4Z0NA

Crystal structure of a periplasmic solute binding protein (ipr025997) from streptobacillus moniliformis dsm-12112 (smon_0317, target efi-511281) with bound d-galactose
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
KITLGVTYYKFDDNFLAGMRNDMIQIAKEKYPNIELLNNDSQNSQSILNDQIEVLINKGVNVLVINLVDPTAGQSVIDKAKAANIPIILFNKDPGVDALNSYDKAWYVGTTPKDSGILQGQVIEKAWLANPAYDLNGDGVIQYVMLFGEPGQPDAEARTKYSIEYLNEKGIKTEELHKDIANWDAAQAKDKMDAWLSGPNANKIEVVIANNDGMALGAVESIKAVKKELPVFGVDAIQEALTLIEKGEMVGTVLQDATGQARAILELANNIANGKEPTEGTEWKLIDKAVRVPYVGVDKDNYKEFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein/LacI transcriptional regulator
publication title Crystal Structure of a Periplasmic Solute binding protein (IPR025997) from Streptobacillus moniliformis DSM-12112 (Smon_0317, TARGET EFI-511281) with bound D-Galactose
rcsb
source organism Streptobacillus moniliformis
molecule tags Transcription
total genus 116
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z0nA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4z0nA02
3CHYA 5HM6A 4WXMA 3CG0A 5KWSA 3HV2A 3KSMA 1YS6A 1S8NA 3H5OA 4W5TA 3NNSA 2AYZA 2V0NA 2FXIA 1JYFA 5FWYB 3IP5A 4XAQA 5JNSA 4YCSA 1A04A 1VPWA 3GYBA 4YRZA 4EVQA 1NXTA 2LUOA 3G1WA 3VNBA 1PEYA 1USGA 1VKRA 3QEMB 3C6QA 3BRSA 1LBIA 4Z4FA 1M5TA 3EQZA 3CU5A 3LUAA 2QZJA 4JAVC 4MS4B 5HSGA 5KQMA 1AB5A 4P98A 3HEBA 5DTEA 2MYPA 4NCBA 5BQ3A 4OLBA 2I6FA 3DBIA 3LUFA 1YIOA 3HJFA 1ISRA 1OXKB 4Z4EA 1P6QA 2VYCA 4RZSA 2M1ZA 3OQMA 1RZRD 1BDJA 2OQRA 1LK0A 5JNUA 4Z4GA 5F64A 3MQ4A 4D74A 5BR1A 3LUHA 4LE0A 3QELA 3TB6A 2B4AA 2GWRA 4ETIA 4RY8A 5BRJA 3H1GA 3MIZA 3QLVC 5I4CA 3FFWA 5TQJA 1NATA 4HNSA 2RJNA 4ZYLA 2A9OA 4NV3A 3DLBA 4YR7A 1URPA 2QR3A 3SM9A 5DGCA 1DCMA 1Z18A 2HQOA 3N0WA 4JASB 3JPWA 3Q7SA 2FQXA 3TMYA 3SNKA 5DCLA 4KK4A 1SRRA 4G0YA 3NBMA 2IDMA 4UHKA 3RVOA 3KYIB 5EWJA 3I42A 3RVJA 1JHZA 2R47A 5TPWA 3FDFA 5TE9A 1RXIA 3JY6A 4D6XA 3QLUA 4ZMRA 1NY5A 2LBPA 4KK3A 3ILYA 4RK7A 3FFTA 4YO7A 2FQWA 3DGFC 3N8IA 4H3KB 4YWHA 5KQPA 2IKSA 1ZVVA 1ZGZA 4KZKA 4Z99A 2W42A 2WY2D 1TMYA 4XFKA 4MLCA 2A9RA 3SAJA 5DLEA 2QVCA 4TLMB 1YMVA 2GBPA 5EWJB 2E4VA 3KS9A 3HUTA 4WXEA 3F6PA 2FN8A 3CG4A 3E61A 1D4ZA 3L49A 4Q6BA 3KLOA 5TPWB 5KI6A 1Z16A 2WB4A 2L17A 3H6HA 4LX8A 4OG2A 3BREA 1JH9A 1APBA 3SG0A 6ABPA 1T34A 1QQAA 3OO1A 2R25B 4KREA 7ABPA 2JVKA 4MPTA 2L18A 2WJWA 4PYRA 5ABPA 1YTUA 1F4VA 5IUKC 2YHBA 2JK1A 3CKMA 2L2QA 1JYEA 4MS1A 4DQDA 4G86A 3N0RA 4EYOA 1DRKA 3IP9A 4G0XA 5IC5A 2YHAA 3C97A 4WWHA 3KG2A 3CS3A 2CWDA 3GT7A 2JBAA 3S99A 9ABPA 2PUAA 2HPHA 2PUCA 4IGAA 3OLZA 4KMRA 1W25A 5TQ2A 3RVNA 1DP4A 4KQ9A 3CRNA 3QEKA 2QV0A 5T3YA 4W5OA 1NXPA 1F51E 1DCFA 1PNRA 3OLXA 2MSLA 4N03A 4YV7A 4N41A 1KGSA 3JVIA 2PKXA 4H60A 1TM2A 4LE2A 3VNAA 3D02A 1UDRA 3OO0A 3UUGA 3DLHA 3Q7RA 2IOYA 3DGEC 4Z4HA 3A10A 4PEVA 4W5NA 1JFVA 5KQGA 1C4WA 3GRCA 4JB2A 4G0OA 2JBAB 4LRQA 4LDAA 4OLAA 5EWMA 5ED4A 3F6CA 5C5CA 4EVSA 1BAPA 2FMFA 4IMIB 1BVHA 2ID9A 4FE4A 4ZPJA 4L4UA 1L5ZA 2HQBA 3LUDA 4S04A 1ZAYA 4XXHA 3TD9A 3BRQA 3IPCA 4MYRA 2RGYA 4HYEA 3SQNA 3I45A 4JA2A 6CHYA 2FKAA 3K4HA 1PHRA 3LKBA 1P6UA 4GNRA 4MAAA 1WETA 1J56A 3BBLA 2E4WA 4L85A 5EWMB 2JCGA 1FFWA 4JOQA 4PICA 2E4UA 4RSMA 3N0XA 1VLZA 2OENG 4MR7A 5FWXA 4ETNA 4HNRA 1B00A 3IDOA 4MGEA 2CD7A 4YP9A 2MSKA 3RVKA 3HS3A 4JP1A 4H3HB 3O2SB 5IUNC 1FQWA 4RY9A 4KVFA 3CFYA 1K66A 3GA5A 5TPZA 2PE5A 3DZDA 5CHYA 1JF8A 4E7OA 3F7NA 1DCKA 4QYMA 2MSWA 2VUIB 2NUBA 5DKFA 1NTRA 5EWLA 4MR7B 5FWXB 4EYQA 4UHJA 3RVSA 1GCAA 4RK4A 1BDIA 1FFGA 3ROTA 4MS3A 3FFXA 4F11A 3R0JA 2GX6A 2P9HA 3Q15C 2FEWB 2KYRA 1E6MA 2PL9A 4KRFA 4B09A 1L5YA 2WRZA 1QP0A 5TQ0A 2R4QA 3QELB 1LJLA 4TMYA 3GV0A 1ZN2A 4XASA 4Z4IA 1DZ3A 3MA0A 1RPJA 3E3MA 1E6KA 4MQEA 1NXWA 2LP4Y 1XHEA 1JL3A 3LUJA 3HXMA 1QPZA 2H3HA 1DJMA 4KV7A 3T95A 3A3KA 1D1QA 5B3JC 3LFTA 3HK2A 1GLGA 3N75A 3MF4A 3RVLA 4M88A 1EWTA 4RKQA 1E2BA 2R48A 3M9XA 3ROFA 1ZH2A 2QVGA 3CTPA 1MAVA 5KQLA 4MRMA 4WZZA 1ABFA 5T7BA 1MVOA 2VK2A 4OBBA 1A0OA 1USIA 4MR9A 4Q7EA 3HVRA 1D1PA 1DC7A 2FMIA 2HQRA 4NQRA 1IIBA 4RK5A 2Q5CA 4LE1A 5CNMA 2LIVA 3HO1A 3D8UA 4KFCA 4LDZA 3N53A 4KQCA 2BGGA 4DADA 1AB6A 3GWGA 3HDVA 2CHEA 1QO0A 2JB9A 3Q41A 4JB0A 3LUKA 5CNJA 1QP7A 2FLKA 5HKOA 2ZWMA 4MRMB 3LTEA 3HDGA 2GKGA 1YS7A 3LKVA 1VRVA 3TO5A 3EJWA 4IF4A 2NZUG 3NNDA 3GBVA 2A9PA 3LUCA 2N9UA 4KNYA 3HM9A 5BRAA 1P2FA 1Z2DA 4Z0NA 3ILHA 3IP6A 1JDPA 2FEPA 3C3KA 4GPAA 3CZCA 1XWWA 1QP4A 2IPLA 3T38A 3CZ5A 2LPMA 2QSJA 3OLYA 1LJUA 4RDCA 2ID7A 2MYUA 2PL1A 3EGCA 3NNNA 3O1IC 5HQJA 5IEJA 1QQBA 1SD5A 3RVQA 5IULC 1SXIA 3OQNA 4MS1B 5C5EA 3I09A 1I3CA 1Z17A 3H5WA 1H9CA 3O1JC 1ISSA 4WUTA 3TX6A 4OTZA 2PUDA 3K9CA 4Y9TA 4O1IA 4RXUA 3SY8A 4QICA 4Z9AA 4PZ0A 5TQ2B 3O2QB 1NXOA 3RVRA 4F12A 1W9HA 3QLVA 1DRJA 4FB4A 3EULA 2J48A 1R8JA 2PMCA 3H75A 1RZRA 2F8SA 4NICA 4KPYA 3KTOA 3IPAA 2L19A 5GQSA 2PUBA 1NXXA 1U2PA 1QO0D 3KLNA 2FN9A 2HJ9A 1YK0A 1DBPA 3QEMA 4QYWA 1RNLA 1U8TA 1D2AA 3MYYA 4RKRA 1MB0A 3BILA 3M9WA 4MS4A 4IMJB 3KJXA 1PUXA 2M98A 4OATA 1PNTA 1QNLA 3C3WA 3EQ2A 3QX9A 3RVMA 1Z13A 4TN5A 4YGXB 3GL9A 3OQOA 3KCNA 1Z12A 4N0PA 2CHFA 4F8JA 2NT3A 3CNBA 2E4ZA 3O1HB 5GOTA 5FBHA 1DBWA 4ML3A 4HNQA 4Z9BA 2ZAYA 3Q7TA 1A2OA 1M2EA 4D6YA 2HSGA 4IILA 4S05A 3OMXA 5CNKA 4EY3A 4QPJC 5B3JA 4EUKA 1M2FA 3NHZA 3RH0A 4N47A 1TLFA 5JNRA 1ZITA 3NHMA 1CEYA 5JNVA 3G85A 1Y1LA 3LUGA 4MLDA 1MIHA 5IX8A 2PLNA 4RS3A 4RWEA 3T6KA 1JDNA 1SXHA 2FSPA 1XHFA 3O74A 1GCGA 4YLEA 3T8YA 2IPMA 3LMKA 4W5QA 2FEKA 2MYTA 1GUDA 1YVUA 4RXMA 3UK0A 1YK1A 2AYXA 1M5UA 4CBVA 1DG9A 4NCAA 3OMWA 1JLKA 4MQFA 3KHTA 3A0UA 5CNIA 1ZHHA 3B2NA 4G0PA 3W9SA 2PUEA 2IPNA 2FVYA 3F73A 2PAFA 2GI4A 3KYJB 2FW0A 3GBPA 1U2QA 1U0SY 3H6GA 2QU7A 3OM0A 2MYNA 5EWLB 5KC9A 4G0QA 2FQYA 3KKEA 3OM1A 4P1ZA 3O21A 1KRWA 3RQIA 4MS3B 1EAYA 1SXGA 3EAFA 3MMNA 2QXYA 4EYKA 5IBQA 1FSPA 1ZY2A 4ZMSA 3L6UA 1JWLA 1QKKA 4EGSA 1Z15A 4RXTA 2P4UA 4G97A 4MQFB 1E6LA 5TQ0B 2IYNA 4F3TA 1JBEA 3P9YA 1TJYA 1DC8A 2X7XA 5TPZD 3QK7A 3URMA 1Z25A 4RV5A 2PUGA 1MB3A 4MQEB 2A9QA 1Z26A 1JFTA 1K68A 4O5AA 3RVPA 1JX6A 2FMHA 3A0RB 3EDCA 5IEBA 4FE7A 4DN6A 3HUUA 1CYEA 2VUHB 4N0QA 4MR8A 5FBKA 5JS1A 4G0MA 5KC8A 1D5WA 1EFAA 3HZHA 1Z2EA 4O1HA 4RY0A 1LBHA 1ZDMA 5PNTA 2JVJA 3HSYA 3OLWA 5JNWA 1C0EA 3H1EA 1GUBA 4WT7A 1CHNA 1KRXA 1FFSA 3M6MD 4MR9B 4RK6A 3CLKA 4XLTA 4G0ZA 2JRLA 1BDHA 2NZVG 4EVRA 1BA2A 3JTEA 2DRIA 3H5LA 2TMYA 4Z4CA 1U04A 3C3MA 2XDYA 4XARA 1ABEA 3Q9SA 2PJUA 3H5TA 3IP7A 3QX8A 4W5RA 2F8TA 2B1JA 3JPYA 4MR8B 1YMUA 4N76A 2RJOA 3N6VA 2JVIA 3FGZA 4TLLB 2NT4A 2WWVD 3UKJA 4EYGA 4PE5B 1NXSA 1ZGGA 4LZLA 3QLTA 4RK0A 4YS6A 1DBQA 3QLUC 3H5IA 5IUJC 1EHCA 1ZH4A 3O75A 2QW1A 1EWVA 3EODA 1ZESA 1QMPA 3HCWA 1NXVA 4E7PA 3JVDA 1OXBB 4RK1A 1USKA 2O20A 4ETMA 5D2CA 5JNTA 1EWKA 4F06A 1JFSA 3H5VA 5FWYA 2WJAA 5E3JA 2FLWA 1RXEA 2RDMA 3OLVA 2FTKE 1HEYA 2E4XA 2E4YA 4RU1A 3I5AA 1TVMA 5JS2A 1P8AA 3H1FA 4ZJPA 3JS5A 2IPAB 3LOPA 2WMYA 3O2JA 3MM4A 8ABPA 2H0AA 4IRXA 3FMVA 1KMIY 1PEAA 4Q6WA 2PUFA 2FMKA
chains in the Genus database with same CATH superfamily
4L8LA 4L0DA 5B2ZA 1YS6A 9MHTA 1ZIOA 1RC1A 2P3OA 4GWLA 4RSRA 5ES3A 2EARA 3NV9A 1K7XB 2OOKA 2X22A 1A69A 5BV2P 3HB4X 4DM7A 1P1KA 4UDXX 1S6YA 3KYBA 5JJ5A 1EX1A 4CLOA 4M9CA 4RTNA 2R8ZA 3G7NA 1PEYA 3NM6B 3OM8A 1QHFA 1QHYA 1EYZA 2CLLB 2R4TA 1TFUA 4HAZA 2YOHA 5I4IA 3BJMA 1VKHA 3MWLA 4QQKA 2D54A 2H9IA 5JSZA 4U7DA 4PLVA 5DWQA 2OB2A 3B9PA 4CMAA 4QWWA 2MSEB 1PL7A 5JY6A 1J21A 1RMQA 2FPWA 3HSKA 5AJXA 2G82A 2C4KA 1D8AA 3EGDB 3HYLA 3MUNA 4OLBA 1F20A 4OFZA 1P9WA 3GT3A 4RLHA 5DI3B 3X1ZA 2W9XA 1PBTA 1YQ9A 1V71A 1YWGO 2XX3A 3HCCA 5FWNA 4HMOA 4P32A 3VISA 4F5DA 3KQSA 2ZT6A 1TD1A 5FF9A 4IF6A 3F78A 1I2AA 1VE5A 3RVDA 1AQYA 3C6BA 4JB3A 2YHUA 1CZNA 2O2XA 2EX0A 4B82A 1Q1GA 4ZTZB 2YMQA 2I2CA 3OPYA 4P4SB 2Z9DA 1QDUA 2JCBA 4LJAA 5E6RA 4A0GA 1EB9A 1KKLA 2I7VA 1ODKA 1OI3A 4DJEC 221PA 4JC8A 1U90A 4QXOA 5JATA 5KOJA 5L4NA 2QSYA 3LBIA 3W5AA 2IXGA 3G2IA 3DDOA 4TQAA 1DCMA 2POQX 3JPWA 3MW8A 5C8ZA 1PDWA 3SNKA 2B35A 1O95D 3RUAA 3ANSA 2BBTA 4KIWA 4ZAFA 4DY4A 3RK1A 2V5AA 4MWGA 2FFAA 2WU3A 1DIBA 3IQWA 3ZE9A 1JHZA 4PG8A 5IVHA 1XF1A 1S2OA 3S3TA 4AD8A 5JT1A 1H6BA 1NE7A 3E05A 5K20A 1C7ZA 4ITUA 4RCYA 2BBWA 1JMYA 2J6BA 3OCJA 2HPVA 2FSUA 3FR7A 4FX5A 3P4XA 1D6JA 1Z0ZA 2C7BA 4F9GA 1JT2A 4LHSA 2FA9A 5YASA 5BWBA 1E3TA 3NATA 4EMBA 1OH5A 1FDIA 1QR6A 2V4MA 4L9WA 3DFZA 1T36B 2ZUUA 3H5NA 4V0NA 2Q6VA 2A9RA 3SAJA 4DJFC 3T9BA 3AZOA 2BUAA 3RRJA 2ZJYA 3SZOA 2RG1A 3JR7A 3LX5A 4IJUA 4EPRA 3DMRA 5JIBA 1ZR4A 3N05A 3O4HA 3C3PA 4OHRA 3DTVB 5EWJB 3DJFA 3PUKA 4C4SA 2GJSA 3E61A 5CG1A 2RAFA 2YC4C 2QE6A 3ZCUA 4LSWA 4X6YA 3F4KA 4WCVA 4G2TA 3M2TA 1U5CA 1Z4QA 1Q7CA 3SC2A 1TX4B 2LV8A 2D1QA 3BXFA 4J7AA 5K8TA 3AVXA 4PN7A 2EZ9A 5M5BA 3BCUA 2C42A 1SA0A 3WGKA 2UXBB 1FDRA 2DFVA 3HCDA 2IZ6A 4DMFA 1WY7A 3K09A 3W5CA 1KFEB 3ILXA 5IMSA 4MJ3A 3TGPA 2GPSA 4PAMA 4QU8A 2FX2A 2I54A 2P9CA 4LFCB 3WK5A 4B3GA 3EC7A 4C43A 1NPYA 3WWDA 3GP5A 1ZAKA 2IYAA 3M5WA 1Q1ZA 4BU0A 3BRWD 5BSKA 1VSBA 3S5JA 3V7FA 4TRMA 3R6DA 2H1CA 1KJ9A 2Q4EA 2QZSA 2YHAA 5DYTA 4O3MA 4DRXB 2H5LA 3DLIA 1GAEO 2RC5A 4INPA 4FD3A 1H65A 2PX5A 2AJBA 2WOOA 4MA5A 4RO0A 3T7KA 2PG3A 3EG5A 4ZQCB 3P1JA 2X6RA 1PDOA 3T1VA 5KNDA 4IDPA 1YFLA 1D4FA 3NRBA 3DO8A 2NMVA 2PSEA 4DDVA 3OZRA 1BNCA 3JQFA 4N03A 3F0TA 5E8JA 5IMBA 3VOBA 1JFFB 2AIRA 3GGCA 4QGGA 4ZT3A 5K2MA 4I50F 3BXOA 3ASZA 3BEDA 3VO9A 4EITA 4TLBA 2HXSA 2J8ZA 2YV5A 3AFHA 5JCOA 2WMOB 1HURA 1E2KA 2KSQA 3KLPX 4AJ9A 1XRRA 2FRDA 5LLTA 3C6MA 9GPBA 3GRCA 3PXXA 1HI9A 5FHRA 3EZFA 3IAAA 4JB2A 1YJ5A 3UF0A 3CNHA 2H7XA 4BZQA 2NUPA 2I1LA 4I55B 4AJLA 4D8YA 2AUTA 4MTLA 4X97A 2K6GA 7REQA 3GG9A 3RU7A 4OM8A 3S7TA 2JIMA 1EM8A 2QTRA 3FPHA 4WW0A 4IMIB 4K6FA 4KQFA 3V6MA 2QTGA 2F1IA 1TT7A 4R4JA 3RAPR 4ENTA 2PAAA 3ELDA 3HL0A 2EC5A 1WEKA 4GOXA 5C81A 1ZAYA 1NJ8A 1U1IA 4TL9A 2VYND 4XEUA 4MYRA 3RSSA 3TZHA 1KMHB 2O6HA 4HYEA 2J3JA 1E5DA 5K9ZA 1K27A 5H9WA 1PG2A 3DYVA 1KJZA 4PWZA 1PJLA 1E99A 4FHFA 3ZZNA 3RF7A 1GR0A 3L1UA 3TK1A 1AC5A 2ST1A 1Y89A 2ETXA 4FYJA 3DSRA 2ZE5A 2AN4A 2ZRAA 3F4LA 3WIDA 1AKQA 3I4LA 1IN6A 5WRFA 2MSKA 4ENPA 1HG1A 3HS3A 2RFLA 3DTTA 1J0AA 2Y71A 4AO7A 4E2WA 5A5DA 4Q4LA 4Z9YA 3UAYA 1W8DA 2WEKA 5K0TA 2ZETA 1OJLA 4ZGBA 1M2OA 5KYKA 1KAQA 1UKZA 4IJMA 2Z8ZA 5CT4A 2ZJ1A 3LCUA 4U8HA 4O8ZA 1R9JA 1JQ5A 1J6UA 4IQ0A 1NI4A 4RNCA 2HA0A 4RPIA 3DC2A 1LQTA 3HB0A 4KX3A 3GLFA 3W2HA 3I39X 3AHFA 1H2WA 4Z2YA 1NW9B 3WL8A 2BDTA 3D7SA 4BCDA 1Y6GA 4RHYA 3CRW1 3GVPA 3TE6A 1RWNA 1RAIA 3U0BA 4UHJA 3U39A 3DF7A 3DAYA 4X3CA 4XB2A 5HRAA 4U02A 4MWTA 1HQKA 4KQEA 1RRVA 3GEIA 4L6IA 5D5PA 3MT9A 2G08A 2GX6A 3OA2A 1JILA 3TBHA 4UTPA 2KYRA 1D2HA 1I6WA 2DY0A 1CIPA 3KT3A 3O93A 3OF2A 4MQBA 1B8VA 1W0JD 3UHAA 3WTBA 5IXJA 1ZWKA 2G4CA 3JVUA 4NZ9A 3EEFA 2BGTA 1VG9B 3G2JA 2CN1A 3QKSB 4IVPA 5K0GA 4Z0PA 4BO5A 1GU1A 1P2TA 3CRQA 1DE0A 1RI1A 5HKLA 4C1BA 3EY4A 4XW2A 3W4JA 4QLOA 3GLQA 2ZBVA 3MA0A 1SKBA 1U63A 5BPHA 2FEAA 1IHXA 4NS4A 3ON5A 4FBLA 2N3ZA 2QJFA 4GW3A 4TXNA 2VTDA 5CD1A 3HGQA 1DQYA 2R66A 2FR0A 3LFTA 3W1EA 2OGSA 3N75A 4OJTA 4PZUA 2C5BA 4MGYR 3MJTA 2YMLA 1ZYUA 2JA2A 4LJ8A 3R7DA 3DD5A 4LGCA 3OI7A 5ELMA 1NOKA 2D2FA 4B84A 1D2NA 3AIKA 5CD9A 1XVTA 5D1NA 3CPEA 3UFXA 1UKVY 2HQRA 1L4NA 5HGXA 4N18A 4BB0A 1T6BY 2ORYA 4X60A 1MB9A 1RSZA 1AHPA 4BGIA 1L1QA 1I3MA 5KTOA 1VSVA 3LHFA 5I6DA 1BVRA 5FO0A 3U80A 5J59A 1T3LA 4P33A 1M34E 3AVWA 3LUKA 2Q50A 2VBCA 2WI8A 2XQKA 3K8OE 4XDGA 3DAGA 1NMQA 3K20A 1U2DC 4PANA 1JJ7A 3GEDA 5AW5A 2OO5C 2YH2A 3EXEA 4GS5A 4EKYA 3TO5A 3QE3A 1QG2A 3PPWA 2QL5A 3A2LA 4IJVA 2WD7A 1MO6A 4F6LA 3L6RA 1P2FA 4ZOBA 4BNLA 4NBTA 1FOEB 2HLDA 4GC9A 4HX5A 1VMIA 2H85A 2YDYA 1L3CA 2CNOA 3CZ5A 3DULA 5IHXA 4AKGA 3EGCA 1Y80A 3N3AC 1JNXX 2HLPA 4TVBA 1T8PA 3VU9B 4LEIA 1ICEA 2BFMA 5DN6A 2ZYDA 3ZCPA 3I09A 1XF9A 3RC2A 3NTUA 2VNHA 1PJRA 5A4DA 1VCMA 4UM5A 4QGAA 1KZ7B 4ER5A 1NONA 5DX1A 1O6GA 4DQLA 2C3UA 1CRLA 3DA8A 1H2ZA 2EOAA 1GQQA 2KQUA 3QA3E 2P6RA 1RPZA 2XSZD 1WUTA 3JWJA 3W5DA 2XJ9A 1U0GA 1IRXA 5JH7F 4PS0A 1AQ6A 4B8ZA 3QH4A 1H1LB 1H1TA 3BH6A 4TL6A 5CDFE 2Z5GA 5DZSA 3RF6A 3TBFA 1I2MA 5EUCA 3WL7A 2CNBA 3N8HA 4N49A 2I03A 2HW8A 4FVTA 4EA9A 4M22A 4NMXB 4P4TA 3ZU6A 2OFXA 2G1KA 1RNLA 4QUAA 5CH8A 5FFFA 4IICA 4FFBB 4DQVA 4UC0A 4NH4A 4EG8A 1U28C 3CLHA 2AEFA 4K87A 4LRSB 4FT2A 5H83A 5JMTA 2EZUA 5CDFA 1D6NA 4E5MA 5KX5F 1RYNA 4AJIA 2PUTA 2J31A 5L40A 3T3EA 4KG7A 1EFPA 5FBHA 4QZVA 3KTAB 2ZWOA 2Z8YM 3SS7X 3TW8B 2PZGA 3W2FA 2AS0A 4G63A 3SDBA 2B37A 3VU0A 5KZMB 2G25A 2HJRA 1NJGA 4H9GA 5JWRA 5EGNA 3CPHA 3NHMA 5K4GA 1U3CA 2QVZX 1YQQA 3G7UA 1NDHA 4PPGA 3LM8A 5B5SA 1HDXA 1KS9A 1P1BA 2RKOA 5DHQA 4BKRA 1MMFB 3GF4A 2R68A 1ZUIA 3NHFA 3ANLA 4AICA 3MJHA 3OFSA 1KS2A 5I3ZA 4AKSA 4QQNA 1QUEA 3C3DA 1CF4A 2NM0A 3B1KA 1JE1A 3OEWA 4M53A 1HZJA 1M5UA 4BCCA 1U3GA 3ZNPA 1UMBB 1UP7A 5D85A 1HQCA 3W5JA 1SVOA 4JLUA 1SJ9A 2B8EA 5CNIA 1MA0A 3D1LA 3QWHA 3WYCA 4ZVOA 4E0BA 3OWXA 5IANA 3H8VA 5EJEA 2BHNA 2Y0PA 3H0EA 3UCFA 5BR4A 1SUPA 3PRJA 1D6SA 5C32A 3TLCA 4G9EA 4CGYA 5FTJA 4OUDA 1ZNWA 2D6FA 1NL3A 2WP8J 1RXVA 2PRYA 4PO1A 1U6IA 4HB2A 2QRVA 2D0DA 3FSJX 1V96A 4J6EA 4QEKA 5JFOA 4MHTA 1DWPA 3O4JA 1UOEA 3TXYA 3EAFA 5FA8A 2O1XA 2XMGA 1GFWA 1POWA 1QQ6A 3HUFA 4V0RA 1RJ9A 2HIAA 1JKJB 4D4KA 2JG3A 4YIKA 3WADA 4R7ZA 3GNQA 1MF7A 4C4RA 1A9YA 3OETA 4G01B 5AI4A 1U2GA 2Y2VA 3NJ4A 5BURA 3AEUB 1OA1A 3FVWA 1AK2A 1AUOA 1SUFA 1Z25A 3JWPA 4KQXA 1MB3A 4RV5A 3URMA 4LNUA 2PHZA 1F0PA 2AK2A 1ADGA 3DZIA 3IAXA 1C7RA 1MXHA 4ALLA 2IT1A 2PWZA 1OIWA 1Y6ZA 2XECA 2QE7A 1DG1G 3BD8A 1MQ8B 3KKLA 1JHUA 3FX2A 4RF5A 2GILA 2Y0EA 4X6LA 5G02A 4CXMA 2QEQA 1XRSB 2IP2A 5AXBA 1YF3A 2MMGA 2ZYVX 4AF7A 3NVKI 1MGPA 2JGRA 1UDXA 3MD0A 5F5NA 4WKNA 1OWNA 1YT5A 1Q16A 4ASUA 3DEIA 4M1YA 4NFYA 4EY8A 1XRNA 2BFPA 1Y4ZA 4C0AC 4JXKA 2HXYA 3TPCA 1CS0B 5J1SB 3HHPA 1CERA 4PO8A 4RK6A 3TIGA 3TXAA 1GKUB 2P2DA 2REQB 2CJYA 1B1AA 2ZSKA 4PG4A 2JD0A 3JTEA 3Q0TA 3MHTA 5LZ9A 3C3MA 2OGWA 1V3QE 2WTBA 3AR9A 1ZU4A 2RBKA 4DXHA 3PE3A 2EG9A 2I7DA 4BL5A 4G81A 4ZO9A 3WLJA 3ADBA 3ZWMA 2WSIA 2QAJA 4QBIA 4K5QA 4NE2A 3AGQA 1Z5WA 5FV4A 4L78A 4EYGA 1N8NA 4ZD6A 1NXSA 1IWOA 2B0CA 2H08A 4WN3A 4TKVB 2W90A 2ZRFA 1B8PA 1L4MA 3FCUB 4K6CA 1BW9B 4YNBA 1P2DA 3BWBA 3ERCA 2BHRA 1UPXA 4WV3A 4CM6A 4QUGA 3Q8MA 3EODA 1I6LA 5EIWA 1PYGA 3HBJA 5AQ1A 4KQMA 2OLEA 4Q7QA 1DNPA 1U31A 2PL5A 4E7PA 4D96A 2NUAB 1CHDA 1OXBB 1USKA 3PR3A 1JFSA 3U7EB 3ZHSA 3LZDA 1NJ5A 1BHQ1 1SCAA 3SR4A 3C8HA 1YB6A 1V25A 3MSXA 3OT1A 1JIXA 1SEPA 2BFWA 5ICEA 2R8OA 1U94A 2GFIA 4HEA6 1WJGA 4XIIA 3ZWNA 2BFAA 1WUJS 2EEPA 2VWPA 4FYIA 3P2IA 4HVAA 1XZAA 3FMVA 4GL2A 1XXHB 4GFDA 2W43A 2F1JA 2E7ZA 1P5HA 2PSFA 4RH3A 3OFVA 5IAGA 3JWEA 1JRLA 1PJ2A 5ERYA 4AIIA 4RKEA 4ECAA 3LTNC 1E18A 3OZGA 5H1YA 2R6HA 1L7XA 2YIDA 2FXIA 1QLHA 1WEHA 3U4CA 1WO8A 1YGPA 1TI7A 1TVCA 1ZI6A 3VJKA 1NZDA 2EF0A 3DE0X 3OCXA 4LUCA 3RFTA 4DLSA 2OKCA 3EUWA 3KEOA 4OSEA 4ZTUB 3NEAA 3K1ZA 4WNYA 1XPJA 1ZS9A 3ZXSA 3BDAA 2FFBA 3EQZA 3CU5A 4ZIRA 1GU7A 3FWNA 1AB5A 5BXQC 4OMFG 3HEBA 3UMMA 2C9CA 1IBKB 3R76A 4NCBA 1MTOA 3OX4A 5D6NA 4L74A 3Q0EA 4XVUA 1NNSA 1T35A 1JHVA 2JNWA 3G6KA 3PDUA 2BFDA 1ISRA 1TEVA 3O95A 1XK6A 2EWMA 1XKTA 1E3WA 1TB4A 1IJKA 3F8TA 4GPEA 2WVJA 5IC4A 4QPPA 4LF7B 4G1CA 1LK0A 4F3YA 4XIYA 4M1SA 3K9BA 3I1YA 3QJYA 4RWZA 5TQVA 3OF3A 2RSLA 4DPKA 5BYKA 5LOVB 4CFYA 1T0PA 3N2YA 3PR2B 1GPYA 1I3NA 1LB1B 2B4AA 2GWRA 4E2YA 2EFYA 1H23A 3EMKA 3BD6A 1QGUA 2ZTVA 1ZXXA 5FPYA 1T29A 1BD4A 2QNBA 2XI4A 1VJ0A 4BFTA 1SZDA 1E59A 3GP3A 4XGRA 1RM5A 1XU9A 5A7FA 3VV3A 4H6XA 3EHDA 1VKOA 1Z75A 5JLAA 4BNIA 4C7XA 4I9UA 4PX5A 1QHXA 4TWIA 3Q7SA 2BC9A 3UWPA 1WXEA 1DKUA 3ER8A 2ZUEA 1HZZA 3OOWA 2YNMC 2OA0A 3RYCA 3RNOA 1UBFA 2HIMA 2OBFA 3RBAA 2MMCA 3PFNA 1RXSA 2PSSA 2ZRDA 2XWPA 3O90A 3R7FA 5JCZA 4AP5A 3FDFA 4C14A 4CUKA 3GLIB 4C01A 1EH5A 1FQOA 3U4QB 3GX1A 1T8SA 4ZMRA 3X2SA 3FYCA 2NQ8A 2OSBA 2RGGA 2RJ3A 2VHUA 2PK3A 3E18A 3L79A 4Y1RB 3S44A 2BR4A 2FQWA 3U56A 4FMCF 4UDYX 2ZXEA 1ZKDA 1WMBA 3AF2A 3FPSA 4ESOA 3HXPA 3FMFA 4WSOA 3OZEA 2I8LA 1A9TA 2HO4A 3PDIB 5HJEA 1PWZA 3IQDB 4KNWA 3B7PA 1G6OA 1CZLA 2GYYA 4U00A 2FZ5A 1N3IA 1CF2O 4JHXA 3L1JA 4NE9A 1P5FA 1PJ4A 1QHGA 2CJFA 2VSNA 5JS6A 4RE5A 4IYRA 1K8YB 1ZRHA 3SG0A 4BNUA 4NEHB 3SF8A 5HOEA 2OK7A 4AMUA 4MRRA 5HTKA 4BRZA 1FQJA 4ME6A 1RMTA 1Y81A 2GVNA 4N54A 3TRJA 4CQMA 5KNCD 4NU8X 1KEZA 1US8A 721PA 4PYRA 4EJ2A 3M4ZA 1SKMA 2WR8A 2QP4A 4FBGA 1UZUA 5IUKC 4F5YA 3EFEA 1UJNA 1NBOA 4UHBA 1MPXA 4Y1EA 4X45A 2XYHA 5BWLA 4GRIA 1RJEA 1EP2B 3IP9A 4IMPA 3GR6A 3HE3A 3FRHA 4JJIA 1GPWB 4CYMA 3DTVD 1UF9A 4DMLA 4ZV7A 2AC2A 3GJRA 1GHTA 4PCAA 2RK6A 3ZHVA 2Y9MB 1DKPA 1OBOA 1L4BA 3I32A 4KQKA 5EZQA 1G18A 2IU6A 3ZUPA 5P8WA 1IPHA 5K8UA 1NXPA 3DBRB 1SBNE 2HTFA 4Z7JA 2OZKA 5ECYA 2MSLA 5C0OE 2YJ6A 2GXSA 3L93A 4UHEA 4RZXA 4F7DA 4KR7A 3F6RA 5HPYB 2PGNA 3PYXA 4I14A 4RJIA 2PH7A 3DGEC 1BCRA 1XROA 4R8SA 5JSHA 1JA1A 5KYGA 1W5AA 3E5HA 3VNRA 3GJ7A 3JD2A 3ZTWA 4GBED 1K3FA 1P0CA 4YLGA 4RQUA 4ZI7F 4QEDA 1FZTA 5HKKD 5EWMA 1KK1A 3DOCA 3KSBC 1ADYA 4KP7A 1GFIA 2XDQA 5C5CA 4QTXA 1ZJ5A 2BGKA 2WFLB 3E9QA 4P0PB 4Y2RA 4CEHB 3OPVA 3F6BX 2VAXA 2GBLA 5CJJA 1XTVA 5H8WA 4Y6SA 3QXCA 3HKBB 3UJBA 1FMTA 2RHTA 4A1OA 3K0AB 1ONPA 4AU1A 4EELA 3WQBA 3WKAA 3WLSA 4OHOA 4DNFA 1ZK3A 3S8MA 3E9ZA 1NW3A 3K4HA 4MVYA 2X15A 2Y1GA 2W2KB 2DHCA 1R4ZA 2FAXA 5TVGA 2A7XA 3WMRA 2R8XA 4JOQA 2DWCA 4B3BA 1PWHA 4PLYA 1IY2A 3L4SO 1RFLA 4D02A 2FU5C 1M0SA 1PR0A 1XTZA 1UEJA 5J40A 3N7AA 4KU4A 4MHOA 4ZCTA 5BN5A 4HATA 5COAA 1AGYA 3FW1A 1CY7A 3FE2A 1XNJA 4AUEA 3OVMA 2N1BA 1XD9A 1TECE 2PYIA 4GLOA 3VDMA 4EKIA 2AOVA 2IBSA 4MA4A 3WJ2A 4KVFA 1D04A 4DCCA 4ZI3A 4OU4A 3VNVA 2NZXA 5AJYA 4EFLA 1NVVR 1HORA 3DR5A 1DIOB 1K0UA 2MR5A 3ZVRA 5L95A 4ALNA 3IAS1 3OCCA 3RLIA 4KR2A 1DGQA 1L9KA 4KDEA 2A0UA 3UT5A 3G0GA 4FR0A 2Y1KA 3KQWA 4EYQA 1NKVA 3I9V6 3PPIA 4X94A 2H07A 1YZ3A 3R0JA 5GVSA 5FI5A 4DCMA 2C5FA 1S02A 2HDHA 3QKIA 1ZOLA 2PL9A 3EVDA 4MUYA 4BNNA 3S27A 4Q4CA 2G5PA 3S28A 3UT0A 3G8DA 4GR5A 3EQ7A 3WLNA 5IAAA 1KKUA 4UTXA 1QGAA 1LXCA 1W1WA 3VQTA 4RUKA 1HDGO 3T4XA 2ZVJA 3GD5A 5CFQA 1HRKA 3QFCA 4GLFA 4I1OA 3KQTA 3QNWA 4EB8A 4FYXA 2M2IA 2WDZA 2I2WA 2CVOA 4FDTA 3F9RA 3IVMA 3SJAA 3QMMA 3Q5DA 3BGVA 4UXIA 1AHHA 2PRJA 4EAAA 5B64A 3PWSA 1PK7A 4BP3A 2VATA 1XJ5A 4J2TA 4M88A 2ROQA 3SWWA 4Q1EA 3AEYA 2R48A 3ZE8A 3ZJ4A 4COOA 4PHGA 4YDSA 1G21B 2OYRA 3EPJA 3HXOA 4LJRA 2R7MA 2PJDA 1O03A 1II8B 4NFHA 4ERXA 2VK2A 4OBBA 2JGFA 1SCBA 4Q7EA 2C84A 4NDAA 4V2UA 4LJLA 3BA6A 3VYTB 4OGFA 3WLMA 3VOSA 4JYCA 3DC7A 1LJ8A 4RK5A 4L8GA 3U17A 3U48A 4QVGA 1ZCBA 2R1VB 2YJ3A 2IY9A 3E2MA 3K0KA 4B85A 3UATA 3LCRA 2HF8A 1B8UA 2CHEA 4U2KA 2BZGA 3K6JA 4MDYA 2JAQA 2B20A 3ENQA 1WZ2A 4PZEA 3KCQA 2BFBA 2JARA 3B1XA 2B7BA 3DPSA 4GZ6A 4AZSA 4B2YA 3TTXA 4F3NA 2Q9BA 4XH9B 2ZI6A 4L4YA 1A4XA 3LCMA 1E6EA 4DQ0A 4YAGA 2HEGA 2IA5A 2ZB2A 3V46A 2IEAA 2ZM5A 2R1TB 3JWHA 1O0SA 2ZSUA 2A9PA 3CSUA 1SG9A 3LUCA 3QXHA 1N0VC 4RQBA 1TF5A 3W9YA 2BMFA 4NCXA 3CVYA 1QIIA 1Y5NA 2AG1A 4N9WA 5C18A 3AP2A 5LYJA 3AJ9A 4G3XA 2CJXA 5HUQA 1LV7A 1XZHA 3REFA 5CLIA 5JV5A 3HDQA 2DAPA 4ZXFA 2LPMA 4CU2A 4CMHA 3R4VA 3NNNA 2LVBA 4DCGA 3QJ5A 4ISCA 1SD5A 3HJRA 3PXCX 2X5OA 3FTCA 4MS1B 5JHGB 3JQGA 3LX6A 3UJAA 2B3DA 4D99A 2JI6A 2WA2A 3E3LA 3ZK8A 1EHYA 2GZRA 3ZVLA 3OU2A 4OK6A 4CKBA 3UK1A 1TZCA 1JJFA 4ZZ2A 3V7YA 4B9AA 3ABIA 5A4KA 1MKYA 5ECWA 1IFXA 1UPFA 5TQ2B 2WU4A 2FSFA 1B8OA 1AKYA 2YFKA 5CTJA 3IUBA 4G4JA 1E66A 3C5CA 4HZGA 3DXYA 5H02A 3X1WA 2F8SA 5GIPE 2IS4A 1ENZA 4UEWA 2IHTA 1TQHA 10MHA 1Z74A 2YV3A 3AY0A 4IV5A 2XBLA 4WK0B 2XCQA 2PUBA 1WXWA 4BJ3A 2IX9A 2VCYA 3FDJA 3GB9A 1QO0D 1X2BA 2DY1A 3VTZA 4XR4A 3SZ3A 3GNSA 4CTOA 5TIIA 3EXFA 3NOVA 4TRJA 1D2AA 4RKRA 1XQYA 3ELWA 5ALPA 3QUCA 1EI9A 4WNIA 4MS4A 4HZUA 5HK8A 4OJMX 5CFPA 3ZV3A 1HT2E 1R00A 1DAMA 1KDPA 3FROA 4XTCS 4CIAA 5GV8A 5L3QA 4W7SA 4RPLA 2F6RA 2ODWA 3DVAB 3I0NA 4BE9A 5AW4A 1YOBA 1DV2A 1H0HA 1R4MA 1P9LA 2WC1A 5CVJA 3WSTA 3MBIA 4PZYA 5JASA 3KCNA 2D8AA 1CIVA 1DEOA 2ARKA 2PKQP 3JYPA 3SXUB 1ZEMA 4IGEA 4ILEA 2P75A 4BXOB 3P9KA 3MILA 2G7MC 4UAVA 1KQ3A 4ML3A 3CSSA 4HQLA 1ZJWA 1F7UA 4NI5A 3WGLA 3M7IA 4WLVA 3IQHX 4QPJC 1EB8A 5B3JA 4KYIB 5BYBA 3FAZA 5IJXA 4OQDA 3LLSA 1TO2E 2Q4DA 4ZCIA 1CEYA 5SZIA 4OF4A 2IHUA 3LPLA 4JOSA 1I4LD 1X74A 3BH0A 3R3VA 4WZ6A 2BTQA 1JS1X 1M2KA 1MG5A 1OBFO 2ZJ0A 3FSRA 4BMCA 3JRNA 1MP0A 4FFDA 3ZJVA 5JVDF 3GEEA 1EUZA 4GR4A 1DHRA 3U7GA 1A7UA 2AJCA 1FU8A 3I2GA 3A4YA 4FE3A 5EIHA 5G40A 3K4QA 5IF9A 2WQZA 1UWVA 3GEPA 5EZSA 2O8CB 1Y1TA 2GN8A 1JPUA 1KMNA 4RVNA 1G5HA 5E3HA 1CVLA 4L1KA 3K71B 1K2WA 1E5LA 1L5NA 5BY2A 3RODA 1RVV1 4Q02A 3WDLA 2WG0A 2D2EA 1F60A 2EJCA 2ZIXB 5FYQA 4F60A 1NNEA 2PUEA 3MWDB 4GRDA 4MW0A 3FTQA 4RD4A 5EHIA 3KDPA 4D5EA 2CJWA 1RPAA 1SELA 1TJPB 4LOJA 2YNMD 3SFTA 3EPRA 3HXQA 4G0QA 4AG6A 2PVSA 4A5OA 2RCNA 1KRWA 4RVOA 1SR8A 3RQIA 3NM5A 3ZI7A 4ZHQF 1ULZA 2X41A 4DRZA 4GX2A 5AM5A 4XWOA 4KPUB 4M0PA 3WMEA 2O4CA 3AC0A 4WXHA 4I5EA 4CUZA 1I9GA 2WYVA 4Q37A 5I9MA 1DELA 4YAJA 1EK5A 3WRYA 4F3TA 5MDHA 3PC8C 4NV1A 1M0TA 4TTJA 3CVJA 1ODLA 4LI0A 4BV9A 3PVCA 4L4SA 2IGTA 4K81B 1A72A 3BMCB 3USES 4E1BA 3PC7A 1C8LA 2ONKA 1GXSB 3HR4A 1E64A 1Z4JA 2NZJA 2Y4OA 1VECA 2FNAA 3CKLA 3EG9A 3IO5A 4MUFA 1IXKA 2H0RA 2BGIA 4F6RA 2ACKA 4IVRA 2MIIA 5AW0A 3I6YA 4E03A 4G5FA 3DXFA 4G0MA 5G4KA 5IBRA 2IVFA 4J07A 1E94E 1Q1QA 2J59A 2G3YA 3FNRA 2WTUA 2II6A 4AY5A 3CF4A 4Q16A 2AMFA 2WAMA 1JG3A 1XTTA 2CLFB 3HSYA 3WWCA 3DDNA 1CX9B 1JR3A 3SIRA 3UPUA 4B3SB 2RMKA 2DULA 4C7VA 1FFSA 4HBZA 2YY7A 4JJ8A 3CLKA 2V97A 4MV9A 4XLTA 4IHQA 1RXWA 4QULA 5AKGA 2ADOA 1VGVA 2QM8A 2WHPA 2QP3A 3C7CB 3HWX1 3ZGZA 4BJ1A 3CUUA 2VJQA 4IIBA 3AFNA 4F86A 1T25A 2RGDA 3G9XA 1J8MF 2YYAA 4P31A 3JQAA 1GAXA 4N76A 1VG1A 5FORA 2GF9A 3UAOA 3V8NA 3V8BA 2ZRMA 3KYDA 3EY9A 4HNAA 4RTPA 1E2MA 3PXEA 4XJVA 1E9DA 4D0NA 3A4IA 4XFDA 1Z7GA 1M6VA 1W1UA 5I8PA 1GPH1 4E5DA 2YFYA 3NDRA 5CT6A 1GP2A 2ZTSA 1TEHA 3GQVA 3ZWBA 4WQMA 2WYOA 5THXA 3UWMA 3SGLA 4BNKA 1QOZA 1SBTA 1SKQA 2GARA 1XQ1A 2O8VA 3F3MA 1CJBA 3UQZA 4FGSA 3LGXA 3NLLA 2PTHA 4Q4HB 5E3JA 3WGYA 5JBIA 1NI5A 2H48A 3MGGA 1HYHA 4ZFNA 3C7KA 3I5AA 2WYWA 1P8AA 1HTWA 3V2IA 1FNNA 2H0AA 3TNDA 2JLVA 1L4YA 2BTOA 2DFPA 2C9ZA 4LBYA 3CR7A 3ZLVA 3NHAA 1A9RA 3WRXC 3H8SA 4ZOEA 1Z82A 5FAKA 3IUMA 2WWXA 5HCUA 1QH1B 3I58A 5A06A 5JSYA 3WGTA 1FTQA 5AO9A 3J7AC 5L3SA 3L9WA 1QBKC 2VS1A 4ZWNA 2FK8A 3GA0A 2FW7A 3LW7A 3RSLA 4EPVA 2AV6A 2AOXA 1FVOA 3F98A 2R751 4WESB 5DP1A 1FL9A 1G3UA 1E7SA 2BFEB 3MT0A 5KNBH 5DDIP 4EFNA 1YHZA 3R0XA 1F3OA 3TZ6A 1YDGA 2KS6A 5EJMA 3UMVA 1XNGA 4JY7A 4DCUA 4HL6A 5KQSA 4XWGA 4CV3A 4ARIA 1NBEA 1UXHA 2X7HA 4W7IA 4CKYA 4D3XA 4DR2B 4WLFA 5I9SA 3PQ4A 3LXXA 3Q7IA 3TUZC 1C9NA 3Q2KA 4LHXA 4CT4B 2A8YA 4DJAA 3CNQS 1AF4A 3RUHA 4NU0A 2HMUA 4DMCA 4V1CB 1IOLA 2GZ2A 2VDJA 1E1RA 1RZRD 1JIVA 2PZFA 4C0WA 5C8VA 1XEXA 1D0IA 5KTYA 3F5SA 4KWTA 2W2MA 2COEA 2FI1A 5D5QA 2XOKA 1KDRA 1ZK4A 3W6ZA 4RBNA 1BEEA 5BR1A 4JT2A 2Q7DA 3MMSA 2Q07A 2IU3A 1JNYA 2C83A 3ZWCA 4ZVRA 3H1GA 1HBJA 4Z6KA 2VJYA 3W5IA 3MTDA 4RTQA 3D59A 3FFWA 3AM3A 3G2MA 4HGOA 1NATA 2JF0A 4HNSA 2I2FA 3TPFA 5ADVA 2HCBA 1JU9A 4HHEA 1TM4E 2EYUA 5CB4F 2AI3A 1BD3A 5CDGA 5EMNA 4HYQA 4ZVUA 2B83A 1YZKA 1ISFA 2DFDA 2H1IA 3AV3A 1HPLA 3W3ZB 5K0CA 1F2UB 1I4WA 1R6UA 3N59A 2RI6A 4LHVA 4X92A 4HPWA 3A8TA 2HRRA 2XUAA 2ZRIA 3D6TB 2ADMA 2NU6A 5D8DA 1UC8A 1VMKA 1K8ZB 3PU6A 4TMZA 4RCZA 4QSHA 4C0XA 3FHTA 4UUQA 2XUFA 3FTEA 1MJGA 4JSRA 5C37A 2DUUA 2E87A 2FZCA 5BQXA 3IT0A 1U1FA 3GFGA 5DBEX 3RSCA 2WHRA 4HVCA 2BKAA 3AHIA 3K9NA 3IILA 2CXQA 2J5RA 2Z6QA 2XGGA 4FFSA 4XFKA 3T9EA 5ESRA 3WWOA 2XGSA 5DISB 1PR2A 2E4AA 2I5PO 1RPTA 5F4ZA 1YMVA 4MUEA 5IM4A 1QHSA 2XLCA 4AFNA 4TYYA 5J2UB 1WXGA 4M1KA 2X9QA 1UQUA 2X5JO 2Q1WA 3KLOA 4Q6BA 4UU0A 4GSYA 5K45A 1ZR2A 2WB4A 2FFRA 4IJWA 4JDUA 3MSCA 4K26A 3PX7A 1U0JA 5IFKA 3C41J 2RGXA 3GDGA 1JECA 2ASEA 2C2YA 1T34A 4AZ3A 2F00A 4RA6B 4EMTA 1XNHA 4FM9A 1PGPA 2DUWA 2Z56A 4IWNA 4MV7A 3L01A 4BECA 1I7LA 5EAIA 2Y6VA 3MJSA 4UNNA 1SB9A 4PYQA 2B0JA 2YIVX 3KO8A 2XUQA 3L4BC 2QL9A 3IE0A 4JVNA 2JK1A 5THKA 2I78A 1I9CA 1XSEA 3I9NA 4B34A 2WFAA 4E21A 2O2IA 4BP1A 3L8MA 4DBVO 5DT9A 3EGEA 5ER6A 1FBNA 1QZ3A 3X1XA 2B1IA 1T0JB 2XUGA 4GGOA 4QT4A 4C6TA 1N5JA 2H92A 3LC0A 4CHTA 4CFSA 5DNAA 4MEBA 2YHIB 2NO4A 2O8FB 4I55F 4N5MA 2VEOA 4RTKA 1MQ9A 4MWZA 2AXQA 2EFEB 4YRTA 1WG8A 2XD9A 3PHCA 2R5FA 4N7RA 4HI0E 4PGMA 1JI0A 2NG1A 1WTCA 4FZ5A 5CVVA 1LFAA 2I66A 4IDQA 1N9KA 4EW3A 1DEKA 2AVDA 2OK8A 4H60A 2FPPB 4Q9KA 4E08A 1NW8A 2HRBA 2QL6A 4CW7A 1W5BA 3B2QA 2QTTA 3BXHA 3HFRA 5B30A 5I01A 4PEVA 1VJ1A 3D6AA 1ZJ6A 3QPCA 4KSCA 1C4WA 3IHWA 1G60A 4G0OA 3PFKA 2CYBA 3AI1A 2IC5A 2WSYB 1NUHA 1Z08A 1DDOA 3DBHA 3E15A 2P2ZA 4N40A 1N4AA 3SQLA 4AS3A 1KPIA 2GJ9A 4WERA 1DIAA 4Z4QA 3NYIA 3RYFB 3P9ZA 1KSGA 2O2ZA 3HDYA 3PYLA 2ID9A 2HDNB 4ZPJA 3IB6A 3PKZA 2I6QA 3R4CA 4EG7A 5ES4B 4F85A 1Y3BE 3F8SA 3NT4A 3LE8A 5D84A 2E48A 2QGFA 4KCGA 1KOGA 4BN5A 1B42A 2CFOA 1GT6A 1OTHA 3CVVA 4EF4A 3NBKA 3L84A 5C8XA 4RSMA 1YZFA 2VFAA 2ZI4A 4QNNA 1E1KA 1OGJA 3S2FA 3GDWA 4YRFA 4L6AA 1K9VF 1HKUA 2Y2UA 1N5IA 1X7GA 4YT5A 3D5TA 5IC6A 3EARA 4Q1VA 3N8NA 2ZK7A 4FYKA 2CGEA 3HRIA 4J0EA 3A7EA 2CW5A 2CHUA 3AIOA 3U37A 1ODJA 4ZEVA 3RKRA 2PE5A 3BE8A 3F7NA 5JSZB 4JZYA 3L7NA 1IZZA 2CXTA 4QYMA 5D7NA 1XMSA 3OCYA 3WGUA 4MR7B 2I71A 3KDAA 3SPXA 4LGMA 4AQYB 2YZGA 2FEMA 2NADA 4KGDA 3S1AA 1BDIA 1VM6A 3TEFA 1V9CA 3FFXA 5EJ2A 1BX1A 2ZDGA 2VDQB 1TGVA 1UOPA 2ZWIA 3OZSA 3HA3A 3ANXA 3GGPA 3PCXA 1WULS 3RBVA 2J46A 4QFMA 4RHFA 2C3MA 4FXPA 3UV6A 3VYSB 2BFOA 1WABA 2Q8NA 1B76A 2XUZA 3L0SA 5LCXA 5LQUA 3D8SA 1T5OA 1SXJA 2K7FA 4N5NA 1F8YA 4E32A 4XASA 1KTVA 2ZYIA 4FQ8A 2FQQA 1VP9A 5H59A 1YJQA 1WIWA 1UJ5A 5E6RB 4C88A 1NXWA 4Y6GB 3D0RA 1GZDA 1UJ6A 3QWBA 4JX9A 4IOLA 5KOJB 1J20A 3ODGA 2A0FA 5H68A 2NU7A 3MUEA 4XIGS 3D3JA 4JKYA 2C2MA 5FI0B 5HMLA 5ER9A 1QVWA 4HFNA 2PFSA 5J9FA 1C5KA 3QU2A 1ZH2A 2DCUA 2HMVA 1ZGHA 1ST3A 3FXAA 3H84A 4GM1A 4MRMA 3BL8A 1X8JA 3SQWA 1OLOA 2ZYGA 4HTFA 4FKZA 3ICPA 3URKA 4CIYA 2HRQA 3UMGA 2AH5A 1CTQA 1DC7A 1ZN8A 4YT4A 1WPRA 4H0FA 4GXRA 4I5FA 3ONWA 3PZBA 4K9LA 3BPSA 1A4UA 2IS2A 2NTEA 2Z95A 3QSYA 1XP8A 2XBMA 3DCYA 4R2LA 4FFRA 4BZPA 4C3OB 4D79A 1NZFA 2JAPA 1G63A 1SIWA 2JB9A 3RC9A 2JANA 4WFKA 3V8QA 5KPDA 5B7PA 4RORA 2DLCX 1GVNB 3PNPA 1ETHA 4BWFB 1SFRA 3QV2A 2H2WA 2XVMA 4JJEA 4K6MA 1KJQA 2CNNA 4FMDB 3P19A 1N7HA 2O1EA 3NHWA 4INOA 5AP9A 4B76A 1TAUA 5LXTB 3HBAA 4JBHA 4BJHB 2ZRGA 5EQFA 2PWYA 1NC3A 5LA6A 1WXDA 2BELA 1K8RA 2ETVA 1UWCA 3BWVA 3MRXA 4KO4S 5KYXA 4AX4A 1SA0B 3PDHA 4HUTA 3CWZA 5ENZA 4ZREA 3N2NA 3KE8A 1HXHA 4X8OA 5LQJA 1QP4A 3AVVA 4RDCA 4YTEA 3RUPA 1FDUA 1AKRA 2H6EA 3L4EA 3RVQA 3KHKA 2DWQA 1Z8HA 4HWGA 4FSDA 3KZ1E 3ZQ6A 1OKKA 1XFAA 2E1RA 3OTGA 4W5WA 1WLSA 4IUCS 3H5WA 3MCVA 2B30A 2FZVA 4FT4A 4F5EA 1HA3A 3R41A 1M9NA 3E4DA 4PRYA 4WNAA 5BP7A 4D7AA 1N7JA 2AC7A 2Q0QA 2ID4A 3F46A 1M2VB 3QITA 4OP1A 3B38A 1IBMB 4FB4A 4W7HA 3K9HA 4RESA 1MABA 5FUMA 1DHTA 5C3MA 3IA2A 3STVA 2JIZA 4OD0A 4PLTA 4XFJA 4JK3A 3UANA 5DMHA 3ZK9A 4JP3A 2XCRB 3AM1A 1DMSA 4II2A 7AT1A 3FOWA 4MJ7A 4QG3A 3I8SA 3AMVA 2C92A 2P6MA 4J1SA 2EKZA 1GILA 3LYLA 1PUXA 1NYQA 3P9QA 4G5HA 4JKIA 1EIZA 3W9BA 4CE6A 2NUPB 5HCIA 1MQSA 3BFJA 3BXPA 4Z0HO 1XDGA 1XVLA 3O3MB 1Q83A 5K0BA 2OUKA 1XZCA 2GAAA 1JEQA 3GL9A 4C6RA 7REQB 1F2DA 1GTRA 2F2TA 4R7TA 1EM8B 3SHVA 1H05A 1RLMA 2PA0A 3FPCA 1INLA 3EEOA 2HMSA 2PH1A 3EWSA 3FBTA 4M6WA 4NBLA 4Z9BA 3TLJA 3S5UA 1E63A 2IHNA 3FPGA 3EPHA 3IMFA 3N58A 1XTIA 5GAJA 3VR5D 5B3LA 1F9AA 4UTOA 1V7ZA 3U81A 1DAEA 4J03A 3VO2A 5AW8A 2IS6A 2GETA 4FFMA 2I7XA 5LN1A 2B6HA 5GJVC 4TZKA 4LMRA 4QREA 3VTKA 1R37A 3TRKA 2HU5A 4ZICA 1JDNA 1EK6A 1KYYA 2QYHA 2Q3FA 1WVMA 4EX6A 1LBTA 1VPDA 1FPQA 2Y92A 2BDUA 3OZ7A 1PCXA 1ISPA 2ZBGA 3G3EA 3MIIA 2FVXA 2J3LA 1MVLA 4B8YA 1DBRA 2COKA 3C3YA 3C70A 4HX9A 2Q1UA 1WU7A 4NCAA 3LAWA 1W5EA 3OMWA 5DTIA 2GKOA 4NZYA 4EMUA 4U7JA 3QVVA 3OKCA 1C9YA 3KOOA 4DDMA 4P58A 5KTMA 4UFOA 4CLRB 1AURA 3CSDA 2FWIA 3IIEA 5LZ5A 3DHVA 4AWBA 1YDFA 5FPKA 3OM0A 3AP1A 3EDQA 1U7TA 4UOQA 1Q0HA 1T9BA 5JMWA 4P4GA 3BX1A 5HF8A 4ZVSA 5GM2A 5H0IA 1UP4A 1CY8A 2ZW9A 4QU9A 3LQ1A 5KKNB 1HDYA 2DC1A 3KE9A 3V97A 4FMPA 4BLOA 2AMYA 2ID8A 3CN9A 1KNXA 4GEKA 4J0GA 4ITRC 3KJGA 1IULA 1CUAA 2WVAA 3L6UA 3ESAA 1WCIA 2Y1EA 1CZUA 1S3SA 5CB8A 4Y2QA 1E6LA 4WJZA 3ZH2A 2YXBA 3J80A 2XCTB 5ALHA 5L3RA 2AMVA 2ZAGA 4KBYA 2Q27A 1ZCZA 3FPBA 4PZPA 1DOZA 2GNOA 4RIEA 5DM70 3AB8A 4EK9A 1SHUX 1V4BA 2C4HA 3C43A 4AJPA 4OHUA 1P4HA 3NVDA 2ERXA 5AVKA 1Z6PA 4WZAA 4POOA 4MZXA 4DMRA 2BFNA 4YALA 4GMXA 1W9MA 1DLJA 2VYQA 3B1JA 1D5WA 3TKYA 2P5SA 4FW8A 5AI8A 5BWNA 1P9RA 4L9AA 1BN7A 1JPNA 1KSJA 3ETCA 4ARVA 4KWIA 1LW7A 1E4EB 3DP7A 4S35A 1NRJB 1C0EA 4MRAA 3VAYA 1Z34A 4AMVA 4B4UA 3GPBA 4PC6A 4RULA 3M6MD 3C4QA 1VHDA 1MJGM 4S1TA 4E5UA 4MW1A 1ORIA 2VHEA 3OAAA 5H4HA 1UJBA 3EFHA 3KB8A 1RQ2A 4MI6A 2HREA 4GE3A 3SMQA 2EJUA 3QX8A 3R7AA 1H3EA 3JPYA 3O83A 1GGVA 5I48A 5HRUA 3TNFA 1CY0A 3FGZA 4M9XA 2ECOA 3IQEA 2RH4A 1L5HA 3RG8A 4IQFA 2C4WA 4YS6A 1ZD5A 1F4LA 4DABA 3EXEB 4LTMA 4X1IA 2AOUB 1YAHA 1SOMA 3FKQA 4ZO8A 2WBLC 4JA0A 4RPCA 2V5VA 2W2LA 3AESA 3IPYA 2Q1XA 3LQQA 3RSFA 1TUEA 3RYTC 2A84A 1M34B 4Y7DA 1XFDA 4JMLA 5C5DA 3OCUA 4BX0A 3U7IA 3KSAC 1IJEA 4BNFA 4JVLA 4JN6B 1XOIA 1KC3A 3ENNA 3E22B 4EKDA 2XXAB 2R8YA 5G3ZA 4D43A 1FMFA 2FLWA 1N7IA 4EPTA 2X4GA 3L02A 2JI9A 5AWFC 4D9HA 2JK0A 2O2DA 4R0NA 5AHKA 1YL6A 4TSFA 5JEDA 4NESA 821PA 1UDAA 3NWOA 2YZMA 2X6QA 3H18A 2R11A 4RJTA 1PT8A 4XQEA 1T8WA 2WM8A 5KYWA 5DNUA 5JYBA 1CSEE 4Y9RA 2PQ0A 2G9RA 4L2IA 4EJ6A 3K09C 2P5UA 3TFQA 1MB2A 3CC8A 3CG0A 3BEOA 5A1TA 1ADCA 2X4DA 4HLQB 3QG1A 2JCYA 4IQ8A 4IVNA 3SDZA 1AUPA 1JYFA 4PFSA 5FWYB 3AKCA 5HJ7A 5D01A 2IYPA 2P2YA 3QW4B 2XQVA 1JFLA 4MRPA 4UUPA 5DX0A 5C4GB 1EZ4A 4OHYA 3GYBA 4OJYA 2QN7A 1WCV1 3F5FA 1OVMA 3LDGA 5KKAA 4ARUA 2XNHA 4B3IA 1IWBB 3WNCA 1Y6JA 3F8WA 1CY2A 3PHIA 4KBFA 4WEQA 2NZ2A 5CVEA 3PGMA 3MWKA 3ZV6A 4C9BA 2DFKB 2FE4A 1CJSA 2A92A 2AG6A 3MN1A 3GQBB 4FZJA 1CZKA 4NSNA 3TLXA 2WOJA 2VF7A 4L7VA 3L4JA 2ZCUA 4LOAA 1H69A 1XQVA 4CCAA 5BQ3A 3I28A 2ZU6A 3HCBA 1RTKA 4E33A 2C03A 4JL5A 4RM2A 1WUKS 1CNEA 2CF5A 5DIFA 4LRTB 1W0KD 1YIOA 4PLGA 4BLTA 4W9MC 1EFPB 1OXKB 4BKUA 1NMSA 1YR1A 1NT2A 1G6Q1 3L8FA 2H2IA 4HWTA 2FF7A 1CR1A 2FRDC 2Q3HA 1AV6A 4UD2A 1YB7A 4AZWA 1FFDA 2VHCA 3JAWA 4MVJI 4ZYWA 5J4VA 1DRVA 2Q62A 2RGNA 4H7FA 1J70A 2PT9A 1ZHOA 4NU5A 3T35A 1H2YA 1JXOA 3CB4A 4K9RA 2JD1A 2GFQA 3AQIA 1SD2A 3FZYA 2H4WA 3ZWXA 4BDTA 4BUJA 1FS6A 4M8NE 1QE0A 4BMDA 5CEEA 1BE0A 5EXXA 3L7MA 3WBJA 1PR9A 3SHFA 1XZJA 1CJCA 4MV0A 5HFNA 1J06A 1VMDA 1W581 3EQ6A 4Y3UA 3VDXA 4YRSA 5FJIA 1Z5NA 1G9TA 4L6CA 4BVKA 2ACVA 3GRYA 1Z4KA 5LR6A 1TM1E 2V7QD 4LYYA 5AKZA 5CJPA 5E1OA 4DDUA 3PNKA 3OY7A 4PNZA 3FPAA 4Q3OA 4Z9FA 2V7GA 3DV2A 3MS4A 4HEHA 2R47A 5EG5A 5C46F 5GONA 4P8RA 4I6GA 3O84A 1ENOA 3RTGA 1C80A 5LWQA 4LXQA 4AKHA 4ENWA 1ZGCA 3I05A 3DF9A 2QG9A 1L5GB 3OCZA 2QRVB 2Y9PB 3KLMX 4L22A 2FWPA 4EJMA 2XE6A 1Q3TA 4BO4A 3B13B 5FPSA 2B5VA 4OIMA 1Q1AA 1WHSA 2JGNA 4JP8A 2EKLA 5LZ7A 4AUMA 4KODA 3CGWA 5DLEA 4OXRA 4AUKA 4TLMB 3ORFA 1RJ9B 5DCWA 2V6FA 3LF2A 1BQ3A 1M8JA 3INYA 3I6IA 2HDOA 1SUDA 3F6PA 1BKSB 5FT9A 4ENQA 2C5AA 3EUFA 3JQ6A 4BVBA 1SIBE 3DV0B 4WCFC 4C5CA 4ZK6A 4LMPA 1W6RA 1Y1PA 1N6HA 1PGQA 4QUEA 5HZGA 3BREA 1U81A 2AFIE 3LDFA 5TMBA 2WK1A 3GEMA 4GX1A 3EEIA 3GJYA 5JSQA 4UBJA 4DS3A 1A9XB 6ABPA 4DR7B 3FOAA 1NA5A 1MJNA 1UOOA 4FZVA 3SSAA 4NTZA 2R25B 2QDKA 1LPOA 4FDMA 2DPXA 2ZSEA 4MPTA 4A9AA 4HUJA 1T15A 4MVJF 3D1JA 1PQ4A 2P8SA 2P9BA 1D8TA 4DL9A 2RHCA 3DCIA 3L8GA 3DOHA 3VZQA 1MG0A 1OR8A 1S4QA 2Z2JA 1A9SA 1NJ2A 3A2MA 4XUEA 2ZIVB 1C4OA 4WWHA 5AW3A 2HSWA 4C2AA 3CLSC 2CWDA 5LBTA 3HYNA 2GF2A 3RWMB 1UKBA 4RANA 1RC0A 1G2OA 3C48A 3TBKA 1AOXA 5E7JA 2A5JA 4PHTA 5TS2A 1QIKA 4TT3A 4U0KA 3AH8A 2ZT7A 1X2EA 4W5OA 3DEHA 3ICQB 1YONA 1KE1A 2PZJA 3U19A 5KU7A 3L04A 2WTMA 1EFTA 3GHYA 3PFFA 2CLEB 3FSGD 5CJ2A 3TINA 2DU8A 5BNWA 1O6ZA 2VJKA 2WIGA 3NIWA 1DWOA 4RZIA 1KYVA 3IUQA 4N8EA 2VP3A 3BL6A 3GLKA 2X77A 3G9UA 1ISGA 3R5FA 4D0GA 3BJZA 4LRQA 2Z8XA 1QF9A 2A59A 1MHTA 4Z7NB 5JOQA 3R7SA 3NPAA 3ZGOA 1JSCA 4LIPD 5AH0A 3IL2A 3B5JA 1BVHA 2O3UA 4YJHA 1GPAA 3FB4A 3LVFO 3OT1B 1J42A 2JJ2D 1CP2A 3C98A 3L46A 5JD3A 2YCBA 2MOKA 1Y98A 2WM9B 4RD0A 3GO4A 3KZOA 3LS2A 4GGMX 3L8CA 2FZWA 4O2BA 1XCMA 5K05A 2DUJA 1PFGA 4Y8VA 4JI3B 3SFVA 5LQCA 5H3HA 4Y0AA 3OUTA 2EF1A 4NARA 4OV6B 4P93A 3L0CA 3ED1A 5DCYA 5ESDA 1VLZA 3S6JA 1TF2A 1XLUA 1F0YA 2GAJA 2PKWA 4HNRA 4QDUA 4YJ2F 4AJKA 1YOVB 3U40A 3FKSA 3R1IA 1GG8A 3K30A 4YP9A 2PIAA 3OIUA 3WWEA 2FUCA 2WQ6A 4PYNA 3OQIA 2BRUA 4FCTA 2QD3A 3T5CA 1YUMA 2YWDA 2OZPA 5DBGA 1CULC 3VPDA 1VJDA 4RY9A 5CA0A 5JAOA 3NJ8A 5KTKA 3ZHZA 1ANKA 3M1IA 3BMQA 4ZIRB 1R4AA 4O2AA 1PZXA 3K2BA 2KX7A 2HU7A 2QLJA 5KOHB 3IKJA 3M34A 5DE3A 3ZU4A 1X1TA 2QPLA 1X1QA 2VC2B 3G2PA 3LX4A 3THWB 3I1IA 4B3TB 5FWXB 4B4WA 2BFDB 1K6MA 1SKYE 1CVRA 4EA6A 2XBUA 1E3WB 2J6HA 3KXPA 2Z2XA 3CEHA 3QY9A 1L5YA 2ZYUX 1O97D 1YASA 3PPVA 1H2AS 1OU0A 5B1EA 1CS4C 4N3CA 5KNCH 1QP0A 1UWKA 5LIPA 2RAPA 1F8XA 4YREA 1E0AA 3Q10A 1FIUA 4JS0A 2GMWA 1TTTA 3FGNA 1L0BA 2ZTUA 1GGNA 1U0HC 5TXGA 4Z49A 3JALB 2HFKA 2V7UA 4LF5B 3WWYA 4TTIA 5DU2A 5F9MA 3BAZA 2HJSA 3ELUA 3LCCA 1OAKA 2Y3IA 2QR5A 5H81A 1X8LA 2Y1LA 1J1IA 1Z7BA 2W2PA 1TE2A 4DBZA 1GLGA 5CCDA 2QLFA 1Q0UA 1LLFA 2VDLB 2JI4A 5CYOA 3KRTA 2BT4A 2XMDA 3RC3A 3T5TA 3T5MA 4EGAA 1WDKA 2ZIAA 2L0XA 3RYCB 1LWOA 5EA2A 2B1RA 4Q7KA 1E8DA 1MV5A 1FC0A 2YICA 3UMYA 4HAWA 3M33A 4X8LA 2GYVA 3UXEA 4EQZA 1RYZA 1JJIA 3NBQA 3T7DA 4CKWA 1VIMA 1V8PA 3ZWYA 4GKVA 4PVCA 3L7LA 1BZYA 4BEJA 3G79A 5EJFA 5CNMA 1H6AA 5LMNB 4KOAA 2BI4A 1T6XA 3BG5A 2BEWA 4US0R 1RBMA 1U8UA 4U1RA 4ZT4A 3L5OA 3TZKA 3OPXA 2JLWA 1JWAB 1N5OX 3KEFA 1DUVG 1G2IA 2N42A 1GIAA 3QW2A 3PXGA 3LVRE 5AJHA 4AC9A 5KDOA 1FNMA 3O7WA 2R6FA 2AW3A 4S0XA 4F4HA 4HWRA 1YCFA 2VJLA 3ESZA 1Q2XA 2V0CA 2CKMA 5JZBA 4KXQA 4DY6A 4TZ0A 2PMWB 4CKZA 4D82A 5LDDC 3IDFA 4GPIB 2DR0A 4W8OA 4IOKA 1K92A 1SC6A 5B4TA 2W6QA 1Z2NX 3RS5A 4XWTA 1E2EA 2FB9A 2CXRA 2WTNA 3A3OA 3H8JA 4MUGA 3SF8B 1EDOA 1FXUA 2YWCA 2BWJA 3L43A 5AFSA 1JDPA 3P9SA 2WAAA 4ESVA 3UENA 4CQMB 3H6KA 2G9VA 3IIIA 1P5ZB 2XHEA 3CX8A 1Z06A 5HQJA 3CW8X 3NHJA 3FDZA 1XPRA 1I2BA 3WP0A 1XN1A 3UJDA 2IF2A 4NYJR 5CPBA 5IARA 2WLSA 4JI2B 1JU3A 4GYKA 1E9SA 4RQAA 4UMEA 1R6AA 4O0LA 4WUTA 3RU3A 5ITWA 4YCJA 3BXZA 3PJFA 4XRRA 3ROQA 3T12A 1P62B 2QM0A 3G13A 2IHKA 3EBPA 3R8XA 1CQWA 3KBOA 3VZSA 2NGRA 3AR8A 4M9QA 3KQYA 3HRKA 4GZMA 1HLGA 2HK8A 4IGKA 4YAWA 4CM8B 3K0SA 1KVTA 1FTSA 1U9ZA 2PMCA 5JR3A 1Z0KA 2VA8A 3WO1A 4KPYA 1Q3KA 2L19A 4YAFA 5EZYF 5DN9A 3QFFA 4TYPA 1IATA 1TQ6A 3SK0A 3DZHA 2I99A 5TVKA 1NKTA 1PJAA 5LYYA 5JU6A 2D5CA 3D6UA 3DEYX 3KLNA 4OGLA 4MI3A 5CPFA 3ZZMA 1SWWA 2ZAOA 2ONYA 2CV1A 1VLVA 3ES9A 4IINA 3TDMA 1KIFA 4HDMB 2GCIA 4EJ0A 5DWVA 3VR2D 4YQEA 4IL5A 3H4MA 3EXIA 3VU3A 3FUTA 4K8OA 3CJTA 1VYUA 3WAGA 2XDQB 1PQYA 1FP6A 1U0OC 3OQOA 3CR8A 1C1YA 1TU4A 3NS7A 1GLNA 5MF6A 5KNDD 2C3PA 1JAYA 3EOBI 3BWYA 5G1OA 3THRA 1GR1A 2PPVA 5FTWA 1G3MA 5HF6A 1W29A 1N7GA 5FTMA 1VKNA 5A0FA 2AFHA 4G5OA 2HADA 3NEYA 1ONSA 4BS9A 4EG3A 1YRYE 5TGZA 2R2AA 2LZ0A 5D5HA 4H15A 5JQGF 3HLKA 2A9JA 3WIOA 5FTLA 1TA9A 1O5IA 4A2CA 5CH5A 2OHVA 2YJNA 3CH5A 2FSPA 4PSDA 3WQRA 5A5VA 4RFLA 2Q7XA 5MN5A 1DMRA 1NBHA 3IMKA 4EW2A 4WBNB 5JAMA 1XMVA 2DFLA 5BSMA 4C4TA 5IDXA 3W5UA 5BN5B 3SVTA 3E7PA 4MIYA 1F0KA 2GT1A 1F6DA 3G88A 4BQFA 1MEEA 2D1FA 2GZ3A 1BOFA 1P3JA 4Q9DA 2ZYHA 3A0UA 1FA9A 3D3QA 3ZDRA 3OURA 3ZE2B 5LM3A 3A1EA 1X92A 2IY7A 3PC4A 4JLDA 4YMSA 4ZA2A 5TY0A 2OP0A 4A8TA 4LKRA 3EDOA 3V1YA 2GI4A 3V3TA 4YXFA 1RJFA 1UODA 1X8XA 3ER6A 5JYDA 1EXVA 1U0SY 3O8BA 2C0QA 3CINA 2HBRA 4LZJA 1YJCA 2W83A 4D6PA 1DEAA 5EERA 3JYOA 5DHSA 2IP4A 1XQ9A 4XGKA 1EVIA 4CF3A 3GEHA 4J3FA 5C1IA 4B3DA 1BJKA 1J7JA 5DTQA 1WP4A 2XQJA 4DLVA 4M49A 2XUPA 3W06A 4MI1A 3EA4A 4GYJA 3SM3A 2BEVA 3A6EA 4ON9A 2AE2A 5DK6A 5FOSA 3ZC3A 3ZN2A 2QYSA 2YZ7A 2YRFA 1ADBA 5IZCA 1IY1A 3UHJA 2ZUDA 4EUEA 5LBIA 4ALIA 4CIWA 3TZLA 3ROPA 1DC8A 1X3LA 4MKIA 5AMXA 1YQWA 2QMYA 4ZCRA 1GDHA 1V26A 2O8NA 3A36A 4GI2A 4IV0A 4UNSA 4YJ3A 4BKMA 3N86A 3ORRA 4ILKA 3ND5A 4IGIA 4CDNA 4NXNB 2ZGVA 5KIAA 2OMKA 1PUIA 1NW6A 2Q0XA 3N3BC 1HWYA 4HS4A 1KJYA 5HTOA 2VUHB 5FBKA 1QS0A 3KQKA 5KC8A 2PKEA 3ZJYA 1R15A 2FPUA 3AETA 3NOQA 1OD6A 2GN9A 2XZPA 2PZEA 1ZVMA 4HDSA 1IQUA 2FN3A 3M8KA 2Z9BA 3AJAA 1FDOA 3TRIA 1ZA1A 3I6ZA 3NGMA 1CQIB 1M83A 4L4XA 1NSFA 3ZOZA 1T1JA 3B5IA 3E7FA 4YRJA 4LMAA 1P75A 1ND5A 2G9ZA 2Q3MA 3NDJA 4RIIA 2A5YB 2PU5A 3WBKA 1FTNA 3IUJA 3MPUA 4ZOQI 1NN5A 2FZ4A 2QORA 5FLYA 1M8FA 3HVKA 3KB6A 3CLSD 2G8LA 2JVIA 2DBVO 2XNSA 2Z5LA 4FHCA 1AMUA 3QMWA 1OVGA 4KDCA 4HDNA 1HTTA 1EJ2A 2X6TA 3AOEA 3K96A 1AN0A 1QYXA 1CQXA 2WF8A 4HB3A 2NSJA 4IDCA 4LXHA 1RADA 4LHWA 4P5PA 4FC6A 5TJ9A 3U60B 1R0XA 1TKCA 4Z3DA 1QMPA 1II9A 3DLCA 3GJ0A 4EG6A 3ZHBA 4A92A 1RLJA 3ZLJA 4OLFA 5F1KA 4BE7B 5F3WB 1NMYA 1K6JA 2XZDA 3ORHA 1H93A 2ATXA 4JQSA 5G1PA 2Z57A 3EVCA 4B4VA 5LYJB 1OY1A 2I91A 1KI1A 3O0DA 2G1UA 2VQ3A 3H5VA 3B20A 4P3XA 4YUYA 2D5LA 2IHBA 1KI7A 4Q19A 1EVZA 1YQTA 1M1UA 2YYSA 2V7PA 2Y05A 4GDMA 1E3MA 3RS0A 1WUIS 2P9ZA 2R8RA 2ZIGA 5JSKA 1CE8A 3JS5A 2RHLA 4OI1A 4P7KA 4HT3B 2J5QA 3JQGB 4MQ4A 1KI8A 3QA9A 2CV2A 5EE0A 1EU1A 1UK9A 2AVNA 3R77A 4RNDB 4Y9SA 4FGZA 2V8OA 2XA9A 5ALMA 4AY6A 1FTYA 3ZYCA 4CKBB 3OEHA 4Q6WA 1ESMA 4AMGA 4K28A 1R5NA 2BBSA 1KOJA 1U8FO 4IX9A 3P7MA 2A35A 4WXMA 4ECEA 1SUSA 3LBAA 2Y76A 1GPUA 4XPIB 5A9TA 3AF3A 2KPOA 4BWYA 3GW8A 5M04A 2C8VA 4B2PA 1C8VB 1KVRA 1HT3A 3OU6A 4Y2XA 3A9VA 1CUJA 1GN8A 3U7FB 3R40A 4BJ5A 4GXNA 4JQCA 1SZPA 1Y8CA 3B36A 3LECA 2P77A 4QTUB 3NAQA 3QX7A 2GEFA 2RKBA 4MS4B 4HZUB 1JIKA 3SHWA 1P4JA 5DN6D 5L3QB 4R2WA 1X7HA 2YS7A 3OIWA 2YKGA 2WAYA 2CXPA 4HZIA 2FJUA 4JC4A 5DHUA 4EKNB 1K6IA 1MPTA 1R4MB 2DGDA 3WLRA 4MICA 2JI8A 5AM2A 2A1UA 3C45A 3QHAA 5I9BA 1AU9A 1GSAA 4ZYVA 2NO1A 1YA6A 1YULA 2GRJA 4JLMA 4ND4A 1EUCA 5NLLA 1SHLA 4YPOA 3P0HA 1KZYC 4M98A 4OQXA 3NX4A 3FSEA 2VHZA 4GO1A 1T26A 1VLLA 2QJTA 3O8LA 2Z1MA 2PDAA 2JAOA 3LUHA 4DEYA 4JEUA 9LDTA 3CB2A 2OO3A 4LFBB 2VPIA 4RY8A 1CUCA 3RM3A 3BHMA 1W88A 2QD1A 2GAIA 1V8DA 2GJAA 2JGIA 3H5RA 2BEUA 2BTQB 3F5QA 3DZCA 1ENYA 2AF3C 4J6FA 4L0MA 3ROKA 3H42B 3TJZA 3WLKX 2I62A 4GT1A 2GBLC 2H4XA 3U3ZA 1W2WB 3WLFA 4UARA 3C1TA 3T06B 4JB8A 1G6HA 1JU4A 5F76A 3WGZA 2ZDQA 5AVQA 1Y7PA 2GM9A 2WPNA 2PBZA 1UBSB 1WW2A 2D1TA 2O52A 4JUAA 2QOEA 4I2NA 2F9MA 5K0JA 4DIFA 3HMQA 1SRRA 3CO0S 1QRTA 2Q5LA 4DILA 2HBZA 4M0MA 4PFKA 1KYZA 2FHPA 4FUTA 3OZWA 4QQFA 2W0SA 2O2SA 4PTZA 5TPWA 1ISJA 1OHHA 3O3OB 2B2XA 2UAGA 1ECJA 1PN3A 2D5BA 4M0KA 5E6SB 5J2TF 1ID8A 3AR3A 4KN9S 2ILVA 1VDZA 2AWNA 2G83A 5IABA 2NTYC 1KE2A 1E62A 3ZZTA 4RZ3A 5JG7A 5LQMA 3U3KA 1KI3A 4LYFA 1A1SA 3A1SA 2RG7A 4Z86A 1MB4A 1W5TA 3RQSA 3I5YA 1W85A 2CFIA 3VSAA 1Y8QA 4F1KA 1PGOA 1YKSA 4WUVA 3FYSA 1JB9A 2D7DA 2JZNA 1UOQA 4JLAA 3FUXA 1UZLA 2YFQA 3GD7A 4HEJA 4PAQA 3IAM1 3SXJA 5AVRA 1L5KA 1RWWA 3QKRA 3G68A 5FA5A 4JH0A 1E9RA 4LX8A 1Q0TA 3IVRA 1G5IA 1ONBA 4XWYA 3WFJA 3WIBA 5B7GA 5JXWA 1GQFA 1HUQA 3B51X 5IAJA 3ZV4A 3AX6A 1XA0A 4BMYA 1W59A 3F5MA 1SCUA 5EKUA 4F6RB 1QQAA 2AUMA 1H2BA 2IODA 2D1RA 3X3HA 3LJKA 4R2MA 5G4KB 4QUDA 4ZPXA 5ITZA 1V1MA 1M3SA 1H42A 3EBLA 2YHBA 4DYDA 1I6KA 1JLSA 1O6FA 1FEZA 1KXJA 5IPFA 1WCWA 2PT6A 3GJZA 4B79A 2V4ZA 1A9QA 4G86A 1SZCA 1IPEA 3NGLA 4EYOA 3NB0A 1RRPA 1F1BA 3L8EA 3IDZA 3UV3A 4B6JA 4F3RA 1V8FA 5A4IS 3KG2A 4KQ2A 4X3OA 2GBIA 4AK9A 1ZMRA 1AVTA 1BEZA 2XMCA 3AUTA 3QLEA 4CWAA 2WHPB 2PUAA 3OPYI 2E18A 1T2NA 2O5RA 3GNLA 3IYLW 3A05A 4KMRA 2AMLA 3KALA 3U31A 2OG2A 1JDBB 1ND6A 3OC0A 3QEAZ 1LPAB 1KI2A 4FR2A 4NHEA 5T3YA 4NC9A 4MDEA 3JQAB 2VJMA 2QE7D 3LPMA 2WUWE 3NANA 4DANA 3GU3A 4W6QA 2Q3JA 4EJFA 5C1DA 3JVIA 1P3Y1 2DKFA 3AKEA 3EOZA 3KYDB 4HNAB 4RD2A 1Y4SA 2DF8A 3UNXA 3IBYA 2J9FB 1PYDA 1NLYA 2VNSA 4ZAWA 5CX1A 2FZLA 1KA9H 1AF7A 2ZJAA 2RGWA 3AB7A 3GNTA 5SYNA 1CG6A 5KINB 4NFLA 4RGBA 3B8HA 2O0KA 4QNRA 1E9VA 3PVZA 4G07A 4OMUA 2KM1A 5EN4A 2WJ6A 3AO0B 2JPDA 3MWFA 3UPDA 1SOVA 1SD1A 1YB1A 2H2AA 2I4MA 4RS4A 4FE4A 4I7EA 1KNQA 4BNMA 1KHTA 2W8BA 3I2JA 3ZWPA 5ILGA 4C0LA 1U4NA 1Z6AA 4IXTA 1DDGA 5LZ8A 1RC8A 3KWFA 1JBQA 3HYTA 2HI0A 3SQNA 2BP7A 3BFPA 3KUCA 2EGGA 2ORVA 3WB2A 2OOSA 4UFPA 1SVUA 2YV2A 2I3ZA 3RS3A 2JJ1A 1MNQA 1O5TA 4AXBA 2G07A 1Y9AA 2M6RA 7MDHA 4EHIA 1HYQA 2OENG 3B3QA 4MV1A 5C5IA 4IKPA 4LF9B 4M0EA 3VMFA 2CD7A 1ZN7A 2FOIA 2P0YA 2R6JA 1T5HX 5FNVA 5I47A 3K35A 1JB1A 1X80A 1YU6A 2HSEA 3ZIAA 3N0TA 1ZK0A 2HSDA 4NCNA 2H7YA 3KSUA 1GTZA 1XP5A 2CLIB 3FMPB 2VDMB 1O89A 4RD3A 1LNQA 1K66A 4Q9NA 4Y1GA 1R8SA 5TPZA 3RRMA 2C3YA 4N5IX 1A97A 2VNIA 3SI7A 4E7OA 1D07A 1GG5A 1G7RA 1DJQA 1PJ3A 3BDVA 3K1TA 1E96A 1TVEA 2BLNA 3L3BA 4OB6A 5E1DA 4N12A 1LSJA 1A4RA 1N9GB 1YJAA 1YRQA 3RGGA 1IBCA 4P3OA 1GPJA 3Q9LA 1XE3A 2BGLA 1JUDA 2Q1SA 4PX3A 3CA8A 3ROTA 4MS3A 4CF6A 4KC0A 3R6TA 4K3VA 2PUJA 3VH2A 1C3LA 1SBCA 3BWXA 1AGRA 2PBLA 3SVLA 1YB4A 1N5DA 3CH7A 1RQ7A 3W3AA 1E3EA 1ZM9A 1YR6A 2QD5A 3MQFA 5D7BA 3OZTA 3ZX4A 3UC5A 4EI9A 2E6UX 1R2QA 3E81A 2CFTA 1TAHA 1J25A 2C94A 5AJWA 3X2EA 4CM9A 1CY6A 1U9CA 1R0KA 1TYBE 2PVPA 3ASUA 3T4EA 4JI7B 2I34A 4UHCA 1AQUA 3IKTA 1D7OA 3TX2A 1QYRA 4DV3B 1TAQA 2R84A 2PQMA 2YJ5A 3I73A 1IN7A 1VLHA 1GNPA 3I61A 3A3KA 4Q05A 4RZQA 4URWR 4Z7OB 5B3JC 4QOJA 4Q21A 2Q6TA 3Q1KA 1UBKS 4QFCA 1ZU5A 4QAJA 5EY5B 5CVDA 1DT5A 2LCIA 1I4EB 3M9XA 2IKQA 2QA5A 2Q29A 3LWDA 3FVQA 2VXBA 3NT5A 4FMDF 3Q85A 4C06A 1Z9BA 4GX5A 3AW8A 1JDTA 4DC0A 4LF6B 3TOXA 1CUFA 2GPTA 3PS9A 4JUDX 3EZGA 4AZVA 5HKAA 3D9QX 1T9ZA 4CM7A 4DLXA 2ZP1A 3KAPA 1WXFA 1YMQA 5I7UA 1Y7HA 3KKOA 4MULA 3EEYA 1U80A 3N53A 4KE9A 4UMDA 4DADA 2N75A 3MXOA 1QR2A 1L4HA 1XRPA 3WG9A 5BNZA 3BICA 1YACA 3UJ8A 4MQ5A 1QP7A 4ZQGA 1I33A 1N2IA 2OV1A 1DC3A 2Y66A 3CUYA 5LSAA 1RHQA 3HU1A 3LTEA 4QL3A 5A3JA 5EE5B 2HHAA 4D9BA 2P91A 3W2TA 3WNVA 1K0FA 1YAJA 1KAMA 4GXQA 1OW3B 1BXRA 3K5HA