4Z1PA

Bspa_c_mut
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
VLFQGPPTKKVLDENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSSLLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQIKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNDTVKLGDEVTYKLEGWVVPANRGYDLFEYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRSSAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BspA_C_mut
rcsb
source organism Streptococcus agalactiae
molecule tags Cell adhesion
molecule keywords Cell wall surface anchor protein
total genus 98
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00746 Gram_pos_anchor LPXTG cell wall anchor motif
A PF16364 Antigen_C Cell surface antigen C-terminus
A PF17998 AgI_II_C2 Cell surface antigen I/II C2 terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z1pA01
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z1pA02
2X9YA 2F6AA 2WOYA 5DZAA 2WZAA 3RPKA 3RKPA 3OPUA 4Z1PA 2Y1VA 3V10A 4UZGA 4IGBB 2Z1PA 4Z23A 4IGBC 2XTLA 3PG2A 2F68X 2X9WA 2WQSA 4OFQA 5DZ9A 3UXFA 3QDHA 2OKMA 3KPTA 3PF2A 2X9XA 4IGBD 3HR6A 4P0DA 1AMXA 2X9ZA 3QE5A 4IGBA 4HSQA 3HTLX
chains in the Genus database with same CATH superfamily
2E6PA 2IH3B 3D08A 4CAGA 1F45A 4J4PA 5FC9A 5EUKB 3J7HA 4N6QA 2DTMH 1KFGA 2EDBA 2JKNA 4S2SB 3H0TA 4JY6B 3QUMA 4L8CB 2BY0A 4UOQA 1OK0A 5LXVA 2JLPA 2HRLA 3ZDXF 2O6PA 2NTSP 5L8KB 3BJ91 3HC4H 3LQAL 1FL6A 1A6TB 3MKKA 3ZDWA 4PJGE 3U2SA 1Z5HA 5K93A 3FF7A 1TQTA 4JY4A 4DEUA 5I8KH 2NUPA 2X9XA 4E9WA 3QJHB 4JUSA 4M3KB 2NX5A 4PJ5E 1HE8A 4ZXBB 4HA1A 1PZBA 5DURD 2P46B 1HI6B 5HHVL 1HL5A 5ICZB 2D7QA 3SJVE 4ELME 1BZQK 2PTVA 5BZDA 1WC7B 1B3IA 3LD8C 3PGFH 4GKZB 2Y1YA 3OAZK 4OLEA 4FA6A 5FYKL 3OHMB 2Q6WB 1EA9C 4X5QA 3L45A 3O3DB 1G9NL 4KDTA 4LEOA 4K3GA 3B9KB 2F1AA 5LG1A 5SWQA 5B3JE 3UBHA 3V6FA 5BMFL 3SKOB 3W1ZA 5A2FA 4HUCA 1P5VB 2Y07H 5B4MC 3D39D 5C8JB 3AAZB 1TVDA 3NZHL 4KJWD 2YUVA 4LARH 1MQ8A 3H0TB 1HXMB 2UV3A 4NEHB 5EO9A 4Z8FL 1MCPH 3G6JA 1WE5A 1IM3A 3GI8H 3GXMA 4G80B 1YPZE 3LNIA 3MRLB 1E4KA 3P30L 1KTJA 1QFUL 3AU1A 4M8VA 4N3TA 1EHAA 3FOMA 1G7PA 3ARFD 4GJTB 4LCYA 4E42B 4HIPA 4BBWA 4LLWA 4YMPA 4XAKD 4NUGH 1S7XB 3ARGB 3VCLB 4S2SA 2ZPKL 2XN2A 3MJ9A 1VADB 1XGUB 2GTQA 2YGQA 4F80A 3MRPB 5KVGL 5JQIB 1G43A 3AFLA 3ALWA 3LZFH 4QJ4B 4KI5F 1V7NL 3R1GH 3HZMA 3IWVA 3X13B 2EYSA 1SJEB 3K71B 2C3GA 1OALA 1OANA 2LFGA 3E6HA 1QSFA 2B9BA 3NCYS 3DUSB 3IE9A 5CJ8A 3VFUA 1QFWL 1T83A 2YMTA 5C0BE 4FYTA 3VE0A 4M5YH 4ZQKA 4N26A 3CQFA 3HFFA 4CSTA 1PZ5A 4OH2A 5MEOB 1GXEA 2EICA 1RK1B 2YOCA 3WG7B 1IT9L 1UCTA 1UWGH 3OAUL 2G5UA 2VLKB 1GCFA 4TUUA 3QPXH 3UP6A 3WE1A 1LO0L 2XYCA 3K4DA 2FT7A 2NUTA 2V8LA 3NJJA 3OKNB 3GO1H 5CJXC 3GTNA 4I0PD 4JGMA 2IBGA 5E9DB 1BOYA 1NC4A 3CXDL 4FLSA 3O3AA 3F83A 5HVHC 5DYFA 3EYSH 5D1XE 4NPKA 1G0YR 2O5YL 2OMVA 3BUTA 3IPEA 2H1LM 5GRXG 4NQDA 4P9HL 3GJFA 1MCWM 5GSRA 4ANWA 4I9WE 1ETZB 3B9KD 4NGHL 1S8DB 1AOHA 5IB5B 1FG9C 5AYUL 5AL0A 2MCPL 3ZZ1A 3V7AG 5JPMA 1FVEB 1DBJH 2V9TA 3BUDA 4K94H 5AOZA 4NQSB 4CW1B 4GKLA 3TEWA 4PJEB 2IAMD 5HGAB 3QXDB 1JFQL 5TJWK 4O51A 4PU2A 1ZIBA 5C7XL 4M8QB 1HX0A 4QOKE 3CBJB 4X5RA 2WINB 3GSWB 4J7RA 4KO9A 4A2MA 4BWWA 1WT5A 1X7SA 1X7QB 2OSWA 1H5BA 1BIHA 2DLTA 1GAFL 4X7FC 2DQCH 3GMQA 1I8IA 5E6IB 1FFOB 3Q44A 3RNKA 5B3JF 3LZNA 4GI6A 3I50H 2Z93B 4OGXH 2Q8BL 2VL5A 3DVFA 2UY7A 2E7BA 2GC7C 1KLGB 1FYTD 4QF1B 3QUXC 4FFYA 1A3RH 5JXAL 2FIKB 3OKEB 4G8IA 4H25A 5J5EA 1COBA 4PGZA 2EH7L 4NN7C 1DJYA 1JZGA 4HX1B 1NM4A 3L2LA 4HWBH 5JDJA 1NIEA 1YDPB 3HN8A 4Q6KA 3MRCB 5DRNA 1DDTA 1AZRA 1QRNE 3CZKA 4BZYA 1FP5A 4I4WA 4P2AA 3VFOB 1V05A 2XZQL 5JIIA 2TSBA 3TFBA 5EG6C 4TNGA 3LD8B 2WWOA 2DYPB 4GLRI 4YK4C 4AIXA 2AABH 4FQXB 5E6UB 4YSRA 2NLJA 5LBSA 1JCKA 1XQ4A 4M5SA 3GYRA 3E9UA 1QI4A 4TM9A 3SDAD 5ADPH 1ITBB 3P0YL 4IU2A 4EUPB 1U42A 1GCYA 1NJ9A 3P9MA 4MJ5A 5KSBB 4BZ1A 1XB3A 5IBUB 3TVMA 2GUOB 4A7SA 1QMUA 2YK1L 3PHSA 3VFMA 4N2EA 2A9BA 2EEDA 5T1MB 2FEJA 5HYQA 4K3JL 3ZVVA 2HPOA 2KZWA 2PF6A 5C0BD 2XWEA 1K5WA 2YEQA 3X2QB 4L0ZA 4MXVF 1RUKL 3EOAA 4KQ3H 5FDWA 1FRGL 1OOAA 2DI7A 5DVMA 5T5FA 3NIGB 2BERA 3BWUC 2ZCKH 1NCWH 1O6SB 3FMGH 1BP3B 3SE4C 3FHQA 3GMRA 4G7QB 1HKLH 1V7NH 2OMZB 4HF5L 2FHCA 2GCYA 2G2NA 4N8UA 5E6IA 4JY5L 4MA8H 2PXYB 3D3VA 1U4FA 1UYWH 4G9FD 4HGMA 3M88A 3SGKA 3EH1A 4JB9L 6CGTA 3WN5B 5HJ3A 4OZFA 4XXDA 2XZCH 5KBNC 1CS6A 4ZMLA 4DESA 2YRPA 2D3NA 2FL5A 4BWUA 4H8HA 1I3GH 1YEDA 2VDRB 1ZPUA 4K71C 5ANME 5JR1H 1RVFH 4Z6AT 4HWBA 5D7KD 4JPWH 1NMCC 3FOLB 1CD1B 3HB3C 3O8XC 4NNYB 5GGUB 1T0MB 1XL4A 2J1XA 1D5IL 3D85A 4LHUD 3GO1L 4O2FB 5C0GA 5HGHB 1O9ZA 4E0RA 2Q7AA 4QXGL 3I75B 3G9VA 4Z76B 3ABZA 3CFDA 4P9MH 3RTQD 4PV8B 2RR3A 4WZ9A 3CN1A 4IRJD 1MCNA 2CPUA 1PKQB 3EG9B 1EHNA 3KD4A 3P73A 4Y2NA 4NJ9H 4JDTH 4ZAKA 5F7EH 2FLMA 1P6FA 2W81C 4Z95L 1A6VH 4XPFL 1L0QA 1S7VB 4JQIL 2DLGA 4N9GA 4U6TA 5ICXA 3UTPD 1MJJA 4NN5C 4HIQA 4K94L 4XNMB 4XZUA 1AXSA 1R1CA 2VLRD 4K0OA 2DKSA 4AW4A 4IDJL 3CFIC 2MCG1 4DQAA 5I8CB 2VSCA 4PRPD 4B95C 5DK0A 5C7XH 2R59A 2HX9A 1S3RA 3U0TB 1F02I 2RACA 5DMJB 2XWXA 1SOKA 3KLDA 3QDJB 4OFVA 5DHVB 1MG3C 2ZCLH 3FT3B 1IGCH 3NCYP 3EO9H 1HSAB 5KN5A 1BZ7B 1LDPH 2GTZB 3WY1A 1BSIA 4YHIA 1F1AA 4A6YH 3N41F 3U79A 1XIWB 2J25A 2E9JA 4BXVA 4YXHL 4UOW1 4KROB 3QXUA 1KJVA 5GRUH 2BSRB 2WQXA 2AK4B 3BIBX 4B0MB 2YMXL 2MPVA 3EFDH 1ILUA 1X6LA 2EDEA 4LGSB 5EOQL 5DRZB 1AH1A 1DBAH 1TJXA 4X99A 1FNLA 2EC9U 3TO4D 2J8UF 4D8OA 5K9KB 1YN7A 4GMTH 2AW2A 1BXVA 1T2QH 1G0XA 2Y1AA 3QYNA 4R6UA 1I9JL 1EDYA 3NJXA 4XP1H 1JGIA 2CUHA 3DJ9A 1NMBL 4KAQH 1ZEAH 3GSQB 1SQ2N 1UXWA 3CFDB 3ZYJA 3RI5K 2NRDA 1KBVA 4JQVA 1H3VA 1F56A 3HI5H 3WDIA 4GG6B 1N64L 1QNZH 1A4KA 3RHWK 1SDYA 3UJJL 2BCKA 1LE5A 1AQKL 4Z7QE 1BQLL 4R90L 2HN7A 3D05A 3QHFH 3HZKA 4L9LA 2YR3A 5L2JB 4AJYV 4A04A 1WGVA 4LLMB 1DCEA 2N3JA 2EVHA 5FHAL 4G7YL 4LVHC 3HR6A 4AG4L 3FZUC 1MAKA 2DKMA 3I3DA 4A63A 3OB8A 2ZCKL 2Y3AA 1KWGA 4L37A 5EEXA 4U4BA 4PJ7A 1CL7H 2HKHL 5IK3B 1WFOA 1CO1A 2X89D 1XBRA 1DFBL 4EI6A 1ODUA 3MLWL 1HXYA 1LL1A 4CADB 2DQIL 3F5WB 2HVBA 1Z66A 1H6UA 2QR0A 3GXIA 4LZKA 3WJMB 3FHEA 4PGBA 1WP6A 4GUQA 4V1DE 4OI9A 4WTZG 2VLMD 4ZMWA 4JN1H 3VFPB 3TBCA 1GR7A 5K5YA 1RVFL 3EW3B 3HAEH 5HI4D 3K7UA 3Q06A 4KFMA 4OZHF 3UCRA 2ODIA 1PZUB 3HE6A 3QIWA 1D5IH 3ARGD 4UT6L 2NY2C 3SE9L 2EH8H 1F4WL 1S8DA 3L5XL 1C7SA 3VD1A 3ZE1E 2A7BA 5F1KC 4L0PB 2AV7A 3QQ3B 1THAA 1WAPA 1CQKA 4HLZG 4HMEA 3RGVB 1XF3A 3FQUA 5IW1A 5AW0B 3TV8A 5L2KE 4PRPE 1IKFL 3CSPA 3DROA 2AJZB 3VWJC 2H8PA 4L48A 1A6VL 2FECI 3QO0A 3CFTA 4A55A 1AXTH 3QISA 2PW2B 2YAHA 3GS4A 3PWLB 3SGEH 4UQBA 1ZSHA 2H0JA 5KYWA 3IDNB 2VXVH 3QUMH 3JWDH 4CU7A 4GP5B 1UD8A 1DLFH 1SOXA 2W0KA 4OFDA 1TTRA 2ZUTA 5JO5B 3EOBB 1JWSB 1NCHA 4OCLC 2JKIS 5AW9B 1WWWX 5HBBA 2DS4A 2UWEB 4OFIA 1MWAA 3MLUH 2Q6WA 4U1SB 2QELA 2N0MA 3JTTB 1IGCL 4NZFA 4X5XB 2PCYA 4GBXA 4GW4B 1AIFA 2ZQKA 4NKIL 1JI2A 1QHPA 3VD2A 3LVTA 2JI3A 5C07D 2FQGA 2FHFA 1SY6A 4L3EB 3PCYA 4P5RA 1F90L 1RJLA 3PDOA 4DVBB 4XVUC 3EFFB 2MRYA 2ZPKH 4FC3E 4XH2A 5AQ0A 4M29A 3RBGA 4R9HA 2PR4H 5B8CA 4HS3A 5EOQH 1ZHKB 3PL6D 1DBAL 1OT4A 5LB1A 1UD6A 5T1KD 3WKQA 3BO8A 1P69B 2BNQE 3GMPA 5AD0B 4ENEC 2EE3A 1JHLL 4GMTL 2WQ8A 1TQWA 4G9FB 3QRGL 1O6VA 2OR7A 2WNWA 1MFMA 3ZQXA 4JZNA 3RPBA 3KJ6H 5BNXD 3QUGA 4FLHA 5D1QD 4WFGE 3WD5L 4F7KA 1SJEA 1XH0A 4B9GA 4XVOA 1JPSL 1QSEE 2ALWA 1M7DA 4GEIA 2WMPB 2W59A 3X11B 5TPWL 2Z0BA 3CZNA 3EJTA 1P9MA 5KW9H 1ZTXH 5EIIB 1QW9A 3UERA 5A43C 2WNKA 2AFNA 3CFBB 3K6NA 3D18B 2IADB 2IBZX 2NYKA 4WI9A 4LFHD 2VLKA 4UQ9A 5IQ9B 4G42A 1CDCA 3L3HB 4ZS6C 2A6IA 3N40P 1ACYL 1O0VA 4RAUA 2PP9A 3I9IA 3PWUB 5LAXB 3MRRA 3Q6GH 3FQRA 3TVMD 3NCJH 4K8RD 1ZDQA 3THMH 4Y9CA 4J27A 1KYFA 4MVBD 5GGQL 3LH9A 4N1CA 5MHSE 1MWAH 3GEFA 3U30B 5AG8A 3BQUC 1FZOB 3IDXH 1P7KB 2G5BB 5TE4H 4X4XA 4ZS7H 3V0EA 4RGNC 5CZXC 1FVEA 5FAAA 1A4JB 5EHFA 3NDZE 1WICA 4QWWC 3QUMB 4TTDD 1ZLWK 1CFNA 2FBJH 4U4IA 5JOEA 1KXTA 5E2WH 1KXHA 3K81A 4OM0L 2MCAA 1KBBA 3ARQA 5AKVA 1NBZB 3QDME 4LP5A 1QR1A 3BW9B 4XNYH 1MCJA 3M86A 1IBGL 3ARYA 3SDAC 1BEYL 4Z7NB 3MLRH 4J3TA 3DK2A 3X3GH 5DC2A 3CFCL 2DN7A 5EF2A 2R56L 1BQSA 4DJMA 5L9DL 4M02A 3GMOB 5DHEA 4Z7VB 4WWNA 1VZHA 4FFZA 4UZSA 1UH3A 4KDVA 4F7PA 3QUML 2D73A 4CGUB 1BG1A 4WV1C 4EAEA 2IAMA 4MASA 3NGBC 4JZJA 4YLQT 1HWWA 5I18H 1QSFD 5I16A 3RVWC 4BCZA 1B0RA 3CPLA 4ZAKD 1CI3M 1Z9MA 2NNRA 2VLRA 1BPLB 3MUJA 3TIDA 4D9LL 5HP5A 2ZWYA 1VACB 4WWOA 3IDIA 1TQCC 3WIIH 4PB9L 2IJ0C 3RL1B 1R24A 4FRWA 4FEMA 1S3KL 3BW9A 2YK1H 2YQ2A 2BSBA 1HEHC 2ETWA 3FYIB 4UOJA 4JFWA 1KPVB 5HXMA 3SIKA 3WEBA 4WW2A 4K7PH 4B7IA 4DEPC 4U6XA 3FOMB 3VRJB 1E5ZA 3CHXA 4ONFH 1BQHA 2VH5L 5D2NE 4WIQA 2KDGA 5BZWB 3STLB 1CLOH 2ITDB 5F89B 4Y4FD 1E4XI 4JANB 4Y89A 2WWMD 2NY4C 2XQYG 1JBJA 1ET8A 3UC0L 4Q74A 1KXQE 2BSSB 2FO4A 3RIFF 1ADQH 1UG9A 3WD5H 4AX3A 4LP4A 4ABWA 4RQQA 4F2MB 5ID0B 1SM3L 3LS5L 3MNMA 4G9FA 4N2AA 3GBNL 4IOSA 1EO5A 2BWQA 4RSVA 4X4YB 1UT1A 4BD4A 2RQ8A 1LP9B 5IHZB 2OAAA 1KWKA 5IJKC 3C5ZA 3BKYL 3TO2A 3GMOA 1AJ7L 1QQDB 3PREA 1W9XA 1C9SA 3BQVA 5A2KH 4DVRH 2MEJB 2CBQA 1G7IB 1SN0A 1ZTXE 4KX7A 4NQTA 3RLSA 2R8SH 5IB3B 4AGQA 4YSDA 4YGVA 1IC7L 5HDBE 1GZHA 5IBTH 5DEZA 3I85A 1IUZA 1NCUA 5DD5H 3CDGB 3Q6GL 1MHEA 1U3HA 3BH8B 3QFDB 1TYJA 4PV8A 5LXGH 2X12A 1CZ8H 3EHBB 2AQSA 3VRIA 5AG9A 1B2YA 2EEXA 3IAQA 3GMPB 4AIZB 4X7TB 1OT2A 3WIAA 4NNYA 4Z7OE 4FFVD 1V3KA 1WFNA 4ZMAT 1OPGL 4GKSB 3O4LD 3OWRA 4XZ4A 3CTTA 2DICA 2KUTA 1CCZA 3B2XA 5DGQA 2D7NA 2I32A 3DRQB 3RWIA 3B9EA 2R39A 3ARFC 3WS3B 4PGBB 3UAJD 2JB6B 1M7DB 1QUNA 3VX1A 2EIMB 4HEPA 1WG3A 3O4LB 5H8DA 4AYDC 3GBEA 1WQVT 1BVOA 4HSCX 3D69B 2FBOJ 3T77A 4PJBA 3MRDB 4N2DA 1ZA6B 2RIKA 3MLRL 4NNPH 2PO6B 1KB5B 4ODUB 5F7DB 2ITEA 2PWGA 1IAKA 1UATA 2IMNA 3I3BA 3O6KL 3S35L 1IGIL 4Y4HB 1GZQB 4Y19E 4V2CB 4LE8A 3WI9A 3QORD 1QVOB 2XKNA 5ICUA 5IB4B 2AQ2A 5B1KA 4YIQB 5F7YC 3WJLA 5IJKA 3OTTA 1NCTA 2HT3C 5E56A 3V9CA 2VZ1A 1QBBA 2XY1A 1EHLH 4WI5A 2E9GA 4QEGA 3QJFA 2G9KA 5DDHB 4H88H 4X6FB 5BUPA 5DMGC 3TP4A 4ONHA 1YEEH 4KAQL 2A3TA 1VA9A 2WSPA 3BPNC 5INCB 1Z5YD 4Z95H 5TH2A 1MCOL 2XXMB 4LB8A 4C58B 5HD8D 3FH8A 3BPLB 4WUUD 3EJYD 4PB9H 4U1MB 4DGYH 2CNYA 1S3KH 4JG9A 4GO6B 5HYSB 1ADWA 3TYGL 1HL9A 2B39A 3VXTB 4PREA 1NFIB 4HJJH 1JPST 4N8VA 4TUOB 3K4AA 3SPCA 2PYFA 1XGRA 2XV2A 3T4AC 5KS9A 2NNFA 1JGDB 1NBCA 3O6MH 2X4UB 5GGTH 1SDDA 1CL7L 3NJNA 3ABKB 3BUYA 4P2QE 3VFNA 3S2CA 5DSCA 1H3UA 3DXAB 3DJRA 5ES4B 3PP3K 5E1AA 1WA2X 4M6MH 4X0NA 5F9OL 1U3YA 4GXUN 2B20A 1PZ3A 1D6EA 3CPUA 4EMZA 1PD0A 1M71B 3QPQC 4HJUA 3RDTD 1MQKL 5F3HA 4OLWH 5HDBF 4NO3A 3EFOB 4QT5A 4OVUA 4UILH 3RP1A 3IPFA 1DEEB 5EBGA 2KDYA 1ZDSA 4FGMA 5LBSL 3Q8BA 5DJDA 3K6SA 3BD5A 1ORQA 2EE0A 2OPCA 3S3JA 3KWWA 1Z2KA 2NCEA 4PY8I 2CUMA 5JYLA 2F5BH 3LHPH 2R8SL 3L4YA 1PZ2A 3LNHA 4H13C 3IYLW 1NTDA 3DPBB 2XI9A 1UURA 4O9HH 1SEBB 2E8YA 4G9DB 5DD5L 1JDAA 1TPXC 3WUWA 4DN3L 1IM3D 1NCAL 1E3ZA 4PJXF 5TFSL 3RGVA 4YHLL 5EORL 3FO9A 4NX0A 3LRMA 2E46A 4FFYL 1T2JA 3MOBH 3SYAA 5DR5L 5EZIH 1XR8B 1ETA1 3OGOE 2BY3A 4R3SA 4G6KH 5DZ9A 4Z7UA 2FX7L 3NACH 5DU7A 4FN0A 5D2NC 5I6MA 1U8NB 3MRCA 1WAAE 2WJ7A 4LK4A 1J0IA 4U6HB 5HHQA 1U8PB 3V6OE 2NY5H 1WZKA 3D39A 5DJDB 5E4IA 3CQPA 1CLCA 1Q94A 3K71A 3GBDA 2ZX8A 3HZVB 3V5HB 1G9NC 1I7UB 3ZIYA 1KG0A 2YEZB 2WLJA 4LCCB 5C0NC 5DHVA 1S7WB 2JKLA 5DSCB 4PVMA 1TZIB 3GHEH 5IIEB 2V2XB 4PBDA 3VXPA 3TVMC 4H2CA 1HJBC 2OMZA 2V8MA 1IGIH 2VN6A 4RFEB 1RZJL 5IESL 5EEUA 3MI6A 4U0RB 5AVYB 2F18A 4BFEA 2CE6A 3RVXD 3LZQA 3F85A 4NRXB 3HI1A 4N0UA 3BT2H 2DWYA 1TMQA 4NI6A 4Q9CA 4LSRL 4XXCA 1L7IH 1U30A 2XKUA 2BVPB 2E7CA 5E94A 3W39A 2WZ6A 4RA3A 3DGDA 5K9KA 5I1GH 1BD2A 1MCOH 2GCYB 5KANG 1PAMA 3WUWB 5AW5B 3RIAF 3MJ9H 2PKDA 3EJRA 4MHHI 3QE5A 1RPKA 4J6IA 4J3XA 3LZPA 1EEZB 2JK5B 1RLWA 5DRXB 5KW9L 4BSJA 4FJYA 1IMHC 1QO3B 3AG1B 3QCVL 5IIEA 1FNGA 3S8FB 1OGTB 3S88H 2WNXA 1MJJB 5CJBA 3M46A 5DJ2B 3RPIA 4Y8AA 2VLKD 5CLYA 2IALA 1LO3L 5CGTA 1L4IA 2OJEB 4LLVB 5LGJB 5GGTL 2GABA 3PXJA 2NX5E 2CMRL 2EKSB 3HE7B 5GGQH 3CSYB 3EYOB 4AWJC 4HWZA 1JRHI 4N4YB 4F9LA 4YSSA 1PG7X 4XPGL 5BOZG 1JWUA 2OX5A 1KCUL 2IH8A 1LWHA 3CXHK 2B1HH 2JQMA 3OKOA 2WXJA 2XN0A 1SHXA 3QDGE 4OLWL 2ZD0A 3DGGB 4R26H 3RUGB 5C2BH 3HKFA 1YN6A 3ROLA 3FKUS 4TKWA 4BFGA 5ICXB 2VDMB 1OP4A 4XP4L 1MZZA 5F7MC 4PJXA 3T4YA 1XCTB 2BIHA 2BM3A 3GBML 1KEMH 3P77B 1CB4A 1G7QA 2QGEA 4HZLB 4D0BA 5AKRA 2Y23A 4U1MA 3TYFB 5SWSB 1PAZA 2CXGA 3VWJB 2MKLC 5D7HA 1WSST 3G6JE 4ABUA 4X7TA 2A5UA 1G9MC 1QSVA 2JIXA 4N8CH 3VFTA 4BSWA 5HVGB 3ZSTA 3H7BB 1MIEH 4UTCA 2A99A 3P9MB 5AVQB 1V7MH 4WENB 5FYKD 2D7TH 4PJGB 5B1BB 3JTSA 2OMXA 5BXFB 3A24A 1JNLH 3CIAA 3V0VA 1TETL 4A2LA 3QHTC 1GS7A 4NLHA 4ZD3L 5EU6B 1QYGL 1ZANL 2F68X 2ZX5A 2QQLL 3DXAA 3OLDA 3P3UA 3OG6B 1VPOH 5LLIC 4G6KL 1FHNA 1E5YA 3V0WL 2XV0A 3RZCB 3V4LA 3IJ9A 4DHLA 1FFNA 4BH8A 3STZA 5F3HB 2VZUA 3AACA 4UIMB 1PZCA 5HHMD 1N8ZA 1X5GA 2DQHH 3WY3A 3QYMA 3G04A 1IGJB 3ZDXB 2IO5A 4PJAA 3ARVA 2QKSA 1AQHA 3B2DC 2DLFH 1P84K 3MTRA 3I6KA 5ICZA 5KS9F 5A40E 4PMFA 4RNRB 3QFJB 4OQTA 2KS0A 4HT1H 2R0ZH 4ETYA 2ENPA 2Y5TB 5DC4B 4Z7WF 1J9QA 2G3XA 1WZMA 1BVLB 2WKLA 5TDNA 5D8JH 5BO1H 5D7SH 1NMAL 5IESH 1KJ2H 3F64A 5DEFB 2NNAB 4HKZB 3SDXE 3PDOB 3PGDA 1QLFB 5HGAA 1OQXA 3QA3A 3S3PA 4AE1A 3E1ZA 4YFLI 3WXVH 1YQ2A 3D6GA 3VX0A 1YC8A 1H15A 4FNLL 1RUMH 4YWGL 5F3BA 4JHAH 1RAMA 4OSUL 5FYJE 3UC0H 5H37A 3BAEH 2D03H 1RPUA 2ISDA 3GK8L 3DETD 2C9SA 3EZ8A 3ARDB 5E0FA 5EEVA 1BZEA 3LS5H 4X7SL 3GT6A 1RSYA 3HFML 2Q76B 3KPSB 4ZZKA 3AUVA 1TU2A 5F89A 3BKYH 3C5ZC 1JVOA 4L8BA 1I1FB 1F2XK 1IFRA 3D4GA 1JMZA 1K4DA 3ALXA 4YHKL 5DFAA 1EFXD 2PW2A 2ZT9C 4LSQH 4KUCF 2H41A 3VCLA 2WYTA 5TQ2L 5I15L 3R06B 3FQNA 2WKOF 4RIRB 1YEGL 5JPNC 1E4XL 1FVCB 2YPKA 2OBGA 4PJDE 4I1RA 4M1CC 4F2FA 3L1GA 3SDDB 4OIIH 4W1TA 3K6OA 3NFSH 4H4NA 2J21A 2VXQH 3CU7A 1BMWA 1KLGA 1U3HD 4LSPL 1QKZL 2FO4B 4Y5XC 5TQ0H 2PR9A 1N26A 3QFDA 2HT4C 3EXJA 3WY4A 4WUKL 4M62L 4XCFH 2W38A 3N43F 4M6NL 5LWYH 2FTAA 5I5MA 3QIUC 2WB1A 3VI3B 3PWPB 3EH5B 5BS0E 1D2OA 1U2YA 1TCMA 3AVEA 1O7DE 1S7XA 1ZGLA 3LS4H 1XAUA 5BVJA 5ILTH 3LSOA 4EE2A 3ZBMA 4JDZB 3HC3H 5F8QC 2FJUB 4WV1B 3PHQA 2P5EE 3T3MF 4E5XA 1HQRB 4KKBD 2GK2A 1FO0A 4UAHA 3BKCL 4OW6A 2QMKA 4PLJC 3CVIH 4JJOA 1OE1A 2V5TA 3IDYB 2PW1A 4W4OA 1AGFA 3KPLA 4W4OC 3VU2A 2AXHA 2JH2A 2QDWA 4F5CA 1FFTB 4P9HC 3RX7A 2FYYB 4LPXA 1JN6A 2CGYA 2YBRB 4MZIA 1XGQA 2G2RB 2IANA 4KXCA 1H6FA 3DI2B 3IJ7A 3LEVL 1E9OA 4AH2A 4HUXB 1N5YL 2E9WA 4QRRA 3VMOA 2GC4C 3WJJC 3VGAC 3QUZC 2I5YH 4IGBC 2BXYA 4L0YA 3B34A 3V8OA 3C6SB 4PRID 3V0WH 5M94B 1BF2A 3O11B 4RMUA 3LQZA 4IMKC 4LHUB 1Q9KA 4U1LA 3WYRA 2BH0A 4J28A 3HPJA 3NJMA 4N86A 5I1DB 1U93A 1LQBC 4NRZB 4POUB 1RZIA 4GKZA 4AC4A 4DCQB 5E2VH 3CDZA 5I2IB 1MW0A 3JV4B 3SQBA 1MNNA 3B2VH 1DVSA 1HCFX 4YDZA 2R29L 5IVXE 3ZHNA 2F54B 1PYWA 3OHXA 5BQ7A 4RGMB 2GK0A 3K1DA 5B39B 1EMTL 3BX7C 5GGSY 1U92B 3IDYC 4HT1L 3P4LA 1PVHA 3L2NA 2YD5A 4TLKA 1IEAB 4JFTA 3T8VA 3KR3H 5ANMA 1KN4L 4G6JL 5D8JL 1DUZA 3W9DA 3MXWH 1CURA 4MCMA 3T0AA 4ZMZA 1YNTB 1MWOA 2PPEA 4M5ZH 4OR1A 4Y8DC 3V6FB 4YS4A 4BRVA 3SYCA 2HWZL 1JI1A 4JG0L 1A3LH 1ACZA 4I2XA 5LNEA 2PTUA 3C6SA 2VO8A 1F3JB 2FT8A 3V0AC 3Q7JA 5TDPB 3OMNB 2ESVB 1JHKH 5J13B 1A65A 2WCPA 4UU9A 4AEHH 2YOAA 4OSUH 2YRBA 4AL8C 3FQRB 4BFKA 1OLLA 3GC3A 4X8JA 5F8RC 3VQ2C 1S9XB 1ORSA 5DT1L 5E5UB 1V10A 5ITBL 3KYAA 1JN6B 1V8HA 1USQA 3VD7A 5EZOL 2MNJB 4HVBA 2XQBL 1JTTA 3NH7H 3TNNA 1T7VA 1K3IA 3S4SG 5K69A 2PXYD 5C0CD 5GS3A 3RVVD 1IAIM 1OF2A 1OF0A 4UANA 3ARSA 5JO5A 1MFVA 3F7YB 2VSMB 3J07A 3SEPA 3JYBA 1PZDA 5GJSL 4OAWA 3TZVC 2Q8AH 2GJPA 4P05A 3BE1L 1NCBL 3B3IB 2CR6A 4O9HL 1QI5A 4EXKA 5KYWB 1LVEA 2BFGA 4QRRD 4F7EA 4EIUA 5HDOA 3UZVB 1ZLDA 5EFIB 3W9EA 2C4XA 4QLWA 3GS7A 1MI5B 2ZXGA 3E6FA 4A6YB 3FN0L 5EORH 4LSPH 1RZPA 1SMDA 3UZEA 3OKLB 4GPVA 1K6QL 2GBTA 5AAMC 2A1WH 3MV8D 1KTKE 2JCCA 4U1SA 2VCOA 3ABGA 1O5PA 3ZUCA 2GAZB 3MUUA 4K23L 3WXWH 4XH2B 1WS7A 4G1EA 3T0WA 1Q38A 1IEAA 4HLZH 4OY9A 3HC3L 1XR9A 4Y16D 4FQ1H 5FGCB 3TCXA 4L3EA 4P48A 4WFFD 4NRYA 5GS0H 2VABA 5BVPL 3KPSA 5IT2L 2SEBB 5TE7H 2ID5A 2EO7A 1X44A 2IH3A 2Y7QA 4Y9GA 4D9QD 1U8JA 2HP4A 1JZFA 5D7JC 1PQZB 1MLCA 4GW1B 5KAQG 3F12A 3OR6A 1IAMA 5KSBE 2A6DA 1K3ZA 2EYRA 1AQDA 1MFBL 3JWOL 4JHVA 4YE0A 1NKRA 1G4MA 5HYJE 4OF8A 1CR9H 1E8XA 5F96H 2G60H 2GG1A 2W9DL 3NN8A 4WY7L 2AC0A 4OZFG 5JMOC 2Q2LA 2XV3A 4J3OD 3NCXA 3DVGA 4KV5E 4U6YB 5EC1B 2R1YB 2ZXWB 5DD6B 4G5AA 3KWTA 3FCUB 4Z77B 3HG1B 3L5WB 3MFFA 4OJYA 1AHKA 1FV1A 1URIA 3RGBA 5CINL 1DFXA 2XVLA 4GSUA 1N6QL 5AKTA 3EH4B 3AT0A 4ODXB 3OMAB 2Q3XA 4F7CA 4EI5A 3KLAA 1NEZA 2B59A 1UXLA 2P3YA 3CHOA 1I1RA 3V55A 1PSKL 1CD9B 3FTUA 7PCYA 3CX5K 3D4CA 4XB7A 4BK5A 5CM1A 4G8FB 3C8DA 1AGDB 4KUZH 1YEFH 2V2TA 3UGXA 4OV5B 3B7RL 4YR6A 4OIFA 1LWRA 3FCBA 3HNSL 2I07B 1XF5A 1PX4A 5KVEE 2DY2A 3IFNL 4AMKL 3DDFA 2YARA 2VDPH 1FE8H 1NAKH 2FD6H 3F62A 5C92A 3IDNA 2XTJB 4Y4KB 1ETB1 4XO9A 4AOFA 1OHQA 2HWZH 3FQWB 2MH4A 4JRFA 4JG0H 3QNXA 4KMLB 4LCWD 2XNAA 5DK2A 4AEIH 4DGIL 1LMIA 4GEJA 4I3SH 1NPUA 1JHKL 1AD0A 4NWUL 5L2KA 1OSZA 2EKSA 2Z1KA 3MV7E 1UGKA 3SGKC 3EYFA 3L95B 2E9IA 4HALA 4BA0A 1OAYL 3L5HA 1PEZA 4NJAH 4JJ5A 4MJJA 1OGTA 3RWHA 2DWEA 4X9BA 3PGFL 4JKPH 2OJEA 5MEPA 3EGSA 5L0QB 2OCJA 1RIVL 3SOBH 2XXGA 4W9CC 1S9KC 5TK4A 4JG1H 1J5DA 1ZHNB 3Q6FA 1OHZA 3QR0A 4LLMA 4KX9A 3F7KA 3HE6C 5GJSH 5LNDA 2P5WB 2WWKO 2BSCA 2J57A 1XD0A 3ECBB 3Q48A 4UNTA 1KLFA 3U46B 5JDSB 2IQAA 4ZMPA 2W91A 3AU0A 3N55A 3NZSA 1C5DB 2WM0A 5AWNH 5SWZD 1CGTA 3RWJA 1JNJA 4XCNA 5HHNA 4H20H 5FKAA 4OZHA 4KZEH 1ZJBA 3F5WA 3NSYA 4D9RE 3P77A 3VW3H 4KTDL 3BFWA 3ABLB 1ZV9A 2JV6A 4PJHF 3QJUB 5E8PA 5C0GB 1CBJA 3OJVC 2WXRA 1AQ8A 1JUFB 1JZDC 1LNUA 3JWDC 3ZDYB 4B96A 2ZJSL 1XCTA 4PJ8B 2DEXX 4J8RB 3QPKA 4IS6A 5I66A 3KCPB 5E5MA 3W0WE 4F7MB 2WCSA 1WFMA 1DBBL 4CKVX 5I82A 3WAJA 5I1LA 2DD8H 5A6IA 3JTSB 1CLZH 3R18A 3PDDA 4A67A 3RU8H 3WFDL 1S7RB 4A7VA 3HC0A 4JHWH 4U1KA 4IKKA 1U91A 3LZFL 3QNYB 1D6VH 4TNVF 5HPMB 3BZFB 1I3UA 4FFWD 4L4TB 2NY1B 2Y2WA 3BUYB 1VFBB 4FNUA 4UQAA 5HDWA 4YDVB 2WXPA 3IWUA 1MOEA 2WLZA 4GS7C 2GJZB 5F96L 4NQQA 1JWMA 4M5YL 1LILA 2GFBA 3B6SB 5F0LB 3NEOA 1BV8A 4QRUA 2QADD 3H53A 3GHBL 2VLKE 1TEYA 3GZKA 2N7AA 1WHOA 3ZIMA 4K71B 3FQ4A 1H9DA 1JF6A 3KLQA 2OXGA 5DJ6B 3QCTL 1W15A 4PGEA 3H85A 1PU0A 2O4EA 4MJ2A 5F0PB 4H7VA 4WEEA 5A16B 5FS5A 3AM8A 3L7FB 3VDAA 5KN5B 3B2UD 4B9YA 2CO1A 1WCBB 3J27A 4XNBA 3C87A 2B59B 2XICA 3EGXA 4BINA 4X99B 5MP6H 5CZXD 2MCPH 1EO8L 3INOA 2UX7A 4P4RB 4J5VA 3WNIA 1P2CA 2JK5A 3HKZA 1THCA 2DM3A 3VACA 5KYUB 3PXLA 4R97B 2XU9A 3OQ3B 2BRRL 4GKNB 2V3DA 4O2EA 3DK0A 3QDMA 3WIFA 4AEIL 1WBYA 3QFJE 2R2EB 2DOCA 1JHTB 2OULB 1MEXH 2DMKA 1KPRB 3KGRA 4HUUA 5FOBB 4Q7DA 1A6WL 1MCIA 2IAAC 3MLXH 2OMTB 1SXCA 4WI4A 4WO4B 5F9AC 1U36A 3BVTA 4HUMB 2BJMH 4ODHH 1OAYH 3JBG7 4G5ZH 4WCYH 1BVKB 5FDWB 4WVRA 4YDIH 3LMJL 1A3RL 5JXAH 5ESVB 1OD7A 3PNWB 4X6BB 4XC3H 3GSWA 3QQDA 1F2QA 4O2FA 2D0HA 1RUPL 2WYZA 3ZGHA 3GUFA 5K59E 4GRWE 4F92B 5IZ7A 2ZX9A 1E6JH 1I31A 2CHXA 1MUJA 2JKWA 2ZXDA 1TYEB 4AITA 2JIXD 1E5BA 4H26B 4PRHD 2VLRE 2WVSA 1LLAA 3NUKA 4Z7QF 1UQSA 5C9KA 1DBML 3BPLC 4FI6A 1LO2H 4L1TA 4RWYH 1HH6A 5JDSA 4I18C 2HX7A 4XHJD 3RI5F 5DDHA 5I1HH 1AO7D 3QCUL 4PJCB 3S34L 5F7WC 4ERSL 4XMUA 4YH6A 4CRPA 2XNAB 3IGFA 4KMQA 2MMXA 4DGVH 4U05A 3RTQA 4N28A 3NJKA 5IHUL 2NNCA 3VXRA 1MNUH 4EJ1C 3FUMA 5L88H 3BZ4A 1ZIAA 1PZSA 4KKQA 3CAFA 4TTDC 5FW6A 3T5WA 5HYSA 4ZMQA 3INUH 1P5UC 2APVA 1G7HA 4UT9H 1WBXA 5GQBA 1PX3A 4Z7UF 4I88A 5E1AB 2GBUA 3F58L 5DEGA 4OFKA 4EUPA 4I85A 1D6EB 4JHWL 4TYUA 2VQTA 5EBWA 3OJDB 5IQLA 5D55A 4N0CD 2CLZA 5D7LD 4N2LA 3DYMA 3BAXA 5K59F 2ZAIA 3U46A 4IBUA 4O4YH 3ZRSA 1NINA 1QI3A 4N87A 5DJCB 5T33L 1BQ5A 3L4ZA 5I1CH 2Q5BA 5B21A 4HU2A 1T1XB 1BVNP 3QDJD 2X3CA 1UZ6E 4AGPA 2WXNA 4XO4A 4U1NA 4OD3L 5DJ8B 3EFOA 3ZE2B 1RJCA 3R4DA 1SF5A 1S5HA 3QP3A 2WBKA 2Z92A 1W0WB 3DVGB 3MLZL 4WHDA 1Q0YH 4C4KO 1GW6A 4E9XA 2M26A 1NAML 1F0LA 4QXGH 4YDKH 1SHWA 2GSGB 3MBWA 3FQTB 3IS0X 5FLUA 1IGFL 5FO7A 5BQ7B 2EIKB 1PKQE 1AP2B 3ELAT 4JGNA 2B0SL 3QHZL 2ZG2A 4JFEA 4PRNB 4ZPTB 2XVKA 2EDDA 3L1OH 4OZIF 4H2AA 3DBXA 3E0GA 3RY6C 1ZY9A 4BDVB 4QRQB 2AEQH 5D7EA 3PWPE 5J0BA 1AGCB 1GMIA 1GA2A 1SJMA 3RKDC 1PCXA 2FWSA 3Q1SH 1QLEH 3OXRB 2IDTA 4LCIH 2X4SA 1HILB 3FFCE 4M7LH 2EACA 4OZFH 5EO0B 4AQEB 3BE1H 1FNHA 3FZUD 3TA3C 2JCCF 2KZKA 2UZYA 5E9DD 5KVEL 4CW1A 3FFOA 1B6UA 1BQUA 3MX0A 3PY9A 1A4AA 3MRDA 4M4RB 4ACTA 3IU4H 3DUHA 1FFOA 3REVB 4LVOB 3UH8A 3KBEA 5I24A 1OAQH 4ZUTB 5ESQB 4NKOB 4TLSA 5MERA 4JREC 2J7LA 3GMQB 4G59C 4A6YL 1LO4L 2YWZA 4Y19A 3CLEL 3JVGA 3KVPA 4WCYL 1UM4H 3BAYA 5CFHA 3EO0A 3B1UA 1RZJC 3BXNA 3QR1A 4X80H 2Q2EB 4XO8A 1KEGL 5T1DL 4JKWA 1I3VA 4JRYB 3VFGL 5SV3A 2LLNA 4QJ3B 4DPBX 2P24B 4W9KC 2WWMC 1RXLA 1TTFA 2FJFB 2G75A 3SZKC 5HJGA 3BMWA 4JDZA 4BZ1H 3VFRA 2ZWZA 3BP7B 4HETA 4OZIE 3WFBH 1QZ1A 1D5RA 1SHMA 4P4KC 1RHHA 2NY1D 4QXTA 4IOIB 3QRLA 5BS0D 1YJDL 7FABH 3DO7A 4KV5F 6PAZA 3V79C 1BFOA 1NANH 5ID0A 2BOBA 5DFVC 4F7TB 4Y4FA 4E9TA 1RURL 1EDQA 4FNTA 4RETB 3S34H 4BUHA 2X4QA 3SY0B 2VDOL 1YEKH 3WTSA 2X0VA 1I1AD 3UG5A 4V1DA 2OXHB 5HI3D 3V5KA 2OFQA 4HH9B 2QHRL 1FC2D 3L13A 3RWDB 4GUCA 1NGXB 4MJIB 4GKSA 1FAIH 2A0LD 1T5XB 5CAYB 1AG6A 2ITFA 1Q0XL 3ASNB 1A4JA 5IBUG 1C5BH 3MUGB 1A21A 1I1AB 2B4CC 3H2QA 1UWEL 3X1BA 3QARA 3EO0B 2TAAA 5F9WB 3ZTNH 2WP3T 1X5KA 4OQ1A 5F44A 3HB3D 3O8XD 2ICWJ 4FFTA 4U49A 4TSCH 3QDGB 4G3YL 1N67A 1SJVA 4M7ZC 3F58H 5AVVB 2A0LC 4JPIA 3OC5A 1UZ6F 1SLWA 5FA3A 3H8NA 5FV2A 1QR1B 1LGVA 1BBDL 2EEFA 2XQYK 3GSXB 2HKHH 4Y9FA 3BVDB 4XPHL 3MRPA 3VFRB 4Z0BL 2JJUA 4FYQA 3B1TA 1IRAY 3WSQH 5IV2B 1CICB 1J8HB 1A7RH 3U2SB 4Y2DC 4Z3IA 1HJCA 3MRJB 5I1CL 1B0RB 1EZUA 1ZLEA 2UX6A 3CPLB 1G7JB 3VXSD 3FUHA 4L05A 3L54A 4YVNA 3KXFE 4JN1L 1OSYA 2JI2A 5AW3B 2CM6A 4OCXH 1PLBA 4GSDL 1IC5L 4WFHD 4Z7WA 4QWWD 1JNHA 5IB1A 1NAMH 4O00A 5JHDD 3L5XH 3RRQA 5HVWA 4KK9C 4BGDA 4JFVA 1G1KA 2N1KA 1IGFH 5I1JL 4JFSA 4OKVB 4HXBH 1U6AH 4N20A 4DQOH 1O5DT 3B5HA 2B0SH 4FQIH 1QPKA 4YXKH 3S5ZA 3S5LG 4CVUA 4JKPL 3VG9B 4OCSL 5T3ZH 1I8MB 4LQ1A 5EIIA 4PD4J 3BO8B 1XZ0B 5AD0A 4HV8B 3AZUA 3IJHB 4HHAA 4FMFA 2CKBL 5IQ9A 5HHMB 1KPVA 3MV9B 2BZDA 4K3EL 2E7LC 3Q1SL 4UNVA 4OTXL 3U1SL 1MCSA 4QRQA 2N7BA 3QIUB 4XMLH 4TMPA 4R7LA 1JV5B 2BZCA 1A6UH 2J6EA 3PJNA 4MJ6A 4EZMA 2DQDH 3MRKB 4GNKB 1QLRA 3H9SE 3LXCA 4C55A 3BKML 3JWNG 4RMRA 4K8RC 3MLUL 1CYGA 2H5UA 1OAQL 1G1YA 5DQDH 2X42A 5I6PA 4GW5B 1JXGA 1LDSA 5LGHH 1BX2B 1CVSC 3ZKMC 2YD4A 1N0LB 3V9FA 3CHPA 1ZK9A 3OMZA 2WKOA 3REVA 2V2WA 1R3LB 1G84A 2QBWA 4G42B 4O2CA 1Y1DA 3EDDA 1SVBA 3ESMA 4R4FL 3V4PB 1CTOA 4WGKA 4PS4L 2CJTA 3JT2A 1KCRH 3ZE0F 1X4ZA 4FF9A 1D7CA 3FCTA 4O02L 2H2PC 4QTHA 5TDNB 4FQLL 4DZBB 4JO2H 1AGEA 1MREH 3A23A 5SX4H 2ED8A 2COVD 4JFQA 1D6VL 1J9SA 3MRGA 1JZ7A 5CZRA 3UFIA 2WLLA 4TLTA 1T0PB 4DKDC 1WD8A 3H9SB 4M3HA 3H4HA 4X6CB 2IDFA 1PIFA 1G6RL 4FL4C 4PV1C 2WLYA 3T65B 4LOEA 2XKSA 1OP5K 1I53A 1GY1A 1JPSH 3H9SD 5BW7A 3F65A 4KOCA 2QZQA 2DV6A 2R0KL 4WTQA 4KBPA 3UBXB 3RWEB 5F1SA 1EVTC 1RSFA 3EJQA 4LP8A 4OGQC 4P07A 4QRAA 3S3DB 3UYPB 1N10A 3ARBD 4B9JA 4XMKL 1P4BH 3N1QC 1MI5D 2OR9H 3MGOA 4LNVA 4F8PA 3WO3B 4GG8A 1F86A 1UXWB 1B4JH 4Z78B 1S7SB 2BCMA 2JIXB 2AQPA 3HS0A 5CN3A 3G5YA 3D0LA 4A68A 4KHTH 3OHXC 2FATL 2YPKB 3MV8A 3L3IA 2AKRA 3PQYD 5EN3A 1ZHBA 2A4CA 3WOVA 3UYOD 3S5LA 4B53A 1UWYA 4C57C 1DSFH 4MWFA 3IDMA 4ZS7L 2RMNA 1JPGB 1QLEB 2AITA 1R17A 2YD3A 3DO3A 5D5MA 5EBMA 4B6ZA 5F70A 3EGDA 4P4RA 1BWMA 2CHWA 5BRZE 1EBPA 4PRNA 4TQHA 4OCYL 3IGAB 2WP3O 5C2UB 2BPBA 1ZTMA 2HYMA 5LCVH 2QSTA 3DX3A 5F0JB 2LU7A 3ATDA 1BQKA 1HOEA 4W6YB 4FADA 2YD0A 1A6WH 2D7PA 3MLXL 2CO7A 4XNYL 1DJHA 1T3FA 1SF3A 1IBGH 4NT6B 5T1LB 3O9WD 4JPVL 4NIYE 1KTRL 5HHVH 3PPEA 4HXBL 4J1UB 1P5UB 4NDMB 1DO6A 2XPGA 3G6DH 2BSTA 1QX1A 4L1LA 1Z9OA 4R96A 4NN6C 5CLWA 3LMJH 4DPCX 4GKNA 1GIGH 1Z6JT 5EA0L 5DJAB 5TK2A 1OM3L 4OU3A 7CGTA 1OB0A 2P1YA 3DYOA 5DMIH 1JSYA 5HHPA 2W80C 4PQXA 3RFZC 3T6QC 4HKZA 5L6YH 3QQDB 1ZE3H 2YA2A 2DPKA 5L7XL 1T0NA 2Y07L 3DOHA 1JZIA 2BWDA 4HZ1A 1HH9B 4FX5A 3NABH 5IW1B 3C60D 4F2EA 4ALAC 2CNZA 1JV2B 3ZTJH 4OLZL 4IRZH 3T6XA 5E23A 3EZJB 3S35X 1EWHA 5HHOE 1KXQA 3AS2A 4L2LA 4M61A 1VIWA 4Z3HA 4DZ8B 3QORB 1H19A 2YUXA 3QJZA 3U82B 3BEWA 4G9FE 4KJWC 5FCUL 4BH7B 3BPOC 3KYKL 2LFEA 1R4XA 2Q20A 4YHOL 3BUBA 3HC4L 4Y5YA 1I7ZB 3TF7C 4U1GB 3QJVB 8CGTA 2GIXA 1QA9A 4YBHA 5JIDA 5ISZB 5IHHA 2BNRD 2JJTC 3I9PA 1J88A 1MLBA 1EPFA 4FQLH 2ZNWA 3EYOA 1MREL 2E6QA 3HZYB 3BRFA 4KVPA 1GTFA 1XGYH 4GRLA 1NDGB 4YL9A 4Q6YA 1UENA 4UZGA 5CJQH 3TBVA 5GGRA 3RL2B 4LQFL 4IMLA 5BZXA 3SJVA 4ELMA 2CRMA 2VW6A 3DARA 3PJLA 5H37H 3NTCL 5I73C 4NBZB 1MG2C 5J11C 3ECQA 1AFVL 3W37A 3MUY1 4R97C 3B37A 1BA9A 1DJIA 3RZWA 1IBYA 5E08H 4LF3B 4IOFC 3R8BB 4NOBA 1CIDA 1X3DA 2QFRA 3HNTL 2XVBA 5FUOH 4NN5B 4BE5A 2QKIB 3DJSA 1A66A 2OR9L 1N4XH 3WN5A 4YDKL 1D5BB 1CYXA 5EDXA 2N01B 3AC0A 4LSTL 1BHGA 5LO7A 4W81A 3T0XA 2DMCA 3FB8B 4JKKA 4GIOA 3QG7L 1S7WA 3TTSA 5LXGL 1DLHB 3O4LE 5BRZB 2OSLB 5J6HA 1IGML 3C5SA 1LP9F 4GRLB 2AEQL 3OSVA 3VFOA 5I6XB 3KLKA 1V5JA 3T6WA 3L4CA 4YHYC 5D2NB 3HB3B 3O8XB 3PL6C 5TD4A 1DBJL 3E1F1 5DD1L 3IM1A 1PLCA 3KL3A 5A1AA 1DVYA 4PLKC 1HVXA 4HJTA 2P26A 1I7ZA 2R0WH 5CN1A 1M05A 5G55A 5T5NG 3TCLA 4PR5A 2VIRB 4YE4L 1S7VA 1GZPA 3MRHB 2AVGA 2Z7UA 4L3AA 1A7BA 1J0YA 1IB5A 3D4ZA 4N9GB 4L8SA 5MEQB 5BUAA 1JGEA 1OGAA 2F7IA 2R2EA 1TPXB 1OVZA 3HNVL 3K0YA 2D3VA 4NQXA 2ESVD 1XGZA 3O6LL 1RZ8B 1XHHA 2QKIC 2FO8A 3KGUA 5E99L 2YA1A 3FQXB 3U36A 2ZX7A 2OMWA 5G4NA 5CF3A 1JD7A 1P4LA 5A2AA 3W38A 5DK0B 1E8ZA 2BNRA 1P9MC 1E65A 1XF1A 5ALBH 4UQDA 1GIGL 2I7SA 4PJBF 4G8GD 4TPRH 2WXKA 4HWBL 3HAEA 4K73A 1H9VA 4GAAA 1PMYA 4LF3A 3PV6A 4XNZB 1NM9A 2JJSC 1JWMB 4FXKA 4GG6A 1NJ9B 4XRCA 4WJ5A 2G3MA 5D7LE 1EHLL 4F2ME 3A22A 1R3IH 3ESNA 4P4KA 5C09D 1AGBB 4G6AC 5IG7A 2PXYA 3D3VB 2YXWA 4HJIA 5F7DA 4QT5B 5IVXA 4PG9B 4ZTPH 2J3SA 5C08A 4NGHH 2CO2A 1ILSA 4OI8A 1WAAF 5AYUH 3EADA 4HBCL 5F7LB 4Z7NE 3C6LC 3NOIA 3RWCA 2Z35A 3VU1A 2WUBL 2VZSA 2IVFC 2E0PA 3GQFA 4G7RB 2F1EA 3BESR 4U1GC 2QHRH 4YIQA 4X2UA 1I1CA 3RE0A 4F27A 2OP4H 1NDTA 2N59A 3FOLA 5GGUA 4AJ0A 4IBYA 4M7LT 4YHOH 3W2DH 2ZCZA 3ZL2A 1GPOL 4F8LA 1S9VB 2LTQB 2PMZA 3IMUA 1XF2B 4GT0A 3NZ8A 4MZ3A 4HC1L 5D2LF 1FL5A 5KTEH 4EDWL 3SKJH 4O2CB 5KBKA 2ZOLA 2V37A 1DO5A 1L9RA 3FO9B 3QORC 4FI7A 5CILH 1XV8A 4AGMA 2C3VA 5KJ7E 3QIUD 2ZUSA 3HCVA 3OPUA 4XPHH 4XX5A 1VGEH 4IU3A 1X7QA 2W0FB 4PMEA 3QNZB 5ECGA 1W0YT 2X09A 4PJDF 3K5RA 4WHYH 1T0MA 4XN7A 6TAAA 4N8VB 2XN1A 4ZMTA 3N50A 4JB9H 4X6DF 4NWTH 4EN2A 2XTJC 1NCCH 4MD5B 2YAMA 4UILL 2ICES 2GI0A 4NKMB 4AYSA 3ILQD 5BZWA 3STLA 2WQAA 4KMTL 2MNWA 1T2XA 3RYMA 3RWHB 3RIKA 3D0LB 4IKLA 3OXSB 1KTBA 4LLWB 2P8MA 1YDPA 3EOTH 1I8KB 4W6WB 1KGCD 1A02N 3ML8A 4MS8C 2NT0A 1A6AA 4N0RA 4XPAH 4EEEA 1U8JB 3B4NA 1H3TA 3O6FD 4PJ5B 2DMHA 1CGSH 1EO7A 3FHAA 3FU3A 4S11A 5DHVH 3W0WD 1T83C 2IQAB 4FQIL 4OZIB 3SOTA 3MGOB 2MPAH 1GGCL 2QT6A 2AV1A 2PABA 4PJ8D 4Y7OC 3KWXA 4NQCE 1IGMH 4I87A 5CWSA 3KH4A 4MXWH 3UAAA 4WO4D 3KWWB 1QQDA 3FUEA 3LKNA 5MI0B 3ARBA 2X2IA 4IGBA 5DR5H 5EZIL 1QTSA 2FIRT 4FQQA 3CHQA 4KKRA 1G7IA 2ZUVA 4CN1A 3H3PL 2ITCB 3QDMD 4U6YA 5DD1H 1E4JA 3MLYL 3ECWA 3Q01A 2B5IB 4JPQA 3WNNA 3LKRA 2M83A 2UWEF 3DTUB 3ESPA 4KUCD 4XMLL 1HKLL 4MWFB 3AXLA 4MZRA 4QRFA 4Z7OF 3PAVA 1I8LC 4HIEB 4JY5H 1BM3H 4MA8L 4POZD 3D69A 3BKMH 4UF7C 3OZ9L 1A1OB 1AY1H 4OJCA 3JV6A 3N85H 2EUWA 2CALA 4QNPF 4U6VH 4IM8A 1QLRB 1OCRB 3HNVH 5AAMA 4JDVB 4XT1C 3QZWG 1OGSA 3GI9H 1XEUA 1MJ7H 5B7EA 4YSQA 1QSED 4P04A 3W9DB 4R4FH 4JPWL 1JV5A 1R3LA 3MA7B 3MV9A 5DTFA 1A7NL 2CR0A 1PEWA 1WHPA 1R3HA 4L4VA 4KVCH 3S0PA 2NY6D 4LO9A 1KFAL 2K9UA 3QUYC 5IB5A 2LE9A 4JAMA 4Y4HA 3FAXA 3VSVA 4P9ML 2R1WB 3FCSA 3HRZB 3O0LA 4P8QA 3D51A 4EKJA 1AKPA 2YFNA 3LEXB 4A38A 2W07A 3BT2L 2VXQA 2AEIT 1ETJA 4NAJA 4P23C 1KB5A 1T2QL 4ODUA 3WFCH 4E41E 1MCFA 1DQTA 4I18A 4P3DA 2ATAA 1G6RH 2DB8A 1BIIA 2H3XC 1LK2A 2KZBA 5ABDE 1G6VK 3D87B 3ROOA 2VMEA 1WIOA 3PWUA 5DGRA 1YRKA 4JRYE 4NKQB 5GZND 1QNZL 4JANA 1JK9A 5F7KC 5PCYA 5F88B 1AQKH 2IFGA 3WTUA 5JTWA 1PIGA 4H40A 4PJ9B 5AOMA 4TN9A 1CG9A 1E3FA 1QR4A 2JKXA 3KPTA 3L3JA 1FHGA 4X6CA 2BVQB 2CO3A 3DX7B 4UV4L 4X6DE 1MI5A 3E6FB 3I6LE 5M7QA 2XIIA 3NA9H 4WK0B 3VJ6A 3Q5YA 1AGFB 3KPLB 2F9BT 3OKMA 1TTCA 4HS8H 3NA4A 3P40A 4QTIL 2HVKA 3ZKXC 5J57B 4R2GC 3RWEA 1M6UA 1NFAA 3COOA 1YNLL 3E7JA 1CPUA 1H8SA 2YMXH 3PUCA 1G6RB 3NP3A 3BLBA 3U7AA 4ZX6A 5K9QI 3NGBB 3C5XA 1QAWA 4NWTL 5I0DA 1NCCL 3MBEC 3UBXA 4MQTB 3LRSB 2P42B 4I48A 3O81A 1AGCA 1MCBA 2J2ZB 4RAVA 5HGBA 1R5IA 1WZ1L 4PJEE 4ZOAA 4GAGH 5IVZB 5JXEC 3ZRCC 1E2VA 4AKOA 2QADB 3GBMH 3WLWC 1FZOA 1NMBH 2H1PH 5FHBH 5B39A 1P1ZB 5SV4A 1Q1JH 2F08A 3EOTL 5AVWB 2CDGA 4AQ1A 3MLSH 3TBYB 4JGJA 3ULUL 4EUPH 4J8QA 1FCCA 3CSTA 2EUXA 2ENSA 2FE0A 5IB1B 5IP4A 4K2UL 3U6XS 4XPAL 2WW8A 4L4JA 5GGVH 2EDJA 4IOIA 5DS1A 1XX9C 1I1FA 3DSNB 3ZR6A 1DQVA 3TTYA 4MCYA 1GGIH 4ORGB 2BDNH 4ZD3H 5DMIL 1QYGH 5I1KL 3BZEA 3SDXA 4K5NA 1AHMA 1I8MA 2A9DA 3Q2LA 1X4XA 5AZUA 3WE6A 2YD1A 4RGNB 2HLFD 3KVQA 4V1DB 5F0MB 1KGWA 4W9GC 3ARTA 1VESA 1OTTC 2YD9A 3R7QA 1SVZA 4UTAA 2SODB 1MCRA 2XQ0A 2IQ9H 3A4FA 3BP7A 2NUPB 4ZTEA 4EI5C 4ZI8A 2ADIA 2HLFC 4QXTB 4U6VL 1MHCA 3EJZC 1Y18B 4UUJA 1YYML 4FQXD 5KJRH 2HMIC 3IDJA 5EU5B 4ES9A 2DLFL 2VDNB 1I1AC 4MAZA 5EPMB 2OYKA 5ACZB 1OY3B 2XPYA 3W11C 3D18A 4URTB 4WNSA 2DM4A 4HH9A 1GOGA 1XT5A 2JQZA 4KVCL 4HYTB 3L4TA 1HL4A 1KJ2L 4KHXL 4S0TD 3ZKXB 4M43L 4NQDD 5K9JH 3VFSB 3SN6N 2V5MA 2Q86B 5KZCB 4WAFA 3EXLA 3MA9H 3VXMD 3HA0A 1HI6A 1JGVL 3MNVA 1JHLH 3K6DA 4WWKC 5EBLA 1MVYA 1RMFL 1AXTL 2AVFA 3K46A 3NTCH 2ICCA 4XOAA 1JVKA 1W0WA 1WLHA 1HXYB 2C9RA 3UAJA 1HCVA 2W07B 4Z7WB 4NXKA 1G7MB 3MKGA 2B08A 2A6JB 4K5PA 3JWDL 4XBMA 3TS8A 4TSAL 2NPLX 4LRNH 3HFMH 3PRZA 4QR7A 3WFHB 2CPCA 4B9ZA 3FB6B 4LOVA 3TU6A 2AQQA 3QJXA 4ZPTA 1HZHL 1UD5A 4DGWC 1M9SA 3VFPA 3HNTH 3GINA 1IBHA 3GLAA 1HIML 3T6VA 2D4FA 5TQ2H 5I15H 3EDFA 1SXBA 4OGAD 4RBPK 1WTLA 1TITA 5C0DB 3QUZD 4Q6IA 5ESQA 3NA9L 4YUEH 2LW3A 4K3HA 3RGVD 1OIOA 2QQNL 3GF8A 3OV6A 4HP5A 4HIIB 5E8DL 2IANE 1HDMB 1FNSL 2JMRA 2LHAA 1FG2B 3KLHC 2JJWA 3HRZA 3IS1X 1Y6KR 4IRJB 5IFAH 2HRGA 2OZNA 1CFNB 2VN4A 3IDXL 3OXSA 4ZFQA 4WUKH 4XCFL 4M6NH 3MR9A 3HJ0A 2P24A 2PYED 3PWVA 4R4BB 5LWYL 4GXVH 4FFVC 1FNGB 2IOIA 3NBNA 4UYPA 1A7PH 1QBML 3ZDYE 4G7VH 3QNZA 3NCMA 1FI8C 3LS4L 4JM0A 3GMLB 3QS2A 4PJXB 4PW9A 2BS71 3A4DA 4DPRA 3CZSA 2V3EA 1RJLB 5C0CE 1KGIA 5CSGA 2DKUA 3D09A 1E30A 5HI5D 3HBPA 1Q1JL 1CLYH 2APXA 1BAFL 1JWUB 1TDQA 1CFTB 3E8VA 5E2TH 3P4MA 2ED7A 2ZP8A 3O6LH 2YLKA 2E75C 3EBGA 2IWKA 1MFUA 1ZT7B 3T0ED 1ZGLP 4IJTA 4N6RB 1YG9A 4KXBA 4W9JC 5GGVL 1HEZB 5D4HA 2Z8WC 3EF4A 3QEHB 2R56H 5JHLH 4G2AA 3DVNB 1N9PA 4L1DA 1FORL 4N2NA 3BZ4B 3D9AH 5J56B 3MRQA 3US9A 2OA9A 5FGSA 3SBRA 2HTLD 1P2CB 3L9BA 4C54A 4LDOB 5G4MA 3HHSA 2HRHA 2HA1A 1B0GB 4KZDL 5JLZB 1R3IL 2NMSA 5IROA 5I9QC 4JVUA 1SRDA 1TLMA 1M56B 3ISWA 5GZNA 4GI8A 3CUPA 3TXAA 5FB8B 2L7UA 1T4WA 3SD2A 4KZDH 3J8F7 3NIGE 4ZBJA 2X44D 3WNLA 1JGUL 3FTWA 1YYMH 3F05A 2WUBH 4BQCA 3ESVF 2H32B 3SPVB 2WAQA 2WN2A 4FXGA 3RY5A 2YXMA 3LIZL 1BVZA 1T1XA 1BGXH 2ZCHH 2Y5QA 1EXUB 3MN8A 5K1VA 3NIDF 3PNWA 5E2WL 4LASH 5F71A 2ZWKA 1EZVX 5AOJA 4K7PL 3N1PC 2Y5TA 2V2XA 3VXPB 1CXKA 2IG2L 1A8JH 3ILQC 3WJMA 1GMEA 4M5ZL 2OYPA 3WNPA 4RFEA 4OFQA 4TVPD 1WCQA 1KPRA 1CLOL 1J8HE 4R7DA 2WXFA 4QAMB 3BP6A 5IVXB 3O3UN 4EIGB 3VI3E 5KYXB 2BNQD 3L1FA 5FO7B 2YRZA 1HXKA 1ZLSH 2C1PA 5FYKH 4Q6IC 2CZNA 3UP1A 4BQ6A 3BP4A 1UZ8B 5J9PA 1M53A 4TL4A 3U0TA 3GEWB 3NQKA 5KWYC 1AMXA 5C0FA 5L8JB 4IRZA 2ORBL 4NC0B 1IC0A 1MRDL 5DJ2A 3UBXI 3KZ8A 5DEFA 5JYMA 3WBDA 3NIFE 1E0OB 2R2HA 2PWEA 2JCWA 5EZOH 1VEPA 3SKMB 4KTEH 4LARL 3U25A 5H4ZA 1O9WA 3MNZB 2ZWSA 2AEPH 2ZSVA 4DVRL 4ONOA 3QO1A 5EULV 2P9RA 4PP1C 3S3BB 1HH6B 1UB5A 1KJMB 2IH9A 3BH9B 2LT9A 2VQ1B 4MXVE 4KVNL 4GRWF 1S9WB 3O2DA 4MJ5B 4MNQB 1D5BA 5C86A 5KSBA 3VMNA 3C9NB 2WZPD 4W9LC 1GGCH 5LGJA 3QQ4B 3UPCA 2OTPA 1Y1UA 1URZA 2AJSL 3BP6B 3ZX1A 2NY4D 3HR5B 5A3IC 1X7TA 4ZDHB 4GQ9L 2GJZA 2VH5H 1Y07A 4Y4KA 4ZFOB 2VDLH 1R5WA 3CFKA 3O0RH 5J1SC 3PHAA 1AS7A 1T66D 4Y5YC 4M93C 2IPUG 1A4KB 3AWEA 5D2NA 1TZIA 3L3OC 1ZHLB 2YQGA 4MJHA 2CDFA 1U0QA 3ESOA 3F7VA 5JIPA 4X0KA 4XAWL 1F3DJ 5MENA 1GC1L 1XR8A 2PPAA 3QG6A 3EYFB 4LCCC 5ICYB 1QFWH 1A9EA 3L16A 4M9OA 4XPTH 3GBNH 4L8DA 1BBJA 1L0YA 5INDB 3VWJA 2VDNL 2WBJB 3CJJA 4QHKJ 2ADYA 3BWUF 2FB4L 4JPKL 4PJHB 5HGHA 2WXHA 4E0RB 2WVUA 5AALA 4K7PX 2HJKB 1MAMH 4ZFOL 1KENL 1GGTA 2ALAA 5CGMA 4NFBA 5D1XD 4HUWB 1R9FA 2P5WA 4JDEA 4X4ZA 4ZMVA 5EOTB 5E1QA 1R3HB 4L4VB 5JPNA 2B2XL 1YC7A 3QUXD 1O6TA 2O5YH 4B9CA 4DWHA 1VCBC 4KKLC 3EF7A 1RZ7H 2P28B 2FJGA 4BV1A 4WI8A 1YA5A 5I0YA 3MODH 1YUKB 2Q7YA 4AYEC 3F6LA 4ZJ9A 4KI1A 4LCWE 3STBA 4BM7A 4E68A 4JFFD 3P73B 2FUQA 3HZYA 1K9TA 1HCYA 1F3RB 1QEWB 1FDLH 2CK0L 3MV7A 4PP1D 1ZGLM 2F61A 2WC7A 2Z93A 1AHWA 2QMJA 1DN0A 5LBGA 5KUMA 4OD2B 2B3RA 2H2PD 2NW2A 1HK6A 4FS0A 4XN2A 1YEFL 2ZKHH 4FQ2H 1JFQH 4J8RA 1KSRA 1GRWA 3MBED 5EN2A 3ZE1B 1BGXL 2CDEB 3B9VA 2BSRA 2Y2TA 3VA6A 3GSRB 2VKWA 1GAFH 1T20B 5L8LB 1BYNA 3O45A 5I73B 1HEJC 3V6BR 2X89A 4BUGA 3EJYC 1F58L 1RK1A 1KGUA 4OZHB 4MJID 2R51A 1KV3A 3KBFA 4XXWA 3HG2A 1CLVA 4YHIB 1TCRB 2BVOB 3N0PB 1U8KA 2EXYD 4ICWA 2HLEB 1S4IA 3AUWB 4OZHE 1B0GA 4XNAA 3L3DB 4AGOA 4HMCA 4OJEH 3T77B 4WK4B 4BGLA 5J3HC 5B3NA 1KT2A 1MQKH 5HHME 4DAGL 2WVVA 2X6VA 4AYBA 2Z0UA 4PD4K 5HYQB 3FONA 5FM4A 1DUYB 2VDKH 2XPGB 4HEME 2H32A 2I25N 4JNXA 3KCWA 4ZW5A 1Z0MA 3TNNB 5AB9A 4PWIA 4JUTA 1EEUA 2JF1A 3LHPL 4GIAA 4Z5RA 1HQ4A 5D7IF 2RAMA 3WL9B 1ZWIB 3B8YA 3FT2A 1S9XA 3IBEA 3TBTA 3M7OA 5IFHH 1IM9D 1ID2A 4Z3EA 4A6YA 3POHA 4LOFA 3QDAA 2IAND 2I60L 4Y16A 4S1DC 2WXGA 3P2BA 3CXFA 1XMWA 4FFZH 5I1KH 1GZQA 3NEEA 4OAWB 2QEJA 4HCRH 3WDHA 2EUZA 3LZOA 1IZJA 3CZGA 5I1IH 1XR9B 1HFUA 2ZJSH 3CN2A 4MGXA 3RUGE 4BH7A 1LP9A 4LOUD 3VGBA 2C3WA 4HF5H 4PGJA 5E4EC 1A5FH 2UXGA 3KPRE 5IHWA 5AFAA 2WLLB 3LRLA 5EU6D 2VR6A 2EC8A 3V0FA 5KJRL 2I9TB 1E5UI 1F3DH 1SDDB 2ITDA 4XMTA 2ZSVB 3GXDA 3HOGA 2ZOWA 3QEQD 4TUKL 1E42A 1KIQA 4FNSA 5DD0H 3K0WA 1P1VA 3MRBA 2ADJA 4XVUD 3BSZH 3RNQB 2WLMA 4YSCA 2OV0A 3QXAA 5T1KA 2AZUA 1N59A 1VADA 4HHAB 4NP9A 1NFDE 4I7ZC 1B4LA 3O4OC 4DW2L 2IAMC 4KHXH 2YO3A 1F11B 4MDIA 4Y1SA 3VWKA 4X4YA 3EUDA 3T3PB 4ZX4A 3BJLA 1DHKA 1PLAA 4DK5A 2KERA 4G7SB 5IHZA 1K8DB 1U92A 1MLCB 1FIGL 1EEQA 1S7SA 4JKMA 4ODBD 4XVJH 1NEZB 1OLZA 1T7XA 1AQDB 3PYCA 4JQIH 4OGAC 5EB9A 3V4UH 1A1NA 2R69L 3X14A 1JZ2A 3FB5B 1XH2A 5SWZE 3MNVB 5EBLB 1F41A 1XTMA 4OM1L 2VGLM 1JPTH 1ZA3B 1SXAA 3BFQG 3OBAA 5L4JA 3DETC 3KDMB 3VFWA 1VCAA 3IJHA 5I16B 4ELKB 2F8VA 3ALPA 4NQEE 5J12C 2WVTA 1EV2E 3ARGC 4O58L 3HW7A 1YEWA 2NY5L 4OV5A 5CCJA 3BVNA 2CJUL 3SYQA 4EN3A 1ITCA 4YR6B 5GHWL 3BPCA 4ZO6A 2K45A 3MZGB 2RGSA 2R4RH 3ZN6A 5ANMB 1EHXA 5G5DA 1MJUH 1JE6A 1PDKB 4C56D 4W9ZA 1LO3H 4N8PA 5D6DA 5DZVA 1I75A 5DYOB 3Q05A 4GW5A 3ME0A 5F9DC 2DWDA 3PABA 5C0DA 4PJ6A 5CMAA 2ED6A 3P9LA 2QGCA 4ODVH 5EC2A 4I2XB 1PGRB 2OMVB 1A7OH 5HDQL 3ES6B 4I0PB 3QO1B 2HSIA 1OQOA 3JVGC 1CVRA 4RIRA 3QXDA 1BF5A 1A9BB 3K72B 5KUKA 3VYPA 1DQMH 3CHRA 4Z9KB 4NO2A 1CJYA 2GJRA 3T09A 4YDIL 1R24B 5IWLA 2L7QA 5J1TC 1BREA 1SY6H 4DP5X 4TULL 4MNQE 2ZONA 3MZTA 1YAZA 2ADFL 4HUXA 3D50A 5GXBB 4JFQB 3FFDB 4OFYA 1ASPA 5IEHB 2OZ4H 1RZKL 2DYRB 2EC9T 1E50A 3EAKA 2JXMB 4CC4C 2OMUB 4XI5C 3DIFA 1INDL 4V2BA 4Z7IA 3GMMA 2MHAA 3SE8H 2VXTH 4NZUH 4WDIA 2CJ3A 1Z9NA 2V9QA 3CZUB 5D1XB 5E5LA 4MMZA 2VABB 2I60H 2Y1VA 4GSRA 4LKXB 5SWQB 2FH6A 3KPMA 1U8CA 1SJHA 5FKPB 1E90A 1F13A 5IHUH 4XNZC 2WZPA 4WFEE 3VG9C 4K07A 3VQMA 4BFNA 3RFZA 3GMNB 3EBIA 5DXWA 3ARGA 5I1IL 3ROOB 4OF3A 1WEJH 1AC0A 4QXWA 4ZW3A 1N5AB 5CEXA 3LTVA 1OP9A 4L29A 1IAII 4IQHA 5AAPA 2A74C 5IJDC 2FRGP 3FTZA 3MRFB 5SX4I 3UZEC 2C8NA 5D6DC 5GRJH 5MERB 4YDLC 2BVQA 4YGVB 3HMXA 4B5EA 5DYOA 2LVEA 3LYRA 4JO8A 5I17A 3KPSD 1WUZA 5HPOA 1TO4A 4DETA 3LIUA 4YFDB 2EIBA 1KXTB 1AR1D 3FRPA 5DD0L 4N2BA 1BJ1H 2ZCHL 2VR3A 4NBXB 3VXMA 1Z1WA 4HAFA 1AS8A 1TTGA 3QR2A 3HG4A 2YD8A 1L6ZA 4MB5A 5JHBA 3FFCA 2XBDA 1T21B 4HU8A 1BOGA 4LVNB 3S9DB 2FWOB 1GHFL 1PYWB 3P4OA 4N85A 4NQED 4H8UA 4FOMA 5CZKA 1V7ML 5BJTA 1XZWA 4IIQA 2EEAA 3IFOA 1RUML 4Y4FB 1RKRA 1MWAB 3NJVA 4CC4A 4LPUA 2Y6SC 3DVIA 4IKJA 3FULA 1AKJB 4TVPE 2NW3A 2CIIB 2ORBH 4AJVA 4L4TD 3PWPD 4IRSC 1YNTA 4RMTA 1JPTL 4JZJB 4L3CA 2G75B 3HLAB 3FQNB 4GAJH 4YHNB 4LXFA 1E40A 4U1NB 1NGPL 4FQPA 4W9EC 1WJ3A 2BVUA 3N42F 3MTXA 2I24N 4Y5VC 2CKBA 5E9DE 5FR3A 2YSSB 1YQVL 4HUVA 1M42A 4Q58C 3LRGA 2LU5A 2YJLA 5CWSB 2CJUH 4HWUA 1DSWA 1KB9K 5GHWH 1DVFD 5G4OA 2AK1H 4LSQL 4F7TA 3BUPA 4M7LL 2D7OA 1ED3A 4WHYG 5HYJD 4DEWA 3RQ3A 4NO0D 4M4PA 2L7EA 1OGAE 4IBLT 4KJYA 5DK3A 3WUZA 2YPLE 2QVMA 3BPCB 5D1ZI 2X6BA 5FO8A 4Q0XL 3DSFL 4GB9A 3KBHE 4XTRD 4EI6B 3GZPA 1HN1A 4ODVL 4DH2A 4PJ9C 4WFHE 1P7QD 3K2IA 2X40A 2FNBA 4N2OA 3TURA 1I1AA 4X6CF 4MB3A 5FYLD 2HT2D 4AQEA 1A1MA 3FSZA 5C0RH 2EDXA 1F42A 1SGKA 4X80L 3A47A 4WF7A 3ZZLA 4L5FE 5I5IA 3PWLA 5AB1A 1BJ1J 3AT9A 1SY6L 3VVWA 4TULH 5EUOA 5ACLA 3ARDC 3BAEL 1F1DA 3CFJA 4XGZB 4HPYL 4YSUA 3PWNA 5BQDA 4Q4EA 4GAFB 1SUHA 4XB8A 1OAKH 2QSCL 2WSKA 4RESB 1NDMA 3HMXH 2C3VB 2MTPA 4XCEA 1BPVA 4HAGA 1A4BA 1JF1A 1OB1B 4H26A 4HSQA 3L9RB 5CN2A 4Z5RB 1AE6H 3QUYB 1J0HA 4JPKH 1UQSB 4IHBA 4U3SB 1XSIA 4BWTA 4QRTB 4ANUA 4HXAL 2FJFA 3SPJA 3VD0A 2XBZA 4ZODA 1K4CA 1SBBA 2CGRL 4BZ2L 3CCHA 3V4PH 1IBFA 3WJLC 3ZOAA 2NNAA 2I9TA 3OAYK 3TN0A 1HHHB 1ES0B 4YZFE 4KGJA 2NYYD 3NFSL 4OCRL 2VR4A 5D96C 2QVFB 5E8NA 1C5BL 4ZTOL 5D1ZB 4DFIA 1IAIL 1KLUB 2VSKB 1OSPH 5FYLE 2PTTA 3ULUE 2ZKXA 3VA2C 1FDLL 4TSCL 1R3JB 3B2VL 3OJDA 4C4UA 3PIQA 3MJ6A 1OAXL 1UUSA 3A67H 3DHPA 3O41A 1NSNH 5HI4C 1YY8A 1Z9SA 1ZMYA 1NUNB 2MFNA 2ROYA 3F01A 3MOQA 1VERA 5BS0A 3OVUB 2CAKA 4ZO7A 4RSYA 2F8XC 1OKEA 3F04A 3H4FA 3KLHD 1DVFB 4G6JH 5TTRA 5GS1C 2BCKB 1LE5B 1AI1H 4AM0B 4LKXA 5DO8A 1BCIA 1A6ZA 5D93B 5DZAA 5BV7C 4IBTA 4HOWA 4PJFA 2VC2B 3W3BA 2IPKA 1ZV2A 4IIZA 5C08B 3F7PC 1BJ8A 1MW1A 5FYJD 3J2PA 2VYRE 4WUUA 4Z0XA 1Q94B 3T8XA 4S1DD 4LDCA 3QXWA 5CCHE 3ML9A 5FYLL 4XWGH 4R4NC 1W8EA 2AJXH 4Y9BA 3T2NL 3TIEB 1C08B 5I18L 2Q9OA 5DZPA 5E2VL 2Z34A 2X2HA 2APWA 3N04A 3V0VB 2YKKA 4NZTL 1INEH 2K1MA 1E28A 1C12B 1UOVA 4MXQC 1WGOA 2EDHA 3JV6B 2R7EB 4UZUA 1XBDA 4PIBA 3CBRA 2RALA 4E9RA 5I19L 4HQQL 2GITB 4CSSA 4X7DC 4Z7VF 2QPUA 2DQEH 3DHUA 3TN0D 3UTTE 3ARWA 3BIKA 3KWVA 1FYTA 1KTLB 3LDBC 4Q97A 3IJYA 3TM6A 5I74B 3UDWC 1XH1A 1HCZA 4UM8A 1IJNA 1LYQA 3VQLA 2AJYL 5LGYA 3AB0C 2EEBA 4P46C 4LEXH 3FQ2A 3C6LB 4MS6A 1Q4NX 5E8OB 1P53A 3UTOA 3WTVA 3F7QA 4FQ1L 3BDYH 5BZZA 4E5XG 4AYMC 4I2XE 3B7YA 1ACXA 4X83A 5ENWA 2EIDA 4P2RA 5GZOD 1N2RB 2VJ8A 2IPTL 2YGPA 1OAKL 2QSCH 3K91A 3QIBB 4G9DA 4P3DB 3KYNB 3VO0A 1E28B 4ZAKC 1J1PL 1UD3A 3UADA 1G7QB 4D0BB 3N1FC 2BIQA 3WO4B 4OFYD 1L3WA 4Y1AB 5DHDA 5C6TH 3BSZL 4HUKB 3IF1B 4KNQA 3ETTA 3ULUD 1W72L 4NKMA 3PU7A 4U0RC 4HXAH 43CAB 4EVNB 1NUGA 3D1MC 2R4SH 5DRZA 5C0BB 3DXAD 3OKOB 2H3KA 3BIKB 5IBTL 2G4EA 2ZOKA 4JR9L 4A2FA 4C4KT 3SYOA 5B22A 4EZJA 1X9QA 4NQXB 3GUTB 3RTLA 1G94A 2DH2A 3V2AR 1ULVA 2A9CA 4XXCC 1AR1C 1N6QH 2BSTB 5EU6E 1MDTA 2F5AL 3C6LA 4UDTA 2C5DC 4Y4FC 4E9QA 1PG7H 3KPPB 5KYUA 3BAJA 5JNYA 1PSKH 4ELDA 3P11H 4XPBH 5F1IA 2AQNA 1KNOA 1MPAL 2W8CA 4XWOD 5CU5A 4KX8A 3D39B 4IOFD 2FNWA 4LSSH 1JG9A 4U1IB 4BELD 1KTLA 1U21A 2Y6TE 3FU6A 4OZ4B 1ASOA 1WAEA 5CSBA 5IT2H 1FUNA 3LPPA 3UTSB 4PJEA 2VDPL 4L3EE 4ESKA 2R4RL 4N1HB 1TUPA 3RWCB 4M61B 1OT1A 2OR8A 4PRIB 5FF6B 4S1RL 3HVNA 1WIUA 3G5YB 3UTSD 4KK5D 1KG0B 4A1RA 3RNKB 2YAFA 3PGCA 1ZHBB 1P7QB 5IG7B 5HHOA 3LN4A 4P23D 4KGLA 2QQKL 4KQ0A 2A74B 4NWUH 1ES0A 3LN5B 1J10A 4QKXB 1BZOA 2OYLA 2O93L 1A7OL 5HDQH 4LLYA 4TUJB 1ZLVH 5HYJA 4F1ZA 3HI1B 3SGDI 3MRQB 1KLFB 3VWKD 4Y19D 4JFHD 1R34A 4QHKI 2MTAA 4QNPE 3US1A 3V5DB 4FHBD 1NGWA 1NIFA 3TWCH 3JZYA 2QVTA 3Q2VA 1LD9A 1N3NA 2AXGA 4HWEL 3O41B 3SOBL 4Z7QB 3SCMA 4AVKA 4AQ8C 4AQ8A 4PH8A 5EC1A 2GUOA 3NYKA 3TL5A 1BZ7A 2GTZA 4M7KH 3WKYA 5BV7L 4L4TA 4LL4A 4NQVA 4GMSH 3WTTA 3G5ZB 3NABL 4UV7H 3S7GA 1WIPA 2Z4QB 3NPSB 2BIPA 2W9LA 2F0CA 4E2OA 4NZRH 3HCVB 4LDLB 3BI9X 2GB2A 2JSFA 3C09C 3MUHL 4GW1A 3MNDA 1YNKH 4DN4H 3LV3B 5FEBA 1G7HB 1WO2A 5GRWA 4KJPC 1CDJA 5E6ZA 3OMIB 5JW3H 5JUEH 2UZIL 5FCUH 5I75B 5EO1B 5T1MA 5CSZA 5E6YA 4AUYA 4P57A 3OC8A 1MELA 4GP8B 2V2WB 5D4IA 2MQ3A 4I3SL 2X2JA 1XF5B 4I0PC 1W72A 5CEYA 4K55A 3T8MA 3QUXB 3VE0B 1U8OB 4JG5A 1ACCA 3GJFB 4WHTA 4JW3A 1NUFA 1R3KA 2QVKA 2HG5B 2IPTH 4JREB 3MRGB 3B2MA 5C3LD 1C1EH 1MFCH 1E4KC 3QNXB 5DK2B 4F37F 1LXMA 1AGEB 4PRAA 3B2PA 2AXFA 5AZ2L 1KCWA 2J72A 2KPNA 3CMOH 4XP9H 3WIHL 4AVIA 4HLJA 3GWJA 3EDKA 4JG1L 2E74C 1JAEA 3BC9A 4O51B 3UL4A 5KSAD 3O3AB 5EOCH 1BQHB 4R4BA 1QVOA 1KZYA 4RMQA 2OTUB 1QHOA 4H5SB 4QPEA 3WEAA 1OL0A 4NCC2 2XN9E 2QTEA 4Y4HC 1DDHA 2XTJD 2O5XH 4YSEA 5DHMC 4HLEA 2AQTA 2FEEL 4AL8H 2GHWB 2FSDA 3CZLA 5JW5B 2EXTA 3MRLA 4PBWD 3CSFA 1UM6H 3TBVB 5IM7B 4S1SH 1JL8A 3LKQA 3AU1B 4NC1E 4ZRGA 1OAUH 3CV5A 1TCRA 3ARRA 2X4OA 2BP3A 4KTDH 2WSDA 3TBWA 5KZCD 2CLVB 1RUQL 5CP7B 4PY8J 2J1WA 3OPZH 3CSBA 3HIZA 3KYMB 2XUWA 1DJXA 3L17A 3O6FA 3P11L 4XPBL 4GAJL 4EN3D 4UT6A 2IBBA 3CSGA 2P80D 2IV9A 2TSAA 3UMNA 1KBGL 5CUSL 3H2PA 3C2AL 3AADB 1YQVH 5EBMB 1I7TB 3C8HA 1CLZL 3IMVA 2PPFA 5C0CA 5FFOA 2X38A 3IFPA 1CICA 3BN3B 2DQ6A 3M45A 1AKJA 3KPNB 3UYRH 2PCPB 3M6DA 4MCZA 1UCBL 3IFOB 4LIQL 5F2FA 3QULA 2H7WA 4FTDA 4PJIF 4NZJA 2DJUA 4Q0XH 1UD4A 5IBLC 1DL7L 4P3CL 3DWTA 4X6EB 3LX9A 3N42B 1VENA 3Q2NA 1UH2A 1OARL 3SBWA 5ID1A 1P84J 3MV11 4P5MA 5E99H 1C12A 5BW7C 4X9GA 3QIUA 4ANVA 1CUOA 3B56A 4W9FC 2YGVA 4ZW8A 2ZYSA 3MLVH 5EOTA 4JY6A 4L8CA 1Z3GL 4GQPH 2YEVB 1X5HA 1PKOA 1QSEB 4FL4B 4OBRA 2FGZA 2ZX6A 4ZFFA 1L7IL 4PJHA 3NN8B 2I69A 5A7EA 4K5LA 2XV6B 4M7JH 4AEFA 2DWTA 3UTTB 1SMOA 5I1GL 3BVXA 3V5KB 2NY0D 4K7FB 4M7KL 5BV7H 5FW8A 2YZ1A 3BAIA 3N06B 4M1DH 1OTUC 3H3KA 3FFDA 3OKDA 4M03A 3TIDB 2OMYB 3PXHA