYB 3FLAA 3GUUA 4HNVA 4OHKA 1F1BA 3V7UA 4J7UA 2GZHA 2O2CA 2OD2A 3NWOA 3KOOA 1E7RA 4JY7A 3TVYA 1E1RA 1IVNA 1FA9A 1ZHFA 3R0QA 4G5XA 1D6NA 1VB3A 3UK2A 4JP2A 4Z9YA 5AVXA 3PLAE 1V0JA 1E3EA 1Z29A 3IMKA 3UGQA 2Q3CA 5IMBA 3OIDA 3X0DA 1Z7EA 1ZD8A 2WRZA 4REQB 4S24A 2NU8A 3N05A 3OWHA 1MO5A 1XMPA 4CF3A 1SVNA 3EUAA 3MS4A 4HD8A 1GNSA 1LJLA 1XNHA 1WQ4A 1Y1PA 1Y81A 2F9FA 3KHTA 1I7SB 2G7ZA 4HNGA 2PTGA 1OSNA 1ZW6A 1FLVA 2DBYA 5BSWA 5ITSA 4JXXA 2IZ5A 3KPWA 3EA0A 3SKXA 3S99A 5E7IA 4Q9LA 3PNMA 3TOXA 2GPWA 1H9AA 3ZU3A 4COKA 2WWIA 3CYFA 1JIQA 1TE2A 4XAQA 3N86A 2CLFB 4MJ7A 4U3JA 4W5TA 4R9RA 4AG3A 2WKPA 2C5FA 2I3AA 1PI3A 5HCUA 3UMRA 1XVVA 4U1RA 3DKKA 4AIIA 2HN9A 5LYJF 3INTA 1C5KA 3O74A 1CYEA 5CA0A 4CKCA 4D9MA 3W2FA 1DPFA 1CUGA 1RWWA 3D7KA 3HDTA 3KPVA 4DC1A 1JV2B 1H22A 1I0LA 1H1LA 4DIMA 2V6BA 4LZJA 4NDZA 3KLBA 1S3SA 3REGA 2R8OA 1ZIPA 3K5PA 4DKJA 1D0IA 2HRCA 1ADYA 1UWVA 2M2IA 2P4HX 3DEKA 1VG9B 3C7KA 4XUGB 1G7CA 5F64A 3FBGA 4E30A 1Q0RA 1V5FA 4KTTE 3GVIA 4KQEA 3HNOA 3VR5H 2WF9A 1N1DA 1SB8A 3CV3A 4FW8A 4R1MA 4M0MA 2YZMA 3SJBA 1ZCJA 4EW2A 4LCEA 5LM3A 4PZLA 3EXHA 1TK3A 2EQAA 3NRCA 4XGIA 5AJHA 4KIWA 2DTXA 1JMVA 5AM0A 2WU1A 1DKRA 1FDWA 1KRHA 3LZDA 2NZWA 2HH9A 5FTNA 1DCKA 1P1IA 3EXHC 4QOJA 3AERB 3T52A 5CB4A 3OOEA 1GZDA 1SQFA 4HQNA 3OEWA 4B40A 4E33A 4Y2HA 1QX3A 3VX4A 3W9SA 1IK6A 4AJHA 2OORC 2WYOA 2XRMA 2ZUCA 3TGLA 4OJMX 2HK8A 4UVHA 5D5HA 2FW7A 2EFJA 3NANA 4H7DA 2GBLC 3ZJYA 1U2QA 4X90A 3OM0A 3KTOA 1R8SA 1PUXA 3K5IA 3JW8A 4LHSA 5EVCA 4ARZB 2O0KA 1E61A 3OD1A 5IFLA 4CVNA 3BHNA 2JA1A 4WV3A 3A7EA 4EP1A 3CR8A 3K53A 4X20A 1XD2A 1EXDA 3VYRB 4FZVA 1T5TA 3AR5A 3OZAA 3FKJA 5CFOA 3LX6A 3OIYA 1DCTA 3K5WA 4BQIA 4PWYA 5B3LA 1BWRA 1ENYA 4FCVA 3RS5A 5C1BA 2H06A 2ZSDA 4PEVA 3E9ZA 5B4UA 1L5RA 5SZIA 1LPAB 3OZBA 4L16A 5FHQA 4BFTA 3PYLA 4DOMA 1ODCA 2GEJA 2OBNA 2GF9A 2R85A 4ANFA 2QMYA 4EK9A 4XWWA 4CUJA 1H9BA 5TX7A 5KNDH 4QEKA 1JZQA 1XD2B 1RJEA 2F3UA 4W63A 4M60A 3UPDA 4EB6A 2A30A 2J9XB 4PAQA 5H5JA 5JISA 2C8KA 1CRLA 1HYBA 5GM2A 4IJWA 4KO2S 1UOEA 5C5EA 1J0AA 2E82A 2I2DA 1GZ5A 4C6HA 1D4OA 4G1BA 3JQCA 2YYSA 3UA3A 3UTDA 1RFLA 5CDSA 1TZCA 1MRZA 3VPDA 2RK6A 3KTDA 4OOEA 4BNGA 2GF0A 4LW8A 4GI3A 821PA 2RGRA 2YVQA 4QM7A 1E2EA 2XUGA 3QMPA 3W9YA 3NHLA 4F93B 4JI4B 3H3JA 1Z28A 1C29B 2RKWA 3AY6A 4X1OA 4OQ4A 2XNCA 3H16A 1YRQA 2WPDD 2D7CA 4EOGA 5HUQA 1OROA 2BZ0A 1GRVA 1QLHA 1V11A 2QTWB 4MUXA 3GGCA 2PSHA 1XN1A 5FQNA 3UCEA 3HB9A 4U00A 4IQ0A 1RFGE 2G1AA 3MCVA 2A0WA 2W2TA 3LOUA 3CZQA 5CA1B 2NO9A 1MQSA 3QXSA 4KSCA 5JT1A 1TKRA 2B61A 3DO5A 4WCVA 3OMLA 4RTLA 1OI3A 1UFOA 2PXCA 4ZPJA 3VR0A 4D6XA 2GBIA 1HZZA 3EGDB 5IXYA 4HB2A 1E1QA 2C96A 1N1EA 2HNAA 5AM5A 4EY7A 3KPJA 1NE2A 2BFOA 3E0XA 2D1FA 4K9QA 4RESA 4WLNA 2M6RA 4K6GA 2OCDA 4W1PA 1BE6A 2WD7A 1RYFA 4RIHA 4KH0A 4F72A 4DDTA 3G1UA 2JK0A 1EDOA 1A5BB 3IIEA 2ORIA 3R5KA 5A0FA 3WSWA 4KOAA 1P74A 3G59A 1KI2A 3NM6B 5GINE 2J31A 1CDOA 4UXJA 1IAQA 2JKYA 3U1BA 3R0IA 1PW5A 2YYAA 3TTYA 5JZOA 2I6XA 5K9ZA 5A0TA 3NKFA 1FFCA 3OQPA 1Z4IA 3D4IA 2QX6A 3H5NA 4CGYA 1UFKA 4K8RB 4ZVNA 3W5HA 1CUJA 2XMSA 5I7OA 2IOQA 2YWHA 3SC6A 1EXVA 1JEDA 1GSAA 3K71B 3VV2A 1QUFA 1Q0HA 2EWVA 1U9IC 2P6PA 1R0ZA 3FRIA 5E6UB 3U4MA 1IY0A 2OC9A 3K0AA 3WYEA 4DMMA 4C4OA 2CJWB 2H9AA 3HWX1 2YWBA 2IPLA 4Y0VA 4DV4B 1UEIA 1H1DA 1RYBA 1LU9A 2PQ0A 2HO4A 4LVNA 4XIYA 1SKMA 4CYMA 1Q1GA 1I5OA 4K40A 1E59A 5DHTA 2I4MA 5TDHA 1TO6A 4ZI7F 5KWJA 1JU3A 3LQYA 1SUAA 3S0JA 4EEKA 1KDOA 2W6NA 1ZXLA 4IRXA 2GJAA 4CMJA 5ICEA 3IT2A 4UMEA 4A92A 3W5BA 3WA7A 1A9RA 3QE3A 3KHKA 3L6UA 4Q1AA 1QQ6A 3RSGA 4C7BA 2O20A 3AVVA 1PG0A 4QC2A 2D8AA 3H8VA 3JAKA 4G8BA 4YJGA 4ETIA 4ASUA 1GZHB 2EZ9A 1X2EA 2ZYTX 2RE8A 5AHRA 1L7QA 1XQ6A 1YL7A 1XNRB 3IFSA 3IS3A 3L8GA 4C22A 1ECFA 1TW2A 1A3CA 1P45A 1RDFA 1WEKA 1Y5IA 3C43A 2PT6A 1NZDA 2VYVA 1MJHA 1RT9A 2KYRA 5AKZA 1YRBA 4HB4A 3OO0A 1WCWA 3CG0A 4H7JA 1BW9B 3ELBA 2HA7A 3UMVA 2G1UA 1E79D 4DA8A 4UFPA 3I0ZA 1F5SA 3TJRA 3TZKA 4F1JA 1DAHA 4JBYA 3UPUA 3OZVA 1ZEMA 4WE3A 3P7MA 4KREA 2Y0CA 2DKOA 3CMMA 5BSRA 1I1NA 4YRQA 1VJ0A 2ZT7A 1ZD2P 3EF3A 1N6KA 1KVTA 4Q3OA 4CL8A 2MINA 3KHSA 2PAFA 2CWDA 4UVIA 2HYDA 5H16A 5C7IO 4WOKA 2UXBB 4F2HA 2Q6LA 1G4AE 2HIAA 2HUNA 3GLVA 4LZZA 1NNSA 3EZFA 3A1EA 3IEIA 1YL5A 3F0TA 3KKNA 3A6ZA 3LLCA 1KWGA 5H83A 1XG5A 2NYVA 1BVRA 1OTYA 4DZZA 3A1DA 3TOCA 1W85B 4JJEA 5TRTA 3F1KA 3DW3X 4QOEA 2YCBA 3OX1A 1R66A 4HUJA 4IWXA 3QU4A 2IPOA 3ZY4A 4DQUA 1ZD4A 3OIWA 4HQLA 1HTTA 1E2NA 2OCXA 2R62A 5IARA 1NULA 3I2HA 1T9CA 5FBHA 5GAJA 1YQWA 1NKTA 4I08A 4JYPA 2YFQA 2OYCA 3DV0B 5SYMA 5ER6A 5BNZA 4EJFA 1GLVA 4JASB 4NG5A 1VL6A 2X9VA 3B1ZA 3GJSA 5TJ9A 3RAEC 5M3BA 2UYGA 2ZU0C 4IIFA 1WMBA 2W11A 4XUEA 3N75A 2NO6A 1KY5A 3R1IA 4DUYB 1ZW1A 2BSQA 1LRKA 2J0SA 2EFHB 1PL0A 1DJPA 4W9NA 5HGXA 4KRGA 3HRHA 4B3FX 4BNJA 3R20A 3JARA 3FLEA 4LS3A 3UICA 2BH2A 2O3JA 3PHLA 1EDZA 1P5HA 1VLMA 5FPYA 3T4EA 1Q7BA 5ALKA 4DCMA 4FWIB 5K20A 2C4NA 1MJ5A 4RE6A 2L82A 3K31A 4WI1A 4O1IA 4KV9A 2CVHA 1HO3A 1RCFA 1SG0A 2Y6UA 4OYRA 4Q24A 4UM7A 1B6GA 2LWIA 5CYPA 4BLVA 2NN3C 3DTNA 3N2ZB 2C7RA 1FIUA 3IT1A 1RE0A 3TNJA 2E48A 3F5DA 2FFQA 2VTEA 4C29A 4DCCA 2VHQA 1L7XA 1CV2A 1D2EA 5A9TA 4BNIA 2DJ5A 5AQ1A 5GTDA 2FSPA 2VUHB 3QY9A 4FDAA 5JJLA 3CNHA 1RQGA 3JX9A 3LIPA 1ATIA 3R40A 1X2BA 1HDZA 3CHYA 3ZK7A 4H18A 4RV4A 1KHHA 2ZRIA 4CMBA 2YXDA 1L7BA 2F3QA 2Q3MA 4ESEA 3HABA 4EGQA 4GC5A 3LUCA 3L92A 1WUKS 3O0TA 1U0EA 2A94A 3BZUA 3HADA 4P38A 3I6BA 3T7RA 3WGMA 3GV0A 1GZVA 1GCGA 4MWBA 1U3GA 2MWMA 3BDAA 3OHSX 1N8NA 1XTSA 4EBBA 2NZ2A 5FEUA 3KJZA 4C4TA 3D5QA 3NHWA 6ABPA 2X0FA 4C6RA 3NLLA 2GHQA 3NM4A 1UFVA 3BERA 4FHFA 2OSVA 4TN1A 5ER9A 4BJ5A 3D64A 1EU1A 3GLTA 4EG3A 3FWNA 3A9CA 1WZCA 2PSEA 5GP1A 1U7UA 3L7IA 1YZHA 3U4GA 5JROA 2RG7A 3ZWMA 2XQGA 1COZA 1UKEA 2P6OA 1RVV1 4K88A 5E4TA 5LZ5A 1LFDB 4HSEA 5K3AA 1QIEA 1TYZA 1XRQA 2PR2A 4UNNA 4WK4B 3BWDD 3EC1A 1JDNA 1EPUA 3L3BA 3MPOA 3OZUA 4MKZA 3AQ4A 1XZGA 2W4MA 4XIJA 4YMUA 2F9LA 2HF8A 2QVCA 1CUEA 3WLLA 3AX6A 3ONNA 4OL9A 4IIJF 3I72A 3OT4A 4K46A 3ZK8A 9MHTA 1D07A 4FYJA 5L3VA 2B36A 4FEGA 1HMYA 4DB2A 5FPHA 2DWQA 1ZM2A 1XF9A 4V38A 4F04A 2J0VA 5A4JA 1XBTA 1S5PA 3P0IA 1JIXA 3FWPA 4MINA 4WLUA 1TJ5A 5D2CA 5CK4A 4I4LA 4BJHB 5A2GA 3RSFA 1CIVA 1BX1A 4UOQA 3RANA 5H1YA 4FVTA 5IW8A 3CC8A 2P7IA 3Q8MA 1NSFA 2BW0A 2X0JA 1WZUA 4O02B 4DA4A 1LLFA 2J9ZB 1DFHA 1SQ5A 4YDQA 2HK9A 2XWSA 4C20A 1DB3A 4RPCA 3TJZA 2FZGA 1WULS 4FDMA 4CW7A 1NW7A 3CO0S 1X94A 4AZSA 2P4UA 4FOSA 1JDJA 2D2XA 5JCXA 2NSJA 4OP2A 4BVJA 1PO7A 3QEMB 3VOTA 1R7RA 2OXCA 1E1DA 3ZZ0A 3N2IA 4XPIB 5FO0A 3WHKA 5AXCA 3O94A 3ONVA 1X9HA 4FDLA 4HOYA 3HLTA 5DASA 4WW0A 1XAGA 3NCHA 2CLMB 4EA7A 2PZAA 1JHQA 2NUTB 1KIAA 3MNFA 1SOMA 2CVOA 3O2JA 4J9UE 1O96A 2WKRA 2ZJ7A 1WLYA 3PCRB 4Q93A 4TM7A 2VH5R 2YV5A 3NBAA 4GEKA 1KO8A 3ROQA 1FNMA 2FX2A 4CLXA 2JGRA 5AW0A 4IQGA 2J0QA 3RUHA 1CFJA 3QMMA 1XFAA 2I29A 3D8NA 4RSGA 5ADVA 1DC4A 3UMMA 1KI1A 2E5LB 4YWHA 3K09A 1R9GA 3BB3A 3VKUA 2PKCA 2W70A 4TT3D 4XFJA 1QCYA 3PGKA 1B74A 3V1LA 3EPPA 3H1AA 2XGOA 1UZMA 4QGHA 2FEMA 2GVZC 3C39A 3HVKA 2FU5C 1H8ED 1A5ZA 2QUIA 1TYDE 2WUVA 2XXJA 3KKLA 4X1YB 2DKNA 3R44A 4XPZA 5IEBA 2J1LA 4B5LA 4DLRA 3U7HB 1SCKA 2QQEA 4S3MA 4FCWA 2VTBA 3FPGA 3DGFC 3H42B 5DGIA 3I1FA 1A9OA 1NVGA 5KDLA 2VFAA 3S28A 3RHSA 4XQGA 1JECA 3GT7A 1YRAA 3O4FA 2HIGA 1WO8A 1V6CA 4YS6A 2F55A 1OLOA 3ZXXA 2VP4A 5LDDC 3AM1A 4V1CI 5AI4A 4LF8B 2Z83A 3BHMA 3H05A 1KTIA 1LF0A 2H0QA 4HRVA 2C58A 2EFGA 4IIYA 5CG2A 5BN1A 5I7EA 2YV3A 4WACA 1N32B 3ET5A 4D92A 5JQWA 4TKLA 1EUYA 2ZLBA 1YT5A 1D03A 2UVQA 2IYAA 4HWSA 4WVFA 4E6PA 3GGGA 1SY7A 5DCUA 3DPIA 1JPUA 4MX8A 4OGFA 3EQ9A 3IALA 2WB2A 4GGMX 2X4DA 1P62B 1WG8A 4IGEA 4DMHA 2IEGA 5DSZA 2QN8A 4MS3B 1AV6A 5K8IA 2Y05A 2Q6IA 3EZ9A 2IV3A 3TLMA 1THMA 2NOAA 1VGQA 3VR4A 5HZKA 4EMUA 3A9TA 3EE6A 3OQIA 2BMJA 2VZ9A 1X1DA 2GFQA 5LP6B 2WVAA 1XRMA 2ZRJA 3AL3A 3A70A 5IVDA 1U4NA 3WIEA 4XYLA 3LP6A 1TM3E 1VKZA 2I33A 2JGAA 2SICE 3K2EA 4OQQA 2ACWA 1TT5A 2O7QA 1J9ZA 1E2BA 2C5AA 3ORSA 2FPIB 4LOAA 4MVYA 1NVEA 2A7QA 2ZBQA 1YR9A 3OEHA 4N7RA 1F7UA 3FCUB 3KD3A 1PNRA 5B36A 1HPLA 1IH8A 1KOFA 2YWFA 1NJ2A 5C7YA 1BFKA 4RY8A 3NTQA 4MIYA 2P79A 2A92A 1N0UA 3WMWA 3GNLA 2IDJA 5EPUA 3LWZA 1V3QE 1NLMA 1PU2A 1EFRD 1DEAA 2FPWA 4XVRA 4BJ1A 1EX1A 1TM7E 3AK4A 2R8EA 1WBBA 1RR6A 2QAGB 1T8PA 4WTOA 1HL3A 3FPHA 3IUNA 3IAAA 2J9FB 4RO0A 4ZVTA 4X7BA 3C48A 2O4UX 4R5MA 3U56A 1UP4A 2YNMC 4I5IA 4BKOA 5K0TA 2AN3A 3OM8A 4LGCA 1I94B 2OL4A 3WKBA 2L18A 3PI7A 3BRCA 2J48A 1RHUA 3K1ZA 1UT6A 3SXPA 1YQ9A 1J1UA 5EQJB 4OG2A 2O0HA 4LMPA 3GNSA 4KACA 4WZAA 1QVWA 1CUDA 5D3MB 5DYYA 2AG8A 3QKSA 1Z9BA 5ULLA 4FEYA 1H6CA 5FPKA 3FKQA 1XK6A 1T2VA 3DOHA 3IKMB 3MWEB 5CUQA 3K9WA 4NYJR 1U7WA 2HHAA 2R7MA 2XCOA 3ADKA 5FBWB 3TTSA 3M33A 5CDHA 4HC4A 4V2UA 3WL4A 4D0NA 1RQ7A 1V26A 2UYOA 3GY0A 3L7BA 1NT2A 4GYYA 5CNKA 3UHOA 3HY6A 4HWPA 2MYPA 3CE6A 1U0NA 3UJNA 3O8NA 3EIUA 1SXIA 2YCLA 4NJEA 3WGHA 1XJ5A 3P2MA 3IPRA 2W6PA 1XMJA 4UU8A 4AY3A 2QTLA 3AY7A 3ICOA 4FUQA 4L4SA 3BN3A 3QP9A 3PQ2A 3DEAA 3SEQA 1J8QA 3OLQA 1N3YA 1T4BA 2PG3A 1JHMA 5AMXA 4M0CA 5JC8A 1PQPA 2R68A 3H6KA 4EB8A 3P45A 4EMTA 3AF3A 3QVOA 2QYTA 3EAFA 4X66B 3OA2A 1ZEJA 3GK3A 2BCGY 5A03A 3V1YA 4GWLA 3HJTA 5K01A 5I7HA 2H1OA 5GY7A 1EVIA 3ZS8A 4ATNA 4GSYA 3PXCX 3LFTA 3ZHUA 1L7NA 3RHTA 3D6HA 2CB0A 2G9VA 2AOVA 2OUKA 3LY7A 4LHEA 4F0JA 4MVJF 2O2JA 4LC9A 4OJQA 2QZJA 3HB0A 1IQPA 5A9RA 3WRXC 2ZRBA 4NLLA 3TKAA 1UBMS 1G6HA 5KNCD 3BDVA 4EUHA 2V5VA 1U11A 1THZA 3RVSA 1PWZA 1NLUA 3HBFA 3K4PA 4GP7A 1QBKC 3EXFA 1W2HA 5HF5A 3STXA 4F4JA 3QX8A 1L8QA 4UMVA 4GNKA 2FXVA 3W2HA 1D0SA 2XNJA 2C57A 2ZYWX 2JANA 5JMPA 4ZTZB 2WF8A 1O95D 3N6XA 1E9CA 1DAEA 4RV9A 5LUBA 4F2GA 4FE3A 4KFUA 3FVWA 3U3OA 5AI5A 3UWDA 1WUIS 3FFXA 3IE0A 5FOTA 2ZI9A 3ZJ5A 4EHKA 4ADSG 2JCVA 4ZDJA 5DNEA 1CUAA 2PZBA 4BO0A 4RM2A 1K6XA 1QRRA 1YVRA 4NECA 2OCYC 4OXQA 1A5TA 3W9UA 3B60A 4LJRA 5AK3A 4PSKA 1TW3A 1BTOA 3CKKA 1QGYA 3RTCA 5KJ6A 1OI4A 4JK3A 1U6IA 4JH0A 4QDXA 2A3RA 3DHYA 3TCNA 2WU3A 4KIUA 5FPTA 3DAHA 4N6GA 3UFXA 1IN8A 1L4LA 3ZIAD 1E69A 1UMBB 1PEDA 1UAGA 4CFYA 1WNFA 1U0TA 1YU9A 2QRLA 3JU3A 3LNCA 4FQ7A 1AB5A 1FMLA 1H8HD 1N6OA 4D3SA 5BUQA 4GC9A 2PMFA 2ZRPA 1GKLA 3TDMA 2O6LA 3NATA 4KXNA 2QUZA 2ZOSA 4RGVA 5J5VA 1U2TA 2ZI3A 3Q6IA 1Y42X 2OZPA 4QBKA 3UGTA 3LLMA 2FZVA 1T0PA 1M1UA 3EWIA 3I5UA 3V8RA 5JS6A 4BFZA 3AM5A 2WFLA 1H9CA 4RDIA 5J59A 2ZUDA 3UT6A 3F9RA 1DXYA 4N5MA 1YU6A 4ONEA 5K8TA 3RWOA 3WMXA 1BU5A 1Y33E 1NFQA 2AEMA 3IVRA 1OH8A 2GNAA 2V7WA 4R8VA 5BYKA 4IMIB 5C8DA 1S2GA 2A9QA 2FSHA 1RYZA 1WHSA 1E2LA 1RXVA 3HR4A 5L7WA 4IUYA 2B6HA 2XHZA 1WL8A 3HXTA 4O0MA 2XNDA 4OK5A 5CVCA 4Z0NA 4M8LA 4C6SA 3WLPA 4N76A 2IKQA 3OA0A 4TSKA 5ALLA 3PX2A 5DM0A 4IDNA 2PIDA 4JOCA 1BKDR 3L43A 3A6LA 4JR1A 3C45A 4K81B 3CISA 1NM5C 1F3LA 1N2XA 1OIXA 1YAJA 3A9VA 5DKFA 5AVVA 4BN0A 5JBNA 5K0JA 1CS0A 5K3FB 1JA1A 2J07A 4I55A 4L8LA 5LQKA 3BRWA 2AFIE 4PS1A 3A9UA 4TZKA 3WGIA 4IH4A 1NZJA 2P2DA 3PEFA 2BEJA 4HPXB 1KQNA 3BFVA 1H1TA 2XUHA 1N0VC 2ASVA 4PSCA 1XYYA 3GB9A 4KXFB 3R5JA 1WY7A 2UU9B 3BE4A 5ALUA 2AMJA 3KR2A 3WBKA 1VA4A 3HY3A 2WIGA 3DP7A 4NBVA 5HG0A 2VHZA 2QKYA 1HM5A 1E9RA 3BVPA 2OV1A 5FR1A 1KO5A 3UMCA 4KX3A 1SU8A 1TKBA 2CBGA 5L4NA 3U7QA 3DHWC 3B9RA 3CMCO 3BCRA 3IDOA 1WOYA 2FMHA 1D2HA 2O2IA 3KZNA 2XVAA 3ZBQA 5CVEA 1W8DA 3DYIA 1MIHA 4GDFA 4LKRA 3K0BA 4PHGA 3CU5A 1I3MA 4B80A 3H4IA 4WKPA 2POQX 2P27A 4BNWA 1TA0A 1HDYA 1FFXB 2RHLA 4IS3A 4XX0A 4EMSA 4P5EA 3RUFA 2JRCA 4J03A 4RKFA 2QN6A 1ZNYA 5EKXA 3PJGA 3U7QB 1QK5A 5AKLA 4BO2A 3N6VA 2OC4A 1XGKA 3O9VA 4YT4A 3MEQA 4KVGA 1NMYA 1YNOA 2UYQA 3I45A 2YXEA 3RS0A 1EWRA 1I32A 5AI9A 3RYTC 2DPGA 2ZAYA 2HMWA 5AK0A 3GFRA 2TMKA 5BW8A 4L6CA 4M49A 1MV8A 2C7VA 3NDRA 5ICSA 4EM6A 3ZBPA 2ZE6A 4E5KA 2VXCA 2HU7A 1QG4A 4K9MA 4WT7A 5AVTA 4IEFB 1G98A 1JSCA 4DLVA 1PTKA 5AYVA 1OC4A 1VBKA 2IBMA 2IEIA 5FB3A 3RTDA 1KEWA 4QWWA 3T5GA 3A4LA 2ZIXB 3DBOB 4CLOA 4L0MA 2BLLA 4IJQA 3JVUA 3W79A 3LHFA 5KSYA 2ID7A 2L19A 4BO9A 3TLEA 3GEMA 1Y82A 3V2GA 2Q2VA 5E4FA 3FWYA 3A14A 3FH0A 4XOUA 4Z4IA 1YVPA 1G6OA 3THXA 2PYIA 3Q98A 4M86A 2CXHA 4WBNF 4WBSA 2WT4A 4P82A 5TVKA 2XA2A 2AMLA 4PNEA 2CNWA 4MUGA 2WTAA 1JIIA 5KNDA 4OF4A 3TRKA 4NZ9A 4JYZA 2A6PA 1U8YA 3JYLA 5FHRA 4AJKA 1JLRA 1LNZA 1ADGA 3EGEA 4DEXA 4YRLA 1JU4A 1E9SA 4B6RA 2QTVA 2JIRA 2D59A 1QB8A 1DC6A 2HSGA 4YAWA 4Q9IA 4Z8XA 5TVGA 3FGNA 3THXB 3BWMA 5HQTA 2I0FA 2BFFB 5KTMA 2Q3HA 1JB9A 5CPFA 3ETGA 5J1SB 1SAYA 2H5LA 5DBIA 5K6RA 2QTRA 3BWXA 2I65A 4ZI3A 3PB3A 4RTMA 4R9SA 1Q12A 1CUYA 3LK6A 1LNQA 4Z0PA 2PRKA 3B38A 5HM8A 1IUOA 3GYGA 1WKVA 3C41J 3PI6A 5G1NA 4AMVA 3WK5A 2JFZA 1OLXB 3QV2A 4QXPA 4BUJA 2JLXA 4TQGA 1QQ7A 3KR1A 1Y7PA 1YRYE 1X92A 1XQXA 3AKEA 4JNCA 4IGIA 2QMUA 5G1OA 2FE4A 3EVAA 1IQ0A 3WNQA 1DRVA 4MARA 2CEKA 4B71A 1QE0A 4XXHA 1YQXA 5DRTA 3TEJA 1CY1A 4PFKA 2D1QA 3CLUC 3E35A 3ZE8A 3T3NA 3UKOA 3QEBZ 2HK6A 3FHTA 3MJVA 1F2TA 5K4AA 2QV7A 4S1PA 3QLVA 3CR7A 1CSEE 2H3EA 1Y7HA 2XBMA 5KYXB 2FE1A 3RYCB 3PSHA 3R6GA 3LKDA 3IE1A 1C1DA 4W9MC 3C5EA 5M2QA 1F0NA 1J5PA 3LPLA 4EHIA 3QLVC 2R8BA 2NPOA 4ETMA 1A8QA 4RAQA 1FNNA 4PS0A 3DEIA 4WLFA 1F2TB 1SG9A 3KDAA 4E1VA 3T9DA 1PZGA 1WXWA 3KLOA 4CEJA 5F1OA 3WHIA 1JR4A 1XCGB 2ZSBA 4RIIA 3T5AA 4RFVA 3AEQA 1G4UR 2VHWA 3EZ6A 5EQFA 1C1DB 4R7ZA 5SZJA 1R00A 4MIEA 4AAYA 9LDBA 1LI5A 2B5OA 3DDOA 1BVYF 2VUUA 2ZB8A 4YJHA 1O54A 2WZDA 2WYIA 1IIRA 5LFAA 3STWA 3WL6A 5EZ6B 2C8LA 1VI2A 1JDBB 2J7KA 1VL8A 2VBCA 1C8BA 1SOUA 1DBSA 1XYVA 2ZIAA 4K9RA 4ND2A 3DLIA 4GS5A 5HDBB 4ZKDA 4IXTA 2ARKA 2R66A 1ZH2A 2WJ4A 4CIDA 5I9MA 2XZLA 3EOBI 1XEXB 5B4VA 1KBZA 5FFNA 1GPDG 3Q1KA 4IS2A 3KBBA 3RJZA 1QKIA 2Y1EA 5AVZA 5IDWA 3E9EA 3KOXA 3V6LA 1Y5MA 1Z5ZA 2QRVB 2YHIA 3S44A 4HFMA 3OE7D 2P6RA 2QQ5A 2MSDB 2E4WA 3M9XA 4HQ6A 2R44A 4P7BA 5JHGB 3UJHA 5ALJA 4BB6A 1WSDA 4DB4A 1IZ9A 1ETUA 1EUDB 2I6UA 4RF5A 3PEUA 4NDNE 5EGNA 4CM8A 3TO5A 2C82A 2HBQA 3A8TA 4N8SA 1QP0A 3GEGA 2Y66A 2JAXA 5IUKC 3OFNA 2W2OA 1FFGA 2ONZA 2YHIB 4MVJI 1JYFA 3PS9A 4J0IA 1KJIA 2KSQA 2HQ1A 2VWHA 1PCXA 4WFQA 5EWMA 2AQKA 1QM5A 1OH7A 2DSTA 2PFGA 3T5TA 4TUYA 5GOTA 5K2MA 4HNSA 4D9IA 2OGTA 3YASA 3T7SA 1MVOA 4KQWA 1QH1B 2FB9A 1PV2A 2I1LA 4HEQA 3WGVA 1MC4A 5TEWA 4PRYA 4D43A 2Q0SA 5A02A 1KTVA 5HX7A 4AZ3A 3MRVA 1QH0A 3HCWA 4KPFC 4X97A 4IWNA 4NU6A 4EW1A 1E58A 4OI4A 4K0KB 3WRYA 3NNNA 2YRFA 1IBKB 1GGNA 2PX0A 3AXTA 1QDUA 3CBGA 4KN9S 3EVDA 2OYSA 3MCWA 4XYGA 1U8XX 3GYBA 3KM0A 4ZCPA 1P72A 2XRFA 4Z4CA 4NHOA 1BXKA 4DG8A 2CFOA 1M3SA 1Y3BE 1MFZA 3EGXA 4UUPA 3T3IA 1KQFA 1SHUX 2VYCA 1JB1A 4ZMSA 2GO7A 4RYLA 1G9XA 4KE7A 3TH5A 5KZMB 3QPUA 3TMYA 1DQYA 2P0YA 4XWGA 4DCVA 3WNDA 4H3VA 2O54A 2MSKA 4J76A 5EJ9A 4UU1A 3QITA 5B3AA 2YWJA 2JBAA 2IPAB 3V1TC 4IHKA 4BLUA 3I32A 2WAOA 1F9EA 4QDZA 4U0JA 4S0XA 1XELA 4D4IA 4E70A 1TZJA 3TQIA 1O6BA 3GN1A 2Z2XA 1A50B 3RIGA 2RGAA 4YDHB 5FEMA 3FTNA 4HAUA 2J0UB 2B4AA 5FUBA 3MELA 2WIAA 1E1MA 1NMEA 4CQNA 1FVHA 4A82A 4XIFA 5FULA 2Q6VA 2D00A 5HF8A 3DEHA 3WJAA 2EBFX 4BMNA 3WHLA 3V1UA 2H2GA 3HS3A 3AP1A 5IULC 2QROA 4RGQA 3THWA 2X0KA 2FG6C 2N42A 1ZFNA 4LV5B 3FOFC 4MRMB 5KTOA 2XUFA 3H17A 1M6YA 1UXOA 4I8IA 1G2OA 4RH0A 5H9VA 5K0BA 4LI3X 3VU9B 1OHHA 4EEXA 3JASA 3ROPA 1ACMA 1QE3A 4Q4JA 2Y27A 3CSDA 5NULA 3IBGA 5EIXA 5G3YA 3TFQA 4C5AA 3B20A 4CL3A 2JCBA 2W98A 3BFKA 4IW3B 4ZQIA 1CK4A 3B1JA 1GQSA 2H6EA 2GX6A 3SZLA 2QENA 3U1VA 2OO3A 1PFWA 2FPOA 4EPYA 2Y3IA 3UAXA 2JBHA 5ENDA 3H7AA 2ZIUB 1XVLA 2G7MC 4FFBA 2P90A 3A05A 3JASB 4U7JA 1O6ZA 2B5VA 4Q4JB 2XVZA 4NNPA 5T7BA 4ABTA 1BRMA 4C6TA 1Q2UA 3ILYA 3I6ZA 1O5IA 4KDFA 3AZPA 1R27A 2J4CA 1J8FA 4CM9D 4D02A 2GXQA 1PEAA 2OHHA 4FFBB 2QM7A 2A9RA 2WZBA 4QUEA 3IP5A 1TO1E 4WX2B 1OQAA 3OJ0A 4EYOA 1E60A 1K0UA 1P3JA 1S8AA 3ESXA 4NPAA 2QG6A 3UJ9A 3K0CA 1YJXA 2HWWA 4C6TB 3RS4A 2GAFA 2VRNA 2ZR7A 3NALA 4MSUA 4NS4A 4OJNA 4E09A 2IZ0A 5FA8A 1VYUA 3GIDA 1NXPA 3KKKA 4RL6A 4CCWA 1GG8A 2Z58A 5I5EA 4P4GA 4RD4A 1M72A 3PC8A 4RFLA 3N2KA 1L7EA 4GOMD 2ZDGA 1XVIA 1OFHA 4AZVA 4DLXA 1AS0A 2GESA 3VAYA 1X14A 3K30A 5KAMA 5IHXA 2R84A 1UZNA 1A4UA 3ZCVA 3TQTA 1UDBA 4GNRA 3WE7A 5CFNA 5IYZA 3E8XA 1ZYUA 1CQJA 1TQ8A 4QL3A 2WTEA 1DIHA 4II7A 3DL4A 1DIOB 4LYGA 5LB4A 2FF5A 3U0BA 1F06A 3RM3A 4NQZA 1WD7A 1JJAA 1P2BA 5JHHB 2HXGA 2V55B 1KQ3A 2LBPA 1PR4A 2CDAA 3OZ7A 4RZSA 3FTCA 3SE0A 1VXRA 2ODEA 1ZPDA 3T5BA 1AOXA 1QQTA 1T5LA 3E7WA 2XB6A 3N9IA 3PUWA 3KT6A 3SR3A 5LWHA 1BYIA 3Q72A 1JTFA 3U6BA 5C52B 3I6YA 4LYDA 3PFHA 5FTLA 2XWQA 2Z4SA 4JMLA 3F3SA 3ONDA 4QRDA 3CGGA 3VHQA 2O8BA 2ZBRA 2FOIA 4MS4A 5KVSA 3L4KA 5FBLB 3AB8A 1NVWQ 2RKOA 3OIGA 5FV7A 1N4AA 5HPYB 1UK8A 4YAIA 5M5BA 1JJBA 1VDZA 3CLRD 1W5AA 3FROA 4N3NA 5FI3A 2BGMA 4MUNA 2HHJA 3UXMA 4HZUA 2WF5A 1M1NB 4KXVA 5CRIA 3Q5GA 3U39A 3VDMA 1Y6GA 2O8BB 2QZZA 2UUBB 4BQEA 1M2WA 2PJUA 2XD9A 4TROA 3ZDFA 1F51E 3NHFA 4UFNA 5JCPA 4UNQA 3E61A 3RS8A 4DIEA 3KV1A 1BA3A 1EWQA 1T9GR 1E2UA 3RUPA 1SQSA 3QQPA 2I4TA 5E1OA 2ATXA 2WHEA 4CEHA 3NFRA 1XAHA 3BIXA 2Z3VA 3PFKA 3TLZA 4C0KA 2CCKA 4LDAA 3M6AA 3K96A 1SOAA 2OM6A 4N03A 5B64A 1FFWA 2G0TA 2G25A 3EWAA 2JS7A 1DAKA 1PDVA 3SM9A 5K6TA 1I6LA 1USVA 1CRWG 1HFJA 4E08A 3LWDA 4Q4DA 1FLDA 1P8JA 2A5JA 3ZW7A 4ISBA 2AI1A 4HDRA 4INZA 1HNNA 1V4VA 3B7GA 4CL2A 1ARZA 1AKWA 1U3TA 4R8KA 4C9BA 4QGFA 4MJLA 1HQDA 1Z25A 3DBVO 4L5CA 2BFBA 1J7JA 3KQLA 2CWWA 3VSDA 4REMA 1C2YA 4L8VA 2VXOA 4AP6A 1U9JA 4C21A 4PLFA 5AUNB 4HXYA 5FOSA 5K4GA 2XE8A 1KZ6A 5LBTA 2CJFA 4BO1A 2CUTA 3F74A 1GDTA 1P4AA 1ZESA 2H1RA 2ZUBA 3IDFA 1E98A 3A1UA 3QEOA 3VR2A 1EFVB 2QXTA 3CCFA 1LI4A 5DW3A 5FX2A 3OQ1A 3LT0A 4XD7D 2WD8A 3Q7RA 4IDOA 1NHWA 4FHDA 5TF4A 3UENA 5TR9A 6GPBA 5IU6A 2BJHA 3F8SA 4C4SA 1RWPA 2FNAA 3D0RA 4YRIA 3DFUA 3FPKA 1LH0A 2NSHA 5EJIA 3IQIX 3T95A 1LVUA 4G1EB 1OBVA 2K5UA 5IBQA 4YY3B 4NEQA 3G2KA 3P2JA 3QIVA 2FSSA 3OZXA 4G8JA 5A0VA 4B7AA 4DARA 2LP4Y 5BNTA 5TF0A 1WLSA 3B7PA 5BQ3A 1QP4A 1OGIA 3JD3A 3RIYA 2ZZNA 2VPWA 5AOVA 2I2WA 4V0RA 4P0QB 1U5AA 4HMOA 2P4SA 4MS1A 2IUSA 3WL3A 2GZDA 4ZO4A 1UZAA 3KTAA 3VTFA 2CVPA 3RD5A 5DZSA 1SBYA 1DP4A 2AVDA 4A2WA 2YVKA 4JEIA 5FUYA 2Q6KA 1JEQA 3KWJA 5EZQA 1ZBQA 4PLZA 3TN7A 1SXQA 2G0NA 2HFKA 4GKJB 2O8EB 4RD2A 1R6TA 2Y67A 2UUPA 1X7ZA 2DFPA 2ECOA 2AE2A 4P5PA 1JEAA 2JCXA 2XBUA 4G07A 4Z5XA 3QE4A 3RT7A 5KKAA 4RXTA 3RUAA 2G6TA 4Q9KA 1I6KA 2WSBA 1ZG3A 4I4TF 4PGMA 5SZKB 1DV1A 1OAOA 3R0XA 4MUYA 3MJEA 1JEQB 1P2VA 3LSTA 3LC2O 3NTUA 3SP1A 4WUVA 4DQVA 5MF6A 1FRVA 3PITA 3AFGA 4BFCA 2I34A 2BCEA 2D4AA 4N54A 3LS2A 4EPWA 5F2NA 1OAOC 3Q3CA 1PS0A 4PVDA 4U02A 5C46F 2Y1XA 3KIPA 1CX9B 1SWWA 1VG0B 4EB3A 2ACVA 1KF0A 2PQMA 3FXAA 5DTJA 3T1OA 3I9FA 4F9EA 2W2XA 4YYZA 5MGNA 1GTZA 5CNJA 5HHTA 4CM5A 1P0MA 3CXRA 4GOLD 4MH0R 2WSMA 5CVJA 1AHNA 2PRZA 1RRPA 3AG6A 1IXKA 2DT5A 2E6KA 4HX9A 4JBXA 4RK7A 5J63A 4BKPA 2ZT8A 3F2VA 4IG4A 3U2QA 1N1GA 5JYEA 4PR3A 1IN1A 1Z0DA 3RU9A 4LN1A 4W1RA 5KNCH 1W59A 2A1IA 4US2R 1I30A 4ME6A 3S2GA 1DBRA 3QNWA 4C1BA 4QJ3A 3W77A 2QRMA 4A2QA 1DAFA 4FZRA 2Q27A 3AKZA 1XMVA 1JG1A 1BHJA 3K9GA 4LMBA 1N7GA 1HTWA 4EHHA 4EJ2A 7MHTA 1VE7A 4XB2A 5GOZA 1GZ7A 3VR6D 1AF4A 1Z73A 4WWHA 1TCAA 3HCCA 4OB6A 3SHOA 4BMDA 3PL1A 2ZM6B 3Q41A 1C9EA 4HB0A 3FCOA 2GN8A 1FX0B 3TS1A 4XGQA 3B51X 2GMWA 3GJ7A 1XLTA 4CHGA 1Y1RA 5J23A 1TGYA 1KGDA 4EKDA 4IEIA 2EJWA 3MAJA 4O59O 3DMPA 4W6QA 5T3YA 2OSBA 4PIMA 4YUWA 1U02A 1VA5A 1NTOA 1RIIA 3R23A 3GGPA 1O57A 5DGDA 3V4LA 1NLYA 4A16A 1C30B 2OLEA 4OBWA 4PC2A 1T5SA 4U6NA 5EE9A 3DDNA 2QL5A 5F12A 1E8NA 2XYHA 2H57A 5C31A 1GNVA 5SICE 4RQUA 2R8ZA 2RAFA 1U5BA 1PIWA 2X9NA 2HCJB 5EVJA 5FWAA 2C9ZA 3SMVA 3WBFA 3KKOA 1B7GO 2XVYA 2WW8A 4IG9A 3GLIE 4NYMQ 3K2IA 3IUQA 5L3QB 3PCTA 2VQ6A 3CGWA 4CDGA 1XF1A 3H11A 1CZHA 2J3JA 1J5XA 1L7PA 3OP4A 2QTHA 2ZI5A 4RZUA 2PXAA 5DP2A 5JQGA 5E4YA 1QOZA 2VJCA 1MJGM 2BMDA 3PTAA 3OZFA 3TQCA 3FPBA 2AZDA 2ZANA 1JTEA 2R1TB 4UD2A 5B2EA 1E4EA 3SG0A 4JX9A 4KO1S 1GNLA 1VE3A 4OHCA 3VUEA 1G5IA 4CLDA 1XTZA 4AXBA 3MQ2A 3K0EA 3QTBA 4L4UA 4FT4A 1E9DA 5EXPA 4ZT6A 2AGVA 3TRHA 3WWEA 5EE3A 3ZNOA 5D3KA 2JNWA 5EKDA 4G3XA 2IZOA 5K2OA 2RHCA 4YWJA 1K8RA 1PD0A 4P83A 5I8WA 3QWBA 2HHLA 3IR7A 2QRNA 3MHTA 3QJGA 4MVJD 3LQ2A 2OB1A 1OBHA 1R4NB 3LHDA 5ED0A 3GGSA 4B83A 1NOIA 3GZNA 3ROFA 3SEAA 3Q10A 4DMLA 1D6MA 2A59A 2OQRA 3CVVA 3M6FA 3WGKA 4DV1B 4G1MB 4G5HA 2QM0A 4OAPA 4IOLA 4AZTA 5TLSA 1L4MA 1Q1NA 1TUEA 3WKCA 3GT3A 4Y3UA 3UOGA 5FOWA 1E32A 3SQXA 1PK8A 3OFJA 2BGUA 3FVRA 4HDNB 2CC2A 5FH9A 4P0TA 3Q0TA 2H7YA 3N74A 3TQRA 2GM3A 2G09A 3MC1A 4HB3A 3SQLA 2C2WA 1Y98A 2EEZA 3DH0A 3WI7A 2VLIA 2HRBA 3H9UA 2VZLA 3ZYZA 2QRKA 4PQRA 5I7SA 1L7RA 5JTUA 2R7NA 1MO6A 2QM3A 2EL7A 1JZSA 4K5QA 1DOHA 1QV6A 2W2LD 4ITUA 2QUKA 1X19A 3AU8A 3IAM6 4RJIA 3UBMA 1OE0A 2AZ4A 4OQLA 5JDCA 1R6DA 1Z34A 4DBVO 1JA0A 3HCDA 4PSAA 2ASEA 1GAQA 1A9ZA 1T10A 4L07A 5KJCA 2HADA 2FY8A 4Q00A 5JV5A 2Q9AA 3UMGA 4KQCA 3V97A 2VP0A 1XXHA 2BGNA 4HEJA 2D2FA 1KK3A 3ICVA 3A0RB 3E3OA 4IUBS 4PFQA 3C6MA 1XX6A 4R2WA 3W5VA 2FJPA 2X77A 3HRIA 4KQ9A 3TDNA 4HXFB 3INNA 4LCBA 5JAPA 2P6NA 4QYIA 5JCOC 3HL4A 3VOSA 1EGAA 2L42A 4G89A 1UAYA 3DJFA 2JFNA 3A32A 4BP8A 4M0DA 3W5SA 4L57A 4PYJA 3A2LA 4KGVA 2XKBA 5AHOA 4Z99A 2YIDA 2Y0BA 3IPXA 3K1JA 3L0OA 4LPKA 2WT8A 1XALA 4GUDA 4M88A 4PAGA 4CUKA 1U7OA 5C8VA 4C08A 1Y3FE 3L4EA 5FLKA 1J8VA 5ALTA 2J5QA 2DWCA 4MKXA 3IJPA 4NOKA 4ZGBA 1XA3A 5HWSA 1T2CA 2ACKA 2UXCB 1FS6A 2QRHA 5E38A 4DLKA 1N8KA 2OV4A 2PV7A 4PLGA 2OK7A 4PLYA 1WVGA 3B1KA 3FMVA 5AESA 3WKDA 3NVKI 1E92A 1GV1A 4LA4A 3AVUA 4XEHA 4UOEA 4UREA 5BR7A 3JQ8B 2O7SA 3F97A 2KE5A 1WKBA 3MW8A 3IAEA 1NBMD 3OLWA 2VPPA 2C2GA 4P22A 5TXGA 3T38A 1LK5A 3A1WA 5KYNA 3KT3A 3RF7A 1ULSA 2AI3A 1LW6E 5JSQA 1RWOA 6Q21A 2DM6A 3RTGA 2O1EA 1I33A 4TV8A 2R96A 1N8TA 2HCTA 2ZSUA 4QYTA 4HLUA 4X6UA 3AUTA 3T5CA 4F9TA 3ELDA 1T0HB 2AWOA 2OBBA 4ALNA 1TK2A 5J2TB 1C41A 4QVGA 3DE7X 4FMDB 2XUDA 4M1YA 2GR9A 3E6AA 3N3AC 3MWDB 5AW3A 1ZMBA 5HF9A 4H7IA 3DR5A 3E7XA 4F71A 2Q2QA 2QLMA 3G2LA 2V7QA 2X4GA 3NHRA 3ZZ1A 1RIFA 4TV8B 1Q0UA 2NT4A 4J7AA 2GHRA 1DRKA 2GPSA 3B3FA 3UA4A 1JHOA 1Y8CA 3E70C 1NUUA 5ELLA 4BVEA 2Q8QA 1EX6A 2GXUA 2X8WA 1G5HA 1EP2B 2X7JA 4PQGA 1VRWA 3DB2A 4F4UA 1R5NA 5JCZA 2RH5A 4DPKA 1II8B 2UUOA 1BYUA 2QW8A 3AF2A 1C7ZA 2FAXA 2IUYA 4XWYA 1EXWA 1N3IA 2PEYA 4MCIA 1RYDA 3TMAA 3VOAA 1HFWA 3E9MA 4FDUA 1MW8X 2VHVA 3WAJA 3C8ZA 2OMKA 3BG5A 1SIUA 2NTVA 1N5DA 2BL4A 3KL4A 1NR1A 4OBXA 5JC1A 3ZDBA 2VRCD 4I5FA 2J9RA 1BSVA 3C5WP 4TL8A 4HAVA 4Y2XA 3RC2A 4URFA 1WA5A 4Z4EA 1TJ3A 4C7VA 2FSFA 1I3KA 3B1VA 1N57A 1EK5A 4DM3A 1T2AA 3I5MA 2CBZA 4N3CA 4EUKA 5LN1A 4ZP1A 1N0HA 4TTVA 2GCEA 3VKGA 1O1YA 1T91A 2CXPA 7ABPA 1BWPA 2W58A 9GPBA 4UCWA 3OPXA 5CA0F 3EDYA 3KUXA 1LF5A 2RBKA 1X7YB 2NUBA 5EWJA 3SDZA 4EA9A 3D4OA 1TF5A 3QOYA 4KRYA 2RGEA 4DNQA 4CEIA 4J4TA 5BOSB 2OXIA 4G2NA 3OEYA 2NSDA 5EZSA 3NRBA 5LL6P 3ST7A 1W0KA 4P4LA 2NACA 3FHJA 1KQPA 1AKMA 5EWJB 1C2TA 3L40A 3DM9B 2O52A 3V80A 5FNVB 3P9NA 1K3FA 1Q22A 1N77A 4O2BB 1UMDB 4R83A 1SU4A 2E21A 4MHSA 4LNHA 4KVAA 2M6SA 2KWIA 1CERA 5DI3A 3IULA 3M5PA 4JLKA 2X1VA 4GPZA 4A8JC 5CB4F 5JAUA 3WO0A 1XRRA 4GAEA 4F9FA 2PT7A 5KYGA 5EPEA 1GUYA 3WGTA 3ZTWA 4PVCA 2CKMA 5A3QA 3ICEA 2AZXA 1T1RA 2ISSD 4C03A 1W36D 1XMQB 3IPLA 4UBMA 3M5CA 5AM3A 4MICA 3W3AA 5L40A 2GKGA 3DDSA 4C3VA 1QH8A 1K75A 1XPJA 3K9CA 1NFRA 1RS0A 1TIKA 1TM4E 1T5OA 4JP8A 3ABZA 3ORYA 1NQ5A 2HKIA 3PGLA 3DONA 4PHTA 2O2HA 1G20E 2WU0A 3SICE 3WQQA 2HJGA 2XF2A 1WSWA 4H7KA 4DLSA 1EI9A 2WOOA 3J80A 4Q4HB 2XSZA 2O48X 2GCGA 1LUAA 3N7UA 1Q92A 1PZNA 1T8UA 1Z7WA 2GYVA 3HA7A 3I6QA 4ZK2A 3THOA 2P75A 2WIFA 2PS1A 1SXHA 1G8FA 4QLOA 5GZ3A 2W2QA 5L53A 1GCAA 2FWAA 5CEEA 3MT8A 1JN0A 4LNAA 4XB1A 3ZHCA 1D7OA 3JYQA 3MTGA 1QFXA 1Q0LA 4EKIA 1L5HB 2ZAGA 4KGZA 4CCAA 3UVEA 2IK8A 4GLFA 1PGPA 2FDCA 3U81A 1VCIA 3E22B 2ENUA 1AXGA 4GMKA 5EMKA 1E99A 3NTVA 4MIOA 1KY4A 3KYDB 4LRYA 2DC1A 1RWMA 2AFIB 4C7KA 4FGJA 4UNIA 3HDVA 4LYYA 4N5LA 3M4ZA 4UHHA 2J5XA 2EGHA 1KPHA 3BTOA 4I6GA 4BV3A 4GL4A 4DIBA 1B16A 2BEUA 4KXUA 3AH8A 2VJAA 3HBLA 4W5RA 1OVGA 2WFZA 3UJPA 1Z4NA 2PSDA 2OUIA 3U4HA 3IKVA 4WY8A 2Q5OA 2YJZA 4B3TB 5JD4A 1B26A 4KFTA 1PVOA 1GU0A 2OK8A 1XWWA 1SEPA 4UZSA 1P7ZA 1T2NA 2ZJFA 3ACDA 3WADA 1UK6A 1CC1S 1YS6A 1SWVA 2C5EA 2XEDA 3PZRA 5EJAA 3UEOA 4L0QA 3CW8X 4KDRA 4M8NE 2V96A 4DWWA 1Z0ZA 2GPYA 2PUWA 2VA8A 2YJ3A 1ENZA 3NJ4A 5A3SA 5LQUA 3LPDA 1HEUA 4EVSA 5LWQA 1G8PA 3E1SA 3GPBA 1OVMA 4DLBA 4PG6A 4AWAA 2P9JA 1ETHA 1LPMA 2AL7A 4IH9A 3GX1A 4M83A 1PGNA 1KJNA 3G02A 4EITA 2BEWB 5AVKA 2YOHA 3OCYA 1Y34E 3UJDA 4ZT3A 2VZ8A 4JA2A 3SC2A 1RCUA 3PUKA 4KE6A 2G5GX 3LW8A 2G8NA 1GXSA 1HDCA 1CQIB 3ZEIA 5ITZB 1IPHA 3M6UA 4MROA 3CN7A 2R1VB 5DM2A 1WU7A 1QCZA 3L1VA 3VU1A 2H18A 4M9SA 1YCHA 1LGYA 1RKUA 1GT91 1P1FA 2AW3A 4Q7EA 5FF9A 3W5UA 1CF9A 1BVHA 3D8HA 3COJA 1NUAA 1XNJA 1SULA 3TLYA 4R16A 2GSWA 2O7NA 2QVLA 3ZGZA 4RKWA 4BAUA 3N6RA 4FHGA 3ZOZA 4HDAA 3W5JA 1BEEA 2OEPA 1U0LA 2I99A 2OGSA 1PV4A 1YA4A 4Q15A 5CNIA 2PWZA 4GPBA 1Z5PA 4HQRA 2R0QC 1RLUA 4EF4A 1OLSA 3C14C 3MRTA 2ILVA 2A1TS 2FUG1 4FMBB 4FFNA 4PPYA 3SHQA 3FZNA 1XJCA 4B7ZA 3KJHA 5GONA 1W35A 1C50A 1WMSA 5IBRA 3VZDA 1FW8A 1WVIA 3AKCA 1NUHA 4TTTS 2OCGA 1QIFA 4FYKA 2QK4A 3N59A 4CIBA 1D1PA 1SUEA 1UINA 5DOZA 3BJEA 1RM3A 3KZKA 2D5LA 4RELA 2PR7A 4JT4A 1W88B 3DZIA 4QVIA 5JW6A 1V1RB 1OLSB 2FQYA 3KU1A 1N2IA 3U4DA 4C4AA 2A8YA 5BNWA 3F71A 2YHUA 5KPJA 1Z0SA 3CLSD 1MQ9A 1OWOA 2V3WA 2WOJA 2GBPA 1QC5A 3I83A 5KB3A 4RLFA 3TNDA 2Q4DA 3PRKE 1U2SA 4MVJM 2C99A 3WA6A 4CDMA 2FPRA 2PCLA 4FFVA 1WVMA 5ETJA 4JJFA 4OTZA 5DB4A 1JYEA 1Q7RA 3FFAA 1I2ZA 3QTLA 4RTNA 3N2GA 2XTAA 3IMGA 1TJPB 2HXSA 3KO8A 1RWXA 3MJSA 3N8DA 1SQGA 2H4WA 2EBHX 1LC3A 1PG2A 1VJ1A 1QC5B 3HJGA 4RNDB 4UNPA 3JS5A 3TD9A 2PUEA 2CMDA 2BBTA 3L0ZA 2C54A 1YI0A 3JSXA 3MWGA 3WK4A 4Y2TA 1NVXQ 4QGBA 3PD7A 5G0WA 4XUCA 5L3ZA 1WXIA 2LZ0A 4C14A 3FB1A 3LL7A 1L5GB 5JAIA 2XAUA 2P9QA 4B2LA 1LTQA 2Q2NA 4WA8A 3RRMA 5HIJA 3E5MA 2RHJA 2VJOA 3H2SA 3RVJA 1NU6A 1RAFA 3OPVA 5KYYA 2V59A 3A1NA 4LXIA 4JR2A 1WUYA 4L76A 1AMNA 2PX5A 3EG5A 2HREA 4IDFA 3U7RA 1TEVA 3AKYA 2JLWA 2QDKA 4C43A 1PT7A 4US1R 2RGGA 3EGIA 4NYJQ 3IHLA 3PBKA 3BEOA 4E22A 2NVWA 3E18A 3SGLA 2E4UA 1ZSVA 3S1AA 1F6BA 5KYYB 2C0CA 2VDJA 1FP1D 5DGXA 1ZQ1A 3AYZB 3SI7A 1GPAA 2PZ8A 1BCRA 3TSYA 4F3RA 1YDFA 5BYBA 5LCXA 1JT2A 2BKXA 1DIGA 2NZUG 2EQ5A 3QXCA 3R5HA 1FE8A 3CA8A 3EF1A 3CJQA 2YQ5A 4PYLA 1XP5A 5DCLA 1MO3A 3AOEC 1ODJA 2AV6A 4DLUA 5LJLA 1RRCA 2VNHA 4UW9A 1G8GA 2MR6A 3M6XA 4DQDA 4ENUA 1WABA 3K70D 2GAOA 1NV9A 5HP4A 1AXEA 1VRCA 2VF7A 3G9XA 4OH7A 1J20A 1OCEA 1HFKA 4QUIA 1R1DA 3FNGA 3L2OB 4GKVA 2X6RA 4R4JA 3WMGA 4E46A 4CLRA 3IAM1 3CCCA 4YROA 2I6QA 1LDEA 1WXFA 1K97A 1EZ4A 2J59A 3WGJA 1ZVVA 4NCBA 1SKYE 3A3PA 1R9MA 3CTMA 4QODA 4RKQA 3AEUA 2CD7A 1J5EB 2NTNA 4A0GA 4EH1A 1H85A 2Q1UA 1J00A 5M34A 3HO1A 3U3ZA 1CE8A 1G5RA 1YB6A 4C2TA 4LHXA 1PYGA 4MTLA 4KUEA 5HE8A 2QRJA 3V8VA 1PGJA 3JWHA 3SXUA 4HNTA 3GRAA 3I34X 2C61A 5WRFA 4L78A 1VMDA 3LX4A 4FI3C 3O83A 3WGOA 2RHHA 2HJRA 4ZODA 3HN6A 1QPZA 4NBKA 4P5DA 4D98A 5B1YA 1M1XB 2REQA 4Z9XA 3K9NA 1EVKA 2VK4A 5D85A 5ARCA 1J33A 3D1JA 3KJFA 3RASA 3TI9A 3V7WA 4ESVA 3VH3A 1D2AA 3B36A 4PSVA 3MA0A 2AUMA 1LSJA 3PNYA 3MS2A 1NNEA 3PA6A 2BRUA 4U2CA 4MPPA 1RYMA 2CHQA 3NAGA 4FJ0A 3WK6A 4IF6A 4NJMA 3UW3A 3AJRA 3OCJA 4XTRA 2COUA 3DUFB 1YVUA 2J46A 1KAHA 2BRUC 4LDNA 5J4KA 1YE5A 2GRJA 2OV8A 1AG9A 5DBGA 4D9NA 3HLYA 3TFOA 3I05A 3VSAA 4IFTA 4I2NA 1L5KA 2NYUA 3OETA 2GH1A 3UJ6A 3R7SA 4DZRA 1W1WA 4OLFA 4FHCA 2AUTA 3QHPA 2KHZA 2V7TA 3KU4A 1DAMA 2IQIA 3L8DA 3FFTA 4I9GA 4YMSA 2NVOA 4YCBA 3U4QB 4CM7A 2J85A 3OEEA 4JVSB 1L4NA 2WM8A 2I2CA 5HFJA 2Z57A 3I30X 1GSOA 1ONOA 4II3A 1RPNA 5AKGA 4LRUA 1QHNA 2DECA 2JKVA 3CSUA 3G2OA 1YTLA 2GAIA 1FUIA 1LFAA 2XD4A 4KWCA 3FUVA 5B1EA 5DNWA 4M7PA 2C3OA 3FPCA 3GA0A 4OMFG 5I9IA 2QJOA 1Q0SA 2VDLB 5D84A 1BCSA 2AC4A 3EQZA 4DABA 5DEOA 1ZITA 5TARA 1RQPA 1BJTA 2BP7A 2HRZA 2XKJE 4A5SA 1EX7A 1QK4A 3QHQA 1CUIA 2VPTA 2X86A 3BXGA 3C0KA 3TM5A 2I2FA 2XMGA 3AVXA 3ER8A 4NHEA 4ZXFA 3T9EA 1J23A 1EZ1A 4JLAA 1MUUA 4MQUA 4GP9A 4WASA 3O8OB 4X1IB 4JSRA 4Z0TA 5CCDA 3HU1A 4Z1OA 1EQAA 3GJZA 2H16A 2OB2A 4NULA 5JEEA 2ISQA 3I53A 1H93A 4HZGA 3LCJA 5KSZA 2WJJA 3LQ4A 4HI0E 1U2GC 1KQGA 3HXQA 4YUYA 1Y80A 2CJPA 4LDRA 4ND7A 4RBNA 4E5SA 1WQ3A 5DJ5A 2GD1O 5CJPA 3WL5A 2KQUA 4EYSA 3G7SA 2ZP1A 3JD1A 1NRXA 1YXMA 4EL0A 5AW4A 5BUCA 2IRWA 3BQMB 1FTSA 4FKBA 5LQJA 4L6IA 1ZNQO 3TG8A 5K3OA 2JJ2A 1PR9A 4A8HA 1UBCA 5EMNA 1EYZA 2REXB 4JENA 4BL5A 1NL3A 4YPOA 2FTKE 1IMJA 4KAXA 5GGXA 3UJ7A 1KAMA 3H2IA 3VR6H 3KXKA 4JI7B 1V96A 5IANA 1A72A 1AUPA 3KQMA 3ZDAA 4C0BA 2QN2A 3IV6A 2AC2A 1JMKC 1L4UA 1MPXA 1O8BA 3U4IA 4HYTA 1GJRA 3R74A 3WHPA 4JOQA 1FS5A 1KP9A 3ORQA 2V6IA 4NBRA 4PRLA 1SUBA 4Y9UA 4DMKA 5L6LB 1KJQA 1OV6A 3EEBA 3DZBA 3BXOA 3HGMA 5A3VA 1E2DA 4AZ0B 1GSHA 4DEVA 2H2FA 1CZOA 1GPUA 2FSGA 4S35A 4D8TA 1ZGJA 1U0JA 1V35A 2C8VA 2LCIA 5HR5A 3HGQA 3TLGB 4P86A 4YH1A 3LDGA 4MR7A 4JDUA 3A6EA 3EPLA 4LXXA 1PEYA 3PHHA 1P1RA 2GN0A 2Q6TA 3FPAA 4GHWA 4Q03A 3ZCRA 4ZV4A 1PDOA 3A1FA 3EW7A 4FUTA 4G67A 4RKRA 3O8CA 1YR1A 1BRTA 3QNMA 4LE0A 5DBEX 1K5DA 2C94A 2EC5A 5AW5A 2X41A 3ZEAA 1NAHA 3D9QX 2ZTLA 1ISFA 4MQEB 4HDKA 4CM6A 1ORVA 1Q6ZA 1WXHA 3HV0A 4YT8A 4O8CA 2X1HA 4OYHA 1O6GA 1G8MA 2G1JA 5IWAB 1ECBA 3DCIA 1OC2A 5CW1A 1KZGB 2JH9A 1P2DA 2YIJA 2YWEA 3DXFA 4W4TA 3PGJA 3X1JA 4D4HA 1AZWA 4GVXA 4J2TA 3TGWA 4GLBA 5HK9A 1I4EB 2C2KA 4BUZA 4D1YA 3AHHA 3HUDA 3RRNA 1AGPA 1TCUA 4W7HA 3ZNQA 4IMRA 4LQLA 2Y1LA 3RO7A 3X2FA 5JPIA 3V4PB 1HLFA 4CKWB 3AESB 4XM0A 3CVXA 5AW2A 1EIWA 3NORA 4YXWA 3WL7A 2PL3A 1CUFA 1GO2A 1VSQA 2VJDA 5IKXA 3LKZA 3ESDA 3UM9A 1J99A 3T0GA 1O95C 1B1AA 1WSAA 3FHOA 4FHEA 5TGDA 2J41A 5B1HA 2JC3A 1WKCA 1FNDA 4IY1A 5JMOA 3RC8A 2QV0A 3QUBA 3HNRA 3W8DA 1SHLA 3RS7A 4DQLA 4GO1A 4GVPA 4E7PA 5IZCC 3OC6A 2L0XA 4IM7A 4GQIA 1G7SA 1NQUA 1RWNA 2SECE 2B8NA 3OECA 4CMEA 1L7DA 1Q50A 4RLQA 2BTQB 1SZCA 3EEQA 3T12A 1X9IA 3DZCA 3QPBA 3UG6A 3WFZA 4D4JA 2QVGA 4EW3A 4RK0A 3B6JA 4QHYA 1GNRA 4KR7A 4CMEC 3OZDA 3V2IA 5DIZA 2RHMA 2C9OA 2ZRHA 3GLHE 4J9VA 4KWIA 3E2IA 3HB5X 4R81A 2YJ6A 1H0KA 2Q1SA 4IDHA 1KAQA 1H2RS 1WDKA 5FA6A 3GIWA