4Z1PA

Bspa_c_mut
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
VLFQGPPTKKVLDENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSSLLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQIKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNDTVKLGDEVTYKLEGWVVPANRGYDLFEYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRSSAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall surface anchor protein
publication title BspA_C_mut
rcsb
source organism Streptococcus agalactiae
molecule tags Cell adhesion
total genus 98
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00746 Gram_pos_anchor LPXTG cell wall anchor motif
A PF16364 Antigen_C Cell surface antigen C-terminus
A PF17998 AgI_II_C2 Cell surface antigen I/II C2 terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z1pA01
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z1pA02
2X9WA 3PG2A 2WZAA 4Z23A 4OFQA 2F68X 3V10A 2WQSA 3KPTA 2X9ZA 2Y1VA 3OPUA 3QE5A 4IGBB 4P0DA 3PF2A 3UXFA 2Z1PA 4IGBC 4Z1PA 2XTLA 3HTLX 4UZGA 3RKPA 3HR6A 2X9XA 5DZAA 2OKMA 4IGBD 3QDHA 1AMXA 2F6AA 2X9YA 4HSQA 4IGBA 3RPKA 5DZ9A 2WOYA
chains in the Genus database with same CATH superfamily
3KYOA 4FABL 3FT3A 2W38A 3OJVC 3WS3A 4TQIA 3V4VH 3PXLA 4G8EB 1RZ7H 4TOYH 4KUCF 5B1JC 3T2OA 1UZ6F 4L8SA 2WINA 3KBHE 1QO3B 1DYZA 2NY2B 2A9MH 1LK3H 2AJYL 2NT1A 1U2HA 3DHMA 4WK2B 2DQTL 3BYYA 5HSFA 1OGSA 1NMBL 1QUPA 2PWHA 1QSED 3BVUA 3IMRA 4EN3C 1SDYA 3P3SA 5AENA 2V5RA 4HPOH 2OMWA 5CIPA 4F7TA 1JGUL 5SWSD 1OCOB 5C0CE 4LP5A 1LVEA 4ZOAA 4S1RL 5C0AB 4MD5A 4XXWA 3FU6A 1VFUA 2D7MA 2H3XC 1EWHA 1M7IB 1N64L 3MXWL 4LPTA 4NHUB 1IEBB 4WHDA 4PRHD 3V4PB 3WFCH 4APQA 1H6EA 4OZFG 2H0PA 3FKUS 2XZCH 4GXUM 3REVA 4QRAA 2EDYA 1IZJA 1D5RA 4RMRA 3VSTA 1PG7L 3UZVB 5BOZG 1V8HA 1ONQB 1I53A 3MJ8B 5HHME 4QRPE 1BPVA 3C5ZA 5DMKA 2Z92A 3O2WL 2PW1B 3V0DA 4U49A 1E4WH 4ATTA 1XGZA 1IIKA 2ZAGA 3H9SB 3OXSB 3PP4H 1AR1C 1XGQA 2XOTA 5J9PA 4JRLA 3W57A 4M62H 1DO6A 5FO2A 4LEBA 3S3SA 1XF4B 3GHBH 4HS3A 4AG4H 4BKSC 5IJKC 2NXYD 2ZKMX 4WDIA 1SYSA 5DD1H 3LIUA 3L1EA 3ZO9A 3QC6X 5EZOL 3HTLX 2FX9L 1HXKA 5IKCB 1T3FB 4PG2A 5SWZE 2J71A 4MJ5A 4RFEB 5F96H 3JV6B 2MTPA 5SV3A 4D0BB 3NIDB 3QH3B 2N7SA 3ALXA 3H4HA 3GDBA 3KYNB 2UWEA 3O2DA 2KL6A 3PRZA 4N2LA 5B1BB 2G3ZA 2OK0L 1R3JB 1JPTH 1U8NA 4ZX4A 3FT4A 1RP8A 2YD5A 1QLEL 3RVXD 4OLXH 1J1XH 1LMIA 1W72B 2VDQL 1THCA 2Y07L 3IB4A 4YK4C 2JJSA 3ZDWA 3QDAA 2ITCB 3FTXA 4PTTA 1AGCB 1CLZL 3OKKA 1NFDF 3UAJD 1TZGH 1SBBA 4G9DA 3QVAA 3ULVE 1G9ML 3K8LA 3U7AA 4EXKA 2ZKHH 4Z7OF 1NM4A 4FD0A 1N68A 4LSTH 2OLDA 1U42A 2ZX7A 5KANI 1KCRH 1L6XA 2YPVH 3Q1EA 1NDGA 5IMMA 1L6PA 2X70B 1LO5B 5AB2A 2WQWA 4JFFB 1XD1A 4L2YA 3S35X 3PL6A 1TG8A 1JI1A 1X44A 3R0MA 4KJYA 3VMNA 5C8JA 1GMEA 1WP6A 2VW6A 4G8GD 2YA2A 1TEYA 2CE6A 4RLDA 3LHAA 5LG6A 5DJ6B 1KF9B 2B0SL 3IRPX 3E7JA 4NQSA 2NW2A 4P3CL 5ETUA 5HI5C 3ARYA 2P42B 5GS2H 2X2HA 2OJZH 2E4TA 2R0WH 4FFZA 4LMQE 5EWIL 4X8CA 5LVEA 1IFGA 6FABH 1JD9A 4LRIC 1YN7A 4G6JH 1U95A 3CWGA 4AEIL 1Y6MR 4NZ8A 2ARWA 2WGNB 3GJEB 4GRLB 4ZO9A 3HKFA 4LSVH 3QUZC 4E9QA 4L8CB 4Y4FA 1ZSHA 1NWPA 1ZLVH 3FUIA 1N6VA 1VERA 2M83A 1HJBC 4Y4HA 3U25A 1YY8B 3BIBX 1QD0A 1MCPL 2P5EA 2WAQA 2YPLB 1YYML 3MNVA 3GJFA 4DNLA 1KJ2H 3H0TA 1NBVH 1N5YH 3ABLB 3VI4A 2WXHA 5IESH 1B9KA 3BIKB 2J6WA 4ZPTA 5L2JB 2JKWA 4HCIA 1WWBX 5CUSL 1CL7L 1OT4A 1S7VA 3W5MA 3QI9A 4PWIA 4XNQA 2WWKO 4IRSC 4KGJA 3X1BA 4F37F 5I1KL 4ODTL 4PJEF 3NCWA 3T6QC 3K4DA 4IYKA 4TRPH 1J88A 3CXDL 1KB5H 2GSIB 4YIQA 1N18A 4RMVA 5CN1A 2VDKB 4FABH 2R23B 3O3EB 5T1MA 4G5ZH 3VXUA 1ZVNA 3W0WD 4C47A 5E8PB 1ZTXL 5F1OB 3RWJB 2YIHA 3QQDA 3U36A 1JNHA 1SMAA 1UKQA 4FG0A 2IAMD 2OR8A 3CH1A 1NMBH 5CO1A 1Z1WA 4OCYL 4D0CB 2YD7A 3TOPA 2XTJD 3PNRB 4Y16C 3MRIB 4LSSH 3ZUCA 1T22A 3AC0A 5DHDA 3HJ0A 4HC1A 3NCYS 1JGUH 2VLLB 2ZG3A 3RE0A 1S5HA 3CHQA 4M00A 4K3JL 3H3KA 5D70H 5IV2A 1TJGH 1QFWM 2MMXA 3D18A 1SF3A 1ILUA 1UOLA 3BUPA 1N64H 3MXWH 4H5SA 4X4XB 3VXSB 1YC8A 5TPWL 3KNBA 3B5GA 5B3JE 3OAWA 1EIBA 1WFOA 1R75A 3TX4A 1HYSD 5AALA 3MMEA 3QEQB 3LEYH 3ESPA 2Y1YA 3GBML 4DOHE 1OAXH 4KDTA 1J8HE 4GEIA 3K7UA 1NAML 2KT6A 2PF6A 3A4FA 5CCHE 4XPTH 2XY1A 5JOEA 3IS1X 5LUMA 1EFXB 1BVNP 2BIHA 2FSEA 5DEGA 3UERA 4P4KC 4B0MB 2NY1B 5FWRA 2CO7A 4MXQD 2ISDA 3ULSA 3RPIA 3HBZA 3T6VA 1TJIH 4MQ7B 1W16A 2B2XL 1BMZA 5TJWK 1WIOA 3NG5A 4CW1B 3L95B 3CFBA 2WWMC 1XCQA 2VO5A 4XI5D 1BEYL 1JXFA 3THML 4BKTC 4Z3FA 1GVIA 4I85A 1IB5A 2WUCL 3D34A 1OP5H 5A7EA 4HPYH 2Q6WB 2X44D 5EU4A 5EZOH 2FX9H 4ZPVB 1AZNA 4NN7C 3MACH 3WIAA 2A38A 5GRJH 5DO2C 3C12A 3ZO0A 5K5YA 2BNRE 2AQTA 3QULB 5AG9A 3L4XA 1MW1A 1EXUA 3FU8A 2OK0H 1IV8A 4WNSA 3HE6C 1QLEH 1PEWA 1QAWA 5DJ0B 4YHLL 4AYEC 1ZV9A 2Y07H 5DWPA 5EHFA 4FQPA 3C8HA 1WS7A 5DJ2B 4JDZB 4UOW1 5L88H 2DTML 2R2BB 1CLZH 1ADQA 4RFNC 5CCJA 4HJ0D 2A9DA 3ZKMC 2V2TA 3BZ4B 3OKOA 4IEFB 1G9MH 1X7QA 2ICEA 3P9LA 5EBMA 2W1NA 4H88H 3BVNA 2G2NA 2P45B 3HMWL 4JZJB 4PCYA 1SHXA 1MELA 1SUJA 2DIBA 4Y5VB 4Y7MA 1JTOA 3FCUB 2EQDA 4AE1A 4GFXA 4ZD3L 3MAWA 3NZSA 4OKVA 1ZHKA 4C83A 3X12B 4TLSA 1UACL 3IDMA 1IAIM 5E2UH 4MAYB 1EHNA 3PIQB 1BWMA 2PO6D 3PABB 2XN9D 3A3YB 2B0SH 2IH8A 3FS9A 4HZLB 1R4XA 5F7AA 3ZX1A 4UTAL 5HVWA 1FG9C 5EWIH 2WB1A 2VIRB 1B4JH 2AJVH 1XH3B 4X6DA 1RUKH 4PYHA 1OPGL 3KM2A 2ZXGA 3WS6A 4UT6L 5TQ2H 4LIQE 2Z8WC 1S78D 2G5RA 4KH2A 4KO7A 1J8HD 2WY3B 4YGVB 1FYTA 3Q1SL 1F3DJ 1HL5A 4CSTA 2UXTA 3IJ8A 1H0DB 4G7VL 5JQ6H 1FC1A 3K2MC 5JO5A 3PQYB 3QQ4A 4NRZA 3QXUA 5IW6A 4Y1AB 1VA9A 1YYMH 2F2HA 3EFFB 4F80A 1SGKA 2P5EE 1PFOA 2R0KL 3NJMA 4YDVA 4PV9B 3VI4E 4JHBA 4TUKL 4WO4C 4PGZA 5I1IL 5I0DA 2Y7QB 4GG8A 4MAZA 1NIEA 3P02A 2VXSH 3QIWC 4QO1B 3N2JA 3OLEA 4R4BB 5CUSH 5C92A 5L9DL 3WTXA 1S9YA 3GHEL 4F7PB 5I1KH 1S7SB 4ODTH 4FYRA 5EU3B 4N9GA 4TUOB 5CR8A 3RFRA 1F02I 2VLKD 3EJRA 1EZVY 2W65B 4WU5A 1EHLH 3LRMA 5DVKA 5IEHA 4BFGA 2PTTA 1ZTXH 3DPDA 1CR9L 1TQBC 2YFNA 2BNRD 1AHWC 3L4YA 1COBA 3VVVA 3LZFH 2KQMA 4J28A 2EXWC 4A2GA 3D0VA 1P4IH 2OTWB 2D7TL 1CPUA 3BDBA 1XH2A 3L2MA 4GSDH 1C9SA 3R19A 2BINA 3KGTA 5EU6B 1T2XA 1TPXC 4DFHA 1A3QA 1YNTA 4MA8H 2RTTA 3NQKA 2GFBA 2C7UB 4PWGA 1FP5A 1C7TA 4OU3A 4FADA 3D4YA 2XSKA 4OUUA 4N0CD 2FEDD 5F7YC 1NCWH 2IJ0C 3ARVA 3CUPA 4LU5H 1UXSB 4MRBA 5CN2A 2QPFA 2UZIL 3CLFL 4R5VA 4YSDA 5D6CB 5HD8D 3MJGX 3PHOB 1KXQA 1EA9C 3ARDC 3GBMH 4X5LA 3SJVA 4XBGA 5E1IA 1BIIB 2ED6A 1QWNA 3L4UA 3SYPA 1T0MA 1R5VB 1FFQA 1RJZB 2B16A 4Q6KA 1T6BX 4ATWA 2ZUWA 1L9MA 3X3GL 4LZKA 3D85B 3QPXH 4O51B 4EDXA 1MIEH 5D1ZC 3RX9A 1Q0YL 4X6EB 4R0LC 5JPMB 1AZCA 5DS2A 2WUCH 4L8DB 4NC1E 1WIPA 5GSVB 3OR6A 2F54A 2QSTA 3W82A 1ZA3A 2ED7A 2HLAA 3B6SB 4LSRL 2D7PA 1E4XL 2Q3ZA 2HRGA 4C8XA 1U3HD 2NZ9C 4M6MH 3MBEA 5GGTH 1I1FB 4JRYD 2NTSP 1FL3A 4F7EA 5CZXC 4JK0D 4L4TA 2ZUVA 4NSKA 2UY6A 3QUXD 4KJPC 3V79C 1MKFA 2O5XL 5FGBA 4G9FE 3K72B 2Z91A 5SV4A 2XKNB 4YBLC 4YHLH 1CGXA 3S96B 3BSZA 2WXGA 3HAEG 3I6KA 4GP8B 4JUSA 5DUJA 2W9LA 2GK0B 3MO1B 5EZPA 2HVKB 3CFTA 3KLQA 4Y8AA 2DTMH 5IHZB 3KYAA 2PCFB 3FF7A 3U9PH 4DP0X 2A99A 5IHLB 2VE6B 2VUOA 3DURB 3BH8A 2NUTB 4MD4A 1CJYA 2M8XA 2WMPA 5IEKB 1SEQL 1W91A 4LFHG 5KVFL 5L2KB 5I1GH 4WTWA 5K9KB 5E1AA 1JDAA 2DYPB 1A6PA 5D7KD 3F7RA 3QHZL 3PXHA 4RAVA 2X12A 2QGEA 5MEPB 1XHHA 2OV0A 2PYFA 3ETSA 4NJAH 1UACH 3FH7A 4H8UA 3U30B 4WSJA 3EYSH 3S5ZA 1MCBA 2I25N 4Q14A 4DP6X 4KV5E 2QHRH 1NBYA 4UTAH 2NYYD 3NN8A 3WJJC 2B3IA 5F0PB 3RI5F 2UYLB 2FJGA 1U8MA 1JVKA 4X8JA 1BG9A 5LBVA 4OGQC 1A1OA 2O1AA 4GB9A 1U8JA 5DLML 2AV7A 3LH9A 2JKXA 3FB7A 4P07A 2Z35A 3T4AB 3F6JA 3G5YA 1FFRA 2HFFA 4DW2L 4UT6H 1I8UA 1BW8A 4WKZA 1MSPA 5EDSA 1SOQA 5B4MD 2EUVA 4XNAA 4JKKA 3Q1SH 4P2RA 3KLSA 4G7VH 4P2OA 4PMEA 4NHCL 4OV6F 4KQ3H 3FT1A 1XH0A 5LAPA 1YMHA 3MV9A 2R0KH 2VR7A 4IS6A 1FJ1B 1G7PB 5HYJA 1USQA 2QFPA 3A47A 1Q9WA 5K39B 3WEAA 3RZWA 1LWJA 3UBXB 2HLEB 2Y4SA 5I1IH 1J18A 2FEEL 2XT1B 2YQBA 3MV7A 4P57A 1ZT1B 4KK5D 3UROR 4PI0A 3GHEH 2VQ1B 1XT5A 4AYSA 1ADWA 2RD0A 1K8DA 4ZX6A 1IBHA 4R3SA 8CGTA 5JW4N 5F8QC 1IKOP 4KHTL 5E8OA 3BVDB 3ABKB 1E65A 1G4MA 4N8UA 5C07B 1X6NA 4K55A 5B39B 4BWTA 3UMNA 3DSNB 1CR9H 3MZTA 2V17L 4P2CG 4H13C 5DZNA 2KLSA 2FQFA 2YK1L 4G9FD 2F1EA 2H32B 1U93B 2D7TH 1BCIA 1PZ5A 4KX8A 4TXVB 5C09A 4DO6A 2HFGL 3LX9A 3RVUD 1A1NB 3N1MC 3IFOB 2ICWB 1OB1B 5HI3C 1CI3M 4ZUVA 5LB1A 5KUKA 1MW0A 3N91A 4M4RA 3B1TA 2X4SB 1TTRA 4JFEB 4TVPD 1MRCL 3SYAA 1T2QL 2UZIH 1GSKA 4M1CD 3Q8AA 2ESVA 5L8KB 2QBWA 5DLLA 2VMCA 1KIRB 1QI5A 3PY9A 2BRRL 4KVNL 4RIRB 1KXQE 1KACB 3AREB 2BVPA 4NGHL 4XNUL 1UWEL 5F3FA 1W6LA 2AGJL 4NYLA 4Y88A 3SJVE 4MX7A 2FECI 3BPLC 4MCZA 3RWHB 4Q9CA 1NFIB 2DQUH 4NAMA 3EYUL 4HKZA 4WI5A 4YDJB 2C5DC 1TZAA 1P7QA 1E8XA 4XMVA 5J4MA 2XY2A 5EZJA 3D3VB 1Q0YH 5EOQH 2QQLH 1ZGLB 4ANXA 4N2IA 1MAKA 4ODXA 1OEZW 2VSMB 3EJJX 4QGYA 1DJYA 2WO4A 4RDQG 2C3XA 4ZFZA 4MJ2A 2F54E 2AK1L 5EOTA 1XR9B 4MAUL 5GS1B 2CK0H 1D5ZA 3ZBMA 1PQZB 2V2WA 3LEVL 1F00I 1A02N 2CLZB 4H0LC 4U6XB 1CDCA 3VFUA 4GJTB 2PR9A 2V9RA 4PJEA 3PF2A 3PWPB 3D07A 2O5XH 3CHXA 4XCYA 3K5SA 4UV7L 3G6DL 3ESOA 2FAUA 3QXVA 1MLBB 3AACA 1JFQL 3GMLB 4DESA 2PPDA 4P3DA 1HCZA 2D8KA 3L6FA 3EO1A 4X99B 4N2GA 3TH2T 4QHUA 1GA2A 2CCWA 1MRDL 3T0VA 1WV7T 2VW4A 3EGDA 2EABA 2EDRA 3FZUD 3L4ZA 2PXYD 1XMEB 1F8TL 1SEQH 4JKMA 2ZYHA 4DGIL 4N0FA 4P2YA 3KWTA 4LSUH 1P4LB 3UAJC 3AQXA 4OTXH 1HN1A 3QFJD 4WZ9A 1Y0LA 3LN4A 4P05A 3QHZH 4P9MH 3P73A 1KWGA 4XODA 1IC4L 3VACA 1RKRA 1DSFL 1CK0L 4PN6A 4FZEL 1FL6B 3U9WA 4LCIH 4DP8X 1B0IA 3CVHH 2P8MA 4MA3B 3SZ6A 3ZSSA 3QIBB 4I1NB 1KIQA 3MC0A 3SBWA 5BQDA 3UJJL 2R2EA 4F8LA 4AJVA 4FKEA 3EO0A 5FGCB 2CKBL 1EDHA 4PP2B 2O61A 4Y4KD 4PJGA 5DLMH 3DETC 4AC2A 5B8CC 3DX7B 3VD5A 3WFEH 3JWOC 3DROB 1OM9A 3D39D 4M61A 1X4YA 2VABB 2Y5EA 3WNJA 4DEPB 3IXTB 2A6DB 3PS6A 3DDGA 4GLRH 1PG7W 1DVXA 1ZHLA 5EO0B 8FABA 3T0BA 3C9NB 4G8AC 4GAAA 4P2RE 1QTYT 2KC0A 1BAFH 1EV2E 3CZUB 3H4FA 5K59E 2AABL 4DPCX 3OHXC 3H9HB 4ADJA 2ATKA 4FCAA 3CD4A 1NGXA 5IVXB 1S6NA 2NXZC 2XV6B 2EILB 2WZ0A 4Z0BL 5GRWA 5AVVB 1PVHA 3B9KC 3Q2LA 5F0LB 1F18A 4HWEL 3P4OB 2BMKA 2J5WA 4FL4B 4RZCA 2WXJA 3MV7E 3KLAA 5E4IA 2BVQA 2Y7MA 1UH2A 4TUUA 1HINL 3DVFA 1IE4A 5J11C 3L3JA 2AK4B 5I6KA 5HYSG 1AG0A 3KWXA 4I2XE 3TL5A 2V17H 5FO7A 3IWVA 3MRMB 3VG0H 3BRDA 3C6SB 3B7YA 3HZKA 4LP8A 1WZ1H 3T9WA 3K4ZA 5GIRA 1BGXL 2YK1H 3B7SA 4PJXF 4ONHA 5D1XA 4HSAC 4WUKL 3IAQA 4HX1A 5C09E 3V7AE 2BC4B 3NGBB 4ZUWA 4MXVF 2AI0H 1LO3H 3WNMA 2O6FA 1PIFA 2ZOLB 3FQUA 2WXQA 3QW9A 1KZYA 2F8OA 1UKTA 3K1DA 4GI9A 1KTKE 3HI5H 1I8KB 1PKOA 4I3SH 4LXFA 5E2TL 2K3TA 3QNFA 2IBGA 4X6CE 2DWEA 4EUPH 1GW6A 1T2QH 3NA9H 3MI6A 1MHEB 3DVIA 3F7PC 4Y2DB 3STBA 4X0KA 3EYOB 2PETA 1ED3A 3AS2A 4IMLB 5E00A 4KVNH 4OZIA 2BRRH 3ULVC 3ZMEA 1NC2A 4LHUD 2B59B 4NGHH 4XNUH 1UWEH 4GQQA 2AGJH 2FLBT 1TSHA 3A21A 4NP4L 3RGVB 5JR1L 4Z78A 3OKDA 4PS7A 5I2IA 4ZMLA 1IU1A 3FRUB 1HYSC 1BQSA 4YVUA 3EYUH 2D0FA 3PHQB 5T1KA 3OR7A 1I3GL 2WXIA 4TNVF 4N2BA 5J1AA 3QDGB 1UC6A 4ZS6C 2C3GA 3PJSA 2X05A 1T1YB 3E38A 4DJMA 4TF4A 4YNYA 2X9YA 1MF2L 3CH8A 1G1KA 2AK1H 2Y5TA 4HJSA 3GKWL 4LNRA 1IAOA 4OI7A 1A0QH 1JF6A 3CVDA 3QZNA 4DK6A 1LNUB 4GO9A 4TPRH 1EDQA 2DDQL 3A4AA 2H7WA 3UGXA 3IBOA 1UCBL 3PLYA 4HHGA 2V5YA 1ZHBB 1YEGH 1T7YA 3DMMA 4P46D 2E27L 3L3IA 4WJG3 3VFPA 4BCZA 2R27A 4LCWA 1YPZB 3PWUB 1GZHC 3CXFA 1PZAA 5FLUA 4NZDA 5EIIB 4GW5A 5C9KA 1JFQH 5T8IA 4JFXB 2LVEA 2CRYA 2LU3A 3ME0B 4Y5YA 1AOZA 3MLPA 4PTUB 4DTGL 4KQ0A 1M7DA 3IGKA 1MRDH 3QIUB 2OL3H 1D2PA 2BZ7A 1MHCA 4YS4A 4JFPB 2WZ5A 1F8TH 1XGYL 4DGIH 1KFGA 3QCTL 2VN7A 2DOCA 1MRFL 4PJDB 3TTSA 5GGRB 1C5DB 1XSOA 4IBSA 1A66A 4AZUA 2NY0B 2HN7A 4A2FA 2FYYB 1N70A 4X6BA 1URZA 1CK0H 3TZVA 1UD4A 4FZEH 3RTQA 2G75A 4L8SC 1MFDL 2WBXA 2DRUA 5EEVA 4NO3A 4XTRD 5CGTA 4OGYH 4NC0B 3ZXAC 1C08A 4JLRA 2CMRH 5KSVA 2DKMA 3GGWA 4BINA 1OL0A 3HPJB 1AKJA 2F7QA 4HIIB 4ECNA 2TRHA 3KCPB 4PJGE 2E7LA 3PCYA 2N7AA 4HF5L 4PJ9B 4X7SL 1SJHB 5KVGE 5EUOB 1F58L 4PW3A 2XIDA 4XXWC 1T04B 4PJ7F 4U2YA 1KN4L 1I1YA 1WTLA 5ECGA 4APQC 3DGDA 3RBSA 2RALA 1EXHA 2BHUA 2YPKA 4YFLI 1MCCA 1RZGA 1PLBA 2AABH 2Q87A 3B4NA 3MLTA 4P2QA 4HUUB 3ES6A 3VXPA 1IJ9A 2C9SA 3GLAA 3NFPA 3L3KB 5M7QA 5FO9A 4NXSA 4XC1H 2DKUA 1H8NA 3QCVH 3AB0C 4LO9A 4HULB 4GFTB 4HWEH 2C8NA 2SEBA 3C5ZC 3H42L 3J8F7 1BQ5A 4MA7L 1MNNA 3HZMB 1MCNA 2MNUA 4XNXL 3LTVA 4BSWA 4HHWA 3HIZA 2IGTA 4N90D 4GMTL 3TS8A 1W0VB 5E8NB 3SOBL 5I1DB 4KKLC 4OIIH 2GJ6B 3MRHB 2LHAA 3HAEB 5ANMB 4E5XA 1AI1L 1AXTH 4JRXA 1TZHB 2EDKA 2QPDB 1QG3A 2JLLA 3FFOA 4XWGL 3VD1A 4U1IB 2ZCKH 4NKOB 4WUKH 1NDTA 3VFMB 3RB7A 1AO7B 3VH8A 5D1XE 1A7RL 3WTSA 4Y2NA 4U3XA 1MCSA 3UCRA 1KJ2B 1MI5B 5KSUB 1J1PL 4Z1PA 5MEOA 3AS1A 3UEZA 3V6OA 2BVEA 1OD9A 4WUUD 1IGYB 5I24A 1RFDH 3D06A 4H40A 2ZF8A 1RLWA 3FONB 4F5CA 2XWZA 4HUVB 3DUSB 5E2TH 1X4XA 2YGPA 4U1HB 5CGYC 2BOBB 2PCXA 3KD4A 3MUHL 4HK0B 2JJSC 1FDLL 1UEYA 3QQ9D 2YSTA 5E6ID 3EH1A 3O9WB 4I77L 5ICYB 4N0CC 4OZIE 2HVJB 3NFSL 3LZOA 3HPLB 2Y36L 5JOPE 5JW5B 2QADC 1JZ5A 2ENPA 4NP4H 4CSSA 3FUMA 3FH8A 4N24A 4QRSB 5IROA 3CPUA 5HD8C 1EO8L 1U3NA 1DVFB 1RUMH 3A6BH 4PJCA 5EEUA 5KYYA 5T1JA 1IGCL 3PL6C 4M8QB 2WGXA 5D7JD 1Y18A 1NBZB 3GIZL 3O3BB 3S5LB 5JOFB 1AGBA 1VEPA 4EIGB 1AS7A 1GY2A 2WLIA 3RFZA 3KBFA 1HDMA 1TNNA 4CJ1A 2L8AA 2DYRB 1RVFL 3MCLL 4HV8A 2J12B 3BO8A 5FYLH 5TE7L 5IB3B 2F1AA 3FQTB 1CURA 4FX5A 4LLYB 4X5XB 3VMOA 4FLSA 2ZP0T 3L9RA 3L3GA 2DDQH 2FT6A 2QDVA 3ESMA 3MX0A 4XO4A 1UCBH 2MNJB 4KJWC 5CJOL 4AQOA 1CLYH 2OJEA 4QTHA 1U3HC 2YUXA 4Y4FC 2IPTH 1V54B 2CIKA 2VQ4A 3EDJA 3QJXA 5HHOA 3SPIA 4QRQA 4MJ4A 4LCWE 4UV4L 5FKAB 4Y4HC 1DQQB 5G4NA 3EHBB 3LMJH 3RURA 1DEEB 3CCHB 4DTGH 2UXVA 3ZE1B 2QQKL 1PCXA 4NQED 4RA0C 4ESKA 1MW2A 1Z32X 1QPKA 5JXEA 5DRNB 1SDDA 2XKSA 2JJUA 3QXDA 4DP7X 1R3KA 4GKNB 4Q58C 5BOJA 2DQJH 1WZLA 5K9OB 2QLYA 3L54A 4H26A 4OIBA 1MRFH 2ZJSL 4I7ZC 1QR4A 4WTZG 4DKAA 5ESVA 4BQ8A 4I13B 4IBUA 4IMKA 2GTWB 4NQCD 1ROWA 2HP4A 1RMFL 4MHHI 3CSTA 4AW4A 4DP5X 3VD0A 3OZ9H 5ESQA 1MFDH 3EKCA 5ISZB 1I1AD 2AQ2A 2CDEB 2XV2A 3P3RA 3G9VA 4FA7B 5C0DB 3H54A 3QBTB 1QASA 4D94A 4MXWL 1WCQA 3B83A 3TBSB 2VDQB 3ZHLA 1JZ2A 1X7SA 4QT5A 4A38A 3QA3A 1NC4B 1MLCB 3ZW3A 3ZKXB 1PD0A 2IALB 3V95A 1WHOA 3BEWB 1DJIA 4ADGA 3C6LB 4QY8B 1F58H 2V5TA 4WVRA 3HN8A 3VRJB 4NEHB 4YFEA 1KN4H 1XGTB 3AY2A 4NKMB 4UT9A 5IVOA 4WHCA 3HUJB 4ZTPH 1WBXB 3BQVA 4WI7A 1FO0A 1ZHNA 2O6PA 2X2IA 4IBYA 4J5VA 4KHXL 3VO0A 3AU0A 5IJVB 1WFUA 4HCRL 4EIZC 5KVEL 4KDTC 4P2QE 4GS7C 1R9FA 2VXUH 2IH1B 3X11A 3WI9A 4AYFB 1YEWA 2BNQA 3QHFL 4L0YA 2GSGB 3A67L 3M1OA 3BWZA 3FU5A 2CKNA 4G8EA 4MA7H 1X9LA 5AVWB 5CJ8A 4XNXH 5AYQA 3ESVF 1QO3A 4W68A 4F15B 4GSUA 3VGAC 3BDYL 4BWWA 4NC1C 4PJAE 4YSOA 5DJYB 4ZMVA 1RU9L 3FTVA 3JYCA 1S9XB 1XIWD 1BXXA 3BSGA 1K2DB 2Y72A 3SGJA 4A67A 2IFFL 1A9BB 1YVLA 3QJSB 5TFSL 3VJ6A 1GC1C 1RJYB 4WK4B 3E2HB 4JM2B 4KXAA 5C0AA 2R0ZH 4FA8A 1HNFA 2YRPA 3QG6B 4ZODA 5IHHA 2I9LA 1NOFA 1M7IA 4HUNB 4QHKI 3V4PA 1IEBA 2OX5B 4D9RE 4J2XA 4HJJH 1OE2A 4K3EL 4HISA 5BQ7B 3RVUC 1TO4A 4F5CE 1KMGA 2C3VB 3EJYD 2WWNA 4O4YH 1FDLH 3OGCB 1S7QB 1OQXA 4QHPA 4L9DA 4XMPL 3VW3L 1ONQA 3QYCA 4I77H 3D05A 3MJ8A 2A83B 2F8VA 2ICEC 1UB5B 5T3XD 3IFLH 2K6ZA 2Y23A 3TO4B 3M8OH 5ID0B 2PW1A 4YFLF 4U0QB 3H9SA 1EO8H 3OXSA 3FQ1A 2XI9A 4GIOA 3UBFA 2E5EA 4UUJB 2DQEH 4HCFA 3SYOA 4PJCE 3OB8A 1XF4A 2P80D 2W80C 4Y9BA 2EXYC 3SQBA 3GIZH 3IKCB 4N20A 5A2CA 1M05B 4L05A 4DK3A 1T3FA 2P4AB 4RFEA 5J56B 3JV6A 3U4BL 2WAHA 4JO2L 3GQFA 3HRPA 1YY9D 1MJ8L 4KJQD 4D0BA 3QH3A 2EE6A 3LY6A 3JWOH 3KYNA 4M7JH 4HK3J 1NIDA 3VE0B 2YWYA 1R3JA 2CPUA 1FBIL 3GSRB 4M6NH 3F04A 3WS6C 4R26L 3SDXB 5CJXA 1W72A 2BP0B 1NAMB 1N6QL 1P5UB 5J1TC 2J43A 5EFIB 3FYEB 5GGSB 3U82B 3G5WA 1CLOL 2MPAL 2MOQA 1AGCA 4UV4H 5HYSB 1WG3A 2K0RA 3B2UC 1T5WB 5CP3H 3UMTA 2FNBA 5I6XC 2XXFA 5AB9A 4LVNC 1E2VA 4F91B 5ABAA 4Y2OB 2X70A 1LO5A 2ICCA 1QBML 4JFFA 3U46B 3HC3L 4U0RB 3SE9L 3RVTC 1ODUA 3AXIA 1IILE 4K7PX 2N3JA 2ZAIA 2ZJSH 2P9RA 3RIFK 5I75C 5DC2A 5DJ6A 5L7XL 1K6QL 2B4CC 4Z7UF 1YNLL 3EJZC 5I5RA 3ILQC 3L4WA 2Q7NA 3AAZB 4H1LH 1SQ2N 5KSBF 2DB8A 2CHZA 4PRNA 1D5MB 4JO4H 4D9RD 4WY7H 2DF3A 3II3A 3ZE2B 2E9WA 1JGVL 4PJ5D 4D9QE 3F84A 3O8XB 5DO8A 3QWRA 2Q8BH 1NL0L 3ILPB 5HPOA 1FG2B 2VLJD 3GJEA 3CZKA 4GRLA 4R90L 2X2JA 2K6WA 1JD7A 1WWAX 2WQAA 3E0GA 3MRCB 4OLWL 4X6FB 5D4HA 4JG0L 1JZ8A 4L8CA 2JFCA 4ALAL 4M43L 3OB0H 3VDAA 2UZYA 2WWKT 1YY8A 4NWTL 5AOZA 5FB8B 3ULVH 3TIDB 4B0MM 1QWUA 4N2MA 4O00A 2OMNA 5DJDA 4LPWA 4OBSA 1NEPA 1P7HL 1TQVA 4KHXH 3TTYA 1KCVL 4HCRH 3OPUA 2IXQB 2H2SC 4FLQA 2HTLC 3V0VB 5JUEL 3QZPA 1JN6B 2GSIA 2WKGA 4LPCA 4YZFF 3QHFH 1HHKB 3A67H 1QI3A 3PWVB 2ODHA 2R23A 5GRUL 2BNQE 3SKJH 5E6SB 1LDSA 3WSQL 3FCGA 2NX5D 3RWJA 2P5WD 1DQVA 4Z9KB 1BXAA 3DVNB 4NNYB 4U7SA 1CBVL 2CJ3A 3HB3D 4WHYG 3WG7B 1MREH 1OAJA 2ARJB 4GXVL 5CCKH 3TYFB 4LARH 3D4CA 2D3NA 3MRIA 3ZT7A 2NNCA 5FW6A 2X28A 2DBLL 2GITB 2OXGB 3K3QA 3MUZ1 3MBEC 2PWDA 2VLLA 2Y9RT 3MR9B 4LNVA 4DGUA 1FV1B 4ZFOL 3RWCB 1F86A 3FSAA 4PSPA 3ATFA 3OX8B 4X4XA 4LDEB 2NY6B 1KYOJ 4ZQKB 4UIKH 4FHJA 4PLKD 4K3EH 2X6BA 1HQ4B 5GZOD 1YYCA 3MRLA 1QNIA 3QEQA 4ZMWA 1VGKB 5DUML 5CEYB 5F1KC 1N59B 4XPAL 4N86A 4XMPH 2XRAL 3IFPB 4G82A 1OV8A 3ARFB 1EFXA 4HWUA 3HG1B 4N2EA 4JB9L 4YUEL 2YKLL 3EJQA 4AM0B 4F3FB 4GH7B 4I89A 5HDOA 1TZIA 2GPZA 1RIHL 1SEBB 1DLFH 4L3AA 4MQ7A 3VWKB 2RAMA 4CW1A 3H9SE 3L95A 1ZEAH 3N50A 4QCIB 1RPKA 1IGIH 1RUPL 3LJ3A 3ZRSA 2Q6WA 4Z23A 4ZPVA 1KCBA 1NLDL 2OCCB 4ZUTB 4PH8A 3U4BH 4JO2H 1SY6A 4XVTL 2AEOA 2VW7A 4DEUA 3NIDE 4M93C 2O5YH 4OD3H 2LE9A 4BWUA 2ZSWB 3QULA 3IMSA 1AQHA 3NRFA 1TYJA 1YEEL 3HNSH 3QS2A 1KBKA 1ND0B 1QW9A 4YN3A 4BSJA 1NA8A 4ZDHB 2A9CA 2FX8L 1MFBL 5KSAD 1TMQA 3PPSA 3UYPA 4J3OD 2BOLA 1CLOH 1EGJL 1OIOA 2MPAH 2NT0A 3KGSA 4JDZA 5DJ2A 4A37A 2MSPA 2R2BA 1MEXH 2XU9A 1XEUA 2L7UA 3GLZA 2EEFA 4JQIL 4OCSL 1PX8A 3FN9A 4FGMA 4P2OC 1UM4H 4NBYB 5EEXA 4IEFA 2GEEA 1HL8A 4KXZI 4JFHD 4YEEA 1J5DA 1MCOL 2VJXA 2PNDA 4JZJA 5D5MF 4CN6A 4Y5VA 1B2WL 1Z3GH 3H8NA 3QG7H 4ZXBD 4ENEC 2C9XA 3AWFA 3PE9A 3IYLW 4BQCA 3J07A 1I8LC 3OG6B 3STLB 1SOSA 3HC3H 4JFFE 3X12A 4GXUN 3SE9H 5E8DL 3GSNB 2DD8H 4MAYA 3FU7B 1G7JB 3PIQA 3PABA 5MP6H 1K6QH 4G8IB 3ZDXB 1YNLH 5DD0H 4Z0XB 4HZLA 3QRGL 4JN2B 4XWOD 4YH6A 1SXAA 4MYWB 5AKTA 4F8NA 3QR2A 5D7LB 1EJ6A 1GC1L 3CVIH 2VIRA 1XH3A 4ANWA 4PYGA 5GISL 3UYRH 1NL0H 4G42B 4H7VA 1X4ZA 2FEJA 1X5MA 2DLFL 4NN5C 4KTDL 3GBNL 4H8WC 3FFCD 1A14L 4IRSB 4OLWH 4CKVX 3WKPA 4JG0H 3ULUE 1H0DA 1WFNA 4AQEB 4N0YL 1V3KA 3PQYA 4LKXB 4NWTH 4A6YL 4K5NA 4Y1AA 2EDBA 3EFFA 4TVPL 4Q0XL 4KH9A 2CUHA 3QUYB 2YPLE 4W9LC 3VMPA 4PV9A 2O30A 3EBHA 4XOEA 4DPBX 2Y7QA 3BWUF 1KCVH 4QO1A 4R4BA 2LFGA 2TRYA 3WUWB 1S7SA 1UTDA 3DARA 1YRKA 3MPCA 4TUOA 3DK0A 5EU3A 5JUEH 3S8GB 1A2YA 1F3JA 3NCXA 5A43C 2W65A 5CAYB 1YPZF 2WZPD 1L9RA 2DAVA 4FERA 3R1GL 4MHHG 5C86A 4BDVA 1PW3A 4TQPA 3G08B 4FFZH 1ROCA 4WJKB 2WZAA 3RDTB 3IE9A 5TQ0L 3V9CA 2H4EA 2OTWA 4LCVA 4C56E 3IFNH 1JGDB 3NJVA 1L3NA 5JHDB 4GG6F 3LKSB 1QBAA 1IQDB 1ORSB 4RGMC 5I6OA 4LIQH 1L0QA 1RURH 3ISYA 3POCA 4M1DL 2AJSL 1ZTMA 4PJ8D 5EU6A 3N85L 4OJCA 3N41F 3WIHA 2NLJA 4F8TA 2C7UA 2J8UF 3IETA 4X5PA 3RWFB 1OAYH 5FUCE 5DCCA 1KEGH 4H20L 5ID1B 4GRMB 1UXSA 3A23A 3GLEA 2F53D 3UZQB 1SXCA 3FOLB 4Y2LA 2ERJB 3GJFH 3Q13A 5D6CA 3NAAL 4HXAL 3VXSE 2YA1A 3VWJB 1J1OL 4GUPB 4UZUA 4Z7VB 1DUZB 3PHOA 3WN6A 1DZ0A 1XQ4A 1G7MB 5E2JA 1AQKH 2C1PA 2V7NB 1WITA 4GQPH 1ZVSB 1C7SA 3W5NA 1BIIA 1S8DB 4TLUA 1AVAA 2XRAH 2BW5A 1C8PA 1R5VA 1EXGA 3SY6A 4HS8L 4JB9H 1E3XA 4QRTB 4X7EC 3T3PF 2B4CL 2AVGA 1AYRA 2V3DA 4A7GA 4Q52A 1GYCA 3D85A 4O51A 3SDAA 4ORZC 3GYRA 4NUGH 2KLRA 5I8OH 4KXBA 5D7SL 4WFGD 4X6EA 1E27B 1RUPH 5JPMA 4L8DA 4ELKB 1AQDB 5DURD 5DQDH 3NZ8B 4CVXB 4F9LA 3SPJA 1LLAA 5I19L 4F7KA 1OPOA 1WCBA 4FA6A 1I1FA 4XVTH 3KCWA 4ZMNA 3NK3A 1J5OL 3GPEA 5D7JC 3SBWC 3D25B 1I82A 1II4E 5EU7E 3KXFD 5D1QB 4PLJC 2AEQL 5CJQH 2X1XR 4AXWB 2YPLD 1MJJB 1YEEH 2VM4A 3QORB 1ZANH 3K72A 3SBRA 5L8LB 2XKNA 2FX8H 2CCLA 1MFBH 3L48A 3S96A 4G1EB 2GHWB 4FULA 3R8QA 2NY5C 1BZ7B 1EAOA 1EGJH 2GK0A 3MO1A 4JFDB 2HVKA 5BXFB 4JQIH 1Q1PA 3OQRA 2PCFA 3HFML 4OGXL 4Z7QB 3WHXB 1QKZH 1LO4L 2VE6A 1J9QA 3DURA 3LD8C 2WVSA 2NUTA 3G6JB 2H1PL 3EDDA 3DTXB 3UTTB 2BIIA 3QJRB 4CGTA 5L2KA 5K9KA 2IQ9H 5TH2B 5C7ZA 2DYPA 4LPVA 2WXKA 4C56D 1E6OL 1H6UA 5MEPA 4ABVA 4KROC 5DZ9A 4OZGF 1JK9B 5IFAH 3CFEB 3LZPA 2NNAB 2B77A 3WTWA 4HUXB 4DZBA 1ZS2A 2AXGB 1Y7VA 2NY4B 4U2ZA 3OV6A 2PTUA 4EIUA 1GC1H 2UYLA 2XZQL 1INEL 3HMXL 3VXSD 2VR8A 5GJTL 4ONGL 2KBGA 3WHE1 4NZFA 3FQ4A 4WO4B 5D1XC 3T4AA 4C4UA 2RFXB 1DQDH 4KTDH 2VDOL 1A14H 4ELMF 2WBJB 4FS0A 2LT9A 1EEQA 3P2BA 3QDMB 4WFFE 4FQIL 4XBMA 3S35H 4N0YH 2JIXD 1JS4A 3PQYE 5FC9A 4P59H 4WWKD 1QFWH 1FJ1A 4Y1AE 1G7PA 3BP5B 5G5DB 4UI2A 5K39A 3UBXA 3VTMA 4H8QA 1SJXA 1PJ9A 3IE4A 2D3LA 3O6KL 2K4WA 3LB6C 1ZGLM 1ZT1A 1BECA 1VPOL 3BIAX 5ANHA 1KBGL 2VQ1A 2P8PB 3BJLA 5AEAA 1SLWA 4FZ8H 2RACA 3S37X 1GTNA 4QRRE 3GS7A 2CR0A 5LWYH 5C07A 3GSVB 5B39A 4J3VA 3DSNA 3R1GH 4CVZB 2CKBB 3AG1B 5INCB 1JOIA 3JT0A 3T2NH 3RDJA 5BNXD 5TQ0H 3WNKA 2EICA 2XIBA 1U93A 4LLVB 1MAJA 1YUKB 1A1NA 1IMHC 3IFOA 3IS0X 2ICWA 4MA1B 3TF7C 2VUKA 1OOAA 2G4EA 3N85H 4I18B 4YHKH 5EU6E 2AS5M 4OLVL 2X4SA 2APFA 4JFEA 4N2AA 5BO1H 1IGTB 4ZOEA 5DA0B 4OLUL 3N43F 5D7IE 1NZRA 3DMMC 3NAAH 1D9KB 4HXAH 3PAUA 35C8L 1J1OH 4Z7UA 3VTAA 2HJKB 1ACZA 1KIRA 1G43A 1UWXH 4S1DD 4RIRA 4KK9D 2VRAA 1T03L 3JWNE 3RZCD 3TEWA 1XBRA 4Y5YC 5I15H 5FCUL 1FZOB 5I76B 1E9PB 5GJSH 4U1NB 1VAHA 4X9HA 2EDJA 1AOHA 1NGYA 2ILLA 2IAAC 4HS8H 1FFPA 4K3DL 1NFIA 3RWHA 2BY2A 1OTTD 2B4CH 3X1NA 4YDJA 3FAWA 2G2RB 3DPBB 2DJ4A 3QRLA 4TSAH 2XBZA 2D4FA 3D3VA 4UQDA 4Z3GA 3W38A 1AMYA 2OTUB 4QWWD 4Z7NB 1ZGLA 1BZDA 2YD4A 3INOA 4GQRA 5HHNB 1D5BB 2AW2A 1SHSA 2WQXA 4P5TD 1X5LA 4G3YL 3TZVC 3MROB 4NXKA 1IAIH 1XR9A 4I0PB 4G8FB 3N42F 4XNZC 3CV5A 1JZIA 5GS1A 2WVUA 3GXPA 5A2AA 1PQZA 1J5OH 3Q06A 3ZL2A 2QMJA 2CLZA 3OJDB 4U6XA 1AQMA 2AEQH 2Q86B 5F7NC 2LLGA 1QATA 1JPSH 3PWPA 2EKJA 3MREB 3ZL1A 4KJQC 2E7LC 3X3FL 4H0GA 3S3PA 1ZK9A 1MCWW 2VRKA 1MLBA 5CLXA 3PWJB 3GMLA 1PLGL 4X99A 5F6HJ 5F88A 4FTVB 1JPST 3HLKA 4QRRD 5B7MA 1N9PA 2Q5BA 2A3TA 1FFTB 3TBBA 3REWB 1OGTB 3LKNB 1NJ9B 3D4ZA 5I71C 4V1DD 2GC7C 4RX4D 1RI8A 4KKBD 2H1PH 5E23A 5F9OH 1PZCA 1P4LA 3CZJA 2NYKA 4LRNH 5L2KE 3TM6A 1NGWB 3I6LE 3EADA 2V33A 4XCNB 3SDDC 1GGIL 5BV7B 5T5FA 4R2GB 1UD2A 3WJMA 3ZL4H 1FL6A 5HDBF 2YXFA 5DJAB 3KVQA 1E30A 2M26A 4KVCL 5FDYA 1XH1A 4MA3A 4AL8C 1WYJA 3QIBA 3OMNB 1OGPA 4UIMA 2Z4QA 2WLMA 5ESAB 2A2QT 1HKLH 3WFZA 5I5IA 1FNAA 2VCOA 9CGTA 1IBYA 4MQSB 4PP2A 4Z3HA 1F0LA 3D33A 1DVUA 5FHAL 5KBLA 4C4BA 4M48L 4MDIA 1V10A 5JDSB 1G7LB 3WV0A 3DROA 5L4MA 4KDVA 2VABA 1JZ6A 4LVHC 4B60A 3IXTA 3DSFL 2A6DA 4QXGL 1T21B 1IVTA 2P7TB 4PJFB 1QYGH 4HLJA 5EO0A 4ZFGH 3C9NA 3WIFB 3BQUD 1AGEB 2EDFA 2FTAA 3H9HA 5IVXA 4F57H 4U1KA 4JKPL 5KTEL 1KCSL 1ZE3C 3EYFB 2EVFA 1VPOH 2JJVA 3P0VH 4BZ1L 1KBGH 3SDXF 1OGAD 1DFBH 3NFNB 1TO5A 3AT8A 5IROC 4M1GL 3OG4B 1AS6A 2AK4A 5TDOA 5HJ3B 1NMAL 3CK0L 4NRYB 3BT0A 2LAAA 2DMCA 1QSEB 3P0GB 3QFGA 1G7HB 4Q56A 1TJXA 2YC1B 2A5UA 3GXFA 3MRMA 3TBWB 4DGVL 1WA1X 3C6SA 1HZLA 5KG9B 3IDYC 4KVPA 3X13B 3APNA 2J3SA 5LQBL 3KLHC 1XB8A 1ZIAA 5SWSB 5KVGL 4AUYA 2BC4A 2X3AA 2JI3A 2H1XA 4HGMA 4PRHB 6PCYA 1JE6A 1OAQH 4GLRI 3PV6B 1UOWA 3BT2H 1GHFL 3GEFA 1I8KA 2WLKA 3OPZH 4LL9A 3NH7L 4WW2B 5F7KC 2GT9B 4NNPL 2BW4A 2CNZA 5KYNA 1G6RA 1RHHA 2K70A 1MHEA 2Z7YA 5HHQB 1TYEB 35C8H 4OIFA 4Y2DA 2QJDA 3EYOA 3Q0HA 4IMLA 3WKQA 2Y06L 1DANU 3CSFA 4QLRA 1PKQB 2B59A 4KU1A 2V7HB 2WQVA 3D69B 1IT9L 2OKMA 4PS8A 1GCFA 1JG9A 2QKSA 4NO0D 2B8OT 3IK2A 5FCUH 1MJ7L 1DQLL 1EEUA 1ICTA 5GZOC 2WBKA 3FBQA 3KPPB 2DQHL 3D9AL 3FRUA 4K3DH 5DMIL 5HVGB 3TYGH 5JXEC 3Q6FB 3PHQA 4WFHE 2NXYB 5I1CH 1YA5A 2QR0B 3TO2B 1JZDC 1K72A 4MS6A 3QDGA 4RWHA 2HX7A 1YJDL 3D3VE 4YO0B 3B3IB 1UM5H 3MCG1 4HOZA 4FQXD 2N4IA 5DDHB 4UQ3B 3FUDA 4G3YH 1N8ZB 1JYNA 4ETQB 3Q01A 4H8WH 1V3JA 2J4WL 4MMXA 2X40A 3OAZK 1LNUA 2NW3B 2X87A 2W0PA 1I8IA 3CU1A 1ZHBA 3NOIA 4WHTB 3PWPE 2IBZX 4U7MA 4XMLH 1YPZA 3I2CL 3PWUA 3HC0B 5FYJD 3L13A 1IEAB 5EPMB 5J13C 2UZXB 5EIIA 1T1XB 3F7YB 4JFXA 1SOKA 1GXEA 1PLGH 3ME0A 4PTUA 3GJFK 2WHVA 2FCBA 3KPMB 3P54A 5I82A 2APXA 3V4UH 1PG7X 3QIUA 4DGYL 4OB5H 1CTMA 4QHNB 1OY3B 4X83A 3EGSB 1UM6L 1F56A 3MQIA 1T0NB 1WUZA 1DBMH 5EORL 4FDWA 3MLZL 4G8GB 2YOAA 4MJJA 2FX7L 1C5DA 2RB8A 2HLFC 2FE0A 2GKIA 2FYYA 3LIZL 1MCQA 1PIGA 2Y1AA 3QJOA 2BSRB 4NZJA 1R3HB 4WQOA 4LEEA 4P49A 1A6WL 4N8CH 3BWAB 4F33B 1RZKC 1RH8A 3HPJA 1U8QB 4JGJA 3K6OA 4HIIA 2YRBA 5GS0D 3LNFA 5FGCE 2Y6SD 2F19L 5FKPB 1LP9F 1QTPA 2Z64C 3E9TA 3DOHA 2XHNA 3KCPA 2VOTA 1ORQB 4PJ9A 1SJHA 3BZDA 4ZYKB 5EUOA 3QWQB 2TSBA 2GQHA 1J0ZA 3WEOA 2V8MA 3DSFH 3FO2B 5CGBA 1S9VA 4LGSB 3ARED 1RV6X 1T04A 5K1VA 4YDKL 5I8CB 1YQ2A 2QFRA 3CMGA 1J5IA 1S7RB 3ARBD 3DKHA 1PEZA 4UB0L 2OSLA 4OVVA 4WFHD 3MV8D 4HUUA 1NCAL 3ZYJA 4K5LA 4MBRA 1QABA 3L3KA 5IVXE 3HC2A 4JKPH 4TNWF 1U4EA 5I1HH 2QZQA 5AWNL 3W0WB 5DRZB 4H1LB 4BZ1H 1YEJH 5EA0H 5T3XL 3HZMA 3GXNA 4R4NC 3UX9B 1YEHL 3T6ZA 4OFQA 2BP8B 1NMAH 1KPRB 2AK4E 2IAMB 3CK0H 3ZN6A 1TTAA 1W0VA 5E8NA 5J06A 5I1DA 5H35B 1ZXKA 2IC2A 2GJ6A 3UG5A 4KUCD 2XTJB 3MRHA 3OLIA 1V7MH 2VLME 1E9OA 3GBEA 3HNVL 5ANMA 4XP6H 2D31B 2AFNA 1TZHA 4NIYE 3WHE0 1OP9A 1F5WA 2BK8A 4POZC 4U1IA 4I88A 2KZWA 3GXDA 2FRGP 3VFMA 1AO7A 5KVGH 3GXIA 4U3HA 4K8RD 4PGCB 1VESA 1KJ2A 3A4DA 5KSUA 1EJOL 1CXIA 2RQEA 1IGYA 1SYVB 4JN1L 3RHWK 1GHFH 3D50A 3FONA 3OQ3B 2Q7AA 4AEEA 3DUSA 4HUVA 4HOWA 4ZG1A 5CJXC 3ZKND 4U1HA 3QO1B 4IKKA 4YSQA 4O2CB 2BOBA 3DO7B 4HK0A 1KB5A 2EC9T 1HHIB 3SEPA 2OXHB 1ZLSL 2Y06H 3O9WA 4UANA 2VNCA 5ICYA 1S7WB 2HVJA 3HPLA 1IT9H 3NPSB 1QLRA 4HXBL 5D1ZI 4V2BA 2K9UA 3MLUL 3UPAA 1DQLH 4QRSA 4P06A 4G6MH 2YD8A 3BGAA 2X89D 4M29A 1DVFA 1CIUA 5DMIH 2OMVA 3TIEB 3ARGD 1QEWB 1YCSA 5C08D 4M8QA 3HA0A 4GIPD 2XN0A 1NBZA 3O3BA 3S5LA 2YRZA 5LCVL 5LN8A 5JOFA 5JLZB 3QDGE 1OT1A 2XJKA 3HN3A 4XMZA 1IGFH 3TVMB 5C6PB 4G71B 4N2CA 2VR5A 3MV9D 3U4AA 2J6EL 4J3WA 4OJFL 5IB3A 1WAPA 3FQTA 4KDWA 4LLYA 2CBPA 4X5XA 4LAQL 3BP7B 1SDAB 5DSCB 4PS4L 2WSDA 3KPSD 5FDWB 4NQVB 3FH5A 4GRLC 3RVVD 4BRVA 4BUHA 1M1SA 1P7BA 5JMRA 4LVOB 3ULUC 3VD9A 1WC7B 3IU3B 1M56B 5ACZB 3S88H 1EJ8A 1IIIA 5FKAA 1DQQA 1ZV5A 2FJUB 2E9IA 4OFDA 3CCHA 1BD2D 3O6LL 3L4TA 2YMTA 4DGYH 1FFOB 5FUOH 1U8IB 1F1GA 4GQ9H 1I8AA 5DRNA 2AHIA 2OR7A 3OZKA 3CZNA 4XN7A 1VF5C 2JK5A 5EORH 5FIEA 4GKNA 1OSPH 3MLZH 3BKJL 5K9OA 3UZEA 4AY0A 2FX7H 2PO6B 2XN9B 3C60D 2F68X 3TP4A 4PJDE 1GMIA 4B9IA 2HPOA 4NLAA 3T0EA 5K93A 2C9VA 3Q9PA 1YAIA 2V9QA 3D0LB 1PS3A 3FCSB 1WWCA 5ISZA 2CDEA 5C0DA 1A6WH 4MKTA 1HEJC 4OM1L 3U1SH 4H44C 3IJHB 5KN5B 3TBSA 4A55A 2YXVA 4PGDA 4LDLB 4I9WE 4TMPA 1DR9A 1CDJA 1J8HB 1MLCA 1NC4A 4KITB 1U8CB 1GW0A 2BPBA 4WI4A 2F19H 2IALA 3VGDA 1AC6A 1KLFB 1LM8V 2A6IB 3BEWA 2XN1A 4JMXA 4QY8A 2DW5A 4MB4A 5FUCC 5JW3H 5EUOE 4M4PA 3VRJA 4UNVA 3NIFB 2G5UA 4YDKH 2CAKA 1XGTA 3TT1L 1Q0XL 1HTYA 3KGRA 4NKMA 2WW8A 5E1GA 3HUJA 3RGVD 3TBYB 4I48B 1WBXA 4UB0H 4NO2B 4M8RA 3AG3B 3II2A 5IJVA 4W93A 4JUTA 3BD5A 1OTUC 2EO1A 1NCAH 4HUCA 3CFNA 2J57A 4S1SL 3KLDA 2VLKB 4BFFA 3MJ9A 2KQNA 2IH1A 4FQJL 4AYFA 1HK6A 3OM3B 5AWNH 2GSGA 1H5BB 1XF5B 2WIMA 2NY1C 3WIIH 4WGKA 5EG6C 4PIRF 1YEHH 3CX5K 3WL9B 2Y1VA 3FQYA 3RIFF 3QRBA 4YLBA 3WKML 5KYUB 1IO4C 3FSOA 1FLRH 4MGXA 4YAQB 3T6XA 5DJYA 2DV6A 2GJ6E 3HNVH 1S9XA 5DZPA 1ID5I 5ANME 1KUMA 1K2DA 3LEXB 1LDPH 3OAUL 1C16B 4R96B 5EN3A 5IJCC 5HY9B 1A9BA 1JNNH 2QSCL 1RJYA 2BSCA 3NJFA 1RULH 1AO7E 4JM2A 5EU7C 4G7RB 3QG6A 4FQLH 2WP3O 2B1AL 1EJOH 1MI5E 4BXVA 1KV3A 3GSXA 2G9HB 3VXOB 2OX5A 7FABL 5IMOB 1P4BH 3KPTA 2X4PB 2C9AA 1EDYA 4W9JC 5BQ7A 4I0CC 4KWUA 5F1NB 4TUJB 2C3VA 4MZ3A 3VXTB 5TD4A 3F6IA 3UIYA 3AWGA 1FIEA 4WGVB 4X5QA 3OGCA 1S7QA 4JPKL 5IQLA 2DKSA 3MU3A 2A83A 1EMTL 3ML9A 1UB5A 4LLWB 2NY0D 3IWUA 2F9BT 4OM0L 5ID0A 3DBSA 3TO4A 4FQQB 4Z6AT 4JZJC 3MLUH 2R1WB 4Y5VC 3L5WA 2MOGA 2WVVB 4DPAX 2YXMA 3QEGL 5DMYA 4UUJA 4B9ZA 5PCYA 5FK9B 4JKLA 4AL8H 3U7YH 4XBEH 1RZKL 1M05A 3WY2A 2WNKA 4ZTEA 2F7IA 4MAYC 3TJPA 4GYBA 3D6GA 4P5RA 3RNQB 4XX5A 4ZFOB 4JRYB 2QQNL 1PDKB 1JRHL 1VADB 2J6EH 1B3IA 2G3NA 1LWRA 2WO2B 3QUXB 4OJFH 5H4ZA 4KY1L 1HX0A 1NGQH 3VE0A 3IXAB 4QWWC 4LAQH 3ZDZF 1EEZB 3GSRA 5E6RB 2CO4A 4HH8A 4UBDC 3SDXA 2BP0A 3KR3H 1VKXB 1NAMA 2I24N 1P5UA 4FXLA 5EFIA 3KDPB 4UAOB 4G6KL 5GGSA 2VGLM 1M1XB 5EF1A 2O5NA 2WLLB 4PVBA 2P49B 5T3ZD 4KO6A 3O6FD 3U1QA 1T5WA 1ZE3H 5DI8A 4Z3JA 3MUGB 1LE5B 5JTWA 1FSKB 2ENSA 3ZE1E 1KT2B 1W15A 4Y2OA 2ZG2A 5IQNA 4MZIA 4P48A 5I74B 3P30L 3Q2NA 5LLIC 3BKYL 4HPHA 4WW1A 2EEAA 3DOSB 1CFTB 2FBRA 4XXDB 2FD6H 1OW0A 4HG4K 3IN2A 4TS6A 1QZ1A 1ZKAA 4M9OA 3EF4A 3WE6B 3AAZA 5KS9F 1JGLL 2W9EH 2JCCB 3L5IA 2CR3A 1MI5D 1KB9J 4EI6B 2XPYA 3MCKB 1D5MA 5ISZE 4LFHD 2JB5H 3O8XA 4E9WA 1FG2A 5E4EB 4XMKH 3QAZB 4FYSA 4WWNA 3HLAB 4E9TA 3RWGB 3U2SB 4X6FA 3MRCA 2X4QB 4FAAB 4NX0A 1QHQA 5GZNA 1ZVYA 4ODHL 4MS8D 5FB8A 1CT8B 4MZRA 1ETJA 1KJ3H 3TIDA 1Q0XH 3KW7A 3BN9D 4ZRGA 2VT0A 4JM4L 4JQVA 4OQ1A 2BERA 1M71B 2VDMH 2J21A 3HUJE 3OKNB 4TNEA 2N01B 1TTUA 4P23D 3JWNC 3MLWL 3GRBA 1DQTA 3K46A 5B3SB 4S1SH 3K91A 5J89A 4LOUC 5JPNB 2ZICA 4OLEA 3SODB 3V0VA 1JN6A 2ED9A 2CBQA 4A66A 1HHKA 4UTAA 1AJ7L 2EYSB 3WXVH 1KGYE 3SCMD 5JIPA 4M03A 2AEPL 4R7VA 3DVNA 4JE4B 3ARUA 4G9FB 3WKMH 1PD1A 4B9PA 3OKMB 2X4NA 4LLUB 1YEFL 4UT6A 3F7QA 5JPMC 4LEXH 3BMVA 2ARJA 2FB4H 3TYFA 3UAEA 5JW4M 2L7JA 4M6AA 2L04A 3H6AA 4F9LC 4BIKA 3VU1A 3CFCH 1O9WA 4ZBJA 2GITA 2VN4A 2IPKB 2ZNWA 2OXGA 3H7BB 1T89C 4KXCA 3ULUL 5BZXA 4A6YB 3MR9A 1FV1A 1U58A 3RWCA 4ZMAT 4GBXD 4TQEL 3OX8A 4GO6B 2B1AH 3HHRB 4AGPA 2VAJA 4JVUA 4ZQKA 3TEXA 3RILA 4UT9H 1X5GA 2D7NA 4UILH 2V2XB 3APMA 1E67A 3GLDA 3MRGB 3C08L 3UCQA 2KZKA 4BFRA 1A4BA 1BIHA 1VGKA 4PI2A 3RTQD 4EI5D 4XHJD 5CEYA 5ADOL 1N59A 4JPKH 3UG3A 3T2PA 3BISA 3KS0J 3IFPA 5F93C 1LE9B 1JK8B 4HJ1A 3ARFA 1EMTH 4AM0A 4OCWL 4F3FA 2H3NB 3IJEB 5BRPA 1SHWA 2R1XB 1XFPA 3VWKA 3CIQA 5HGGS 3ZTDC 1TNMA 1W2KT 5AAPA 4QCIA 4Z95L 3RWIB 2P48B 5ABZA 2Z0BA 4TV3A 1RZKH 3CSGA 4U1MB 2EDWA 4YDNA 5KOMC 4RVBA 5I6LA 1KCKA 4N2FA 1KYAA 3U30C 2IH9A 4ZUTA 2VM3A 3FNKA 3Q8EA 1QSFA 3BESR 4F1ZA 2DJSA 3MRNB 3RWDB 2K45A 3E8UL 4K94L 4I9XA 4AV0A 2WK2A 4KY1H 1OANA 1TVDA 4R4FL 1AY1L 4G11A 4AX3A 4BK5A 3TASA 4A68A 2W5PA 3BVVA 1ZWIB 5F6IB 2VM9A 5FWQA 3V4PH 1E5UI 1ND0A 3T4AC 4ZDHA 2BRQA 1GAFL 5AYTA 3ZTNL 3T5WA 1TIUA 4WTQA 1B90A 5IBUG 4YPGB 5CD5D 4BFBD 4DCQA 4HP5A 3MLYL 5LGYA 5B1CA 3FU3A 5C0FB 1XGRB 2PXYB 2YLKA 3DJRA 1A9EA 2GCYB 3VM5A 1KBBA 3ZIYA 4JHAL 5J6HB 3QFJB 2H26A 2AP2A 5CBAB 2BY0A 3X17A 5ENWB 1GYAA 3MKKA 3STLA 2A0LD 1BX2B 3TNMB 1G7JA 2ENYA 2RIKA 3TXAA 4X7TB 4RNRA 4G8IA 4NO5B 4Z0XA 4JN2A 1KJMA 2AC0A 1EJFA 1JGLH 3JVFC 5D7LA 5IMLB 2NTFB 3IGAB 4Y4KB 1FORL 2K8QA 2QPEB 2ADFH 1RAMA 4LOVA 2A1WH 4EQ3A 5IUSA 2XQBL 3ZE2E 1DBBL 3D39B 5IQ9B 4G42A 1PZSA 4WEBL 4UQCA 3T4YB 4ACPA 4HKBB 4APXB 1FZKB 1UOVA 4IRSA 2VERN 5EBGA 3L1OH 4OF8A 3WCYA 5GRXG 3MFFB 1WUNT 4LLDB 1H3GA 4ODHH 3MLSL 4LKXA 4JDVB 4OZHF 2B15A 4YSUA 9PCYA 3QUYA 3T71A 3WFDH 1FHGA 1JV5B 5E6YA 3U6XA 4FJYA 4RMQA 5DEZA 3ZE0F 3MRDB 3MLWH 1FI8C 3AREC 1U36A 4N5UA 1CXKA 2P28B 3WUWA 4Y16A 5ICZB 1KTCA 1FAKT 2VR3A 3TPUA 4YHZL 2Z31B 1H15B 2EDNA 2IMNA 4LGRB 2A4CA 3KE0A 1F11B 4HKJA 4IOIB 1DSYA 4QHMB 2XBDA 3G08A 5GRYA 3W9DB 3RDTA 4LQFL 5EBWB 3V0EA 1JGDA 1JHLL 5E7BA 1Z9OA 2VDOB 4N68A 3CHPA 3VU2A 5IQ7L 1IQDA 1ORSA 3C87A 5DK3A 1D6VL 1H9DA 2CRMA 2AQPA 4MFHA 1DTUA 4DP2X 7CGTA 5DFVD 1ID2A 4DSYA 5GS1C 3ULUH 4CN4A 4B9KC 1S9KC 4LSQL 3RWFA 3OKYA 4QRUB 5AZ2H 5TTRA 1XCWA 1KLGB 2DJUA 5A16B 4UNUA 5ID1A 3SIKA 4GRMA 3TN0D 2AMUA 4PR5B 3UZQA 3JBG7 3FOLA 4GW4B 1AHMA 3VWJA 4QHLB 1F4YH 3FDWA 4Z7VA 2TSAA 3QWNA 1DUZA 4LHUB 1GZQB 2ZXWB 3EUDA 3C08H 1G7MA 5D8JL 2V7NA 5IVZB 2BP5M 2JELL 2QVKA 3P11L 3HE7D 2GIYA 1ZVSA 1UWGH 2YQGA 4FMKA 5E5RB 5J6SA 1GPOH 5ADOH 5I1JL 1LO0H 1S8DA 1A6UL 5I1LA 4N1EA 4N3UA 4C58B 3VQMA 3CG8A 3WKYA 4OCWH 2E86A 1DBKL 2GC4C 3HG1E 1IFRA 3L81A 1AZRA 4FYQA 3GMNB 3MVSA 4HLZH 1BXUA 1KTBA 4WKXA 1EERB 1FYHB 4MMYB 4Z95H 2YOCA 4MJID 3T1FB 1GR7A 3FT2B 1E27A 3HE6A 4KMTL 4BM7A 3MNZB 1AQDA 2XACC 1O6VA 1I4FB 2P24B 2XFGB 2XX1A 4OKDA 3DV6B 3TWCL 3QIBC 1DBAL 5DHMC 1VZHA 3MUUA 3E8UH 3D25A 5ILTL 1S3KL 3MGTA 3QGVA 4YEFA 3QPQD 4XB8A 1AY1H 5D1QA 3OAYH 3AABA 4P46B 1MJJA 3DRQB 5E94B 2YEZB 2MHAB 2Z0UA 3S7GA 3GHPA 5IG7A 3EBAA 4UQIM 1I9JH 1GAFH 1KELH 1SLUA 2WXNA 1U9KA 2XBTA 4G1EA 4DEPC 3P77B 4YHIB 1IGMH 1UB6B 1OP3K 1CB4A 4JFDA 2ADJB 2DLGA 5BXFA 5HYJD 3MLYH 1N12A 3D09A 3GRWL 3DRTB 3WHXA 4I2XB 4NKQB 1RIVL 2XG5B 3ULVF 4DWHA 3SYQA 4N4YB 1V3LA 3UTTA 3DTXA 2H9GA 4WCYL 4CC0A 5TH2A 3BI9X 1PYWA 4PRPA 2R7EB 3PWNB 3PGFL 4FL4C 5JIIA 1JK9A 1NANH 2EAEA 3CFEA 4HBCH 5CFAA 2ED8A 3KPQA 3ZDXE 4P4RB 1LEIB 1DCLA 2F1BA 1DQML 1SY6H 2X6MA 5D7LE 4AGMA 2GG1A 1CBJA 3RKDD 3EIFA 4R8WL 2NR6D 4WEUD 2XQBH 3UTPE 1DBBH 4WO4A 4WEBH 2XWJB 3EH4B 2RFXA 3NZUA 3VFSB 3CZLA 2MWCA 4Q9QL 1WE5A 3T04D 3NP4A 3NGBC 2KPNA 1Z3RA 1ASQA 1G7IB 2WBJA 3U48A 3QDMA 1HHGB 4AKOA 3LQZB 1KGXA 2B1HH 3MLSH 3BAEH 5ALBL 3QWOB 2W0LA 4GPVA 4K7PH 4Z7WF 3BP5A 5KVFE 4DUXA 1J0KA 2EEBA 2J8HA 5G5DA 4Y2DC 1MWAL 3E1ZA 1BFVL 4J3OG 2VR6A 2P8PA 1SRDA 3RGVC 4M5TA 4YSPA 2KLTA 2ZIDA 1INDL 5BVPL 1HWWA 2Y22A 2YGVA 3GSVA 2DH3A 4KI5E 5D4QA 3QZBA 4XVJL 4CVZA 4MTMA 5CU9A 2CKBA 1H3PH 3ASNB 5INCA 3QXWA 5B38B 3K71A 4LQFH 1N6UA 3QO0B 4FMFA 4JL2A 4LLVA 1JHLH 1DDHB 2D03H 3U6RB 1ITCA 1I3RB 1C12B 4N2HA 5JHDE 3FB5B 4P9HC 4FG4A 2DBJA 4UDTB 5DZJA 3D4GA 4I18A 4WUUB 3DUHA 1CLCA 4YDIL 2HG5B 4GI8A 2LU4A 4LSQH 3V0JA 2J1XA 5CKGA 5AUMB 4XBPB 2IBBA 3I85A 1IGTA 1IC5L 2D73A 5CBEB 2QKIB 3ZKQD 3KYKL 3S4SG 3T09A 3D52A 1D9KA 3MOAH 3QJQB 5E6IB 4LB8A 1U3JA 1Z5HA 5IB1B 1QFWI 2HJKA 2BHYA 4JW3A 4Z7VE 5FYJL 5D8JH 2VDPL 1RK7A 5MERB 4HMEA 3P11H 4ZO7A 5FA4B 1A6UH 1KGCE 1FZOA 1E9PA 2FIRT 3JTTA 4U1NA 3TH3T 3V0FA 1FVCB 1E43A 3KJ4B 2WNGA 3QIUC 3O0LA 3I9GH 1P69B 4HJUA 25C8L 2G2RA 3FBKA 3DPBA 4O58L 3MA7B 2JKTM 1KBVA 4XP9L 1A7OL 2X4RA 2OTUA 4FN0A 3OF6D 4KMTH 5HHNA 2NY0C 1D5BA 1MHPL 1BREA 2J1WA 4URTB 2XN2A 4NCDA 2YAPA 5EH1A 1UFGA 5C6TL 2CO1A 3MROA 1ZJBA 2EH7H 2D9CA 3WFHB 2ZOKB 4I0PA 4G8FA 2MCPL 3FSZA 2FUTA 2OSWA 4B9GA 1DBAH 5KBMA 3IJYB 1JXJA 5ILTH 4FG6D 3OJDA 3SBQA 1UURA 2EDTA 2VKXA 4OJDH 2BOCB 2Q86A 5HPMB 4TSBL 5D1QE 5GS0L 2UWEF 2CD0A 3TJHD 1L0PA 3MREA 4PJ9C 2YMXL 3U9UB 1IFHH 3PWJA 4BUGA 3JWNH 3V8CA 2EP6A 3ZDYB 4DUVA 4FTVA 4MVBC 4NQEB 3GRWH 1CYWA 2D2OA 3S3BB 2HRPL 4Z7QE 4UZSA 2BSSA 1OGTA 3LKNA 3POHA 1RIVH 4ZOCA 3L5JA 3R7QA 3WJJA 4KRMB 3EOAA 3CPLB 4L5FE 2LABA 3AT0A 3G6JE 2XWCA 3HEIB 3UTTE 1KXHA 3SSGA 4R7NB 3AS0A 1NGWA 3TA3D 3RKPA 1OTSD 3PFQA 4QYAA 3PGFH 4G72B 4XCNA 4NQCB 3HR6A 4JPWL 3WEBA 4D8OA 4KK6D 2X4TB 4AIOA 2NQCA 2Y0SA 2IAND 3D8MA 1P5VB 3WTYA 1NIAA 1D2OA 1I1AB 5C0ND 1SXSA 2H5UA 5T1LD 2WD0A 1PJWA 2WXRA 3NJNA 4JDTL 2Y3AA 5CWSB 2XQYG 3IAPA 4PRDB 1AD0B 2IVFC 1WVZA 4K9EL 2W8CA 3LOWA 2DQCH 1I31A 4Y9GA 3W9EB 3SGDH 5JDSA 1G7LA 1HQRB 4Q9QH 4K8RL 1ACYH 5EU5B 5FPIA 1KGCD 4ODBD 4L3FA 1K5NB 2P7TA 4PJFA 4AJWA 4Q2ZB 5E1HB 2OP4H 4BFKA 1N0XH 3WIFA 3K0YA 3QDME 4ZUUB 5BRZE 3CSBA 1UD5A 2R9HC 3B2XA 1AGEA 3ZZQA 1JF5A 1DQJB 2H2PC 3CZFB 3NPZB 1IX2A 4HOMA 1F90L 3LQAC 4ZW3A 3VI4F 4KAQH 3RQ3A 3CQPA 4W6YB 3EYFA 5PAZA 1BFVH 3DVGB 3SYCA 2XC8A 4FXKB 3ABZA 1FZMB 3NFNA 3N55A 1TTBA 2NY7H 5AVUB 2K4AA 7PCYA 4Z76B 5BVPH 1DVFC 3UTZB 4P23C 4OJYA 1U6AH 4NRYA 4KUZH 1J86A 3VXNB 1QBLL 2R51A 1GJUA 1KEML 1QSEA 1G7HA 3TBWA 3LRKA 4LQ1A 2CIIA 1XIWB 2ENJA 4F58H 5KG9A 3X13A 1KV7A 3QORD 5DD5H 1M2VB 1UQSB 4QHKJ 1ZY9A 2OMXB 1UT2A 5HDWA 2IPUK 1TEGA 5H4YA 3TT3L 1BFSA 1UVQB 5AD0B 4XPHL 3M7OA 3VFNB 4PRHA 4UQ2B 1BVKB 3AU1B 1A1MB 1BF5A 3PV6A 3QXTA 2BWQA 2EADA 1IC5H 3KHQA 1AGFB 4WW2A 5T33L 2GT9A 3F8UB 3QNZB 4X50A 4N6RB 1F4AA 4QAWA 1CMOA 2FDBP 4M3KB 4JG1L 4UTBA 2OW6A 3RWEB 1NCDL 4BK8A 1PKQA 3OJMB 5IBLD 4ZJ9A 3SDYL 5JW4R 2V7HA 2IV8A 3D69A 3EHBC 4UQ9A 4YHMH 4RMTA 2WO3B 2GIXA 4IBZA 2WM0A 3DJTA 2HMIC 4TSCH 2EIKB 4AH2B 3KPPA 4AE0A 2F7PA 3Q6FA 3QJHB 2WPGA 1NCHA 3E9UA 3W1ZA 4M7ZB 4QEGA 4G6FD 2QR0A 3WGUB 25C8H 2JJWA 3TO2A 4BSVB 4OGAD 5AW0B 1CYGA 5J12B 1J0HA 4GNKB 3UZEC 1BJ1H 3UABA 4DKTA 4J4PD 4YO0A 3B3IA 1MHPH 4DKEL 3B5TA 4Z7NE 2H32H 5DDHA 4UQ3A 4XB3A 4A7TA 4XGZB 1N8ZA 4JY4B 1OSYA 5CM1A 3EGXB 4PU2A 2WXMA 4ETQA 1P1ZB 2MCPH 3PWLA 3GMRA 2WIIA 5IBTL 4WFED 3V0HA 4D7PA 2XYBA 3WJLA 4Q8BA 5BRZD 1GYUA 1OAKL 2VISB 4TYUA 2NW3A 5BS0D 1G87A 1KULA 5E9DD 1KPVB 5FX3A 5IY5B 3ZKXC 3BAWA 3L5XH 4FQCL 3VI3B 3H9ZA 4YX2L 2Q2EB 5FAAA 3TLRA 3UAJA 5KVDL 3C6LC 3MRJB 2EZ0C 4YSTA 3CSYB 1IEAA 5EPMA 3V52H 5A3ID 1XTLA 2UZXA 1FN4B 1T1XA 3BVXA 3F7YA 1ZA6A 2DI7A 2FJSA 4GKLA 4J2QA 4UYPA 3ARWA 1CDHA 4NCC1 3KPMA 3VGHA 4FTVE 5E2WH 1K8IB 1AE6H 4WEMB 1GIGH 4QHNA 4EVNA 4LE8A 1JGEB 2G60H 3GUTB 4PJAB 3W2DL 5HYFA 4HGWA 4LCYB 5CSZB 3DV4B 1H3TA 5F3BA 4G8GA 3OWRA 2HKFH 2L0DA 1I9RH 4JPWH 1EO5A 2A9AA 1C5CL 4XCFL 3TNNB 2BSRA 1X7TA 4XPFL 3GMPA 4P9HL 1R3HA 4F15C 2E6PA 4NQQA 4PJ5B 4EZLA 1S7UB 1XX9C 3BWAA 1TQSA 4HFUL 4JDTH 4B9YA 4BE6A 4E9RA 4F33A 3M45A 2VLJB 4KV5F 2RGSA 4DN4L 1J8KA 1U8QA 2DEYX 1Z66A 3PDOB 3QYNA 1NAKL 3FO0L 3RA7L 2I7SA 3DGGB 3DLQR 1DANT 4PCTA 1F2XK 4XH2B 5FKPA 3HFFA 3SD2A 5I0XA 1ORQA 2C1OB 3GSQB 4QRPA 2BSTB 4ZYKA 5KYWB 1DLHB 3E2HC 4JM2C 3FO2A 3DYPA 3N04A 3KJ6H 4KKCD 5CINL 2Y25A 3OAYK 5I8CA 4HEPA 2DM3A 5HDQL 1VFBB 4OT1L 4PJFE 5DUPH 4ZMTA 1S7RA 4B7IA 1JDDA 3L7EB 1CI5A 2K7QA 2BCMA 1TQWA 3UDWA 1KTDB 2Z9TA 2JF1A 1BVLB 5F97E 3L16A 4ZMYA 4KNTA 5HXMA 1I8MA 2FJFB 5DMGC 2JE8A 4YL9A 3KG5A 3W0WA 1NLBH 4H1LA 5DRZA 2NX5B 1YYLL 2Q0ZX 2P5WB 3TO4C 2HVBA 1BF2A 4K7FB 1OM3H 5T5FH 3HB3B 2BP8A 3HKZA 1KPRA 2X2YA 2IAMA 1T0OA 1D5IL 2ZCHL 3DYMA 2YUZA 1QBLH 5H35A 3ZMRA 5FA3B 4GSRA 1AIFB 1IBGL 3N40F 3RVWD 2D31A 1NCOA 3EJPA 4W9FC 5FYKD 4HUMB 3OWEA 3VFGL 2QVFB 3NACH 4YHNB 5ITBL 2EECA 3X14B 3SZKC 1U2YA 2WV3A 3LKRB 1OT2A 5SWSE 3C09B 4JPQA 3F7LA 4XP1L 4XN8A 1WTGT 3TEYA 5LBSA 1I85C 4PGCA 4N2NA 2VDNL 3TT3H 2EINB 4HETA 4XPHH 2CNYA 4XT1C 2XDHA 3W11D 5AW8B 1T83A 5H37G 1WBZB 4PRHE 1X9RA 1SYVA 2YA0A 1YNTF 4RWYL 5T33H 3V7MA 1VENA 2VZUA 2P44B 2YKKA 3S37H 3K6IA 1P5UC 4O2CA 3NRQA 3LHPH 4JG1H 1HHIA 4GMSL 5E4OA 5I16A 2OXHA 1FA4A 3CLWA 3HI1B 3V6BR 1NCDH 2FK9A 4KQ4H 4U6HB 1PKQE 2AEIT 3O0RH 3BUQA 4ACTA 3A24A 4NOFA 5L4IA 4FNSA 4NDMB 4HW6A 3TIEA 2VO8A 3PGDB 3ZGIA 5JQHC 3HBPA 1QEWA 2HB0A 4NN6B 4U0RC 3BUIA 1AGDB 3QUMB 1BOGA 4DP9X 2UX6A 1U33A 5GXBB 5CP7B 4PJHB 1GS6X 1OW0C 2VZVA 5DJ8B 2FGWL 2CM5A 3IRZA 4MJ6B 4HBQA 3LRHA 2VC2L 5HYQB 2WQSA 4HCGA 2AZUA 4NKIL 1KN2H 2YGNA 4ERSL 1N5AA 3BP7A 2ITFA 1NUFA 2ARJQ 3NK4A 4PFEA 3WNPA 2BX5A 5DSCA 3O8XC 4OLZL 5KSAB 1N67A 3EYVB 5FDWA 5IB4B 4NQVA 3ASWA 4HD9A 1UGNA 4TVUA 2XWRA 2OMTB 3PPEA 4YX2H 3I9PA 3IU3A 2JCWA 3NSFA 5ACZA 3U1PA 3AGVA 1MIML 3LQAL 1RHFA 4PJIB 2DQFB 5BW7A 5GZNC 2QSQA 3O45B 3QPQC 4J6IA 1VACB 2ZX6A 1PTZA 5F70A 3PAZA 5LG1A 2ETWA 5GHWH 1E2WA 4ZXBB 4JQVC 1CU4L 1FFOA 2Q3XA 3KLLA 4LASL 1HXYB 3ELQA 3G6AB 1E3ZA 5DD6A 4BFNA 1R34A 2ODIA 1IUZA 3W2DH 4ZMPA 4PRBB 1KY6A 3IPFA 3RY6C 3LPFA 3FB8B 4Q9RL 5CILL 4LLAA 3RL2B 3UTSD 3BGMB 4G8GE 3WUZA 2XN9A 3BAJA 4BCYA 3O11B 5JNYA 1FH5L 1OWRM 4AM0Q 3WO4C 4O9HH 5GPRA 2QTEA 4X5RA 1JCVA 3D0LA 4L1BA 5DYOA 3NEEA 2YQ3A 4P9HH 4NCC2 3BWSA 1AXSB 4HFUH 1NKRA 4MCMA 4W4OC 4DQOL 1PZBA 3IJHA 4RISH 3ZR6A 5KN5A 1NAKH 3FO0H 3FFCB 1IM3D 1J8HA 3RA7H 1U8CA 5C0GB 4J3XA 2A6IA 3U0WH 2VSDA 2G2PA 1PMYA 3JTBA 5E9AA 4N87A 5IK3B 2XV3A 3MRRB 1EHAA 2GI0A 1LJMA 4IU2B 2QGDA 5CINH 3ZUNC 4AQ8A 4HD5A 4JR9H 2NY6C 3L45A 5C7XL 3TBYA 4YDLB 1L7IH 2A74B 4I48A 4AQ1B 2E76C 5JW4Q 4R9HA 4IU3B 5I6PA 5JYLA 4NO2A 4HIQA 5K59F 5BUGA 4NBZB 4NRXB 3VVWA 1K5WA 3H3PH 2X4UB 2VLKA 1A7NH 3TV3L 1X9QA 4DKFL 3ARFC 2LW3A 4PLNC 1H5BA 1XF5A 2NUPB 4JJOA 4XOAA 1YYLH 3W0WE 1QQDB 2BJML 2D4DA 2BNRA 1EZSA 5IW1B 2E7DA 3VWKC 3WL9A 2ADGB 3O3AB 2BIOA 1F4HA 1GGTA 3A22A 4JQXA 5KYUA 4F2FA 2ZCHH 2R8SL 3N44F 3QHTC 4YAQA 4V33A 5D5ME 2WP3T 1JHKL 2HT3C 1KFAL 2MH4A 2XTJE 3ET9F 4XOCA 3LN5A 4PJ8B 5IHUH 1VZIA 4R96A 1C16A 5ITBH 1FNLA 1INQB 5HY9A 1DL7H 2HRHA 1RZIB 4ZMXA 4XP1H 3KH3A 3LPGA 4Y1SA 4ZAKD 4BQBA 1BYNA 2F53B 4BK5C 1WFTA 3F83A 3FTGB 2ZOOA 5IMOA 3VXOA 3VXME 3GK8L 4AMKL 4M6OL 2X4PA 4IOFD 4RWYH 1DO5A 1PSKL 3P9WB 5KVEE 3VXTA 3VD7A 1GGUA 1P84K 2BWIA 4X6CF 3RX7A 1IM9D 3TH4T 1YHPA 3LH2L 4GMSH 1DUYB 2IO5A 3MJ9L 4EDWH 4HKXA 3OC8A 3SN6N 3LKPB 1HAUA 4F8OA 5C2BH 1FLTX 2FWUA 4LLWA 4XRCB 4GEJA 4X4KA 4FQQA 5AVQB 2R1WA 3CN4A 4X80L 1UASA 1QPXA 3QJFB 2WVVA 4Y8DC 2FH8A 1R19A 4XN5A 4IGBD 3KM1A 4DETA 2I32A 1YEIL 1HH6B 1M2OA 4GAGH 3U4KA 5DURB 3L7FB 1G6VK 2XPZA 4MMZB 5J57B 2CGRL 3OLGA 3RNQA 2VXVH 1UENA 3HAEH 1U3HA 1MFNA 4FFWC 2AJ3B 4YC2C 5EEYA 4ZFOA 4JRYA 1PDKA 2FGWH 2PPAA 5INDB 1HSAB 1VADA 4JRFA 4B96A 3KXFB 3SE8L 3QUXA 2VC2H 4PVNA 1JWSB 3IXAA 4G6AD 5FW8A 1XF1A 1TETH 1EEZA 5LHDA 2ZYRA 1F97A 4FKKA 5AOKA 2EE2A 2GBAA 1CE1L 2DQGL 3H9YA 3WXWL 4GRWB 2ADYA 1VKXA 4ZS7H 5E4AA 5CEZE 2PCPB 1M1XA 2ROYA 1KCWA 2WLLA 3NJIA 1JXGA 3TU6A 4GG6E 4FG6C 1MIMH 3LQAH 2XXCB 1JUFB 3IDNB 5JIMA 5AAWA 1NICA 4J3UA 1L9OA 1R5IA 3MUGA 4KZ0A 5C0RL 3QUYC 1LE5A 3W37A 4PVMA 2AJYH 2J8UE 1KT2A 1SJEB 4PGBB 1Z5LB 4C56B 2CXGA 2DQTH 3WU1A 5E5UB 4D9LL 3T77B 1HZHL 3C2AL 5CILH 2A77L 3FQNB 1ZJAA 3DOSA 3VG9B 1CFTA 1FH5H 3BVTA 4XXDA 2C4FT 2XN9E 1AG6A 4KI5C 2JKIS 2C3HA 3WE6A 2WQRA 1L4IA 1CGUA 4IRJD 4S1RH 2N59A 3NABL 2JCCA 4CC4C 3B7UX 4Y19D 4RRPM 3ROLB 4P5SA 2P8LB 3MCKA 3RDTC 3VXMD 3VRIB 3B3BA 2W07B 5DHVB 3CMOL 2OBGA 4DQOH 3SKMB 3MOBL 5DMKB 2UXGA 4QOKD 4P8QA 5EZLB 5HHXL 3T0XA 3RUGE 4OF7A 2E75C 1EGJA 5I9QB 3HLAA 4B50A 4JQIA 3RWGA 4N5ED 1E3FA 1PG7H 4DERA 1CCZA 3Q43A 4HZ1A 2X4QA 4YBHA 1UCTA 1QTSA 4HS3B 4PJGF 5E99L 4OJEH 2JIXB 4WDIB 1T80A 2CLVB 2A6JB 4WWKB 4M7LL 3NIFE 2B9BA 3O2WH 2MQCA 5CNHA 4BCXA 2ERJC 4MJ5B 3VWJC 4V2CB 4PHZA 5D2LB 5DTFB 3BUYA 1U30A 3B9AA 3OKNA 4KPHL 2HH0L 3BPNB