4Z0UA

Rnase hi/ssb-ct complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Interaction with Single-stranded DNA-binding Protein Stimulates Escherichia coli Ribonuclease HI Enzymatic Activity.
pubmed doi rcsb
source organism Escherichia coli o139:h28
molecule tags Hydrolase/peptide
total genus 49
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2015-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4z0uA00
1Z26A 3C6UA 4CF2A 4OPJA 3TANA 3MEEA 1D8YA 1HYZA 4AHTA 3NGZA 4E7LA 3AVCA 1D9FA 2KTQA 3M8PA 2YKNA 1SL1A 3MEDA 2XHBA 2OYQA 1QE1A 1BI4B 2ZE2A 5K14A 4F4KA 1WSIA 3OYAA 4E89A 3OYBA 4AILC 4RW9A 3KIOA 4WE1A 1UA1A 4M3ZA 2PYJA 4OKKA 1WSJA 4Z0UA 3K58A 3CQ8A 4CIGA 4O0JA 3SNNA 1VRTA 1HPZA 4L8RB 3QESA 2IAJA 4B08A 2G8WA 1LAWA 3KJVA 2X74A 1RT2A 3HP9A 1TAUA 1VSFA 2XRIA 1VSMA 3AVNA 2G8HA 3NBPA 1YVUA 3AA2A 4HUGA 1X9MA 3PO5A 1D5AA 2HHTA 4Z4IA 4E7JA 3H08A 4EP4A 4FJ7A 1REVA 1EKEA 4CE9A 5HRNA 3E01A 4CHOA 1CZ9A 4CJVA 4DF8A 4CJ5A 1NJYA 3V1OA 4I2QA 4KV8A 1FXXA 1J5OA 2RF2A 2A1RA 2BGGA 1KVBA 2WOMA 1TK0A 3NF7A 3SUPA 1I3AA 3OYJA 4AHCA 1L3SA 1BHLA 5CZ1A 3OYEA 2FC0A 3IAYA 2IS3A 3V1QA 1IKWA 3SJJA 4JLHA 1JLFA 4RG8A 3VN5A 3SV3A 4C8LA 1UWBA 1Y97A 4DTNA 3NF8A 3DLBA 1B92A 1JKHA 4G1QA 3LAMA 2OZMA 4BWMA 4CGJA 3C94A 3L2UA 3SZ2A 1WSFA 2X6SA 1HQUA 3CM6A 4YFUA 3V9UA 3AVKA 3PX6A 1U4BA 4W5TA 1RDAA 4ID1A 4CGIA 3V1RA 4W5RA 4J2DA 3RR8A 5EU7A 3TR8A 4B9UA 4Z4FA 4N47A 4E7KA 3VQEA 4K8XA 4KAZA 4ZTJA 4BDPA 3SPYA 1TL1A 1TKXA 3L3UA 3MXJA 2XY6A 3K5NA 3SQ4A 3PO4A 1BIUA 4FZZA 4CGDA 3OYLA 1WSHA 1NKCA 2BDPA 1JLQA 1JL1A 2KW4A 2ZD1A 3KK2A 1VRUA 4CHZA 3AVIA 3SYZA 2DFEA 1RDCA 1XHZA 3VQ8A 4DG1A 4Y1CA 4CJWA 4HCBA 4KO0A 1WAJA 3RTVA 3V9WA 2QKKA 1X9WA 2IOCA 3HPOA 5KGWA 3NCIA 3PX4A 3TAEA 2ETJA 4FW1A 2XO7A 1TAQA 2VWJA 3SUQA 3S9HA 1SKSA 4DFMA 3O3GA 1HJRA 1DTQA 4FYDA 1VSDA 4DQQA 3WNFA 4MQ3A 3ZT0A 3NH1A 4GMJB 3THVA 3KLGA 4PWDA 2XY5A 3VQBA 3QEPA 1A5WA 2ATQA 1QHTA 3AO2A 4CJRA 4C8KA 2DTUA 2KFZA 1L3TA 1LV5A 3P83D 4KFBA 2HNDA 1ZBLA 3LALA 5T7BA 5CYQA 4FJLA 3ZSZA 3VQ4A 3LP3A 4FLXA 4GVMA 1LW0A 4DS4A 4CJEA 4FLZA 5KRSA 1ZBIA 3V9ZA 1C0TA 4CK2A 3VQQA 2Z1IA 4DTPA 4N56A 4C8MA 2X78A 4FJ8A 4CF9A 4FK0A 4FJ9A 2KZMA 1Q9XA 2YHAA 3RWUA 3HJFA 1RT5A 3OYDA 1B9DA 5I42A 1XWLA 3DOKA 4O4GA 2P51A 4M3TA 4M3WA 3IG1A 4B9LA 1MU2A 4KTZA 1IH7A 2HHUA 4DSFA 1ZYQA 2HMIA 1SKWA 4FJXA 1BCOA 4CERA 1JLGA 3VQAA 4F3OA 4NCGA 3IRXA 3PY8A 3OS1A 3WNHA 3B6OA 3WNGA 3KLFA 5KRTA 1DTTA 4CHNA 3TARA 1U45A 4Z4HA 3U6FA 1W9HA 1TK8A 3EYZA 4DU1A 2IGIA 4AHUA 4CJLA 3SV4A 1DLOA 3ZSQA 3EY1A 4FLTA 3V9XA 3F9KA 4B9VA 4ELTA 4KTQA 4PUOA 1BISA 1KLMA 3QNOA 3MEGA 4N41A 4M3YA 1S1WA 4M41A 4B9MA 3IS9A 4ELVA 3ZSWA 3NH0A 2YNFA 3DOLA 4JS4A 4DSLA 4GW6A 3MAQA 3QIPA 4CJFA 3KK3A 1CXUA 3RMCA 1NK0A 3C6TA 4KRFA 3DMJA 3O3FA 3SQ1A 3QEVA 3VQ5A 3ZT1A 1VSHA 3OYMA 3QNNA 1VK0A 4DQRA 3BDPA 5I3UA 3JYTA 2E4LA 4KTWA 3KLIA 3HPGA 4FLWA 3VA3A 2YNIA 2FBVA 4IFYA 3K59A 4EZ9A 1UOCA 4UQGA 3QLHA 5JS2A 4KB0A 3KLHA 3D45A 1LW2A 4Y1DA 4BE1A 1HYVA 1GOAA 4W5NA 1NOZA 4JRPA 3CFPA 3QO9A 5CY4A 1NOYA 4CF0A 1HMVA 4IKFA 2VG5A 1EXQA 3L3VA 2HHWA 1RT3A 4BWJA 3ZCMA 2HHSA 2F8SA 3QETA 1VSJA 4QAGA 4AHRA 4FCYA 4KI6A 1G15A 3ZSOA 2DY4A 4N5SA 3HVTA 5DK5A 4JS5A 2BANA 4J2AA 5D3GA 1SKRA 1HRHA 4K8ZA 1R0AA 3QEWA 4LD0A 3OS0A 1T03A 2YKMA 3T3FA 4FXDA 4H4OA 4DS5A 4M42A 2WONA 4DFJA 1RBSA 2GV9A 1LWEA 4ZTFA 4N76A 1IO2A 1CZBA 1HNIA 2Q3SA 3M8RA 1VSLA 3G0ZA 5J2MA 1D9DA 1VSIA 5KI6A 3L2QA 1RCHA 4FJ5A 2HVHA 4FJMA 3K2PA 4FZXC 4FJHA 2GUIA 1ASVA 1J54A 4PQUA 4FJKA 4M3UA 3PUFA 3WNEA 1RT6A 3ZT2A 2RN2A 4Q0BA 4DTOA 3QEIA 2XY8A 1XHXA 2VG6A 2ZQBA 3AVJA 4E3SA 3TABA 2Z1HA 4O5BA 3DLKA 3VQ9A 1RT1A 3VA0A 3DLHA 3DRPA 1U48A 1BI4A 1EP4A 1GOBA 5DMRA 3OYHA 4I2PA 4CHPA 1J53A 4DMNA 4LSNA 4RW6A 4HUEA 5J2PA 4CF1A 3LP0A 4CEFA 3DM2A 5HRPA 4FJGA 3ULDA 4CGFA 3AO5A 3S3OA 4KHWA 2ITGA 4CJQA 2RPIA 3LPTA 2YNGA 2F8TA 4IG3A 1TKDA 4DSIA 4OPKA 3VQDA 4H4MA 1KRPA 1A5VA 3NF6A 4FVMA 4CGHA 1ASWA 2EHGA 2FBXA 2X6NA 3NE6A 2G8VA 2PZSA 4ELUA 3LANA 3OYGA 3JSMA 1JL2A 4B3OA 3DRSA 1W0HA 1U49A 4KREA 5J1EA 4PY5A 1TVRA 2Z1JA 1K6YA 1S1XA 2HVIA 1JLEA 5HRRA 5SZTA 2OPPA 1HNVA 4CJ3A 3NDKA 2OPSA 3BGRA 3SQ2A 3MECA 1TL3A 4DFPA 2QKBA 1SL0A 4OLAA 1RBVA 5E41A 3ZSXA 1C1AA 1YT3A 4DF4A 3SCXA 1NK7A 2OA8A 1S5JA 2PYLA 3TI0A 4OKJA 3ASMA 3C95A 3AO4A 5HRSA 1BQMA 3NH2A 1N6QA 4CJ4A 5J2QA 1C0UA 1C0MA 4F2SA 1FKPA 4I9LA 4CCHA 1CLQA 4FLVA 4H8KA 3FFIA 1RNHA 4CECA 3AVBA 4CEQA 4LY7A 3SQ0A 2RKIA 3ZT3A 2LSNA 2D0BA 4DTXA 5FRMA 2D5RA 3G10A 4BACA 2FBYA 4Q5VA 1X9SA 2HHVA 3EZ5A 1JLAA 4CIFA 4DSKA 4HCCA 3U3YA 1Z25A 4DFKA 4C8NA 4M3XA 2W42A 3K5MA 1U47A 5CYMA 1KTQA 4FM1A 3TAFA 3HK2A 3ZSVA 1NK5A 3KKRA 2D0CA 2B6AA 4Z4GA 4O0IA 2YV0X 3F73A 3V81A 2OZSA 3ITHA 4O44A 1T8EA 1JXBA 3KD5E 3ISNC 4EZ6A 4CEBA 1KFSA 4EP5A 1KCFA 4HTUA 5FDLA 3LWLA 1EX4A 4OGEA 5HLFA 1KSPA 2B5JA 1BCMA 3QEXA 4DWIA 4O55A 3L2WA 1XI1A 4PA1A 1Q9YA 3HVRA 1JLCA 1KVCA 2VWKA 3NF9A 4CK1A 3QERA 3V4IA 1JLBA 4DU3A 3S3NA 4HVJA 2O4GA 1NJZA 3OYFA 1IKVA 4FJIA 4LH4A 4CJTA 4FK4A 3DLRA 3DLEA 4ICLA 2OPRA 4CF8A 4DLEA 1KFDA 3AVLA 2VG7A 3I0SA 4DSEA 3SUOA 2HNZA 4MFBA 4DTJA 1RILA 1A5XA 4CHQA 3LDSA 2Y1JA 4AH9A 3RMAA 1BL3A 4KPYA 3PX0A 1LWFA 4OJRA 4CFDA 4E1NA 3TAQA 4DQPA 3AA3A 1RT7A 4R5PA 5JS1A 1LWCA 1RTHA 4W5OA 1VSKA 1X1PA 3M8SA 2R7YA 3OYIA 1LAVA 2B4JA 3AVFA 3LZIA 3I8DA 3A2FA 4OVLA 1EETA 1RDBA 1WN7A 2NUBA 4DTMA 4FLUA 4KI4A 1S9GA 3AVMA 1YTAA 3NGYA 4CEEA 1S1VA 3KK1A 2HW3A 4CK3A 1QTMA 1RBRA 1UAXA 4DU4A 2P5GA 4CEDA 5SWMA 3OY9A 2G8KA 3SI6A 4KHQA 3AA4A 4KB1A 2F96A 3AA5X 4E0DA 3B6PA 4ZHRA 4CIEA 1FK9A 5KTQA 5J2NA 1IG9A 1RTDA 2G8UA 2P5OA 5FRNA 3AO1A 3K5OA 4E7HA 1HQEA 1TKZA 3OYNA 1TK5A 4CESA 4CEOA 4I7FA 4W5QA 3MXMA 1QQCA 1RDDA 2A1SA 2I5JA 3CM5A 3LWMA 2JGUA 3M8QA 4RW8A 1IKYA 3QIOA 3OJSA 3T1AA 3OVNA 4B9SA 2QK9A 1TGOA 1IKXA 3NFAA 1RTJA 3MXIA 2FBTA 4KKOA 4NYNA 3OJUA 1NK8A 2G8FA 3ZSRA 4BDZA 3L2RA 4J2BA 1WLJA 4B9TA 2JLEA 3AVAA 4FM2A 1UA0A 1NK4A 3HPHA 4NYFA 5CZ2A 3T19A 3VQCA 1TV6A 4FJNA 3RMBA 3AVGA 5HROA 2KZZA 4CJPA 3ZT4A 1RBUA 3P1GA 3LZJA 3U3GA 5HP1A 2HHXA 4DTUA 1GOCA 2HB5A 5HBMA 3VQPA 5C42A 1NKEA 2P1JA 4YNQA 4JRQA 1C6VA 1NJWA 4CJSA 3P5JA 3V9SA 4I9QA 1S6QA 3RMDA 4OLBA 4LH5A 3K57A 4B8AB 2EX3A 3QINA 1CXQA 4KHUA 4HHTA 3HP6A 1U04A 4IFVA 1NKBA 2OPQA 4AHVA 4DTSA 4M45A 3NAEA 1B9FA 5C24A 4NCAA 4E19A 1S6PA 4RW4A 4NCBA 3HL8A 2YHBA 3HXMA 3K5LA 3CFRA 2IDOA 4DTRA 3AO3A 4CGGA 4HUFA 4DLGA 1HYSA 1KVAA 3RRHA 1BQNA 1C1BA 4IDKA 4CJUA 4CEZA 3HM9A 4QOZB 2KFNA 4KHYA 1S1UA 4B8CA 3VQ6A 2IC3A 4RW7A 3CFOA 3O3HA 1QS4A 2HHQA 3LP1A 3O4QA 2E6MA 4KHSA 4XIUA 2O4IA 2BE2A 4B9NA 3TAPA 5C25A 3KD1E 1BIZA 1ITGA 1WAFA 4TSXA 3L2VA 1NK9A 3DI6A 2PY5A 1WSEA 2AJQA 1VSEA 2E6LA 3LPUA 3S3MA 3SPZA 4F2RA 3AV9A 4DQSA 4IG0A 4DQIA 3SUNA 3CYMA 4QCLA 3CG7A 3HYFA 4CHYA 3NGIA 1TKTA 1S1TA 2DFHA 2XY7A 4J2EA 1ZBHA 1I39A 3KKSA 3KTQA 3DYAA 4KHNA 2GBZA 1ZBFA 4FM0A 4FZYA 4OKEA 1QSSA 3DLGA 4IBNA 3NHGA 1SL2A 4DSJA 3D0PA 3OYKA 1L3UA 2D0AA 3VQ7A 4BE0A 1XC9A 4F3TA 1RBTA 3RR7A 3PV8A 4Z4EA 4E7IA 1YTUA 2Z1GA 3ZSYA 1ZBUA 1SV5A 1BGXT 1T05A 4C8OA 3TAGA 3UIQA 4FW2A 4M3RA 1QSYA 1J9AA 4Z4CA 1RTIA 1F21A 4FK2A 3I0RA 1ASUA 4CEAA 1RT4A 1S9EA 1L3VA 1QSLA 3LAKA 3LP2A 1Q8IA 1WNSA 2YNHA 4CJKA 4FJJA 4BE2A 3AVHA 3OYCA 5FROA 1FKOA 2KQ2A 4ID5A 4CFBA 2G8IA 4CFCA 3OS2A 3TWHA 1C1CA 3V6DA 1O1WA 2HNYA 3DRRA 2Y1IA 4F8RA 3HSTB 3KLEA 4BDYA 1KLNA 3HO1A 3RRGA 3ALYA 5KGXA 1L5UA 2DFFA 4OGCA 3TAMA 4FLYA 1SUQA 4LSLA 4CFAA 3HT3A 3L8BA 1JXEA 1WSGA 2QXFA 4AHSA 3O4NA 1NK6A 1T7PA 1N5YA 1NJXA 4E1MA
chains in the Genus database with same CATH superfamily
1Z26A 3TANA 4OPJA 1D8YA 3MEEA 4V19S 1XNQK 2CGKA 3KZBA 3M8PA 5EX5A 1SL1A 2OYQA 4BR2A 3H6EA 3OYAA 4E89A 3OYBA 2QWRA 1CZAN 3MMVA 2DPNA 1HNZK 2ZGYA 3WXLA 4EAHD 1HPZA 3VF6A 4WFBL 5JLFA 2Q0RA 3KJVA 4DUYK 1VSFA 1YVUA 1KAXA 4E7JA 3S41A 3E01A 4DF8A 3BF1A 1P90A 3N4QA 3UKUA 1NJYA 4CI6A 4I2QA 3O9TA 1J5OA 4DR7K 3NF7A 3ZETB 1I3AA 1NLVA 1BHLA 1D4XA 3IAYA 1RDUA 3SJJA 4JLHA 4K42A 4JKDA 4JI8K 3CJBA 3VN5A 3SV3A 3H3NO 1VAZA 4ILGB 3NF8A 4DTNA 1B92A 1FJGK 1JKHA 1HNXK 3LAMA 2OZMA 3VEXA 3THXB 3L2UA 2GEMA 4DB3A 1HQUA 3CM6A 3A5LC 3V9UA 5DM6L 1U4BA 3G6EN 3CHWA 2OTLN 5EU7A 1HUXA 4K8XA 4KAZA 4PKGA 3VPZA 1T3VA 3L3UA 3SQ4A 1KAZA 2PAVA 4NLBA 2BDPA 1VRUA 3AVIA 4BRAA 3CCSN 2QI2A 4Y1CA 4DG1A 4YORA 4CJWA 3DLLL 1WAJA 2E2QA 5CHIA 5MLCQ 3VOVA 3NCIA 3TAEA 3SUQA 2VWJA 3S9HA 4CZIA 1HJRA 5GAEP 4O8KA 5JLHA 4FYDA 1VSDA 5JICA 1VQPN 4MQ3A 1S3XA 3ZT0A 3THVA 2P9SB 2FXUA 3QEPA 4X64K 3AO2A 1QHTA 4KFBA 2W41A 2HNDA 3LALA 4CZFA 4A61A 1NGAA 4GVMA 4DS4A 4FLZA 2FF6A 5AR0A 4CK2A 3VQQA 4N56A 2X78A 4B1UB 4FJ9A 3HJFA 1EWQA 3EKUA 1B9DA 3MWTA 3DXMA 1J6ZA 3E9OA 3QMLA 3VEOA 1IH7A 4DSFA 1OH7A 3VQAA 4F3OA 3CERA 3PY8A 4Z4FA 5KRTA 3TARA 1H1VA 1IBMK 3WQTA 2O8BB 4AHUA 1DLOA 3KWGA 4ELTA 4B1ZA 4UY8O 5AQLA 4M3YA 3IS9A 1ILYA 3PLAA 3WXMB 4GW6A 3LDLA 2P9UA 3HI0A 4GV9A 3TSPA 3VQ5A 3ZT1A 3QNNA 1VK0A 1GLLO 1WUAA 3JYTA 3KLIA 4C1NK 3HOTA 3K59A 4EZ9A 2GWKA 1UOCA 3MN6A 4JKEA 3AARA 5JS2A 4U7BA 5BR8K 3JXUA 3D45A 2P9KB 4PKIA 4CF0A 4JKFA 1EXQA 2ZJRL 2HHWA 4BWJA 3ZCMA 2HHSA 1HX1A 3QETA 1VSJA 4FCYA 3ZSOA 3HVTA 3I8BA 4J2AA 5D3GA 1SKRA 1HRHA 4A2AA 4BRLA 3T3FA 5KQDA 4M42A 3PSIA 2GV9A 4N76A 2HVHA 3L4IA 4QS9A 2ASOA 1ASVA 1J54A 4CD1A 1BU6O 3WNEA 1GLEG 3SAFA 4DTOA 4E3SA 3DLKA 3VQ9A 3VA0A 4LF6K 3VGKA 1GOBA 3OYHA 4CHPA 4RW6A 3LP0A 4BRDA 4FJGA 2I7PA 5F1XA 3AO5A 4CJQA 3LPTA 2F8TA 4H4MA 3D6RA 1OVYA 4H0XB 3VTIA 3NF6A 4FVMA 4CGHA 1BO5O 2FBXA 2G8VA 2I7NA 1BWFO 4KREA 1OH8A 1TVRA 1S1XA 2JWLA 2D4WA 5SZTA 4BC2A 3D2EB 1SL0A 1IBLK 2HBKA 3U8XA 4OLAA 4DF4A 1S5JA 4A57A 1N6QA 1NGCA 4CJ4A 3CC4N 3RSEA 3EL2A 1NMNA 1C0MA 3FZLA 4H5RA 3P38A 3SBTA 4CCHA 1CLQA 2O8DB 1RNHA 4CECA 5M1NA 3ZT3A 2LSNA 2VGNA 5FRMA 4H03B 2D5RA 3B8AX 4Q5VA 5AJ3K 1X9SA 1Z6RA 1ZC6A 4CIFA 4HCCA 4O8UA 3MN9A 1U47A 5CYMA 1KTQA 1I94K 3WQUA 3HK2A 3ZSVA 4CBXA 1NK5A 3C6HA 2B6AA 2YV0X 4JEPA 1T8EA 4EZ6A 4DR1K 2FF3B 5FDLA 4OGEA 4AM7A 3J80O 4JHDB 4DWIA 2AP1A 3L2WA 4PA1A 3EEQA 4WYBA 1Q9YA 3NF9A 2NRZA 4CK1A 3QERA 3V4IA 4DU3A 3S3NA 2O4GA 4FJIA 4CJTA 1QVGM 3I0SA 5C12A 1XNRK 4IOAL 2HNZA 5KPRA 3RMAA 1BL3A 3THWB 5BRDA 1RT7A 3AA3A 1LWCA 1RTHA 1VSKA 1X1PA 3M8SA 4BRGA 2NUBA 1S9GA 3AVMA 4CEEA 1S1VA 1V4TA 3CCLN 1GLBG 2UXDK 1RBRA 3AA4A 4KB1A 2F96A 4E0DA 4CIEA 5KTQA 3O1WA 4AF1A 5FRNA 3K5OA 5B8HA 1HQEA 2A5XA 3EE9A 4CD3A 1QQCA 1RDDA 2I5JA 2OANA 4A59A 2JGUA 2HF4A 4RW8A 4B9SA 3OVNA 3WT0A 5BN8A 2V7YA 4BDZA 3F5TA 4B9TA 1UA0A 2F7TA 4FM2A 2NNWA 5EVZA 5CZ2A 3T19A 4BRQA 5AZJB 4HTLA 3U4LA 1YF5L 1NKEA 4JRQA 4YNQA 4CJSA 3E9PA 3RMDA 3ID6A 1KC8O 4DR3K 3IDHA 4K25A 1CXQA 4IFVA 4DTSA 3CC2N 1YVNA 5JVGL 3CFRA 2IDOA 3VEVA 3AO3A 1HYSA 4DLGA 3O9UA 3CCMN 2GELA 1WBDA 4X66K 5FPEA 1S1UA 4KHYA 3VQ6A 4BG8A 4RTFD 3CFOA 2Q0UA 2D0OA 4FWQA 5FPNA 2O4IA 3TAPA 1YXQA 1BIZA 1NK9A 3DI6A 3U9DA 3QBXA 3SPZA 3HYFA 4J2EA 1TKTA 1S1TA 1I39A 3KKSA 3DYAA 1YUWA 1VQ9N 4JD2B 1VQ4N 3RR7A 2YJFA 1NWKA 1YTUA 1N36K 4C8OA 1ZBUA 1T05A 1HKBA 3UIQA 1HKCA 1J9AA 4JKGB 5AQIA 1RTIA 4Z4CA 3BZKA 1YHQN 4FK2A 4CEAA 1L3VA 2P9LB 4NXMK 3C65A 3LP2A 3FR0A 4LF4K 3LDOA 3AVHA 3TTCA 2KQ2A 4CFBA 2G8IA 2IVPA 2QXLA 4BQZA 1O1WA 2Y1IA 4F8RA 4BDYA 4CW7B 4DR2K 3ALYA 5KGXA 1L5UA 4I6MA 4JK8A 3TAMA 1IV0A 2QXFA 3O4NA 1T7PA 1NJXA 4FWPA 3NGZA 4CZLA 1N8RO 2YKNA 3MEDA 2VGMA 2GUPA 3H1QA 4IDHA 1QE1A 5BN9A 1BI4B 5CR4A 3CD6N 4AILC 3CJ9A 1Q82O 5AQJA 3KIOA 3CJ1A 5HOOA 2YHWA 4OKKA 1WSJA 3K58A 4ISFA 1VRTA 4L8RB 4JV5K 2G8WA 1RT2A 4BRHA 4DCHA 2O8EB 2P9NB 3M3ZA 3NBPA 4HUGA 3AA2A 1D5AA 4ISGA 4Z4IA 5IT9O 1C0FA 3MK6A 4EP4A 1BA0A 3H1VX 1EKEA 3K9KA 4CE9A 5HRNA 4CHOA 4DV4K 3SJHA 3ZX2A 2A1RA 1KVBA 4M63C 1SAZA 2ITMA 3OYJA 5GADP 3CQXA 4FWSA 2IS3A 4H0TB 3GL1A 3O6WA 1JLFA 1R59O 4RG8A 3VGMA 4Z94A 5GIPA 4G1QA 2HBJA 1MWKA 4YFUA 1IJJA 1ATNA 3RVCA 4LFAK 1RDAA 4ID1A 4J2DA 3V1RA 3TR8A 5AQSA 4IO8A 4N47A 4E7KA 5AQNA 4H5TA 4BR9A 4BDPA 3SPYA 1TKXA 4H5WA 3LDNA 4FPBA 4FZZA 4CGDA 1NKCA 1WSHA 3KK2A 3SYZA 2KW4A 2DFEA 3VQ8A 4CZHA 1X9WA 3GOIA 3ENOA 3G71N 2Q31A 3WXIA 5EXWA 1XC3A 4U67L 3T1HK 3O3GA 2NRHA 3VGLA 1IG8A 1DTQA 4LF5K 3O8MA 2E1YA 4DV2K 4DQQA 3N4PA 2UXCK 3NH1A 4GMJB 3TTDA 4OPAA 2XY5A 3BF3A 3U9ZA 3J7YP 1A5WA 4C8KA 4CJRA 1X9JA 1L3TA 5T7BA 3K9JA 3ZSZA 3VQ4A 5JVHL 1HR0K 3LP3A 1GLJO 3J7AP 4CJEA 1VHXA 4RWTA 2VQEK 1C0TA 2Z1IA 3THXA 4FJ8A 3J8AA 2KZMA 4FK0A 2YHAA 2GX9A 1N32K 1XWLA 4M3TA 3IG1A 3CPEA 4B9LA 1DGKN 1TUUA 1MU2A 1Z05A 2HHUA 3LM9A 3C6AA 1ZYQA 4AM6A 1BCOA 4CERA 3M6GA 4NCGA 1U6ZA 5FPDA 3KLFA 3B6OA 2W6KA 4LFCK 1DTTA 1U45A 4Z4HA 2IGIA 4CJLA 3SV4A 3V9XA 4IJAA 3F9KA 2E2OA 4KTQA 1JJ2M 4FVUA 1S1WA 4B9MA 4ELVA 2Q97A 3ID8A 4JKAA 4JS4A 3RMCA 1QZ5A 3C6TA 4CZEA 3SQ1A 2Q36A 5IWAK 3OYMA 3CXCM 4DQRA 3BDPA 5I3UA 2E4LA 4FLWA 3HPGA 3VESA 3UKRA 2P9IB 3QICA 4Y1DA 1LW2A 5KQ8A 2YJEA 4YDUA 3DXKB 4KH5A 3HRGA 4IKFA 4WQ4C 1WBBA 1RT3A 5EOYA 3M1FA 4BR4A 4IFEA 4QAGA 3TSUA 4KI6A 1G15A 4H5NA 4K8ZA 3IFRA 1T03A 4MO4A 3MCAB 2WONA 4IWVA 4J8FA 1RBSA 4DFJA 3MWPA 4ZTFA 1HNIA 2Q3SA 3G0ZA 5J2MA 1D9DA 4MLEA 3SK3A 5I9EB 4FZXC 5BPMA 2UU9K 2V51B 3PUFA 1RT6A 2RN2A 4B1YB 2O8BA 3QEIA 2QWQA 2ZQBA 3FZKA 3DLHA 3DRPA 4O5FA 4DV5K 5DMRA 4I2PA 1YI2N 4DMNA 4HUEA 4CF1A 4EHUA 3DM2A 3VF2A 2ITGA 5DM7L 4IG3A 1TKDA 4DSIA 4OPKA 3THYB 4AQYK 3VETA 3NE6A 3LANA 4DQ8A 2Z1JA 5HRRA 5GINA 2OPPA 1HNVA 2A3ZA 1TL3A 2QKBA 1RBVA 3ZSXA 1YT3A 2OA8A 3NH2A 1BQMA 2NLXA 5J2QA 1C0UA 2KLAA 1HLUA 1FKPA 1OH6A 4F2SA 4I9LA 1BG3A 4H8KA 2QWPA 1ZXOA 4DTXA 3R3LA 4A5AA 2HHVA 3EZ5A 4XEIA 2UUCK 4JI0K 2HF3A 5AQYA 3U3YA 1Z25A 4DFKA 4C8NA 3ZEUA 3BP8A 4FM1A 5AFUA 3HM8A 4O0IA 3V81A 3ITHA 3LDPA 5AZIA 5BPLA 1KCFA 3J81O 1KSPA 2A6AA 2CGJA 4O55A 3ATVA 4GV3A 4DV0K 1BA1A 1JLBA 1NJZA 3OYFA 1IKVA 1U2VB 1Q81O 4LH4A 4GKJK 2YI1A 4CBUA 3DLEA 2IIRA 4DLEA 3AVLA 2VG7A 3CF5L 1YAGA 4MFBA 1HJOA 1X3MA 1RILA 4EIAA 3LDSA 1LWFA 3TAQA 1YJ9N 4DQPA 4R5PA 5AQQA 5JS1A 4YOXA 4GNIA 4BROA 1EO1A 1RFQA 4FOEA 5FLXO 1J5EK 1LAVA 2B4JA 3AVFA 3LZIA 1EETA 1RDBA 1WN7A 3CCRN 1RGIA 2J4RA 4KI4A 1YTAA 3NGYA 2GWJA 3GG4A 3KK1A 5FPMA 2NRXA 4LF9K 1QTMA 4DU4A 1E3MA 4FWLA 3AA5X 3EZWA 3B6PA 3VEWA 4ZHRA 1FK9A 3VERA 4BGBA 4JKBA 3OYNA 3VEZA 4KHPK 4CEOA 2H3GX 2YHYA 3CMAN 2A1SA 3FZFA 2QK9A 2OTJN 1IKXA 2O8FA 1RTJA 1QQMA 2FBTA 3OJUA 3R6MA 2WBNA 4JHDA 2W40A 4NYNA 5AQVA 1ZBSA 1WLJA 2JLEA 3AVAA 3BY5A 4L3QA 3HPHA 3VQCA 1N33K 1TV6A 3A5NC 1E4GT 2WC9A 3C0BA 4FJNA 3RMBA 3CCEN 3ZT4A 1RBUA 3P1GA 4FL9A 2HHXA 4JI6K 1VQON 5HBMA 4BVOA 3V9SA 2PBDA 5AQOA 1DT9A 1S6QA 4C23A 1FW6A 1NU0A 4BRFA 3DXMB 3Q7CA 3HP6A 1QVFM 1U04A 2OPQA 4M45A 4JKHA 3NAEA 1QZ6A 5BRFA 4NCBA 3HL8A 4WQ5A 5C15A 3K5LA 4CGGA 2ZGZA 4FWRA 1BQNA 3RRHA 4CJUA 4CEZA 3HM9A 3QB0A 4B8CA 1VQKN 2IC3A 4RW7A 1QS4A 4KH4A 3LP1A 2BTFA 2FSKA 1WAFA 4TSXA 2PY5A 4YDUC 2E6LA 3LPUA 1GLDG 4IG0A 3CYMA 2DFHA 1K8AO 4MDAA 4XH1A 4KHNA 4FM0A 1QHAA 4B1XB 4IBNA 3NHGA 1SL2A 4DSJA 3D0PA 1K8KA 1T44A 1SQKA 2D0AA 3VQ7A 4HWIA 2NRRA 4E7IA 3T7ZA 3A0IX 5BR9A 3IMXA 3G4SN 4JI7K 3I0RA 2A41A 1QSLA 4ILHA 1NBWA 5FROA 4CFCA 4FPAA 3SAHA 3V6DA 3FZHA 2QW9A 5C2DA 2HNYA 2QA4N 1Y64A 3HSTB 3O1BA 2DFFA 4OGCA 1GLCG 3ENHA 5LY3A 4FLYA 1JXEA 3TPQA 1N5YA 1XUPO 1X9MA 4CF2A 2NRWA 4AHTA 4E7LA 3AVCA 2XHBA 2ZE2A 4FOIA 4F9OA 4QS8A 2PYJA 4M7YA 5KPTA 3VMFB 3CI5A 2IAJA 1LAWA 2X74A 4BGAA 2G8HA 3AVNA 3IUCA 3O80A 5AQHA 3CCJN 3PO5A 2HHTA 1MDUB 3D2FB 3H08A 2E2PA 4FJ7A 1REVA 3VENA 2QWLA 1CZ9A 4CJVA 4CJ5A 3V1OA 5ADXA 1MWMA 1TK0A 2D0PA 4EHTA 3VEYA 1L3SA 5CZ1A 3OYEA 2FC0A 3V1QA 1IKWA 2UUAK 1KD1O 1Y97A 4CGJA 3C94A 3SZ2A 1P8ZA 2X6SA 3CJCA 3PX6A 2ASPA 3FLCO 2HBLA 3GDQA 4CGIA 4W5RA 1NNEA 3VQEA 4GKKK 3FFKB 3MXJA 2CH5A 1BIUA 3CC7N 2ZD1A 1JL1A 1Q7YO 4CHZA 2QEXN 1RDCA 4HCBA 1W7AA 2P9NA 3RTVA 3V9WA 2IOCA 5KGWA 2ETJA 1TAQA 4DFMA 4CJ7A 3CCQN 1JCGA 3WUHA 4CVNE 3WNFA 1IBKK 4NO7A 1YIJN 4X65K 1WOQA 3C7NB 4FWOA 2E2NA 3K0SA 3I55N 5LJWA 3OTOK 1ZBLA 5CYQA 3SMSA 1LW0A 3SBGA 4DKWA 3L4QA 4C8MA 1Q9XA 3WEEB 3RWUA 1RT5A 1VQ8N 4M7XA 5BPNA 3QFUA 2E88A 4O4GA 2P51A 2QTDA 1TYQB 4M3WA 5BREA 2KKZA 4GVEA 4KTZA 1SKWA 4FJXA 1JLGA 1EWRA 3MDQA 3OS1A 3WNHA 3WNGA 4BR5A 1GLAG 3U6FA 1TK8A 3EYZA 2E5LK 1E4FT 4B9VA 4YOVA 4PUOA 1BISA 5F0XA 3QNOA 3MEGA 4N41A 1HPMA 4M41A 3CPWM 3NH0A 3DOLA 3MAQA 1ATSA 3QIPA 4KRFA 3O3FA 2HBMA 3E1YA 3CIPA 1VSHA 1NGEA 1W97L 4KTWA 3VA3A 2YNIA 2FBVA 4UQGA 2O8CA 1BDGA 4KB0A 2RE2A 1HYVA 4W5NA 3QO9A 1NOYA 3O5BA 2VG5A 3L3VA 4H0VB 2F8SA 1BOTO 4AHRA 4N5SA 5DK5A 4JS5A 3CMEN 5EY4A 3FGUA 3QEWA 4LD0A 3OS0A 2ZJPL 2RHKA 4DS5A 2P9PA 3BEXA 1IO2A 1VSLA 5KI6A 3L2QA 1T6CA 1RCHA 4WFAL 3ZX0A 4FJHA 2GUIA 4CZMA 3LL3A 4PQUA 4FJKA 2JWKA 3ZT2A 4NXNK 2XY8A 5AFUH 4BC5A 3AVJA 3TABA 3WXKA 2Z1HA 2ZJQL 1RT1A 1U48A 3D7EO 4LSNA 4MDBA 3UB5A 4CEFA 5HRPA 3IKMA 4JAXA 2RPIA 4BREA 3OHRA 3PIPL 1TUYA 3ULEB 4A5BA 1ASWA 2EHGA 1JCEA 3PSFA 3FZMA 4ELUA 4RCHA 3OYGA 3DXKA 4B3OA 2IVNA 3DRSA 3AGKA 5J1EA 2UXBK 3NDKA 2OPSA 3BGRA 3SQ2A 3MECA 4WF9L 3CCUN 3SCXA 1C1AA 2PYLA 3TI0A 4OKJA 3ZETA 3ASMA 3C95A 3AO4A 5HRSA 3ATUA 4FLVA 5M1KA 1NG9A 4CEQA 3M5RA 5AQFA 4LY7A 3SQ0A 2WTUA 2D0BA 3G10A 2FBYA 3ENBA 3HSCA 4CBWA 1JLAA 4JK9A 4DSKA 3NMUA 4M3XA 3K5MA 5TKWA 3HBTA 2ZM6K 1VQ7N 3O08A 3CQYA 2E20A 4IOCL 2D0CA 4Z4GA 2OZSA 3KD5E 2KFNA 5CE3A 4O44A 1JXBA 4CZKA 3ISNC 4CEBA 2F4VK 1KFSA 1BUPA 4HTUA 1EX4A 1G99A 3OA9A 3QEXA 4JYAK 4B1WB 4BRPA 4QS7A 4H0PA 3HVRA 1KVCA 4PL8A 4FK4A 1M90O 3CETA 4ICLA 4KH6A 2OPRA 4CF8A 1KXPA 4DSEA 4IOXA 4DTJA 1NGGA 4CHQA 1X3NA 4IEIA 5AQGA 3PX0A 2P9SA 4OJRA 1ATRA 4W5OA 2R7YA 3I8DA 3A2FA 1NMDA 4DTMA 3SAGA 5LMNK 2A42A 2GTDA 4B1VA 1UAXA 3EE8A 2P5GA 4CEDA 5SWMA 2G8KA 1NGIA 4JI2K 1ESVA 4H5VA 5GAHP 1IG9A 2G8UA 2P5OA 1VQ5N 4E7HA 1TK5A 5E26A 4CESA 4I7FA 2VQFK 4IXCA 4W5QA 3CM5A 3LWMA 3M8QA 3OJSA 1IKYA 3QIOA 4FSVA 3T1AA 3NFAA 3ZSRA 3L2RA 4NYFA 1SZ2A 4BR7A 3AVGA 5HROA 1U2VA 4CJPA 4DV3K 1GOCA 3VQPA 3F9MA 3VF4A 1C6VA 3P5JA 4I9QA 4LF7K 1VQLN 3KHYA 3K57A 4B8AB 2EX3A 3QINA 2P9KA 3KWIA 1NKBA 4AHVA 4G9ZA 1B9FA 4YOYA 5C24A 4NCAA 2PFUA 2YHBA 3R1XA 3MCPA 4HUFA 1KVAA 1C1BA 4BG9A 4LC9B 4IDKA 3T1YK 4QOZB 3TSQA 3O3HA 4B3SK 2HHQA 4A62A 3O4QA 3W0LA 4KHSA 3GBTA 4YY3K 5LMUK 4JN4A 1WB9A 3JAMO 3TTFA 1Q18A 2V52B 1WSEA 2AJQA 3QBWA 1VSEA 3O4WA 4F2RA 4QCLA 4DQIA 3SUNA 3CG7A 4CHYA 3NGIA 1VQMN 1ZBHA 4DV1K 2YHXA 3UKRB 1QSSA 3EO3A 2VWBA 1XMQK 4K43A 1L3UA 4BE0A 3PV8A 4C1NI 4Z4EA 3DWLA 3ZSYA 1BGXT 5ADXH 3P4IA 4FWMA 3UKUB 3L6QA 1F21A 1KQSM 3MN5A 4CZJA 3AAQA 1ASUA 4GV6A 1RT4A 1YJNN 3LAKA 3VTHA 1WNSA 1OKJA 4CJKA 3WXJA 3OW2M 3OYCA 1FKOA 3CCVN 2FSNA 3MX2A 4ID5A 1OH5A 1C1CA 2KHOA 4IZ9A 2E1ZA 3DRRA 2UYTA 3HO1A 2CGLA 4KBOA 5AQUA 3D2EA 4B9QA 1SUQA 4CFAA 3L8BA 1NK6A 5AQZA 1SS6A 4E1MA 3C6UA 1HYZA 5AQTA 1D9FA 2KTQA 3L0QA 3KVGA 5K14A 4F4KA 5E84A 1WSIA 2O8DA 3A5MC 4RW9A 2HHHK 4WE1A 1UA1A 3EN9A 4M3ZA 4Z0UA 3CQ8A 4CIGA 4O0JA 3SNNA 3QESA 3G25A 4B08A 2OCEA 3HZ6A 3HP9A 1VQ6N 1TAUA 2XRIA 1VSMA 3DAWA 4Y0WA 4R79A 2IVOA 4PKHA 4PL7A 5F2RA 5AQMA 2A40A 3OBWA 1FXXA 4KV8A 2RF2A 2BGGA 2WOMA 4BY9C 5TKYA 3SUPA 4YOTA 3A8YA 1HKGA 4AHCA 2ASMA 4C8LA 1UWBA 3DLBA 1NGFA 5C2FA 4BWMA 4BRCA 1WSFA 5KPZA 2FSJA 4JI4K 3THWA 3AVKA 3AAPA 5M1FA 4W5TA 3ZEUB 4WCEL 3RR8A 4B9UA 2QWOA 4ZTJA 3BUZB 5AZIB 2V7ZA 1TL1A 4ISEA 2XY6A 2VCPA 3K5NA 3PO4A 3OYLA 1NGHA 1JLQA 3QFPA 5AQKA 3GE1A 1XHZA 3BZCA 1XMOK 5AQXA 4KO0A 5M1OA 4X62K 2QKKA 3HPOA 3D2FA 4H0OA 3PX4A 3MX5A 2P9UB 4FW1A 2XO7A 1SKSA 3ZX3A 3TU5A 5C0YA 2BUPA 1HNWK 2F9WA 4YOWA 3KLGA 4PWDA 3VQBA 5AZJA 2ATQA 2DTUA 3LDQA 5HL7L 4FO0A 2KFZA 1LV5A 3P83D 2ZF5O 4FJLA 5A2QO 4FLXA 1EQYA 5KRSA 1ZBIA 3V9ZA 4DTPA 1MA9B 4CF9A 3JS6A 4DV7K 3OYDA 5I42A 3DOKA 2NZTA 5AQRA 4JNEA 4DHYA 2NRTA 2HMIA 1QQOA 3E9LA 3A5OC 3IRXA 4JI5K 4CHNA 1YITN 1W9HA 2O8FB 1NGDA 4DU1A 3ZSQA 3EY1A 4FLTA 3KK7A 4BC4A 1KLMA 1V4SA 2EWSA 3ZSWA 2YNFA 3O9QA 3W3DA 4OPHA 4DSLA 3KK3A 4CJFA 4YOUA 1CXUA 1NK0A 3DMJA 3QEVA 4IFYA 3QLHA 3C7NA 3KLHA 1S22A 4BE1A 3H3OB 1GOAA 1NOZA 4JRPA 4DR6K 3CFPA 5CY4A 4JD2A 3SLCA 4LF8K 2HSTA 1HMVA 1T6DA 5LL6Z 4CZGA 4JKGA 1VQNN 3I33A 2DY4A 3WEEA 2BANA 2P9LA 4H0YB 1R0AA 2YKMA 1TYQA 3RSEB 4FXDA 4H4OA 1W2BM 1LWEA 1CZBA 3M8RA 2VYPA 1VSIA 4FJ5A 4FJMA 3K2PA 2QM1A 1O13A 3HTVA 4BR0A 4M3UA 4IEEA 4Q0BA 4BRKA 1XHXA 2VG6A 4O5BA 4FWKA 3R8EA 1BI4A 1EP4A 4PHTX 1K8KB 1J53A 5J2PA 3ULDA 4CGFA 4XH5A 4E1JA 3SMPA 3R9PA 3S3OA 4KHWA 3P39A 2UUBK 2YNGA 4IO9L 3VQDA 1KRPA 1A5VA 2QWMA 2X6NA 2PZSA 2O8EA 2NRVA 3JSMA 1JL2A 1C0GA 1K9MO 1OVQA 1W0HA 5AQWA 1JCFA 1U49A 1K73O 4PY5A 5H1SQ 1K6YA 2HVIA 1JLEA 4CJ3A 3ZLJA 4K41A 4DFPA 4NLCA 5E41A 1NK7A 1M1KO 4NB4A 1GLFO 2YCHA 1Q86O 4LFBK 4WQ4A 1DKGD 3FFIA 3AVBA 2RKIA 4BACA 4BRIA 3F2KA 3Q7BA 1YJWN 2W42A 3TAFA 5AQPA 3KKRA 4XH4A 3F73A 1NGJA 4EP5A 3CJ7A 4ILJA 3LWLA 5M1QA 5HLFA 1NM1A 2B5JA 1BCMA 2ZWHA 4B3MK 4MLHA 1XI1A 1XQSC 4JK7A 4A2BA 3ULEA 4OX9K 1JLCA 2VWKA 4JI3K 3ZYYX 4HVJA 3DJCA 1DEJA 3MN7A 3DLRA 1KFDA 2FLOA 3SUOA 1NJIO 2E8AA 4WQ5C 1KAYA 2Y1JA 1A5XA 4AH9A 4KPYA 2CH6A 1RDWX 1N34K 4CFDA 4E1NA 4JI1K 3NVKA 4B3TK 3OYIA 4OVLA 3E66A 4FLUA 2HW3A 2AA4A 3H46O 4CK3A 3HOSA 5JMVA 4OO1J 2D1KA 3OY9A 4DUZK 3SI6A 4KHQA 4BQLA 5J2NA 1RTDA 4GY2B 3AO1A 5BRHA 1TKZA 3UE5A 2WFBA 4JKCA 3MXMA 4BRNA 1TGOA 3MXIA 4KKOA 1NK8A 2G8FA 2YX6A 4J2BA 5M1PA 1NK4A 3AY9A 2KZZA 3PIOL 3LZJA 5HP1A 3NVMA 3U3GA 4DV6K 4DTUA 2HB5A 5C42A 2P1JA 1NJWA 4BVPA 5ELZA 4OLBA 4LH5A 5LJVA 2P9IA 5GAGP 4KHUA 4HHTA 3CJAA 4E19A 1S6PA 4RW4A 3O9RA 3HXMA 4DTRA 1QQNA 4I6MB 2QWNA 1S72N 5GIOA 3H45C 4YHHK 2HMPA 3OBYA 3J7ZO 2E6MA 4FWNA 4XIUA 2BE2A 4B9NA 4MO5A 2Q2RA 5C25A 3KD1E 2F9TA 1ITGA 4B3RK 3L2VA 2Q1NA 3S3MA 3AV9A 4DQSA 2XY7A 3FE1A 3KTQA 4DR4K 1NGBA 1LCUA 2GBZA 1ZBFA 2O8CB 4FZYA 4OKEA 3O9SA 3DLGA 3EKSA 3P31A 3I56N 3OYKA 4F3TA 1XC9A 4K0KK 1RBTA 2HOEA 4BRMA 4EFHA 1LOTB 2Z1GA 1SV5A 3T69A 3TAGA 4BC3A 4FW2A 4M3RA 1QSYA 5C10A 3THYA 3QDKA 1S9EA 4WFNL 4DR5K 1Q8IA 2YNHA 2W6LA 4FJJA 4BE2A 3OS2A 2BH1A 3TWHA 2P9PB 3AGRA 4IJNA 3KLEA 1KLNA 3LM2A 3RRGA 4LSLA 3HT3A 1WSGA 4AHSA 2WUSA
chains in the Genus database with same CATH topology
1Z26A 3C6UA 4CF2A 4OPJA 3TANA 3MEEA 1D8YA 1HYZA 4AHTA 3NGZA 4E7LA 3AVCA 1D9FA 2KTQA 3M8PA 2YKNA 1SL1A 3MEDA 2XHBA 2OYQA 1QE1A 1BI4B 2ZE2A 5K14A 4F4KA 1WSIA 3OYAA 4E89A 3OYBA 4AILC 4RW9A 3KIOA 4WE1A 1UA1A 4M3ZA 2PYJA 4OKKA 1WSJA 4Z0UA 3K58A 3CQ8A 4CIGA 4O0JA 3SNNA 1VRTA 1HPZA 4L8RB 3QESA 2IAJA 4B08A 2G8WA 1LAWA 3KJVA 2X74A 1RT2A 3HP9A 1TAUA 1VSFA 2XRIA 1VSMA 3AVNA 2G8HA 3NBPA 1YVUA 3AA2A 4HUGA 1X9MA 3PO5A 1D5AA 2HHTA 4Z4IA 4E7JA 3H08A 4EP4A 4FJ7A 1REVA 1EKEA 4CE9A 5HRNA 3E01A 4CHOA 1CZ9A 4CJVA 4DF8A 4CJ5A 1NJYA 3V1OA 4I2QA 4KV8A 1FXXA 1J5OA 2RF2A 2A1RA 2BGGA 1KVBA 2WOMA 1TK0A 3NF7A 3SUPA 1I3AA 3OYJA 4AHCA 1L3SA 1BHLA 5CZ1A 3OYEA 2FC0A 3IAYA 2IS3A 3V1QA 1IKWA 3SJJA 4JLHA 1JLFA 4RG8A 3VN5A 3SV3A 4C8LA 1UWBA 1Y97A 4DTNA 3NF8A 3DLBA 1B92A 1JKHA 4G1QA 3LAMA 2OZMA 4BWMA 4CGJA 3C94A 3L2UA 3SZ2A 1WSFA 2X6SA 1HQUA 3CM6A 4YFUA 3V9UA 3AVKA 3PX6A 1U4BA 4W5TA 1RDAA 4ID1A 4CGIA 3V1RA 4W5RA 4J2DA 3RR8A 5EU7A 3TR8A 4B9UA 4Z4FA 4N47A 4E7KA 3VQEA 4K8XA 4KAZA 4ZTJA 4BDPA 3SPYA 1TL1A 1TKXA 3L3UA 3MXJA 2XY6A 3K5NA 3SQ4A 3PO4A 1BIUA 4FZZA 4CGDA 3OYLA 1WSHA 1NKCA 2BDPA 1JLQA 1JL1A 2KW4A 2ZD1A 3KK2A 1VRUA 4CHZA 3AVIA 3SYZA 2DFEA 1RDCA 1XHZA 3VQ8A 4DG1A 4Y1CA 4CJWA 4HCBA 4KO0A 1WAJA 3RTVA 3V9WA 2QKKA 1X9WA 2IOCA 3HPOA 5KGWA 3NCIA 3PX4A 3TAEA 2ETJA 4FW1A 2XO7A 1TAQA 2VWJA 3SUQA 3S9HA 1SKSA 4DFMA 3O3GA 1HJRA 1DTQA 4FYDA 1VSDA 4DQQA 3WNFA 4MQ3A 3ZT0A 3NH1A 4GMJB 3THVA 3KLGA 4PWDA 2XY5A 3VQBA 3QEPA 1A5WA 2ATQA 1QHTA 3AO2A 4CJRA 4C8KA 2DTUA 2KFZA 1L3TA 1LV5A 3P83D 4KFBA 2HNDA 1ZBLA 3LALA 5T7BA 5CYQA 4FJLA 3ZSZA 3VQ4A 3LP3A 4FLXA 4GVMA 1LW0A 4DS4A 4CJEA 4FLZA 5KRSA 1ZBIA 3V9ZA 1C0TA 4CK2A 3VQQA 2Z1IA 4DTPA 4N56A 4C8MA 2X78A 4FJ8A 4CF9A 4FK0A 4FJ9A 2KZMA 1Q9XA 2YHAA 3RWUA 3HJFA 1RT5A 3OYDA 1B9DA 5I42A 1XWLA 3DOKA 4O4GA 2P51A 4M3TA 4M3WA 3IG1A 4B9LA 1MU2A 4KTZA 1IH7A 2HHUA 4DSFA 1ZYQA 2HMIA 1SKWA 4FJXA 1BCOA 4CERA 1JLGA 3VQAA 4F3OA 4NCGA 3IRXA 3PY8A 3OS1A 3WNHA 3B6OA 3WNGA 3KLFA 5KRTA 1DTTA 4CHNA 3TARA 1U45A 4Z4HA 3U6FA 1W9HA 1TK8A 3EYZA 4DU1A 2IGIA 4AHUA 4CJLA 3SV4A 1DLOA 3ZSQA 3EY1A 4FLTA 3V9XA 3F9KA 4B9VA 4ELTA 4KTQA 4PUOA 1BISA 1KLMA 3QNOA 3MEGA 4N41A 4M3YA 1S1WA 4M41A 4B9MA 3IS9A 4ELVA 3ZSWA 3NH0A 2YNFA 3DOLA 4JS4A 4DSLA 4GW6A 3MAQA 3QIPA 4CJFA 3KK3A 1CXUA 3RMCA 1NK0A 3C6TA 4KRFA 3DMJA 3O3FA 3SQ1A 3QEVA 3VQ5A 3ZT1A 1VSHA 3OYMA 3QNNA 1VK0A 4DQRA 3BDPA 5I3UA 3JYTA 2E4LA 4KTWA 3KLIA 3HPGA 4FLWA 3VA3A 2YNIA 2FBVA 4IFYA 3K59A 4EZ9A 1UOCA 4UQGA 3QLHA 5JS2A 4KB0A 3KLHA 3D45A 1LW2A 4Y1DA 4BE1A 1HYVA 1GOAA 4W5NA 1NOZA 4JRPA 3CFPA 3QO9A 5CY4A 1NOYA 4CF0A 1HMVA 4IKFA 2VG5A 1EXQA 3L3VA 2HHWA 1RT3A 4BWJA 3ZCMA 2HHSA 2F8SA 3QETA 1VSJA 4QAGA 4AHRA 4FCYA 4KI6A 1G15A 3ZSOA 2DY4A 4N5SA 3HVTA 5DK5A 4JS5A 2BANA 4J2AA 5D3GA 1SKRA 1HRHA 4K8ZA 1R0AA 3QEWA 4LD0A 3OS0A 1T03A 2YKMA 3T3FA 4FXDA 4H4OA 4DS5A 4M42A 2WONA 4DFJA 1RBSA 2GV9A 1LWEA 4ZTFA 4N76A 1IO2A 1CZBA 1HNIA 2Q3SA 3M8RA 1VSLA 3G0ZA 5J2MA 1D9DA 1VSIA 5KI6A 3L2QA 1RCHA 4FJ5A 2HVHA 4FJMA 3K2PA 4FZXC 4FJHA 2GUIA 1ASVA 1J54A 4PQUA 4FJKA 4M3UA 3PUFA 3WNEA 1RT6A 3ZT2A 2RN2A 4Q0BA 4DTOA 3QEIA 2XY8A 1XHXA 2VG6A 2ZQBA 3AVJA 4E3SA 3TABA 2Z1HA 4O5BA 3DLKA 3VQ9A 1RT1A 3VA0A 3DLHA 3DRPA 1U48A 1BI4A 1EP4A 1GOBA 5DMRA 3OYHA 4I2PA 4CHPA 1J53A 4DMNA 4LSNA 4RW6A 4HUEA 5J2PA 4CF1A 3LP0A 4CEFA 3DM2A 5HRPA 4FJGA 3ULDA 4CGFA 3AO5A 3S3OA 4KHWA 2ITGA 4CJQA 2RPIA 3LPTA 2YNGA 2F8TA 4IG3A 1TKDA 4DSIA 4OPKA 3VQDA 4H4MA 1KRPA 1A5VA 3NF6A 4FVMA 4CGHA 1ASWA 2EHGA 2FBXA 2X6NA 3NE6A 2G8VA 2PZSA 4ELUA 3LANA 3OYGA 3JSMA 1JL2A 4B3OA 3DRSA 1W0HA 1U49A 4KREA 5J1EA 4PY5A 1TVRA 2Z1JA 1K6YA 1S1XA 2HVIA 1JLEA 5HRRA 5SZTA 2OPPA 1HNVA 4CJ3A 3NDKA 2OPSA 3BGRA 3SQ2A 3MECA 1TL3A 4DFPA 2QKBA 1SL0A 4OLAA 1RBVA 5E41A 3ZSXA 1C1AA 1YT3A 4DF4A 3SCXA 1NK7A 2OA8A 1S5JA 2PYLA 3TI0A 4OKJA 3ASMA 3C95A 3AO4A 5HRSA 1BQMA 3NH2A 1N6QA 4CJ4A 5J2QA 1C0UA 1C0MA 4F2SA 1FKPA 4I9LA 4CCHA 1CLQA 4FLVA 4H8KA 3FFIA 1RNHA 4CECA 3AVBA 4CEQA 4LY7A 3SQ0A 2RKIA 3ZT3A 2LSNA 2D0BA 4DTXA 5FRMA 2D5RA 3G10A 4BACA 2FBYA 4Q5VA 1X9SA 2HHVA 3EZ5A 1JLAA 4CIFA 4DSKA 4HCCA 3U3YA 1Z25A 4DFKA 4C8NA 4M3XA 2W42A 3K5MA 1U47A 5CYMA 1KTQA 4FM1A 3TAFA 3HK2A 3ZSVA 1NK5A 3KKRA 2D0CA 2B6AA 4Z4GA 4O0IA 2YV0X 3F73A 3V81A 2OZSA 3ITHA 4O44A 1T8EA 1JXBA 3KD5E 3ISNC 4EZ6A 4CEBA 1KFSA 4EP5A 1KCFA 4HTUA 5FDLA 3LWLA 1EX4A 4OGEA 5HLFA 1KSPA 2B5JA 1BCMA 3QEXA 4DWIA 4O55A 3L2WA 1XI1A 4PA1A 1Q9YA 3HVRA 1JLCA 1KVCA 2VWKA 3NF9A 4CK1A 3QERA 3V4IA 1JLBA 4DU3A 3S3NA 4HVJA 2O4GA 1NJZA 3OYFA 1IKVA 4FJIA 4LH4A 4CJTA 4FK4A 3DLRA 3DLEA 4ICLA 2OPRA 4CF8A 4DLEA 1KFDA 3AVLA 2VG7A 3I0SA 4DSEA 3SUOA 2HNZA 4MFBA 4DTJA 1RILA 1A5XA 4CHQA 3LDSA 2Y1JA 4AH9A 3RMAA 1BL3A 4KPYA 3PX0A 1LWFA 4OJRA 4CFDA 4E1NA 3TAQA 4DQPA 3AA3A 1RT7A 4R5PA 5JS1A 1LWCA 1RTHA 4W5OA 1VSKA 1X1PA 3M8SA 2R7YA 3OYIA 1LAVA 2B4JA 3AVFA 3LZIA 3I8DA 3A2FA 4OVLA 1EETA 1RDBA 1WN7A 2NUBA 4DTMA 4FLUA 4KI4A 1S9GA 3AVMA 1YTAA 3NGYA 4CEEA 1S1VA 3KK1A 2HW3A 4CK3A 1QTMA 1RBRA 1UAXA 4DU4A 2P5GA 4CEDA 5SWMA 3OY9A 2G8KA 3SI6A 4KHQA 3AA4A 4KB1A 2F96A 3AA5X 4E0DA 3B6PA 4ZHRA 4CIEA 1FK9A 5KTQA 5J2NA 1IG9A 1RTDA 2G8UA 2P5OA 5FRNA 3AO1A 3K5OA 4E7HA 1HQEA 1TKZA 3OYNA 1TK5A 4CESA 4CEOA 4I7FA 4W5QA 3MXMA 1QQCA 1RDDA 2A1SA 2I5JA 3CM5A 3LWMA 2JGUA 3M8QA 4RW8A 1IKYA 3QIOA 3OJSA 3T1AA 3OVNA 4B9SA 2QK9A 1TGOA 1IKXA 3NFAA 1RTJA 3MXIA 2FBTA 4KKOA 4NYNA 3OJUA 1NK8A 2G8FA 3ZSRA 4BDZA 3L2RA 4J2BA 1WLJA 4B9TA 2JLEA 3AVAA 4FM2A 1UA0A 1NK4A 3HPHA 4NYFA 5CZ2A 3T19A 3VQCA 1TV6A 4FJNA 3RMBA 3AVGA 5HROA 2KZZA 4CJPA 3ZT4A 1RBUA 3P1GA 3LZJA 3U3GA 5HP1A 2HHXA 4DTUA 1GOCA 2HB5A 5HBMA 3VQPA 5C42A 1NKEA 2P1JA 4YNQA 4JRQA 1C6VA 1NJWA 4CJSA 3P5JA 3V9SA 4I9QA 1S6QA 3RMDA 4OLBA 4LH5A 3K57A 4B8AB 2EX3A 3QINA 1CXQA 4KHUA 4HHTA 3HP6A 1U04A 4IFVA 1NKBA 2OPQA 4AHVA 4DTSA 4M45A 3NAEA 1B9FA 5C24A 4NCAA 4E19A 1S6PA 4RW4A 4NCBA 3HL8A 2YHBA 3HXMA 3K5LA 3CFRA 2IDOA 4DTRA 3AO3A 4CGGA 4HUFA 4DLGA 1HYSA 1KVAA 3RRHA 1BQNA 1C1BA 4IDKA 4CJUA 4CEZA 3HM9A 4QOZB 2KFNA 4KHYA 1S1UA 4B8CA 3VQ6A 2IC3A 4RW7A 3CFOA 3O3HA 1QS4A 2HHQA 3LP1A 3O4QA 2E6MA 4KHSA 4XIUA 2O4IA 2BE2A 4B9NA 3TAPA 5C25A 3KD1E 1BIZA 1ITGA 1WAFA 4TSXA 3L2VA 1NK9A 3DI6A 2PY5A 1WSEA 2AJQA 1VSEA 2E6LA 3LPUA 3S3MA 3SPZA 4F2RA 3AV9A 4DQSA 4IG0A 4DQIA 3SUNA 3CYMA 4QCLA 3CG7A 3HYFA 4CHYA 3NGIA 1TKTA 1S1TA 2DFHA 2XY7A 4J2EA 1ZBHA 1I39A 3KKSA 3KTQA 3DYAA 4KHNA 2GBZA 1ZBFA 4FM0A 4FZYA 4OKEA 1QSSA 3DLGA 4IBNA 3NHGA 1SL2A 4DSJA 3D0PA 3OYKA 1L3UA 2D0AA 3VQ7A 4BE0A 1XC9A 4F3TA 1RBTA 3RR7A 3PV8A 4Z4EA 4E7IA 1YTUA 2Z1GA 3ZSYA 1ZBUA 1SV5A 1BGXT 1T05A 4C8OA 3TAGA 3UIQA 4FW2A 4M3RA 1QSYA 1J9AA 4Z4CA 1RTIA 1F21A 4FK2A 3I0RA 1ASUA 4CEAA 1RT4A 1S9EA 1L3VA 1QSLA 3LAKA 3LP2A 1Q8IA 1WNSA 2YNHA 4CJKA 4FJJA 4BE2A 3AVHA 3OYCA 5FROA 1FKOA 2KQ2A 4ID5A 4CFBA 2G8IA 4CFCA 3OS2A 3TWHA 1C1CA 3V6DA 1O1WA 2HNYA 3DRRA 2Y1IA 4F8RA 3HSTB 3KLEA 4BDYA 1KLNA 3HO1A 3RRGA 3ALYA 5KGXA 1L5UA 2DFFA 4OGCA 3TAMA 4FLYA 1SUQA 4LSLA 4CFAA 3HT3A 3L8BA 1JXEA 1WSGA 2QXFA 4AHSA 3O4NA 1NK6A 1T7PA 1N5YA 1NJXA 4E1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z26 A;  3C6U A;  4CF2 A;  4OPJ A;  3TAN A;  3MEE A;  1D8Y A;  1HYZ A;  4AHT A;  3NGZ A;  4E7L A;  3AVC A;  1D9F A;  2KTQ A;  3M8P A;  2YKN A;  1SL1 A;  3MED A;  2XHB A;  2OYQ A;  1QE1 A;  1BI4 B;  2ZE2 A;  5K14 A;  4F4K A;  1WSI A;  3OYA A;  4E89 A;  3OYB A;  4AIL C;  4RW9 A;  3KIO A;  4WE1 A;  1UA1 A;  4M3Z A;  2PYJ A;  4OKK A;  1WSJ A;  4Z0U A;  3K58 A;  3CQ8 A;  4CIG A;  4O0J A;  3SNN A;  1VRT A;  1HPZ A;  4L8R B;  3QES A;  2IAJ A;  4B08 A;  2G8W A;  1LAW A;  3KJV A;  2X74 A;  1RT2 A;  3HP9 A;  1TAU A;  1VSF A;  2XRI A;  1VSM A;  3AVN A;  2G8H A;  3NBP A;  1YVU A;  3AA2 A;  4HUG A;  1X9M A;  3PO5 A;  1D5A A;  2HHT A;  4Z4I A;  4E7J A;  3H08 A;  4EP4 A;  4FJ7 A;  1REV A;  1EKE A;  4CE9 A;  5HRN A;  3E01 A;  4CHO A;  1CZ9 A;  4CJV A;  4DF8 A;  4CJ5 A;  1NJY A;  3V1O A;  4I2Q A;  4KV8 A;  1FXX A;  1J5O A;  2RF2 A;  2A1R A;  2BGG A;  1KVB A;  2WOM A;  1TK0 A;  3NF7 A;  3SUP A;  1I3A A;  3OYJ A;  4AHC A;  1L3S A;  1BHL A;  5CZ1 A;  3OYE A;  2FC0 A;  3IAY A;  2IS3 A;  3V1Q A;  1IKW A;  3SJJ A;  4JLH A;  1JLF A;  4RG8 A;  3VN5 A;  3SV3 A;  4C8L A;  1UWB A;  1Y97 A;  4DTN A;  3NF8 A;  3DLB A;  1B92 A;  1JKH A;  4G1Q A;  3LAM A;  2OZM A;  4BWM A;  4CGJ A;  3C94 A;  3L2U A;  3SZ2 A;  1WSF A;  2X6S A;  1HQU A;  3CM6 A;  4YFU A;  3V9U A;  3AVK A;  3PX6 A;  1U4B A;  4W5T A;  1RDA A;  4ID1 A;  4CGI A;  3V1R A;  4W5R A;  4J2D A;  3RR8 A;  5EU7 A;  3TR8 A;  4B9U A;  4Z4F A;  4N47 A;  4E7K A;  3VQE A;  4K8X A;  4KAZ A;  4ZTJ A;  4BDP A;  3SPY A;  1TL1 A;  1TKX A;  3L3U A;  3MXJ A;  2XY6 A;  3K5N A;  3SQ4 A;  3PO4 A;  1BIU A;  4FZZ A;  4CGD A;  3OYL A;  1WSH A;  1NKC A;  2BDP A;  1JLQ A;  1JL1 A;  2KW4 A;  2ZD1 A;  3KK2 A;  1VRU A;  4CHZ A;  3AVI A;  3SYZ A;  2DFE A;  1RDC A;  1XHZ A;  3VQ8 A;  4DG1 A;  4Y1C A;  4CJW A;  4HCB A;  4KO0 A;  1WAJ A;  3RTV A;  3V9W A;  2QKK A;  1X9W A;  2IOC A;  3HPO A;  5KGW A;  3NCI A;  3PX4 A;  3TAE A;  2ETJ A;  4FW1 A;  2XO7 A;  1TAQ A;  2VWJ A;  3SUQ A;  3S9H A;  1SKS A;  4DFM A;  3O3G A;  1HJR A;  1DTQ A;  4FYD A;  1VSD A;  4DQQ A;  3WNF A;  4MQ3 A;  3ZT0 A;  3NH1 A;  4GMJ B;  3THV A;  3KLG A;  4PWD A;  2XY5 A;  3VQB A;  3QEP A;  1A5W A;  2ATQ A;  1QHT A;  3AO2 A;  4CJR A;  4C8K A;  2DTU A;  2KFZ A;  1L3T A;  1LV5 A;  3P83 D;  4KFB A;  2HND A;  1ZBL A;  3LAL A;  5T7B A;  5CYQ A;  4FJL A;  3ZSZ A;  3VQ4 A;  3LP3 A;  4FLX A;  4GVM A;  1LW0 A;  4DS4 A;  4CJE A;  4FLZ A;  5KRS A;  1ZBI A;  3V9Z A;  1C0T A;  4CK2 A;  3VQQ A;  2Z1I A;  4DTP A;  4N56 A;  4C8M A;  2X78 A;  4FJ8 A;  4CF9 A;  4FK0 A;  4FJ9 A;  2KZM A;  1Q9X A;  2YHA A;  3RWU A;  3HJF A;  1RT5 A;  3OYD A;  1B9D A;  5I42 A;  1XWL A;  3DOK A;  4O4G A;  2P51 A;  4M3T A;  4M3W A;  3IG1 A;  4B9L A;  1MU2 A;  4KTZ A;  1IH7 A;  2HHU A;  4DSF A;  1ZYQ A;  2HMI A;  1SKW A;  4FJX A;  1BCO A;  4CER A;  1JLG A;  3VQA A;  4F3O A;  4NCG A;  3IRX A;  3PY8 A;  3OS1 A;  3WNH A;  3B6O A;  3WNG A;  3KLF A;  5KRT A;  1DTT A;  4CHN A;  3TAR A;  1U45 A;  4Z4H A;  3U6F A;  1W9H A;  1TK8 A;  3EYZ A;  4DU1 A;  2IGI A;  4AHU A;  4CJL A;  3SV4 A;  1DLO A;  3ZSQ A;  3EY1 A;  4FLT A;  3V9X A;  3F9K A;  4B9V A;  4ELT A;  4KTQ A;  4PUO A;  1BIS A;  1KLM A;  3QNO A;  3MEG A;  4N41 A;  4M3Y A;  1S1W A;  4M41 A;  4B9M A;  3IS9 A;  4ELV A;  3ZSW A;  3NH0 A;  2YNF A;  3DOL A;  4JS4 A;  4DSL A;  4GW6 A;  3MAQ A;  3QIP A;  4CJF A;  3KK3 A;  1CXU A;  3RMC A;  1NK0 A;  3C6T A;  4KRF A;  3DMJ A;  3O3F A;  3SQ1 A;  3QEV A;  3VQ5 A;  3ZT1 A;  1VSH A;  3OYM A;  3QNN A;  1VK0 A;  4DQR A;  3BDP A;  5I3U A;  3JYT A;  2E4L A;  4KTW A;  3KLI A;  3HPG A;  4FLW A;  3VA3 A;  2YNI A;  2FBV A;  4IFY A;  3K59 A;  4EZ9 A;  1UOC A;  4UQG A;  3QLH A;  5JS2 A;  4KB0 A;  3KLH A;  3D45 A;  1LW2 A;  4Y1D A;  4BE1 A;  1HYV A;  1GOA A;  4W5N A;  1NOZ A;  4JRP A;  3CFP A;  3QO9 A;  5CY4 A;  1NOY A;  4CF0 A;  1HMV A;  4IKF A;  2VG5 A;  1EXQ A;  3L3V A;  2HHW A;  1RT3 A;  4BWJ A;  3ZCM A;  2HHS A;  2F8S A;  3QET A;  1VSJ A;  4QAG A;  4AHR A;  4FCY A;  4KI6 A;  1G15 A;  3ZSO A;  2DY4 A;  4N5S A;  3HVT A;  5DK5 A;  4JS5 A;  2BAN A;  4J2A A;  5D3G A;  1SKR A;  1HRH A;  4K8Z A;  1R0A A;  3QEW A;  4LD0 A;  3OS0 A;  1T03 A;  2YKM A;  3T3F A;  4FXD A;  4H4O A;  4DS5 A;  4M42 A;  2WON A;  4DFJ A;  1RBS A;  2GV9 A;  1LWE A;  4ZTF A;  4N76 A;  1IO2 A;  1CZB A;  1HNI A;  2Q3S A;  3M8R A;  1VSL A;  3G0Z A;  5J2M A;  1D9D A;  1VSI A;  5KI6 A;  3L2Q A;  1RCH A;  4FJ5 A;  2HVH A;  4FJM A;  3K2P A;  4FZX C;  4FJH A;  2GUI A;  1ASV A;  1J54 A;  4PQU A;  4FJK A;  4M3U A;  3PUF A;  3WNE A;  1RT6 A;  3ZT2 A;  2RN2 A;  4Q0B A;  4DTO A;  3QEI A;  2XY8 A;  1XHX A;  2VG6 A;  2ZQB A;  3AVJ A;  4E3S A;  3TAB A;  2Z1H A;  4O5B A;  3DLK A;  3VQ9 A;  1RT1 A;  3VA0 A;  3DLH A;  3DRP A;  1U48 A;  1BI4 A;  1EP4 A;  1GOB A;  5DMR A;  3OYH A;  4I2P A;  4CHP A;  1J53 A;  4DMN A;  4LSN A;  4RW6 A;  4HUE A;  5J2P A;  4CF1 A;  3LP0 A;  4CEF A;  3DM2 A;  5HRP A;  4FJG A;  3ULD A;  4CGF A;  3AO5 A;  3S3O A;  4KHW A;  2ITG A;  4CJQ A;  2RPI A;  3LPT A;  2YNG A;  2F8T A;  4IG3 A;  1TKD A;  4DSI A;  4OPK A;  3VQD A;  4H4M A;  1KRP A;  1A5V A;  3NF6 A;  4FVM A;  4CGH A;  1ASW A;  2EHG A;  2FBX A;  2X6N A;  3NE6 A;  2G8V A;  2PZS A;  4ELU A;  3LAN A;  3OYG A;  3JSM A;  1JL2 A;  4B3O A;  3DRS A;  1W0H A;  1U49 A;  4KRE A;  5J1E A;  4PY5 A;  1TVR A;  2Z1J A;  1K6Y A;  1S1X A;  2HVI A;  1JLE A;  5HRR A;  5SZT A;  2OPP A;  1HNV A;  4CJ3 A;  3NDK A;  2OPS A;  3BGR A;  3SQ2 A;  3MEC A;  1TL3 A;  4DFP A;  2QKB A;  1SL0 A;  4OLA A;  1RBV A;  5E41 A;  3ZSX A;  1C1A A;  1YT3 A;  4DF4 A;  3SCX A;  1NK7 A;  2OA8 A;  1S5J A;  2PYL A;  3TI0 A;  4OKJ A;  3ASM A;  3C95 A;  3AO4 A;  5HRS A;  1BQM A;  3NH2 A;  1N6Q A;  4CJ4 A;  5J2Q A;  1C0U A;  1C0M A;  4F2S A;  1FKP A;  4I9L A;  4CCH A;  1CLQ A;  4FLV A;  4H8K A;  3FFI A;  1RNH A;  4CEC A;  3AVB A;  4CEQ A;  4LY7 A;  3SQ0 A;  2RKI A;  3ZT3 A;  2LSN A;  2D0B A;  4DTX A;  5FRM A;  2D5R A;  3G10 A;  4BAC A;  2FBY A;  4Q5V A;  1X9S A;  2HHV A;  3EZ5 A;  1JLA A;  4CIF A;  4DSK A;  4HCC A;  3U3Y A;  1Z25 A;  4DFK A;  4C8N A;  4M3X A;  2W42 A;  3K5M A;  1U47 A;  5CYM A;  1KTQ A;  4FM1 A;  3TAF A;  3HK2 A;  3ZSV A;  1NK5 A;  3KKR A;  2D0C A;  2B6A A;  4Z4G A;  4O0I A;  2YV0 X;  3F73 A;  3V81 A;  2OZS A;  3ITH A;  4O44 A;  1T8E A;  1JXB A;  3KD5 E;  3ISN C;  4EZ6 A;  4CEB A;  1KFS A;  4EP5 A;  1KCF A;  4HTU A;  5FDL A;  3LWL A;  1EX4 A;  4OGE A;  5HLF A;  1KSP A;  2B5J A;  1BCM A;  3QEX A;  4DWI A;  4O55 A;  3L2W A;  1XI1 A;  4PA1 A;  1Q9Y A;  3HVR A;  1JLC A;  1KVC A;  2VWK A;  3NF9 A;  4CK1 A;  3QER A;  3V4I A;  1JLB A;  4DU3 A;  3S3N A;  4HVJ A;  2O4G A;  1NJZ A;  3OYF A;  1IKV A;  4FJI A;  4LH4 A;  4CJT A;  4FK4 A;  3DLR A;  3DLE A;  4ICL A;  2OPR A;  4CF8 A;  4DLE A;  1KFD A;  3AVL A;  2VG7 A;  3I0S A;  4DSE A;  3SUO A;  2HNZ A;  4MFB A;  4DTJ A;  1RIL A;  1A5X A;  4CHQ A;  3LDS A;  2Y1J A;  4AH9 A;  3RMA A;  1BL3 A;  4KPY A;  3PX0 A;  1LWF A;  4OJR A;  4CFD A;  4E1N A;  3TAQ A;  4DQP A;  3AA3 A;  1RT7 A;  4R5P A;  5JS1 A;  1LWC A;  1RTH A;  4W5O A;  1VSK A;  1X1P A;  3M8S A;  2R7Y A;  3OYI A;  1LAV A;  2B4J A;  3AVF A;  3LZI A;  3I8D A;  3A2F A;  4OVL A;  1EET A;  1RDB A;  1WN7 A;  2NUB A;  4DTM A;  4FLU A;  4KI4 A;  1S9G A;  3AVM A;  1YTA A;  3NGY A;  4CEE A;  1S1V A;  3KK1 A;  2HW3 A;  4CK3 A;  1QTM A;  1RBR A;  1UAX A;  4DU4 A;  2P5G A;  4CED A;  5SWM A;  3OY9 A;  2G8K A;  3SI6 A;  4KHQ A;  3AA4 A;  4KB1 A;  2F96 A;  3AA5 X;  4E0D A;  3B6P A;  4ZHR A;  4CIE A;  1FK9 A;  5KTQ A;  5J2N A;  1IG9 A;  1RTD A;  2G8U A;  2P5O A;  5FRN A;  3AO1 A;  3K5O A;  4E7H A;  1HQE A;  1TKZ A;  3OYN A;  1TK5 A;  4CES A;  4CEO A;  4I7F A;  4W5Q A;  3MXM A;  1QQC A;  1RDD A;  2A1S A;  2I5J A;  3CM5 A;  3LWM A;  2JGU A;  3M8Q A;  4RW8 A;  1IKY A;  3QIO A;  3OJS A;  3T1A A;  3OVN A;  4B9S A;  2QK9 A;  1TGO A;  1IKX A;  3NFA A;  1RTJ A;  3MXI A;  2FBT A;  4KKO A;  4NYN A;  3OJU A;  1NK8 A;  2G8F A;  3ZSR A;  4BDZ A;  3L2R A;  4J2B A;  1WLJ A;  4B9T A;  2JLE A;  3AVA A;  4FM2 A;  1UA0 A;  1NK4 A;  3HPH A;  4NYF A;  5CZ2 A;  3T19 A;  3VQC A;  1TV6 A;  4FJN A;  3RMB A;  3AVG A;  5HRO A;  2KZZ A;  4CJP A;  3ZT4 A;  1RBU A;  3P1G A;  3LZJ A;  3U3G A;  5HP1 A;  2HHX A;  4DTU A;  1GOC A;  2HB5 A;  5HBM A;  3VQP A;  5C42 A;  1NKE A;  2P1J A;  4YNQ A;  4JRQ A;  1C6V A;  1NJW A;  4CJS A;  3P5J A;  3V9S A;  4I9Q A;  1S6Q A;  3RMD A;  4OLB A;  4LH5 A;  3K57 A;  4B8A B;  2EX3 A;  3QIN A;  1CXQ A;  4KHU A;  4HHT A;  3HP6 A;  1U04 A;  4IFV A;  1NKB A;  2OPQ A;  4AHV A;  4DTS A;  4M45 A;  3NAE A;  1B9F A;  5C24 A;  4NCA A;  4E19 A;  1S6P A;  4RW4 A;  4NCB A;  3HL8 A;  2YHB A;  3HXM A;  3K5L A;  3CFR A;  2IDO A;  4DTR A;  3AO3 A;  4CGG A;  4HUF A;  4DLG A;  1HYS A;  1KVA A;  3RRH A;  1BQN A;  1C1B A;  4IDK A;  4CJU A;  4CEZ A;  3HM9 A;  4QOZ B;  2KFN A;  4KHY A;  1S1U A;  4B8C A;  3VQ6 A;  2IC3 A;  4RW7 A;  3CFO A;  3O3H A;  1QS4 A;  2HHQ A;  3LP1 A;  3O4Q A;  2E6M A;  4KHS A;  4XIU A;  2O4I A;  2BE2 A;  4B9N A;  3TAP A;  5C25 A;  3KD1 E;  1BIZ A;  1ITG A;  1WAF A;  4TSX A;  3L2V A;  1NK9 A;  3DI6 A;  2PY5 A;  1WSE A;  2AJQ A;  1VSE A;  2E6L A;  3LPU A;  3S3M A;  3SPZ A;  4F2R A;  3AV9 A;  4DQS A;  4IG0 A;  4DQI A;  3SUN A;  3CYM A;  4QCL A;  3CG7 A;  3HYF A;  4CHY A;  3NGI A;  1TKT A;  1S1T A;  2DFH A;  2XY7 A;  4J2E A;  1ZBH A;  1I39 A;  3KKS A;  3KTQ A;  3DYA A;  4KHN A;  2GBZ A;  1ZBF A;  4FM0 A;  4FZY A;  4OKE A;  1QSS A;  3DLG A;  4IBN A;  3NHG A;  1SL2 A;  4DSJ A;  3D0P A;  3OYK A;  1L3U A;  2D0A A;  3VQ7 A;  4BE0 A;  1XC9 A;  4F3T A;  1RBT A;  3RR7 A;  3PV8 A;  4Z4E A;  4E7I A;  1YTU A;  2Z1G A;  3ZSY A;  1ZBU A;  1SV5 A;  1BGX T;  1T05 A;  4C8O A;  3TAG A;  3UIQ A;  4FW2 A;  4M3R A;  1QSY A;  1J9A A;  4Z4C A;  1RTI A;  1F21 A;  4FK2 A;  3I0R A;  1ASU A;  4CEA A;  1RT4 A;  1S9E A;  1L3V A;  1QSL A;  3LAK A;  3LP2 A;  1Q8I A;  1WNS A;  2YNH A;  4CJK A;  4FJJ A;  4BE2 A;  3AVH A;  3OYC A;  5FRO A;  1FKO A;  2KQ2 A;  4ID5 A;  4CFB A;  2G8I A;  4CFC A;  3OS2 A;  3TWH A;  1C1C A;  3V6D A;  1O1W A;  2HNY A;  3DRR A;  2Y1I A;  4F8R A;  3HST B;  3KLE A;  4BDY A;  1KLN A;  3HO1 A;  3RRG A;  3ALY A;  5KGX A;  1L5U A;  2DFF A;  4OGC A;  3TAM A;  4FLY A;  1SUQ A;  4LSL A;  4CFA A;  3HT3 A;  3L8B A;  1JXE A;  1WSG A;  2QXF A;  4AHS A;  3O4N A;  1NK6 A;  1T7P A;  1N5Y A;  1NJX A;  4E1M A; 
#chains in the Genus database with same CATH topology
 1Z26 A;  3TAN A;  4OPJ A;  1D8Y A;  3MEE A;  4V19 S;  1XNQ K;  2CGK A;  3KZB A;  3M8P A;  5EX5 A;  1SL1 A;  2OYQ A;  4BR2 A;  3H6E A;  3OYA A;  4E89 A;  3OYB A;  2QWR A;  1CZA N;  3MMV A;  2DPN A;  1HNZ K;  2ZGY A;  3WXL A;  4EAH D;  1HPZ A;  3VF6 A;  4WFB L;  5JLF A;  2Q0R A;  3KJV A;  4DUY K;  1VSF A;  1YVU A;  1KAX A;  4E7J A;  3S41 A;  3E01 A;  4DF8 A;  3BF1 A;  1P90 A;  3N4Q A;  3UKU A;  1NJY A;  4CI6 A;  4I2Q A;  3O9T A;  1J5O A;  4DR7 K;  3NF7 A;  3ZET B;  1I3A A;  1NLV A;  1BHL A;  1D4X A;  3IAY A;  1RDU A;  3SJJ A;  4JLH A;  4K42 A;  4JKD A;  4JI8 K;  3CJB A;  3VN5 A;  3SV3 A;  3H3N O;  1VAZ A;  4ILG B;  3NF8 A;  4DTN A;  1B92 A;  1FJG K;  1JKH A;  1HNX K;  3LAM A;  2OZM A;  3VEX A;  3THX B;  3L2U A;  2GEM A;  4DB3 A;  1HQU A;  3CM6 A;  3A5L C;  3V9U A;  5DM6 L;  1U4B A;  3G6E N;  3CHW A;  2OTL N;  5EU7 A;  1HUX A;  4K8X A;  4KAZ A;  4PKG A;  3VPZ A;  1T3V A;  3L3U A;  3SQ4 A;  1KAZ A;  2PAV A;  4NLB A;  2BDP A;  1VRU A;  3AVI A;  4BRA A;  3CCS N;  2QI2 A;  4Y1C A;  4DG1 A;  4YOR A;  4CJW A;  3DLL L;  1WAJ A;  2E2Q A;  5CHI A;  5MLC Q;  3VOV A;  3NCI A;  3TAE A;  3SUQ A;  2VWJ A;  3S9H A;  4CZI A;  1HJR A;  5GAE P;  4O8K A;  5JLH A;  4FYD A;  1VSD A;  5JIC A;  1VQP N;  4MQ3 A;  1S3X A;  3ZT0 A;  3THV A;  2P9S B;  2FXU A;  3QEP A;  4X64 K;  3AO2 A;  1QHT A;  4KFB A;  2W41 A;  2HND A;  3LAL A;  4CZF A;  4A61 A;  1NGA A;  4GVM A;  4DS4 A;  4FLZ A;  2FF6 A;  5AR0 A;  4CK2 A;  3VQQ A;  4N56 A;  2X78 A;  4B1U B;  4FJ9 A;  3HJF A;  1EWQ A;  3EKU A;  1B9D A;  3MWT A;  3DXM A;  1J6Z A;  3E9O A;  3QML A;  3VEO A;  1IH7 A;  4DSF A;  1OH7 A;  3VQA A;  4F3O A;  3CER A;  3PY8 A;  4Z4F A;  5KRT A;  3TAR A;  1H1V A;  1IBM K;  3WQT A;  2O8B B;  4AHU A;  1DLO A;  3KWG A;  4ELT A;  4B1Z A;  4UY8 O;  5AQL A;  4M3Y A;  3IS9 A;  1ILY A;  3PLA A;  3WXM B;  4GW6 A;  3LDL A;  2P9U A;  3HI0 A;  4GV9 A;  3TSP A;  3VQ5 A;  3ZT1 A;  3QNN A;  1VK0 A;  1GLL O;  1WUA A;  3JYT A;  3KLI A;  4C1N K;  3HOT A;  3K59 A;  4EZ9 A;  2GWK A;  1UOC A;  3MN6 A;  4JKE A;  3AAR A;  5JS2 A;  4U7B A;  5BR8 K;  3JXU A;  3D45 A;  2P9K B;  4PKI A;  4CF0 A;  4JKF A;  1EXQ A;  2ZJR L;  2HHW A;  4BWJ A;  3ZCM A;  2HHS A;  1HX1 A;  3QET A;  1VSJ A;  4FCY A;  3ZSO A;  3HVT A;  3I8B A;  4J2A A;  5D3G A;  1SKR A;  1HRH A;  4A2A A;  4BRL A;  3T3F A;  5KQD A;  4M42 A;  3PSI A;  2GV9 A;  4N76 A;  2HVH A;  3L4I A;  4QS9 A;  2ASO A;  1ASV A;  1J54 A;  4CD1 A;  1BU6 O;  3WNE A;  1GLE G;  3SAF A;  4DTO A;  4E3S A;  3DLK A;  3VQ9 A;  3VA0 A;  4LF6 K;  3VGK A;  1GOB A;  3OYH A;  4CHP A;  4RW6 A;  3LP0 A;  4BRD A;  4FJG A;  2I7P A;  5F1X A;  3AO5 A;  4CJQ A;  3LPT A;  2F8T A;  4H4M A;  3D6R A;  1OVY A;  4H0X B;  3VTI A;  3NF6 A;  4FVM A;  4CGH A;  1BO5 O;  2FBX A;  2G8V A;  2I7N A;  1BWF O;  4KRE A;  1OH8 A;  1TVR A;  1S1X A;  2JWL A;  2D4W A;  5SZT A;  4BC2 A;  3D2E B;  1SL0 A;  1IBL K;  2HBK A;  3U8X A;  4OLA A;  4DF4 A;  1S5J A;  4A57 A;  1N6Q A;  1NGC A;  4CJ4 A;  3CC4 N;  3RSE A;  3EL2 A;  1NMN A;  1C0M A;  3FZL A;  4H5R A;  3P38 A;  3SBT A;  4CCH A;  1CLQ A;  2O8D B;  1RNH A;  4CEC A;  5M1N A;  3ZT3 A;  2LSN A;  2VGN A;  5FRM A;  4H03 B;  2D5R A;  3B8A X;  4Q5V A;  5AJ3 K;  1X9S A;  1Z6R A;  1ZC6 A;  4CIF A;  4HCC A;  4O8U A;  3MN9 A;  1U47 A;  5CYM A;  1KTQ A;  1I94 K;  3WQU A;  3HK2 A;  3ZSV A;  4CBX A;  1NK5 A;  3C6H A;  2B6A A;  2YV0 X;  4JEP A;  1T8E A;  4EZ6 A;  4DR1 K;  2FF3 B;  5FDL A;  4OGE A;  4AM7 A;  3J80 O;  4JHD B;  4DWI A;  2AP1 A;  3L2W A;  4PA1 A;  3EEQ A;  4WYB A;  1Q9Y A;  3NF9 A;  2NRZ A;  4CK1 A;  3QER A;  3V4I A;  4DU3 A;  3S3N A;  2O4G A;  4FJI A;  4CJT A;  1QVG M;  3I0S A;  5C12 A;  1XNR K;  4IOA L;  2HNZ A;  5KPR A;  3RMA A;  1BL3 A;  3THW B;  5BRD A;  1RT7 A;  3AA3 A;  1LWC A;  1RTH A;  1VSK A;  1X1P A;  3M8S A;  4BRG A;  2NUB A;  1S9G A;  3AVM A;  4CEE A;  1S1V A;  1V4T A;  3CCL N;  1GLB G;  2UXD K;  1RBR A;  3AA4 A;  4KB1 A;  2F96 A;  4E0D A;  4CIE A;  5KTQ A;  3O1W A;  4AF1 A;  5FRN A;  3K5O A;  5B8H A;  1HQE A;  2A5X A;  3EE9 A;  4CD3 A;  1QQC A;  1RDD A;  2I5J A;  2OAN A;  4A59 A;  2JGU A;  2HF4 A;  4RW8 A;  4B9S A;  3OVN A;  3WT0 A;  5BN8 A;  2V7Y A;  4BDZ A;  3F5T A;  4B9T A;  1UA0 A;  2F7T A;  4FM2 A;  2NNW A;  5EVZ A;  5CZ2 A;  3T19 A;  4BRQ A;  5AZJ B;  4HTL A;  3U4L A;  1YF5 L;  1NKE A;  4JRQ A;  4YNQ A;  4CJS A;  3E9P A;  3RMD A;  3ID6 A;  1KC8 O;  4DR3 K;  3IDH A;  4K25 A;  1CXQ A;  4IFV A;  4DTS A;  3CC2 N;  1YVN A;  5JVG L;  3CFR A;  2IDO A;  3VEV A;  3AO3 A;  1HYS A;  4DLG A;  3O9U A;  3CCM N;  2GEL A;  1WBD A;  4X66 K;  5FPE A;  1S1U A;  4KHY A;  3VQ6 A;  4BG8 A;  4RTF D;  3CFO A;  2Q0U A;  2D0O A;  4FWQ A;  5FPN A;  2O4I A;  3TAP A;  1YXQ A;  1BIZ A;  1NK9 A;  3DI6 A;  3U9D A;  3QBX A;  3SPZ A;  3HYF A;  4J2E A;  1TKT A;  1S1T A;  1I39 A;  3KKS A;  3DYA A;  1YUW A;  1VQ9 N;  4JD2 B;  1VQ4 N;  3RR7 A;  2YJF A;  1NWK A;  1YTU A;  1N36 K;  4C8O A;  1ZBU A;  1T05 A;  1HKB A;  3UIQ A;  1HKC A;  1J9A A;  4JKG B;  5AQI A;  1RTI A;  4Z4C A;  3BZK A;  1YHQ N;  4FK2 A;  4CEA A;  1L3V A;  2P9L B;  4NXM K;  3C65 A;  3LP2 A;  3FR0 A;  4LF4 K;  3LDO A;  3AVH A;  3TTC A;  2KQ2 A;  4CFB A;  2G8I A;  2IVP A;  2QXL A;  4BQZ A;  1O1W A;  2Y1I A;  4F8R A;  4BDY A;  4CW7 B;  4DR2 K;  3ALY A;  5KGX A;  1L5U A;  4I6M A;  4JK8 A;  3TAM A;  1IV0 A;  2QXF A;  3O4N A;  1T7P A;  1NJX A;  4FWP A;  3NGZ A;  4CZL A;  1N8R O;  2YKN A;  3MED A;  2VGM A;  2GUP A;  3H1Q A;  4IDH A;  1QE1 A;  5BN9 A;  1BI4 B;  5CR4 A;  3CD6 N;  4AIL C;  3CJ9 A;  1Q82 O;  5AQJ A;  3KIO A;  3CJ1 A;  5HOO A;  2YHW A;  4OKK A;  1WSJ A;  3K58 A;  4ISF A;  1VRT A;  4L8R B;  4JV5 K;  2G8W A;  1RT2 A;  4BRH A;  4DCH A;  2O8E B;  2P9N B;  3M3Z A;  3NBP A;  4HUG A;  3AA2 A;  1D5A A;  4ISG A;  4Z4I A;  5IT9 O;  1C0F A;  3MK6 A;  4EP4 A;  1BA0 A;  3H1V X;  1EKE A;  3K9K A;  4CE9 A;  5HRN A;  4CHO A;  4DV4 K;  3SJH A;  3ZX2 A;  2A1R A;  1KVB A;  4M63 C;  1SAZ A;  2ITM A;  3OYJ A;  5GAD P;  3CQX A;  4FWS A;  2IS3 A;  4H0T B;  3GL1 A;  3O6W A;  1JLF A;  1R59 O;  4RG8 A;  3VGM A;  4Z94 A;  5GIP A;  4G1Q A;  2HBJ A;  1MWK A;  4YFU A;  1IJJ A;  1ATN A;  3RVC A;  4LFA K;  1RDA A;  4ID1 A;  4J2D A;  3V1R A;  3TR8 A;  5AQS A;  4IO8 A;  4N47 A;  4E7K A;  5AQN A;  4H5T A;  4BR9 A;  4BDP A;  3SPY A;  1TKX A;  4H5W A;  3LDN A;  4FPB A;  4FZZ A;  4CGD A;  1NKC A;  1WSH A;  3KK2 A;  3SYZ A;  2KW4 A;  2DFE A;  3VQ8 A;  4CZH A;  1X9W A;  3GOI A;  3ENO A;  3G71 N;  2Q31 A;  3WXI A;  5EXW A;  1XC3 A;  4U67 L;  3T1H K;  3O3G A;  2NRH A;  3VGL A;  1IG8 A;  1DTQ A;  4LF5 K;  3O8M A;  2E1Y A;  4DV2 K;  4DQQ A;  3N4P A;  2UXC K;  3NH1 A;  4GMJ B;  3TTD A;  4OPA A;  2XY5 A;  3BF3 A;  3U9Z A;  3J7Y P;  1A5W A;  4C8K A;  4CJR A;  1X9J A;  1L3T A;  5T7B A;  3K9J A;  3ZSZ A;  3VQ4 A;  5JVH L;  1HR0 K;  3LP3 A;  1GLJ O;  3J7A P;  4CJE A;  1VHX A;  4RWT A;  2VQE K;  1C0T A;  2Z1I A;  3THX A;  4FJ8 A;  3J8A A;  2KZM A;  4FK0 A;  2YHA A;  2GX9 A;  1N32 K;  1XWL A;  4M3T A;  3IG1 A;  3CPE A;  4B9L A;  1DGK N;  1TUU A;  1MU2 A;  1Z05 A;  2HHU A;  3LM9 A;  3C6A A;  1ZYQ A;  4AM6 A;  1BCO A;  4CER A;  3M6G A;  4NCG A;  1U6Z A;  5FPD A;  3KLF A;  3B6O A;  2W6K A;  4LFC K;  1DTT A;  1U45 A;  4Z4H A;  2IGI A;  4CJL A;  3SV4 A;  3V9X A;  4IJA A;  3F9K A;  2E2O A;  4KTQ A;  1JJ2 M;  4FVU A;  1S1W A;  4B9M A;  4ELV A;  2Q97 A;  3ID8 A;  4JKA A;  4JS4 A;  3RMC A;  1QZ5 A;  3C6T A;  4CZE A;  3SQ1 A;  2Q36 A;  5IWA K;  3OYM A;  3CXC M;  4DQR A;  3BDP A;  5I3U A;  2E4L A;  4FLW A;  3HPG A;  3VES A;  3UKR A;  2P9I B;  3QIC A;  4Y1D A;  1LW2 A;  5KQ8 A;  2YJE A;  4YDU A;  3DXK B;  4KH5 A;  3HRG A;  4IKF A;  4WQ4 C;  1WBB A;  1RT3 A;  5EOY A;  3M1F A;  4BR4 A;  4IFE A;  4QAG A;  3TSU A;  4KI6 A;  1G15 A;  4H5N A;  4K8Z A;  3IFR A;  1T03 A;  4MO4 A;  3MCA B;  2WON A;  4IWV A;  4J8F A;  1RBS A;  4DFJ A;  3MWP A;  4ZTF A;  1HNI A;  2Q3S A;  3G0Z A;  5J2M A;  1D9D A;  4MLE A;  3SK3 A;  5I9E B;  4FZX C;  5BPM A;  2UU9 K;  2V51 B;  3PUF A;  1RT6 A;  2RN2 A;  4B1Y B;  2O8B A;  3QEI A;  2QWQ A;  2ZQB A;  3FZK A;  3DLH A;  3DRP A;  4O5F A;  4DV5 K;  5DMR A;  4I2P A;  1YI2 N;  4DMN A;  4HUE A;  4CF1 A;  4EHU A;  3DM2 A;  3VF2 A;  2ITG A;  5DM7 L;  4IG3 A;  1TKD A;  4DSI A;  4OPK A;  3THY B;  4AQY K;  3VET A;  3NE6 A;  3LAN A;  4DQ8 A;  2Z1J A;  5HRR A;  5GIN A;  2OPP A;  1HNV A;  2A3Z A;  1TL3 A;  2QKB A;  1RBV A;  3ZSX A;  1YT3 A;  2OA8 A;  3NH2 A;  1BQM A;  2NLX A;  5J2Q A;  1C0U A;  2KLA A;  1HLU A;  1FKP A;  1OH6 A;  4F2S A;  4I9L A;  1BG3 A;  4H8K A;  2QWP A;  1ZXO A;  4DTX A;  3R3L A;  4A5A A;  2HHV A;  3EZ5 A;  4XEI A;  2UUC K;  4JI0 K;  2HF3 A;  5AQY A;  3U3Y A;  1Z25 A;  4DFK A;  4C8N A;  3ZEU A;  3BP8 A;  4FM1 A;  5AFU A;  3HM8 A;  4O0I A;  3V81 A;  3ITH A;  3LDP A;  5AZI A;  5BPL A;  1KCF A;  3J81 O;  1KSP A;  2A6A A;  2CGJ A;  4O55 A;  3ATV A;  4GV3 A;  4DV0 K;  1BA1 A;  1JLB A;  1NJZ A;  3OYF A;  1IKV A;  1U2V B;  1Q81 O;  4LH4 A;  4GKJ K;  2YI1 A;  4CBU A;  3DLE A;  2IIR A;  4DLE A;  3AVL A;  2VG7 A;  3CF5 L;  1YAG A;  4MFB A;  1HJO A;  1X3M A;  1RIL A;  4EIA A;  3LDS A;  1LWF A;  3TAQ A;  1YJ9 N;  4DQP A;  4R5P A;  5AQQ A;  5JS1 A;  4YOX A;  4GNI A;  4BRO A;  1EO1 A;  1RFQ A;  4FOE A;  5FLX O;  1J5E K;  1LAV A;  2B4J A;  3AVF A;  3LZI A;  1EET A;  1RDB A;  1WN7 A;  3CCR N;  1RGI A;  2J4R A;  4KI4 A;  1YTA A;  3NGY A;  2GWJ A;  3GG4 A;  3KK1 A;  5FPM A;  2NRX A;  4LF9 K;  1QTM A;  4DU4 A;  1E3M A;  4FWL A;  3AA5 X;  3EZW A;  3B6P A;  3VEW A;  4ZHR A;  1FK9 A;  3VER A;  4BGB A;  4JKB A;  3OYN A;  3VEZ A;  4KHP K;  4CEO A;  2H3G X;  2YHY A;  3CMA N;  2A1S A;  3FZF A;  2QK9 A;  2OTJ N;  1IKX A;  2O8F A;  1RTJ A;  1QQM A;  2FBT A;  3OJU A;  3R6M A;  2WBN A;  4JHD A;  2W40 A;  4NYN A;  5AQV A;  1ZBS A;  1WLJ A;  2JLE A;  3AVA A;  3BY5 A;  4L3Q A;  3HPH A;  3VQC A;  1N33 K;  1TV6 A;  3A5N C;  1E4G T;  2WC9 A;  3C0B A;  4FJN A;  3RMB A;  3CCE N;  3ZT4 A;  1RBU A;  3P1G A;  4FL9 A;  2HHX A;  4JI6 K;  1VQO N;  5HBM A;  4BVO A;  3V9S A;  2PBD A;  5AQO A;  1DT9 A;  1S6Q A;  4C23 A;  1FW6 A;  1NU0 A;  4BRF A;  3DXM B;  3Q7C A;  3HP6 A;  1QVF M;  1U04 A;  2OPQ A;  4M45 A;  4JKH A;  3NAE A;  1QZ6 A;  5BRF A;  4NCB A;  3HL8 A;  4WQ5 A;  5C15 A;  3K5L A;  4CGG A;  2ZGZ A;  4FWR A;  1BQN A;  3RRH A;  4CJU A;  4CEZ A;  3HM9 A;  3QB0 A;  4B8C A;  1VQK N;  2IC3 A;  4RW7 A;  1QS4 A;  4KH4 A;  3LP1 A;  2BTF A;  2FSK A;  1WAF A;  4TSX A;  2PY5 A;  4YDU C;  2E6L A;  3LPU A;  1GLD G;  4IG0 A;  3CYM A;  2DFH A;  1K8A O;  4MDA A;  4XH1 A;  4KHN A;  4FM0 A;  1QHA A;  4B1X B;  4IBN A;  3NHG A;  1SL2 A;  4DSJ A;  3D0P A;  1K8K A;  1T44 A;  1SQK A;  2D0A A;  3VQ7 A;  4HWI A;  2NRR A;  4E7I A;  3T7Z A;  3A0I X;  5BR9 A;  3IMX A;  3G4S N;  4JI7 K;  3I0R A;  2A41 A;  1QSL A;  4ILH A;  1NBW A;  5FRO A;  4CFC A;  4FPA A;  3SAH A;  3V6D A;  3FZH A;  2QW9 A;  5C2D A;  2HNY A;  2QA4 N;  1Y64 A;  3HST B;  3O1B A;  2DFF A;  4OGC A;  1GLC G;  3ENH A;  5LY3 A;  4FLY A;  1JXE A;  3TPQ A;  1N5Y A;  1XUP O;  1X9M A;  4CF2 A;  2NRW A;  4AHT A;  4E7L A;  3AVC A;  2XHB A;  2ZE2 A;  4FOI A;  4F9O A;  4QS8 A;  2PYJ A;  4M7Y A;  5KPT A;  3VMF B;  3CI5 A;  2IAJ A;  1LAW A;  2X74 A;  4BGA A;  2G8H A;  3AVN A;  3IUC A;  3O80 A;  5AQH A;  3CCJ N;  3PO5 A;  2HHT A;  1MDU B;  3D2F B;  3H08 A;  2E2P A;  4FJ7 A;  1REV A;  3VEN A;  2QWL A;  1CZ9 A;  4CJV A;  4CJ5 A;  3V1O A;  5ADX A;  1MWM A;  1TK0 A;  2D0P A;  4EHT A;  3VEY A;  1L3S A;  5CZ1 A;  3OYE A;  2FC0 A;  3V1Q A;  1IKW A;  2UUA K;  1KD1 O;  1Y97 A;  4CGJ A;  3C94 A;  3SZ2 A;  1P8Z A;  2X6S A;  3CJC A;  3PX6 A;  2ASP A;  3FLC O;  2HBL A;  3GDQ A;  4CGI A;  4W5R A;  1NNE A;  3VQE A;  4GKK K;  3FFK B;  3MXJ A;  2CH5 A;  1BIU A;  3CC7 N;  2ZD1 A;  1JL1 A;  1Q7Y O;  4CHZ A;  2QEX N;  1RDC A;  4HCB A;  1W7A A;  2P9N A;  3RTV A;  3V9W A;  2IOC A;  5KGW A;  2ETJ A;  1TAQ A;  4DFM A;  4CJ7 A;  3CCQ N;  1JCG A;  3WUH A;  4CVN E;  3WNF A;  1IBK K;  4NO7 A;  1YIJ N;  4X65 K;  1WOQ A;  3C7N B;  4FWO A;  2E2N A;  3K0S A;  3I55 N;  5LJW A;  3OTO K;  1ZBL A;  5CYQ A;  3SMS A;  1LW0 A;  3SBG A;  4DKW A;  3L4Q A;  4C8M A;  1Q9X A;  3WEE B;  3RWU A;  1RT5 A;  1VQ8 N;  4M7X A;  5BPN A;  3QFU A;  2E88 A;  4O4G A;  2P51 A;  2QTD A;  1TYQ B;  4M3W A;  5BRE A;  2KKZ A;  4GVE A;  4KTZ A;  1SKW A;  4FJX A;  1JLG A;  1EWR A;  3MDQ A;  3OS1 A;  3WNH A;  3WNG A;  4BR5 A;  1GLA G;  3U6F A;  1TK8 A;  3EYZ A;  2E5L K;  1E4F T;  4B9V A;  4YOV A;  4PUO A;  1BIS A;  5F0X A;  3QNO A;  3MEG A;  4N41 A;  1HPM A;  4M41 A;  3CPW M;  3NH0 A;  3DOL A;  3MAQ A;  1ATS A;  3QIP A;  4KRF A;  3O3F A;  2HBM A;  3E1Y A;  3CIP A;  1VSH A;  1NGE A;  1W97 L;  4KTW A;  3VA3 A;  2YNI A;  2FBV A;  4UQG A;  2O8C A;  1BDG A;  4KB0 A;  2RE2 A;  1HYV A;  4W5N A;  3QO9 A;  1NOY A;  3O5B A;  2VG5 A;  3L3V A;  4H0V B;  2F8S A;  1BOT O;  4AHR A;  4N5S A;  5DK5 A;  4JS5 A;  3CME N;  5EY4 A;  3FGU A;  3QEW A;  4LD0 A;  3OS0 A;  2ZJP L;  2RHK A;  4DS5 A;  2P9P A;  3BEX A;  1IO2 A;  1VSL A;  5KI6 A;  3L2Q A;  1T6C A;  1RCH A;  4WFA L;  3ZX0 A;  4FJH A;  2GUI A;  4CZM A;  3LL3 A;  4PQU A;  4FJK A;  2JWK A;  3ZT2 A;  4NXN K;  2XY8 A;  5AFU H;  4BC5 A;  3AVJ A;  3TAB A;  3WXK A;  2Z1H A;  2ZJQ L;  1RT1 A;  1U48 A;  3D7E O;  4LSN A;  4MDB A;  3UB5 A;  4CEF A;  5HRP A;  3IKM A;  4JAX A;  2RPI A;  4BRE A;  3OHR A;  3PIP L;  1TUY A;  3ULE B;  4A5B A;  1ASW A;  2EHG A;  1JCE A;  3PSF A;  3FZM A;  4ELU A;  4RCH A;  3OYG A;  3DXK A;  4B3O A;  2IVN A;  3DRS A;  3AGK A;  5J1E A;  2UXB K;  3NDK A;  2OPS A;  3BGR A;  3SQ2 A;  3MEC A;  4WF9 L;  3CCU N;  3SCX A;  1C1A A;  2PYL A;  3TI0 A;  4OKJ A;  3ZET A;  3ASM A;  3C95 A;  3AO4 A;  5HRS A;  3ATU A;  4FLV A;  5M1K A;  1NG9 A;  4CEQ A;  3M5R A;  5AQF A;  4LY7 A;  3SQ0 A;  2WTU A;  2D0B A;  3G10 A;  2FBY A;  3ENB A;  3HSC A;  4CBW A;  1JLA A;  4JK9 A;  4DSK A;  3NMU A;  4M3X A;  3K5M A;  5TKW A;  3HBT A;  2ZM6 K;  1VQ7 N;  3O08 A;  3CQY A;  2E20 A;  4IOC L;  2D0C A;  4Z4G A;  2OZS A;  3KD5 E;  2KFN A;  5CE3 A;  4O44 A;  1JXB A;  4CZK A;  3ISN C;  4CEB A;  2F4V K;  1KFS A;  1BUP A;  4HTU A;  1EX4 A;  1G99 A;  3OA9 A;  3QEX A;  4JYA K;  4B1W B;  4BRP A;  4QS7 A;  4H0P A;  3HVR A;  1KVC A;  4PL8 A;  4FK4 A;  1M90 O;  3CET A;  4ICL A;  4KH6 A;  2OPR A;  4CF8 A;  1KXP A;  4DSE A;  4IOX A;  4DTJ A;  1NGG A;  4CHQ A;  1X3N A;  4IEI A;  5AQG A;  3PX0 A;  2P9S A;  4OJR A;  1ATR A;  4W5O A;  2R7Y A;  3I8D A;  3A2F A;  1NMD A;  4DTM A;  3SAG A;  5LMN K;  2A42 A;  2GTD A;  4B1V A;  1UAX A;  3EE8 A;  2P5G A;  4CED A;  5SWM A;  2G8K A;  1NGI A;  4JI2 K;  1ESV A;  4H5V A;  5GAH P;  1IG9 A;  2G8U A;  2P5O A;  1VQ5 N;  4E7H A;  1TK5 A;  5E26 A;  4CES A;  4I7F A;  2VQF K;  4IXC A;  4W5Q A;  3CM5 A;  3LWM A;  3M8Q A;  3OJS A;  1IKY A;  3QIO A;  4FSV A;  3T1A A;  3NFA A;  3ZSR A;  3L2R A;  4NYF A;  1SZ2 A;  4BR7 A;  3AVG A;  5HRO A;  1U2V A;  4CJP A;  4DV3 K;  1GOC A;  3VQP A;  3F9M A;  3VF4 A;  1C6V A;  3P5J A;  4I9Q A;  4LF7 K;  1VQL N;  3KHY A;  3K57 A;  4B8A B;  2EX3 A;  3QIN A;  2P9K A;  3KWI A;  1NKB A;  4AHV A;  4G9Z A;  1B9F A;  4YOY A;  5C24 A;  4NCA A;  2PFU A;  2YHB A;  3R1X A;  3MCP A;  4HUF A;  1KVA A;  1C1B A;  4BG9 A;  4LC9 B;  4IDK A;  3T1Y K;  4QOZ B;  3TSQ A;  3O3H A;  4B3S K;  2HHQ A;  4A62 A;  3O4Q A;  3W0L A;  4KHS A;  3GBT A;  4YY3 K;  5LMU K;  4JN4 A;  1WB9 A;  3JAM O;  3TTF A;  1Q18 A;  2V52 B;  1WSE A;  2AJQ A;  3QBW A;  1VSE A;  3O4W A;  4F2R A;  4QCL A;  4DQI A;  3SUN A;  3CG7 A;  4CHY A;  3NGI A;  1VQM N;  1ZBH A;  4DV1 K;  2YHX A;  3UKR B;  1QSS A;  3EO3 A;  2VWB A;  1XMQ K;  4K43 A;  1L3U A;  4BE0 A;  3PV8 A;  4C1N I;  4Z4E A;  3DWL A;  3ZSY A;  1BGX T;  5ADX H;  3P4I A;  4FWM A;  3UKU B;  3L6Q A;  1F21 A;  1KQS M;  3MN5 A;  4CZJ A;  3AAQ A;  1ASU A;  4GV6 A;  1RT4 A;  1YJN N;  3LAK A;  3VTH A;  1WNS A;  1OKJ A;  4CJK A;  3WXJ A;  3OW2 M;  3OYC A;  1FKO A;  3CCV N;  2FSN A;  3MX2 A;  4ID5 A;  1OH5 A;  1C1C A;  2KHO A;  4IZ9 A;  2E1Z A;  3DRR A;  2UYT A;  3HO1 A;  2CGL A;  4KBO A;  5AQU A;  3D2E A;  4B9Q A;  1SUQ A;  4CFA A;  3L8B A;  1NK6 A;  5AQZ A;  1SS6 A;  4E1M A;  3C6U A;  1HYZ A;  5AQT A;  1D9F A;  2KTQ A;  3L0Q A;  3KVG A;  5K14 A;  4F4K A;  5E84 A;  1WSI A;  2O8D A;  3A5M C;  4RW9 A;  2HHH K;  4WE1 A;  1UA1 A;  3EN9 A;  4M3Z A;  4Z0U A;  3CQ8 A;  4CIG A;  4O0J A;  3SNN A;  3QES A;  3G25 A;  4B08 A;  2OCE A;  3HZ6 A;  3HP9 A;  1VQ6 N;  1TAU A;  2XRI A;  1VSM A;  3DAW A;  4Y0W A;  4R79 A;  2IVO A;  4PKH A;  4PL7 A;  5F2R A;  5AQM A;  2A40 A;  3OBW A;  1FXX A;  4KV8 A;  2RF2 A;  2BGG A;  2WOM A;  4BY9 C;  5TKY A;  3SUP A;  4YOT A;  3A8Y A;  1HKG A;  4AHC A;  2ASM A;  4C8L A;  1UWB A;  3DLB A;  1NGF A;  5C2F A;  4BWM A;  4BRC A;  1WSF A;  5KPZ A;  2FSJ A;  4JI4 K;  3THW A;  3AVK A;  3AAP A;  5M1F A;  4W5T A;  3ZEU B;  4WCE L;  3RR8 A;  4B9U A;  2QWO A;  4ZTJ A;  3BUZ B;  5AZI B;  2V7Z A;  1TL1 A;  4ISE A;  2XY6 A;  2VCP A;  3K5N A;  3PO4 A;  3OYL A;  1NGH A;  1JLQ A;  3QFP A;  5AQK A;  3GE1 A;  1XHZ A;  3BZC A;  1XMO K;  5AQX A;  4KO0 A;  5M1O A;  4X62 K;  2QKK A;  3HPO A;  3D2F A;  4H0O A;  3PX4 A;  3MX5 A;  2P9U B;  4FW1 A;  2XO7 A;  1SKS A;  3ZX3 A;  3TU5 A;  5C0Y A;  2BUP A;  1HNW K;  2F9W A;  4YOW A;  3KLG A;  4PWD A;  3VQB A;  5AZJ A;  2ATQ A;  2DTU A;  3LDQ A;  5HL7 L;  4FO0 A;  2KFZ A;  1LV5 A;  3P83 D;  2ZF5 O;  4FJL A;  5A2Q O;  4FLX A;  1EQY A;  5KRS A;  1ZBI A;  3V9Z A;  4DTP A;  1MA9 B;  4CF9 A;  3JS6 A;  4DV7 K;  3OYD A;  5I42 A;  3DOK A;  2NZT A;  5AQR A;  4JNE A;  4DHY A;  2NRT A;  2HMI A;  1QQO A;  3E9L A;  3A5O C;  3IRX A;  4JI5 K;  4CHN A;  1YIT N;  1W9H A;  2O8F B;  1NGD A;  4DU1 A;  3ZSQ A;  3EY1 A;  4FLT A;  3KK7 A;  4BC4 A;  1KLM A;  1V4S A;  2EWS A;  3ZSW A;  2YNF A;  3O9Q A;  3W3D A;  4OPH A;  4DSL A;  3KK3 A;  4CJF A;  4YOU A;  1CXU A;  1NK0 A;  3DMJ A;  3QEV A;  4IFY A;  3QLH A;  3C7N A;  3KLH A;  1S22 A;  4BE1 A;  3H3O B;  1GOA A;  1NOZ A;  4JRP A;  4DR6 K;  3CFP A;  5CY4 A;  4JD2 A;  3SLC A;  4LF8 K;  2HST A;  1HMV A;  1T6D A;  5LL6 Z;  4CZG A;  4JKG A;  1VQN N;  3I33 A;  2DY4 A;  3WEE A;  2BAN A;  2P9L A;  4H0Y B;  1R0A A;  2YKM A;  1TYQ A;  3RSE B;  4FXD A;  4H4O A;  1W2B M;  1LWE A;  1CZB A;  3M8R A;  2VYP A;  1VSI A;  4FJ5 A;  4FJM A;  3K2P A;  2QM1 A;  1O13 A;  3HTV A;  4BR0 A;  4M3U A;  4IEE A;  4Q0B A;  4BRK A;  1XHX A;  2VG6 A;  4O5B A;  4FWK A;  3R8E A;  1BI4 A;  1EP4 A;  4PHT X;  1K8K B;  1J53 A;  5J2P A;  3ULD A;  4CGF A;  4XH5 A;  4E1J A;  3SMP A;  3R9P A;  3S3O A;  4KHW A;  3P39 A;  2UUB K;  2YNG A;  4IO9 L;  3VQD A;  1KRP A;  1A5V A;  2QWM A;  2X6N A;  2PZS A;  2O8E A;  2NRV A;  3JSM A;  1JL2 A;  1C0G A;  1K9M O;  1OVQ A;  1W0H A;  5AQW A;  1JCF A;  1U49 A;  1K73 O;  4PY5 A;  5H1S Q;  1K6Y A;  2HVI A;  1JLE A;  4CJ3 A;  3ZLJ A;  4K41 A;  4DFP A;  4NLC A;  5E41 A;  1NK7 A;  1M1K O;  4NB4 A;  1GLF O;  2YCH A;  1Q86 O;  4LFB K;  4WQ4 A;  1DKG D;  3FFI A;  3AVB A;  2RKI A;  4BAC A;  4BRI A;  3F2K A;  3Q7B A;  1YJW N;  2W42 A;  3TAF A;  5AQP A;  3KKR A;  4XH4 A;  3F73 A;  1NGJ A;  4EP5 A;  3CJ7 A;  4ILJ A;  3LWL A;  5M1Q A;  5HLF A;  1NM1 A;  2B5J A;  1BCM A;  2ZWH A;  4B3M K;  4MLH A;  1XI1 A;  1XQS C;  4JK7 A;  4A2B A;  3ULE A;  4OX9 K;  1JLC A;  2VWK A;  4JI3 K;  3ZYY X;  4HVJ A;  3DJC A;  1DEJ A;  3MN7 A;  3DLR A;  1KFD A;  2FLO A;  3SUO A;  1NJI O;  2E8A A;  4WQ5 C;  1KAY A;  2Y1J A;  1A5X A;  4AH9 A;  4KPY A;  2CH6 A;  1RDW X;  1N34 K;  4CFD A;  4E1N A;  4JI1 K;  3NVK A;  4B3T K;  3OYI A;  4OVL A;  3E66 A;  4FLU A;  2HW3 A;  2AA4 A;  3H46 O;  4CK3 A;  3HOS A;  5JMV A;  4OO1 J;  2D1K A;  3OY9 A;  4DUZ K;  3SI6 A;  4KHQ A;  4BQL A;  5J2N A;  1RTD A;  4GY2 B;  3AO1 A;  5BRH A;  1TKZ A;  3UE5 A;  2WFB A;  4JKC A;  3MXM A;  4BRN A;  1TGO A;  3MXI A;  4KKO A;  1NK8 A;  2G8F A;  2YX6 A;  4J2B A;  5M1P A;  1NK4 A;  3AY9 A;  2KZZ A;  3PIO L;  3LZJ A;  5HP1 A;  3NVM A;  3U3G A;  4DV6 K;  4DTU A;  2HB5 A;  5C42 A;  2P1J A;  1NJW A;  4BVP A;  5ELZ A;  4OLB A;  4LH5 A;  5LJV A;  2P9I A;  5GAG P;  4KHU A;  4HHT A;  3CJA A;  4E19 A;  1S6P A;  4RW4 A;  3O9R A;  3HXM A;  4DTR A;  1QQN A;  4I6M B;  2QWN A;  1S72 N;  5GIO A;  3H45 C;  4YHH K;  2HMP A;  3OBY A;  3J7Z O;  2E6M A;  4FWN A;  4XIU A;  2BE2 A;  4B9N A;  4MO5 A;  2Q2R A;  5C25 A;  3KD1 E;  2F9T A;  1ITG A;  4B3R K;  3L2V A;  2Q1N A;  3S3M A;  3AV9 A;  4DQS A;  2XY7 A;  3FE1 A;  3KTQ A;  4DR4 K;  1NGB A;  1LCU A;  2GBZ A;  1ZBF A;  2O8C B;  4FZY A;  4OKE A;  3O9S A;  3DLG A;  3EKS A;  3P31 A;  3I56 N;  3OYK A;  4F3T A;  1XC9 A;  4K0K K;  1RBT A;  2HOE A;  4BRM A;  4EFH A;  1LOT B;  2Z1G A;  1SV5 A;  3T69 A;  3TAG A;  4BC3 A;  4FW2 A;  4M3R A;  1QSY A;  5C10 A;  3THY A;  3QDK A;  1S9E A;  4WFN L;  4DR5 K;  1Q8I A;  2YNH A;  2W6L A;  4FJJ A;  4BE2 A;  3OS2 A;  2BH1 A;  3TWH A;  2P9P B;  3AGR A;  4IJN A;  3KLE A;  1KLN A;  3LM2 A;  3RRG A;  4LSL A;  3HT3 A;  1WSG A;  4AHS A;  2WUS A; 
#chains in the Genus database with same CATH homology
 1Z26 A;  3C6U A;  4CF2 A;  4OPJ A;  3TAN A;  3MEE A;  1D8Y A;  1HYZ A;  4AHT A;  3NGZ A;  4E7L A;  3AVC A;  1D9F A;  2KTQ A;  3M8P A;  2YKN A;  1SL1 A;  3MED A;  2XHB A;  2OYQ A;  1QE1 A;  1BI4 B;  2ZE2 A;  5K14 A;  4F4K A;  1WSI A;  3OYA A;  4E89 A;  3OYB A;  4AIL C;  4RW9 A;  3KIO A;  4WE1 A;  1UA1 A;  4M3Z A;  2PYJ A;  4OKK A;  1WSJ A;  4Z0U A;  3K58 A;  3CQ8 A;  4CIG A;  4O0J A;  3SNN A;  1VRT A;  1HPZ A;  4L8R B;  3QES A;  2IAJ A;  4B08 A;  2G8W A;  1LAW A;  3KJV A;  2X74 A;  1RT2 A;  3HP9 A;  1TAU A;  1VSF A;  2XRI A;  1VSM A;  3AVN A;  2G8H A;  3NBP A;  1YVU A;  3AA2 A;  4HUG A;  1X9M A;  3PO5 A;  1D5A A;  2HHT A;  4Z4I A;  4E7J A;  3H08 A;  4EP4 A;  4FJ7 A;  1REV A;  1EKE A;  4CE9 A;  5HRN A;  3E01 A;  4CHO A;  1CZ9 A;  4CJV A;  4DF8 A;  4CJ5 A;  1NJY A;  3V1O A;  4I2Q A;  4KV8 A;  1FXX A;  1J5O A;  2RF2 A;  2A1R A;  2BGG A;  1KVB A;  2WOM A;  1TK0 A;  3NF7 A;  3SUP A;  1I3A A;  3OYJ A;  4AHC A;  1L3S A;  1BHL A;  5CZ1 A;  3OYE A;  2FC0 A;  3IAY A;  2IS3 A;  3V1Q A;  1IKW A;  3SJJ A;  4JLH A;  1JLF A;  4RG8 A;  3VN5 A;  3SV3 A;  4C8L A;  1UWB A;  1Y97 A;  4DTN A;  3NF8 A;  3DLB A;  1B92 A;  1JKH A;  4G1Q A;  3LAM A;  2OZM A;  4BWM A;  4CGJ A;  3C94 A;  3L2U A;  3SZ2 A;  1WSF A;  2X6S A;  1HQU A;  3CM6 A;  4YFU A;  3V9U A;  3AVK A;  3PX6 A;  1U4B A;  4W5T A;  1RDA A;  4ID1 A;  4CGI A;  3V1R A;  4W5R A;  4J2D A;  3RR8 A;  5EU7 A;  3TR8 A;  4B9U A;  4Z4F A;  4N47 A;  4E7K A;  3VQE A;  4K8X A;  4KAZ A;  4ZTJ A;  4BDP A;  3SPY A;  1TL1 A;  1TKX A;  3L3U A;  3MXJ A;  2XY6 A;  3K5N A;  3SQ4 A;  3PO4 A;  1BIU A;  4FZZ A;  4CGD A;  3OYL A;  1WSH A;  1NKC A;  2BDP A;  1JLQ A;  1JL1 A;  2KW4 A;  2ZD1 A;  3KK2 A;  1VRU A;  4CHZ A;  3AVI A;  3SYZ A;  2DFE A;  1RDC A;  1XHZ A;  3VQ8 A;  4DG1 A;  4Y1C A;  4CJW A;  4HCB A;  4KO0 A;  1WAJ A;  3RTV A;  3V9W A;  2QKK A;  1X9W A;  2IOC A;  3HPO A;  5KGW A;  3NCI A;  3PX4 A;  3TAE A;  2ETJ A;  4FW1 A;  2XO7 A;  1TAQ A;  2VWJ A;  3SUQ A;  3S9H A;  1SKS A;  4DFM A;  3O3G A;  1HJR A;  1DTQ A;  4FYD A;  1VSD A;  4DQQ A;  3WNF A;  4MQ3 A;  3ZT0 A;  3NH1 A;  4GMJ B;  3THV A;  3KLG A;  4PWD A;  2XY5 A;  3VQB A;  3QEP A;  1A5W A;  2ATQ A;  1QHT A;  3AO2 A;  4CJR A;  4C8K A;  2DTU A;  2KFZ A;  1L3T A;  1LV5 A;  3P83 D;  4KFB A;  2HND A;  1ZBL A;  3LAL A;  5T7B A;  5CYQ A;  4FJL A;  3ZSZ A;  3VQ4 A;  3LP3 A;  4FLX A;  4GVM A;  1LW0 A;  4DS4 A;  4CJE A;  4FLZ A;  5KRS A;  1ZBI A;  3V9Z A;  1C0T A;  4CK2 A;  3VQQ A;  2Z1I A;  4DTP A;  4N56 A;  4C8M A;  2X78 A;  4FJ8 A;  4CF9 A;  4FK0 A;  4FJ9 A;  2KZM A;  1Q9X A;  2YHA A;  3RWU A;  3HJF A;  1RT5 A;  3OYD A;  1B9D A;  5I42 A;  1XWL A;  3DOK A;  4O4G A;  2P51 A;  4M3T A;  4M3W A;  3IG1 A;  4B9L A;  1MU2 A;  4KTZ A;  1IH7 A;  2HHU A;  4DSF A;  1ZYQ A;  2HMI A;  1SKW A;  4FJX A;  1BCO A;  4CER A;  1JLG A;  3VQA A;  4F3O A;  4NCG A;  3IRX A;  3PY8 A;  3OS1 A;  3WNH A;  3B6O A;  3WNG A;  3KLF A;  5KRT A;  1DTT A;  4CHN A;  3TAR A;  1U45 A;  4Z4H A;  3U6F A;  1W9H A;  1TK8 A;  3EYZ A;  4DU1 A;  2IGI A;  4AHU A;  4CJL A;  3SV4 A;  1DLO A;  3ZSQ A;  3EY1 A;  4FLT A;  3V9X A;  3F9K A;  4B9V A;  4ELT A;  4KTQ A;  4PUO A;  1BIS A;  1KLM A;  3QNO A;  3MEG A;  4N41 A;  4M3Y A;  1S1W A;  4M41 A;  4B9M A;  3IS9 A;  4ELV A;  3ZSW A;  3NH0 A;  2YNF A;  3DOL A;  4JS4 A;  4DSL A;  4GW6 A;  3MAQ A;  3QIP A;  4CJF A;  3KK3 A;  1CXU A;  3RMC A;  1NK0 A;  3C6T A;  4KRF A;  3DMJ A;  3O3F A;  3SQ1 A;  3QEV A;  3VQ5 A;  3ZT1 A;  1VSH A;  3OYM A;  3QNN A;  1VK0 A;  4DQR A;  3BDP A;  5I3U A;  3JYT A;  2E4L A;  4KTW A;  3KLI A;  3HPG A;  4FLW A;  3VA3 A;  2YNI A;  2FBV A;  4IFY A;  3K59 A;  4EZ9 A;  1UOC A;  4UQG A;  3QLH A;  5JS2 A;  4KB0 A;  3KLH A;  3D45 A;  1LW2 A;  4Y1D A;  4BE1 A;  1HYV A;  1GOA A;  4W5N A;  1NOZ A;  4JRP A;  3CFP A;  3QO9 A;  5CY4 A;  1NOY A;  4CF0 A;  1HMV A;  4IKF A;  2VG5 A;  1EXQ A;  3L3V A;  2HHW A;  1RT3 A;  4BWJ A;  3ZCM A;  2HHS A;  2F8S A;  3QET A;  1VSJ A;  4QAG A;  4AHR A;  4FCY A;  4KI6 A;  1G15 A;  3ZSO A;  2DY4 A;  4N5S A;  3HVT A;  5DK5 A;  4JS5 A;  2BAN A;  4J2A A;  5D3G A;  1SKR A;  1HRH A;  4K8Z A;  1R0A A;  3QEW A;  4LD0 A;  3OS0 A;  1T03 A;  2YKM A;  3T3F A;  4FXD A;  4H4O A;  4DS5 A;  4M42 A;  2WON A;  4DFJ A;  1RBS A;  2GV9 A;  1LWE A;  4ZTF A;  4N76 A;  1IO2 A;  1CZB A;  1HNI A;  2Q3S A;  3M8R A;  1VSL A;  3G0Z A;  5J2M A;  1D9D A;  1VSI A;  5KI6 A;  3L2Q A;  1RCH A;  4FJ5 A;  2HVH A;  4FJM A;  3K2P A;  4FZX C;  4FJH A;  2GUI A;  1ASV A;  1J54 A;  4PQU A;  4FJK A;  4M3U A;  3PUF A;  3WNE A;  1RT6 A;  3ZT2 A;  2RN2 A;  4Q0B A;  4DTO A;  3QEI A;  2XY8 A;  1XHX A;  2VG6 A;  2ZQB A;  3AVJ A;  4E3S A;  3TAB A;  2Z1H A;  4O5B A;  3DLK A;  3VQ9 A;  1RT1 A;  3VA0 A;  3DLH A;  3DRP A;  1U48 A;  1BI4 A;  1EP4 A;  1GOB A;  5DMR A;  3OYH A;  4I2P A;  4CHP A;  1J53 A;  4DMN A;  4LSN A;  4RW6 A;  4HUE A;  5J2P A;  4CF1 A;  3LP0 A;  4CEF A;  3DM2 A;  5HRP A;  4FJG A;  3ULD A;  4CGF A;  3AO5 A;  3S3O A;  4KHW A;  2ITG A;  4CJQ A;  2RPI A;  3LPT A;  2YNG A;  2F8T A;  4IG3 A;  1TKD A;  4DSI A;  4OPK A;  3VQD A;  4H4M A;  1KRP A;  1A5V A;  3NF6 A;  4FVM A;  4CGH A;  1ASW A;  2EHG A;  2FBX A;  2X6N A;  3NE6 A;  2G8V A;  2PZS A;  4ELU A;  3LAN A;  3OYG A;  3JSM A;  1JL2 A;  4B3O A;  3DRS A;  1W0H A;  1U49 A;  4KRE A;  5J1E A;  4PY5 A;  1TVR A;  2Z1J A;  1K6Y A;  1S1X A;  2HVI A;  1JLE A;  5HRR A;  5SZT A;  2OPP A;  1HNV A;  4CJ3 A;  3NDK A;  2OPS A;  3BGR A;  3SQ2 A;  3MEC A;  1TL3 A;  4DFP A;  2QKB A;  1SL0 A;  4OLA A;  1RBV A;  5E41 A;  3ZSX A;  1C1A A;  1YT3 A;  4DF4 A;  3SCX A;  1NK7 A;  2OA8 A;  1S5J A;  2PYL A;  3TI0 A;  4OKJ A;  3ASM A;  3C95 A;  3AO4 A;  5HRS A;  1BQM A;  3NH2 A;  1N6Q A;  4CJ4 A;  5J2Q A;  1C0U A;  1C0M A;  4F2S A;  1FKP A;  4I9L A;  4CCH A;  1CLQ A;  4FLV A;  4H8K A;  3FFI A;  1RNH A;  4CEC A;  3AVB A;  4CEQ A;  4LY7 A;  3SQ0 A;  2RKI A;  3ZT3 A;  2LSN A;  2D0B A;  4DTX A;  5FRM A;  2D5R A;  3G10 A;  4BAC A;  2FBY A;  4Q5V A;  1X9S A;  2HHV A;  3EZ5 A;  1JLA A;  4CIF A;  4DSK A;  4HCC A;  3U3Y A;  1Z25 A;  4DFK A;  4C8N A;  4M3X A;  2W42 A;  3K5M A;  1U47 A;  5CYM A;  1KTQ A;  4FM1 A;  3TAF A;  3HK2 A;  3ZSV A;  1NK5 A;  3KKR A;  2D0C A;  2B6A A;  4Z4G A;  4O0I A;  2YV0 X;  3F73 A;  3V81 A;  2OZS A;  3ITH A;  4O44 A;  1T8E A;  1JXB A;  3KD5 E;  3ISN C;  4EZ6 A;  4CEB A;  1KFS A;  4EP5 A;  1KCF A;  4HTU A;  5FDL A;  3LWL A;  1EX4 A;  4OGE A;  5HLF A;  1KSP A;  2B5J A;  1BCM A;  3QEX A;  4DWI A;  4O55 A;  3L2W A;  1XI1 A;  4PA1 A;  1Q9Y A;  3HVR A;  1JLC A;  1KVC A;  2VWK A;  3NF9 A;  4CK1 A;  3QER A;  3V4I A;  1JLB A;  4DU3 A;  3S3N A;  4HVJ A;  2O4G A;  1NJZ A;  3OYF A;  1IKV A;  4FJI A;  4LH4 A;  4CJT A;  4FK4 A;  3DLR A;  3DLE A;  4ICL A;  2OPR A;  4CF8 A;  4DLE A;  1KFD A;  3AVL A;  2VG7 A;  3I0S A;  4DSE A;  3SUO A;  2HNZ A;  4MFB A;  4DTJ A;  1RIL A;  1A5X A;  4CHQ A;  3LDS A;  2Y1J A;  4AH9 A;  3RMA A;  1BL3 A;  4KPY A;  3PX0 A;  1LWF A;  4OJR A;  4CFD A;  4E1N A;  3TAQ A;  4DQP A;  3AA3 A;  1RT7 A;  4R5P A;  5JS1 A;  1LWC A;  1RTH A;  4W5O A;  1VSK A;  1X1P A;  3M8S A;  2R7Y A;  3OYI A;  1LAV A;  2B4J A;  3AVF A;  3LZI A;  3I8D A;  3A2F A;  4OVL A;  1EET A;  1RDB A;  1WN7 A;  2NUB A;  4DTM A;  4FLU A;  4KI4 A;  1S9G A;  3AVM A;  1YTA A;  3NGY A;  4CEE A;  1S1V A;  3KK1 A;  2HW3 A;  4CK3 A;  1QTM A;  1RBR A;  1UAX A;  4DU4 A;  2P5G A;  4CED A;  5SWM A;  3OY9 A;  2G8K A;  3SI6 A;  4KHQ A;  3AA4 A;  4KB1 A;  2F96 A;  3AA5 X;  4E0D A;  3B6P A;  4ZHR A;  4CIE A;  1FK9 A;  5KTQ A;  5J2N A;  1IG9 A;  1RTD A;  2G8U A;  2P5O A;  5FRN A;  3AO1 A;  3K5O A;  4E7H A;  1HQE A;  1TKZ A;  3OYN A;  1TK5 A;  4CES A;  4CEO A;  4I7F A;  4W5Q A;  3MXM A;  1QQC A;  1RDD A;  2A1S A;  2I5J A;  3CM5 A;  3LWM A;  2JGU A;  3M8Q A;  4RW8 A;  1IKY A;  3QIO A;  3OJS A;  3T1A A;  3OVN A;  4B9S A;  2QK9 A;  1TGO A;  1IKX A;  3NFA A;  1RTJ A;  3MXI A;  2FBT A;  4KKO A;  4NYN A;  3OJU A;  1NK8 A;  2G8F A;  3ZSR A;  4BDZ A;  3L2R A;  4J2B A;  1WLJ A;  4B9T A;  2JLE A;  3AVA A;  4FM2 A;  1UA0 A;  1NK4 A;  3HPH A;  4NYF A;  5CZ2 A;  3T19 A;  3VQC A;  1TV6 A;  4FJN A;  3RMB A;  3AVG A;  5HRO A;  2KZZ A;  4CJP A;  3ZT4 A;  1RBU A;  3P1G A;  3LZJ A;  3U3G A;  5HP1 A;  2HHX A;  4DTU A;  1GOC A;  2HB5 A;  5HBM A;  3VQP A;  5C42 A;  1NKE A;  2P1J A;  4YNQ A;  4JRQ A;  1C6V A;  1NJW A;  4CJS A;  3P5J A;  3V9S A;  4I9Q A;  1S6Q A;  3RMD A;  4OLB A;  4LH5 A;  3K57 A;  4B8A B;  2EX3 A;  3QIN A;  1CXQ A;  4KHU A;  4HHT A;  3HP6 A;  1U04 A;  4IFV A;  1NKB A;  2OPQ A;  4AHV A;  4DTS A;  4M45 A;  3NAE A;  1B9F A;  5C24 A;  4NCA A;  4E19 A;  1S6P A;  4RW4 A;  4NCB A;  3HL8 A;  2YHB A;  3HXM A;  3K5L A;  3CFR A;  2IDO A;  4DTR A;  3AO3 A;  4CGG A;  4HUF A;  4DLG A;  1HYS A;  1KVA A;  3RRH A;  1BQN A;  1C1B A;  4IDK A;  4CJU A;  4CEZ A;  3HM9 A;  4QOZ B;  2KFN A;  4KHY A;  1S1U A;  4B8C A;  3VQ6 A;  2IC3 A;  4RW7 A;  3CFO A;  3O3H A;  1QS4 A;  2HHQ A;  3LP1 A;  3O4Q A;  2E6M A;  4KHS A;  4XIU A;  2O4I A;  2BE2 A;  4B9N A;  3TAP A;  5C25 A;  3KD1 E;  1BIZ A;  1ITG A;  1WAF A;  4TSX A;  3L2V A;  1NK9 A;  3DI6 A;  2PY5 A;  1WSE A;  2AJQ A;  1VSE A;  2E6L A;  3LPU A;  3S3M A;  3SPZ A;  4F2R A;  3AV9 A;  4DQS A;  4IG0 A;  4DQI A;  3SUN A;  3CYM A;  4QCL A;  3CG7 A;  3HYF A;  4CHY A;  3NGI A;  1TKT A;  1S1T A;  2DFH A;  2XY7 A;  4J2E A;  1ZBH A;  1I39 A;  3KKS A;  3KTQ A;  3DYA A;  4KHN A;  2GBZ A;  1ZBF A;  4FM0 A;  4FZY A;  4OKE A;  1QSS A;  3DLG A;  4IBN A;  3NHG A;  1SL2 A;  4DSJ A;  3D0P A;  3OYK A;  1L3U A;  2D0A A;  3VQ7 A;  4BE0 A;  1XC9 A;  4F3T A;  1RBT A;  3RR7 A;  3PV8 A;  4Z4E A;  4E7I A;  1YTU A;  2Z1G A;  3ZSY A;  1ZBU A;  1SV5 A;  1BGX T;  1T05 A;  4C8O A;  3TAG A;  3UIQ A;  4FW2 A;  4M3R A;  1QSY A;  1J9A A;  4Z4C A;  1RTI A;  1F21 A;  4FK2 A;  3I0R A;  1ASU A;  4CEA A;  1RT4 A;  1S9E A;  1L3V A;  1QSL A;  3LAK A;  3LP2 A;  1Q8I A;  1WNS A;  2YNH A;  4CJK A;  4FJJ A;  4BE2 A;  3AVH A;  3OYC A;  5FRO A;  1FKO A;  2KQ2 A;  4ID5 A;  4CFB A;  2G8I A;  4CFC A;  3OS2 A;  3TWH A;  1C1C A;  3V6D A;  1O1W A;  2HNY A;  3DRR A;  2Y1I A;  4F8R A;  3HST B;  3KLE A;  4BDY A;  1KLN A;  3HO1 A;  3RRG A;  3ALY A;  5KGX A;  1L5U A;  2DFF A;  4OGC A;  3TAM A;  4FLY A;  1SUQ A;  4LSL A;  4CFA A;  3HT3 A;  3L8B A;  1JXE A;  1WSG A;  2QXF A;  4AHS A;  3O4N A;  1NK6 A;  1T7P A;  1N5Y A;  1NJX A;  4E1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...