4Z1PA

Bspa_c_mut
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
334
Chain Sequence
VLFQGPPTKKVLDENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSSLLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQIKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNDTVKLGDEVTYKLEGWVVPANRGYDLFEYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRSSAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall surface anchor protein
publication title BspA_C_mut
rcsb
source organism Streptococcus agalactiae
molecule tags Cell adhesion
total genus 98
structure length 334
sequence length 334
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00746 Gram_pos_anchor LPXTG cell wall anchor motif
A PF16364 Antigen_C Cell surface antigen C-terminus
A PF17998 AgI_II_C2 Cell surface antigen I/II C2 terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z1pA01
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4z1pA02
1AMXA 2X9ZA 4IGBC 2WZAA 3PF2A 3RPKA 3UXFA 3HR6A 4Z1PA 2WQSA 2Y1VA 4IGBD 4HSQA 3V10A 5DZ9A 3HTLX 3KPTA 2OKMA 2X9YA 3QE5A 3QDHA 2XTLA 4IGBB 2F68X 2Z1PA 4Z23A 2X9XA 3OPUA 4UZGA 5DZAA 4P0DA 2F6AA 3RKPA 2WOYA 3PG2A 4IGBA 2X9WA 4OFQA
chains in the Genus database with same CATH superfamily
4FC3E 2HFGL 1M42A 2JB6B 3D25B 4LPVA 4HDIB 4WGKA 1FC1A 2WB7A 4J3OH 1UJTA 2KPWA 4E9RA 4NO0A 2FEDC 3I3DA 4H4NA 1S7UA 2HX7A 2JH2A 2YD3A 3FCTB 1N7MH 4G6FD 1D5MA 4NQQA 4XVOA 5D1ZB 3TJEH 5I1AB 2F53E 3MRMA 3ULUD 3FO0H 4KVNL 1XV8A 3LYRA 2ZIDA 3VX1A 1NIEA 4R0LB 4WWKB 3PAZA 3TIEA 5BOJA 1NZRA 5DGRA 4P5RA 1W0VB 4E9LA 2J8UF 1LK3H 5IHUL 2EE6A 1QW9A 3MMEB 3WUWA 3KLAA 4NC2B 2QGDA 3VXNB 4W9EC 1KGCD 4IQHA 3Q2WA 3NIFE 1FZMA 3DUUA 3LH2L 4M6OH 4Y4FA 4P4KD 4KRPD 4R90H 1OVZA 3L8QA 4IJTA 4F2EA 1XSOA 2GVYA 5CBAA 2ZUYA 2ZAIA 3IMUA 2X2HA 4FP8L 1K8IA 1QI3A 3L9EA 4U1LA 1KCRH 2K6ZA 1UOWA 4YZFE 1RL1A 2VZUA 5K9OB 1F2QA 3IGKA 4PR5B 5HJDA 4IBYA 4N8VG 5TF1L 4D0DB 4NKDB 4LAJH 3BD4A 3IWVA 4ZX6A 1UM4H 2FO4A 3VRIA 4AK1A 1XF1A 4Z6AT 5KSAA 1DTUA 5F7YC 4GO6B 3OGCA 1BVZA 2F6AA 1YN6A 3S5YA 5CD3B 2EH7H 4DGYH 1LXMA 1P7HL 1KELL 5FHAH 1U8CB 4EI6A 3PFQA 2AAVA 5IQ7H 1T21B 5SX5H 2AXWA 1OM3L 3FB7A 3V0VB 1SJXA 3V4PB 2C8NA 3ZSSA 3B8SA 4AQZA 1JWSA 1ZKAA 3UC2A 3M1BA 1FIGL 4PWKA 5KVEL 1XIWB 4RSVA 3HFML 4RFOH 4GBXA 4JFUA 2AW2A 4FEMA 2EIZA 5F1IA 3HBZA 2XIDA 3EYQC 2XTLA 4P46C 2MPAL 4I0PC 1O6SB 2OMWB 4BK4A 2VZ3A 3NVQA 4HS6A 4FLOA 5A16B 1RUQH 1I9RL 5IVXE 4WNJA 3TJHC 3RWGB 2APSA 2V2WB 2NXZD 3JV6B 4X8JB 3H9SD 3ZL4L 4QTFA 1DCEA 2GY7B 3CFCL 5E4IA 3CU1A 4LIQE 4HLZH 1OIOA 4U1NA 4OF7A 4FYQA 1RULL 2QFPA 1DLFL 4ZX4A 3MZGB 2QPEB 4F93B 3RVWD 4R7DB 1DJXA 3IRPX 4UOQA 2JCCF 1Y6NR 1VERA 4ZNEE 1OCCB 4MAYB 2CM6A 4AZ8A 2AJZB 1PZBA 3K6FA 3LVTA 4Z7OB 1CGTA 2R2HB 4L1TA 4LPTA 5IB3B 4U2ZA 2Y5TB 1D6EA 1IQDB 2LLNA 4HHWA 4OUUB 2HJKA 4KK9D 1T04B 3NCYP 2W94A 5J6HB 4NCC2 1E9OB 2AJYH 2IGLA 3II3A 1RMFL 4V1DE 1PEWA 2ENYA 5DVNA 2XZQL 2VDLL 2CNYA 3L4TA 3ZE2E 1PKQB 2A77H 4N0UE 1T7VA 3O11B 4IOFD 2G5BA 4YSAA 2R69L 1OB1B 4P57B 4YSRA 3R4RA 4Z3GA 3QW9A 5IIEB 3O3AA 3T2NL 3KGSA 2ZOTA 3O45B 2DBLH 1RZIB 1V7NH 2YUXA 5AW1B 2FH8A 3SKMA 1IC4H 1XD0A 5F2FA 3UC0H 2EDJA 5I1CL 3WE6B 1C16B 3FQNA 4JQVC 5JA8B 2QPSA 3IJEA 4OLXL 4QRSA 1WWBX 3IVKB 1ZEAH 1IGFH 1OAKH 1B0RA 1NIAA 1DR9A 1WDAA 4LKCA 4OFQA 1QOKA 5KBMA 4I1RA 4KI1A 3QQ4A 5E94A 5GS1B 1AFVH 2OI9B 5GS3A 4WO4A 5DUBA 1KIQB 1VACA 3AABA 3BPNC 2AVFA 5C0AB 4C59B 2BIIA 5LO7A 1HQRA 4XRCA 4W9CC 1G9EA 2HRHA 3QJFB 3IJ9A 5IB4A 3ZO9A 5F0LB 1QFWL 2Z91A 1FHNA 4M5ZL 3LKPB 5DMKA 4KHXH 3APMA 5DS1A 1DVFC 1MCRA 1M05B 4JY5L 4PRBB 4A7QA 2YPLE 2WNWA 1YJDC 1KJMB 3F6JA 5GSRB 1H3PH 2OL3H 2BIMA 2Z3FA 4ABVA 3EYSH 4YUEH 3VCLB 3OQ3B 5ABAA 1NCWH 3FCUB 3BUDA 2IANA 3TBTA 1AGEB 4G7YL 3CFDB 3QO0B 4X7FC 4D0BB 3TT3H 1T22A 5FO7B 5DHVA 2DLFH 3MTRA 1AH1A 5HDRA 2FIKB 3BHBA 3WEXB 5I1IH 3QZBA 4HKXB 2WUBH 4YHZL 3I3EA 4WI0B 4GQRA 4KJWC 4YS4A 4Q6IB 3JV5A 2RACA 4JHWL 4OKVB 4KKBC 4MJIA 5CJQL 1AANA 5LB1A 4B9IA 2HWZH 4FNRA 1LM8V 3FO9A 4FFYH 4PS3A 5FA4A 5GS0L 2FX9H 3O9WA 2CR3A 3VI4E 1HEZA 2BNRB 1GW6A 1NKOA 2C7UB 2NXYB 3DSNA 2DAVA 3V6OE 1B90A 2DJ4A 2PCPB 4NPYA 3IKCB 3S0PA 2GITB 3X1GA 3FU7A 2BVOA 5I15H 4PJ7E 1OW0C 2Q8BL 4TULL 2GJZA 4JQIA 3ZUCA 2FWSA 1D5BA 4AQ8C 2H6PB 2VDPL 4P5TA 1HH6B 4O02L 5JHMA 3VD3A 1SM3L 3ROOA 2OXHA 4ZMAT 5HI4D 3MROB 5E8OA 3FN0L 5DS8B 1RD6A 2X87A 5M95B 1N64H 2XKNB 3OKOB 4KZDH 4UT7L 4PQXA 1MNNA 5FWRA 2HP4A 5B1CA 1I53A 4HS3A 2Q76B 3EYOA 4G6FB 3VMNA 4MVBC 3V4VL 2F08A 2IALB 1CFBA 1OAYL 3DX9B 4UZSA 4MMZC 2OYPA 2HLAA 2HT2C 3SY6A 1Z6JT 3KGTA 4J4PC 2XN9D 2MTPA 2VZ1A 4FXGA 3TZVD 4AG4L 1JZ7A 4J7RA 4LLWA 3A4EA 3O4LA 4W93A 4X5LA 2OW7A 3MI6A 2GEQA 4ODUB 1A6ZA 1SEBB 4X7TA 3KXFD 3WSQL 5GZNA 2C3GA 2R0KH 5HHOD 1G7LA 4DK6A 2NUPA 3I9GL 4YFEA 1UQSA 3VWKA 1UA3A 2GTZB 4URTB 1Q0XH 1MCQA 2WLMA 4H2AA 6CGTA 5SV4A 5EUOE 1BHGA 3K1DA 3ARED 5C6TL 3RB5A 2PF6A 3B83A 3ECBB 3EADA 1F58H 1L0XA 1GCFA 2EDHA 1YN7B 1HXYB 3AGWA 5E2TH 2VZTA 4PMFA 1MCIA 2PWDA 5KSBB 1X5GA 3EZJB 5F7BA 5CEYA 2HFFB 2CPCA 5FGSA 1RZJC 2V3FA 3WKQA 1LQSR 5KVEE 3GBNL 1PYWA 4KUZL 1RLBA 4UAOB 4CSTA 5D9SB 5EA0L 5GGUA 2PW2A 4UBDD 3B2PA 3FQWA 1P5UC 2VR6A 5SWSD 1HEJC 4G6ML 1KXTB 1HAWA 5LGHL 1E4XH 3DVFA 3IXAA 5ANMB 3REWB 1KTBA 3O3UN 3JTSB 4J2XA 3VWJC 3MOBH 4FDWA 1CD8A 4BK5C 4CBPA 4LVHC 1DQJB 1JK9B 3CPLB 1CDUA 5IK3A 2APWA 3D33A 3Q6FB 3EO0A 1M6OA 4DKAA 2VGLM 2OK0L 1DP0A 4NYLB 1C8PA 2HTLD 5DQDH 1PX3A 2EP6A 3L08A 4WEUD 5C08B 2MHAB 4LAQL 1Z32X 4O2CB 4HZLB 4PG9A 2NXZB 2XQYA 1DVTA 4EZMA 1E4KC 3H9SB 3MA9L 3O6FD 4GKZA 3S34H 3QDHA 3ZBMA 4WWNA 3S4SB 4D9LL 2BSRB 4K73A 1T1YA 2KPNA 1DDHA 3QUMB 4LB8A 2CBOA 4WEEA 4BM7A 4E9WA 3WL9B 1NC2A 1QFUH 1ZLWK 2H1PL 1QSEA 3CZLA 3LHAA 5EZLB 2J12B 4LDOB 3TH3T 1TJHL 1B6DA 1W80A 1P1VA 4YWGH 5F9JA 4FNUA 3EOBA 3U9PH 5F89A 4KXZH 4M56A 5D1QD 5BS0B 5KS9F 3QHTC 4QRQA 1YNLL 3IS0X 3V7MA 1TVDA 3UADA 4N2DA 2Y7LA 4YSUA 1P1ZB 2CIIB 2YXVA 4OGAC 2OTUB 2P24A 3L4XA 3HC4H 3VGDA 5IEKA 3ULSA 3MRPB 4L4TD 5E70A 4HS8H 4NM8L 3OXSA 4H8HA 4KH2A 5GZOA 3MOAL 3TWCH 2CD0A 4OAWA 2KLRA 1OP5K 3E1F1 3FQYA 5L2JB 1EANA 3S2CA 4OLUH 2EIKB 2XV6B 4JPIA 4XN5A 4A7VA 2WZAA 3J07A 5TDPB 3CLEH 4YLBA 2EKSA 1FUNA 4LP8A 4ERSH 1QLFB 3RHWK 5H4ZA 2JCWA 2ICEC 1F4YL 2PPDA 2EEFA 1D6VL 5KOMC 4NQCD 2X0WA 4HU8A 4MB5A 5L88L 2Z1PA 5GGQL 5EF0A 5IMKB 3BVNB 2KLSA 3O6ML 3EH3B 4LSVH 4TL5A 2H9GA 3MYJB 1DQQA 1F8TL 1U93A 4YFLI 3OAUH 3CLWA 3G6DH 1Z66A 4ZUTB 1G9NH 4WHTB 2QFRA 1A5FH 2VQ1B 1NGYA 2YZ8A 4FZ8L 2P7TB 3TBWA 4ZFZA 5H35B 4RGMC 1U92A 2ITEA 2YJLA 2EXYD 2AK4B 5E00A 3KEHA 2EYTA 4IRJC 3EO1B 5DZ9A 5E9NA 2JJTC 1WC7A 2KDYA 5AKSA 3MCG1 2JIXD 5HTSA 4DTGH 3S8WA 4DZ8B 3U4AA 2ODIA 1UD8A 3ALXA 2EDXA 2LU4A 3STLB 3LNIA 1CDGA 1QNZH 2YAOA 1J8HE 2UX6A 1EHAA 1FL6B 2V37A 1YNTB 2ZUXA 5AVTB 1OAZL 1TTFA 3LKSB 5HVHC 4I2XB 3OM3B 3STZA 1BD2A 1AZUA 4JB9L 4L0PB 4IJ3C 4JDZB 4POZD 2VO5A 4U6VH 4PBVC 5B7EA 3LX9A 1Z9SB 1FFOA 3N1FC 3CC5B 3VI3E 1KYUA 3FQXB 5IMLA 3QJVB 4MQTB 3L3OC 2NYYC 3BAJA 4DSYA 3L5JA 1KT2A 4HWUA 2I69A 3IFNH 2P44B 4XNXL 2ADFH 2EDOA 2ZWYA 3ZZQA 3EJZD 3R1GH 1U3HA 5CJOH 3ZKMD 4OQTA 1DBJH 1BXAA 4Z7IA 4F57L 4OIIL 5FFGA 5ID0B 5L4MA 3FQTB 1SN2A 2OMTB 2XOTA 2Y6SC 3CVIH 3QH3B 1FIEA 1QLEH 3TVMA 2KI6A 1MEXL 2AP2A 2ZAGA 1U8QB 3ZPDA 3N3EA 5CZVL 5HPOA 1SYSB 4FULA 1IGCL 3NCBB 4C4BA 4BCZA 4G71B 5DLLA 2Y36L 4L8CA 2W8CA 1QEWA 1XEUA 3LDBB 1KY6A 4HT1L 3D0VA 4Q2ZB 4OVVA 3WMSA 5DT1L 5ALBH 1KB5A 3BWUF 4C83A 4X80H 2BP5M 5I8OL 4L1LA 3EG9A 5CMAA 5AOZA 4LCVA 4RGNE 3SSGA 1XMWA 3OB0H 2BSCA 3VFMB 2WO2B 2O5NA 5C0CE 3ZUNC 2XN9B 1BZEA 4JFEA 4XC1H 5JPNA 3F3HA 4XVSH 4QKTA 5IG7B 5IQMA 1BFOB 1PLCA 4Y2DD 1MLCB 3UPAA 1BVKB 2HN7A 4RIRB 1W72A 1VGEH 4GKNA 3C5SB 2EDBA 4CSSA 3KXFB 2CA4A 4TSAL 4U6HA 3WJJA 4AQAA 5HHOB 5ICZA 3SKOA 1LL1A 4QHUB 2N4IA 3KS0H 4HKZB 3L3DB 4C56D 4AYID 3AREB 3PDGA 4NZTH 3QG6A 1JDDA 3ZR5A 4K5LA 1OSYA 1Q90A 4JDTH 3N0PB 3P3UA 2DQCH 4Y9GA 1CVRA 1T66C 3ZYZA 5KTEH 3NEOA 3IJHA 1T0MA 1XGPA 3MRJA 3QFJA 3ZTCC 12E8H 3D9AL 3ARUA 1NGXB 1DO5A 1KJVA 2RA1A 2ZP8A 3Q5TA 2MCG1 3T0WA 2CG9X 2WZPD 3TN0C 4NOFA 4TUKH 5SWSB 5AB0A 3BZ4A 1M1XB 3PFUA 4IS6A 3GSQB 3ZL2A 5ESQB 1G9MH 4ZG1A 4FN0A 3RDTD 2OM5A 2ZOLB 4NN6C 1OCZB 1WBYB 2JELL 2WM0A 3GSNA 1BM3L 4A6YB 3X13A 1IAKA 1MCWW 4ZD3H 4FNLL 4YGAB 5T3ZD 3FT2A 3GMLB 1CCZA 1ZT1A 3ZL1A 1GAFL 1YEHL 3QZWA 1KJ3L 4KBPA 5CGBA 4YDKH 2P5WA 3FKUS 3AWFA 3HRZA 5IROD 4DP9X 1MVFA 3WHXB 4HOXA 1OLLA 2C3VB 4ANKA 2EVGA 1K6QH 2F74B 1JG9A 3CMOH 3WEAA 2K45A 5C0FA 4IGBA 3HJEA 3O6FB 4H0HB 4O58L 4ZQKB 3TBVB 5IR1B 2VN3A 2ZKHH 4JDVB 5F97E 1I7RB 2HG5A 3IFOB 8FABB 4AXWB 1S2EA 5C71A 3RBSA 3VACA 5HDWA 1HXMA 5J13B 2EE9A 3BZDA 3KBEA 2WIIA 2A6KB 5BO1L 3UTTE 1EAOA 3MUGA 4JNXA 3OHXC 5D1QB 4PSRA 3F12B 1MI5A 4RQQA 5MENE 1UZ6E 4J3BA 4F1SA 5DJDA 4A2HA 3HNTH 2Z31A 3WI9A 2H6OA 2UWEB 3HHSB 4QR7A 2KQMA 5DD0H 3FTXA 4L4TB 3WELA 1ACZA 1GY2A 3TURA 4UUJB 2MCPL 1KFAH 1RFDL 4M61B 1MG3C 5JOFB 4R8WL 1Q0YH 4LMQE 1YPZB 3NCCB 2CPUA 5E0FA 4UZUA 3B7RL 3BO8B 3MJ7A 3D2UD 5E08H 2H5UA 2NSMA 4XN9A 2QL1A 2XN0A 1ZLSL 1JXFA 2J1WA 4I77H 3ULVL 3H7BA 1BX2A 4IJ3B 4QTIL 2X38A 5TK2A 1U2CA 4P2QE 3C2AL 2I7SA 4X7SH 4JZNB 1BMGA 3QDJD 4DJMA 5IQ9B 6TAAA 4HW6A 1TETL 1XAUA 1BV8A 3D3VA 5MEQB 3OKEA 3L3OB 1CIDA 2ZCLL 4NQCB 1QVOB 3PIQB 1SXNA 5EEVA 1MXGA 1MRFL 4QXVA 4W9JC 1F86A 3S36L 2Y72A 4L37B 1EJOL 1M56B 2G60H 2NQCA 3QJZA 4NUGL 1L3NA 2WW8A 3SY0B 3X14A 1JIBA 3ZTNL 2KYIA 3REVA 3RWHA 1XCQB 1ZHLA 3JTBA 5DK0B 1VZHA 3CG8A 4PLKD 5I1HL 3NK4A 5HGDA 3VFUB 5L2KD 1PDKA 2LT9A 4HKJA 4OZIF 4Z76A 4MX7B 5AD0A 2DI7A 3PJNA 5AW0B 3NZ8A 2F7OA 5BRZA 4M93C 4HETA 4GG6A 3FO1B 4NQTA 2KT6A 3AT9A 4Z3HA 3D4ZA 2XY2A 4G6JH 5B3JF 1AS8A 1UB6A 1J1OL 1A1MB 3CFUA 4F7EA 4LP5A 2CJUL 4GRWB 5EBWA 4HIPA 3J2PA 2FX8L 2XNAA 1QHPA 3MCKB 4X4XA 4HK0B 5CHNB 3LIUA 1TZGH 1GZQB 1T4KA 2A73A 3S37H 2QQNL 2X1PA 2R15A 2Y06L 5JORB 1A4KA 4PY7B 5FYKD 3G5XB 4JQIL 4BHUA 2WCSA 5I1LA 1TYEB 4JPKH 3E3QE 1DN0A 2VLKD 3QHZH 2IWGA 3NCXA 4LCWD 3OKDB 2EDRA 2VRKA 2DJMA 4G1EB 5E1AB 4GOSA 4U1HA 1JZ3A 3IFPB 3RGVB 1BQ5A 3LRHA 1NCCL 4JFFD 5C97A 4I18B 1WTGT 3E8UH 1AY1L 3BUBA 5B3JE 4UQCA 4N2IA 5IV2B 4DEPB 1RZ7H 4KMTH 4LCCB 5LBVA 1I8UA 2RCSL 1RZKH 4S1SH 4DAGH 4F7PA 1NBQA 3GRWA 2IQAB 5D2NA 2OR8A 4AEHH 5C0GA 2HFEA 5LBSA 1YEGH 1LO3H 1YYLL 3CFEA 3V0IA 3WIIH 3L4ZA 4EIZC 4UINL 2QZQA 3H54A 3QI9A 4RFNB 5J11B 3TN0B 2VRQA 1D5ZA 1U91A 4PJ9C 3WENA 2OCJA 4YVUA 1E8WA 3SDXF 5D72H 3GM0A 3VXMD 2P43B 3LQAH 4JFDA 4JKPL 2PMZA 5D7LA 5CUSL 2L4OA 3AQDA 1U8HA 1BAGA 1CFTA 2R29H 2VLRD 3HUJB 1CFQB 2ZG3A 3FUJA 4MFHA 4XBEH 5GGRY 5DO8A 3HJ0A 3MUJA 1D3CA 2VWEE 4YDNA 2DLIA 3IJ8A 3TO2B 43C9B 4UTAL 2XIIA 3F64A 2VN6A 3NCEB 3OKLB 4HFWA 4N8VB 1E3FA 3U36B 2VB5A 3BWUC 1BLNB 3NPSC 4JL2A 3DK0A 4F24A 4EIGB 4CVUA 4CMMB 3B7SA 1MJUH 1P9MC 3GBMH 4G6AC 4N9GB 1ZS8A 4C56B 4JANB 1YYMH 2RTTA 4R96B 1GCYA 3SKNA 3MKGA 3QEQE 2VDOB 3LQZB 1AZVA 1MQKL 4B9JA 5IB2A 1CURA 2UXGA 2E6PA 1IRAY 5B38G 3C08H 3ISWA 2W9DL 2KERA 3TU6A 5KSVB 5LCVA 1ROCA 1F3DJ 3QEGH 1IAOB 2PO6A 4YHIA 4LSDA 4OGXH 3WNIA 4TXVB 5L4IA 2FSEB 4GRLC 4YIQB 1MCOH 1QO3B 2FUTA 1VZGA 3M07A 2X4NB 3Q2NA 1MCCA 2ODHA 4TL4A 3BGFC 1IC5L 5EB9A 4P99A 5I8KL 3RDTB 1H0DA 1EHLH 5IJKC 3ZTJG 1JHKH 4LARH 1BQHB 1EDYA 4NO5A 3QWOB 4S0HA 4KVCL 4RZCB 5DD3L 2NTFB 1T2QH 4Y2OA 3SZ6A 1JPFA 1DLHB 1IZKA 4JO2L 4OZFG 5J6SA 5KW9H 4PP2A 3H9YA 2WBKA 4BKTC 2VL4A 4XMKH 5DEJA 1CFNA 4BFBD 1MAJA 2VAAB 4ETQB 3NG5A 3IDMB 1AXTL 4FNTA 3X1BA 4HULB 2EYRA 4R3SB 2MEJB 2IPTL 1SFDA 2VNCA 1NAML 2FGWH 1JPST 3LS4L 3OZ9H 1HI6A 3MXWH 2V9UA 4GRMB 1G7QA 4O5LH 4G42B 4UNUA 3VXOA 2HVKA 1AVAA 1BG9A 4PJIF 4X6DA 2ZUVA 3CUPB 5CR8A 2WBWB 5L4JA 1YECH 2P8LB 4ODSL 4P4RB 5DO2C 2D0FA 2E56A 1NOFA 1WLHA 2JB5H 4RFEA 3TNNA 3E6FB 1QX1A 4ZAKD 4F5CA 3ULVE 5SWZA 3K8MA 3V6BR 4MXVF 4APXB 1MRCH 4TTGA 3WFDL 4JKMA 4TYUA 2YHGA 4K7FA 4KDTC 4CA4A 1XO8A 5DYOA 1Z1WA 4S2SB 3VU2A 1OXYA 5EUKA 3V7AE 4NC1E 5EO1A 3SDDC 5ECGA 1BECA 2Y1ZA 3HKZA 4KV5F 4BRJA 4LOEA 3L7EA 2WGNB 2FJHA 2FEEI 5ERWA 5CD5D 1SXAA 1EO7A 5DD1L 1EFXD 2IANE 4GH7B 3EOTH 3IU4H 4FQHB 1KBVA 2C4FU 4UQ3A 1SQMA 3L1OL 5IMOB 4IHBA 3QDJB 4UTBH 3IB4A 4P23B 3KDMA 4PREA 2AJXH 4JFQA 1G43A 5E6ID 1U8PA 4L4VA 4GUPB 4ZFGL 3GMRA 4M43L 1F90H 3S5LG 5C9JA 4F8TA 5JQ6L 1T20A 1G7HB 5I8CA 2AV1A 5TDOA 3LKRB 3WKPA 5F3BB 4LSUH 1MCDA 3SCMA 4DUXA 4PJHF 4LLYA 4ZUUB 1OTUC 5CZRA 4GS7C 2VCOA 2JKJA 1UXMA 4ECNA 4DP0X 2O61A 1M4KA 1NDTA 4ODWB 2Q6WB 1TQWA 4WFGE 3EW3B 1FSKC 2WYIA 2YAPA 4EF3A 2Y2YA 1IJNA 3V5HB 4M7JH 4NQXB 3GLEA 3GDBA 3U79A 4MBOA 2J1XA 5HJ3A 3C5ZD 2J25A 3I3BA 4Z0XB 5ETUA 2V7NA 3TV3L 2XFGB 4Y7OC 2GAZB 3DMMA 3KCPB 3NRQA 1OANA 3PHQB 4X42A 2EEDA 4YDIL 1ADQA 1RUPH 4AJ0A 5GXBB 4X4ME 4G9FD 4K9EH 5T5FA 2OX5B 5HI5D 3S3DB 1AXSA 2IDCA 4ZYKA 2P5PA 5B3NA 1G4RA 1JGLL 1TR7A 1QKZH 3LNEA 3G6JF 2FNWA 3C60A 2VLKB 2ZF9A 4HX1B 1G6VK 5BJTB 4P2OA 4AM0Q 4NZDA 5I6XC 3P30H 3SOBH 3ROLB 1GGCL 4PV8A 3MV7A 5TJWK 3VAEA 5F7EH 3OVUB 1C5CL 1HIMH 1O75A 2DM7A 3FCBA 1GH7A 1SDDB 2HT4D 3VFVA 1MJJA 1U2HA 2PYFB 2NX5E 2OLDA 3RIKA 3DIFB 2D7TH 35C8L 5J3HD 2DQEH 5H4YA 4YZFF 4ESKA 1KB5L 3SODB 4BRVA 1EAQA 5HGHB 3S3SA 5AYTA 4TUUA 2FR4A 4B96A 5CJ5A 2ZJSL 3CVCA 1GIGH 5DC4B 3K1KC 3O2VL 4WW2B 3BQUC 5GRUH 1C08A 5E51A 5DEFA 4AQEB 3FTZA 1NC4D 4EZKA 1B3JA 1PTZA 3QISA 3VG0H 1U95B 5DLMH 4U0RB 1W72L 3NCYS 2R23A 2RJMA 3GJFH 1GMEA 3MBWB 4KJPD 1P4UA 1CXHA 3HZMB 3OKMB 5DRXA 1U2YA 1WHPA 2D0HA 3VXMB 3BSGA 3RY5A 3PHOB 1I8IA 1P53A 1HOCA 2DZEA 3CZJA 3L45A 4FQJH 4YXLH 4NQVB 5T1DH 3TA3A 1E4WL 4W9FC 4XXWC 1RV6X 1CBVH 3W38A 2VLRB 3BKCL 4XTRD 3KWXA 3WKNA 3VFNB 3IRCA 1BIIA 4UDTB 5IB5A 4KXAA 1KB3A 3OHMB 5DMGC 4YHKL 2VDMH 1G7PA 5TPWH 5TFSH 2UZIH 3QAQA 1N59B 1THCA 2H0FA 2VRAA 3Q44A 3OX8A 3QXUA 4HKBB 3T71A 5JW3L 4WCYL 4BH7B 2JB6A 5IVXF 5MHSD 1N4XH 4TSBH 3UH8A 1C1EH 4P2AA 1T3FB 2X3AA 3DI3B 3TT1H 4Q4EA 3ARFD 4NNXA 3L95A 3JWDC 4I48B 2X0UA 3ATEA 3BDYH 4JM0A 3UGXA 5DU7A 2CHDA 4PJBA 3FCTA 5D1ZA 3EYVA 3JZ7A 1UENA 2VJ8A 5FPIA 5I1AA 5L8KB 3GXMA 4X0NA 3EF7A 4XWOC 3GSNL 2ZYHA 3LMJH 3OZLA 4PRIE 3S88H 4KKCD 1BBJB 1YEIL 2ZSVB 2Z0UA 5CIPH 5DFWH 5C09D 1EO8L 5D2LF 3I50H 3MMEA 4ZXBB 2EVJA 2FQDA 3QCTH 2QMKA 3SD5A 1UB5A 2DQIL 4R6UA 4ODVH 1R3KB 2A1WH 2NCEA 5B1JA 1P4BL 1CF8H 2V5TA 3NIGE 1R5IA 4ALAC 4BA8A 5IHBA 4LLQA 3APCA 4F58H 3IMBA 1EBPA 1TO5A 4EI5C 5B39G 3KZ8A 3EBIA 4LOUC 3AUVA 1KULA 4JG0L 5LLIC 1MIML 1NINA 3UBXB 2R1WB 3PREA 1LE5A 5E56A 1DJHA 4D0DA 4PJCE 4NKDA 4HYTB 3EBAA 2DH3A 2BK8A 3CVHH 3D39B 2GUOB 5CSZB 1NMAH 2DJUA 3DWTA 5F88B 4XVTL 2GBVA 3MV8D 2I32A 3BSZH 1OOAA 4OF6A 4LGRB 4YQXL 3CXHK 3ZHKA 4PCTA 4XO4A 3U30C 3RJDA 3L6FA 3QWRA 5BRQA 5CD3A 2CO7B 1CMOA 2PWFA 1MHEB 5JPMB 2EC9U 4GS7B 1T21A 3V0VA 1AZBA 4A67A 4YXHH 1KG0B 2BSED 2YAMA 4NWTH 5JXAH 1VFAA 3OAYH 1LMKA 5FOBB 2GJJA 1KTJA 2A6DA 2EIMB 4ZAKB 3UZQB 3AXLA 1XIWA 3KGUA 2XWDA 3CFJB 1IGJB 1XF5A 3WS6A 1RERA 2B0SH 2JJWA 4X9FA 4NQED 2OMWA 3CQQA 3D52A 1ONQA 4QRFA 2RH0A 3RWGA 1W91A 1KF9B 2E6QA 4RCAA 1A4JA 1OF0A 3AADB 3KLHD 3JV6A 4X8JA 2QPUA 3V9CA 2R4SL 3EYUH 4N4YB 4NT6A 2XSKA 1EFXB 4WFHE 1MDTA 2VZVA 2PXYC 1QR1B 1I82A 1NMCB 3QDMD 1GSMA 1MFEH 1KIRB 1UEYA 1IM9D 3ZSTA 1OEZW 1H6TA 4LLDB 1WV7T 4XN1A 4MZIA 4WTZA 4MWFB 4H8WC 1MCEA 2ZXCA 4XB7A 2AJZA 5D1XE 3GSRB 5E6RB 2P46B 2YKLL 4U1SA 5IB3A 1R5WA 1PY4A 4ODHL 1IQDA 1NCIA 4OUUA 1U8OA 4PJ7F 4PLNC 1BEYL 4KX8A 1T04A 4FF9A 1E9OA 5FV1L 4NI3A 4LEOB 2W60A 3DKHA 5DJZB 2G2PA 3BP7B 4PVBA 1PKQA 4PCSA 4E36A 3BI9X 3WTUA 5SX4H 4P57A 3EH4B 1INDL 6PAZA 1QFWI 3EGSB 3BN3B 4XAWH 2YXMA 3O45A 1MCFA 5I1KL 6FABH 1DFBL 2VDRB 3T0DA 2Q3AA 1FL5A 4HALA 1R19A 3M1CA 4DESA 3MCLL 3W0WD 1BAWA 2OL3A 3RX5A 4C8XA 4QO1A 1PY0A 4G9FB 5IFHH 1OD7A 3T6XA 3SE9H 3HC0A 4E41D 5GS1A 5E8DH 3G5YA 1KIQA 5DMYA 3NMEA 1AGCB 5C0AA 1JMXA 1G0DA 4OGQC 4FQCH 3WXVH 4KTEL 3ZDYB 1A6WH 2VOTA 4BSWB 5LBSL 4FXKC 4AY0A 3LKPA 4JG5A 5D8JH 3VXSD 1MXDA 2Z35B 2NY3C 1G5GA 1M05A 1CO1A 4FFYA 4PRBA 4B27A 2YRZA 2OV0A 1CWVA 2XWJB 3NCWA 1J8KA 5EUOF 2HLEB 5AVZB 1WA2X 1KNOB 4HHAB 5EZIH 1NFIA 1EZVY 1WZMA 1T7YA 4XPBL 1WISA 4K3JL 3MN8A 1JZIA 3CFDA 4CGUB 1WP6A 2QQLL 4S1RL 4U3SA 5FO7A 5AZ2H 5MEOA 2D4DA 4MJ5B 3WEXA 4B9PA 5GS2D 4HKXA 4U7MA 2L7UA 2NY6D 1MNUH 4XXDA 4OKVA 4S11A 5HYJA 2AS5M 2Q10A 1JPEA 1GC1C 5IESL 3A6CL 1MIEL 4GIOA 1BWMA 1ZGLM 3K2KA 4HAKA 3QNXA 5F6IC 2C7UA 3WAKA 2BOCA 5EFIB 1T1ZB 2R0WL 1QR4A 3JTTB 3FO2B 2PCPA 1MW0A 3T2QA 4Q89A 2GITA 1CICC 2PWEA 4YL4A 3EJUA 3TFKC 4M9OA 5IBTH 2F5BL 3ZIMA 3Q6GH 3UJTL 5B8CB 3AU1A 5FYLL 3P4OB 1Z3RA 2H6PA 5LCVL 5CF3A 1MJ7L 4G70B 4OI9A 2CXKA 4K9JA 4FG4A 4FXLA 4DVRL 4GYBA 2O5ZL 2GBUA 4AYMC 4LESA 3FRUA 5IHLB 3ARFB 1QACA 2NR6D 2XKNA 2E8YA 5GPRA 1UUNA 2F19L 4W68A 5B1BB 1VPOL 3N42F 2QV4A 3H9HB 1DQLH 2Q76A 2ESVD 5LHDA 2R1YA 4BZ2A 3LRGA 3NT0A 3DX9A 1DUYB 3ES6B 3MZTA 2WVSA 2GHWB 1DJGA 3VXRA 4PMEA 3AC0A 2X0VA 3HLAA 3FB6B 3TPUB 5C09B 3F58H 1OALA 1W15A 4XPGH 3SIKA 4H40A 4XP9H 4H2CA 2XFXB 3UJJH 3IKKA 1MI5E 3T0ED 4ODUA 2DB8A 1N18A 1T83A 3ESPA 3NQIA 4P4KA 1TVHA 2LU3A 2QGCA 1L7TL 2GTZA 4PGCB 4YZWA 5EU7E 2FLMA 3DV6B 4Y1AD 4GIPD 4D8OA 1T7ZA 3J8F7 2HPTA 1OM9A 3ECBA 5JHBA 4G7SB 1FJ1B 1HXYA 3HMWH 1A2YB 4AUYA 2HKFH 3RU8H 2HLFD 1E7VA 2C9RA 4K15A 5I6MA 4TLTA 2HFFA 5EOCH 1H5BC 2QLYA 2CALA 2BHYA 3FUEA 4JZJC 3QUZC 3MV8B 1MW3A 4KY1L 1R9FA 4U05A 3ATFA 5C2BH 4HFUH 4HIEB 1H3WM 3QUGA 3BMVA 3D3VE 5GRXG 5CJ8A 4NKOB 5ANMA 5I28A 3REWA 1AKJD 5IZ7A 1ZVYA 2FWLB 1J0ZA 4K5PA 5AAMA 1Y1UA 3JTSA 2D03L 1TU2B 1L0YA 5LGJA 1ED3A 3OPZL 3PYCA 1IL1A 3VNZA 4ONHA 3IBEA 2F54D 1GHFH 3JWNH 1DQJA 1DUZA 1JK9A 2DQHL 3CPLA 4PGJA 4YGVB 4BKSC 2VTFA 3Q6FA 5EF1A 3IGAB 4ELMA 5F7KC 3UAJC 5DMIH 3WDHA 1RIUH 3GI9H 5LAXB 5FHBL 1HWWA 1XF4A 2PPFA 1N8OE 2JKTM 3INUL 4IKKA 4J8RA 4NQEB 1QLRB 3FMGH 3MGOB 4PJHB 3UYRH 4Y0GA 3CTTA 3G04A 1TEGA 3CU7A 1EUTA 2MHAA 1PG7W 4O2CA 5IFAL 4R4NC 1ESOA 2H6UA 3O6LL 4MDJA 1EZUA 4KRNA 2Q7AA 2HPOA 2EEBA 2VAJA 3ZDZB 4GKOA 3S4SA 5EEUA 2BSRA 5TE6L 2DMBA 3BE1L 3QUMA 5TF0A 4HV8B 2DS4A 4MB1A 3ZQXA 4MSWB 1IT9H 3FTGB 3QDMB 2ICES 1E5YA 4YXKL 4K3HA 1CVSC 3QORC 4K8RH 3PWPD 1IM9B 5EZLA 4EEEA 3K46A 1RHHA 5DA0B 3OTTA 1A6VH 4LLUA 1LWRA 3VI3F 2VXTL 3DETC 2CMRH 3DVNB 4FXKB 2YPKA 3R7QA 1U3NA 1QAWA 1NKGA 4WV1C 4APQC 5AG9A 4LQFH 3IM1A 4XNQB 2ZF8A 2E86A 4S1DC 4OD3H 2VSCA 4LMQI 1P1ZA 5IQOA 2CIIA 3S3PA 2WLYA 3M1OA 3OAZK 4JPVL 3PGCB 5C07D 4FYRA 5JW4M 3N1QC 3VD1A 4XNAA 2OMNA 1A6TB 2QKSA 4I87A 5ECJE 3G6JB 3LEYL 3AAZB 1N9PA 1BVOA 5DK2B 1WFMA 3S37X 3WY1A 1XBRA 2DKSA 1Z5YD 2SEBB 1ANUA 3N5AA 4W6WB 1CD0A 3H9ZA 5IY5B 1NSNH 4I0CC 4J5VA 4NN5C 2VM4A 3V6OC 2VR9A 2Z8WC 1TQVA 1OF2A 2JKSA 3B43A 1BYOA 2IDSA 1DBAL 1JRHL 2A83B 1M53A 3DX2A 1VFBB 5D2NE 1XH2A 5B1AB 1QLFA 3JUZA 2IOIA 5A40E 4FADA 4UF7C 4JX0A 4ZMZA 2XZCH 3WAJA 4HPYH 3WTXA 1TG8A 5DK3A 3ZRFC 4E41B 4AKOA 1XFPA 3MYJA 1KN4H 1X5FA 2BXZA 4V33A 5BV7L 4G7VL 2J7LA 4LEXH 1ZRUA 1JZFA 2IDTA 3HI1A 4GSQA 1NCJA 4HISA 2OMUB 3ZDXE 4WHTA 5D7LE 5IOPB 3QG7L 2P7TA 5H35A 2AGJH 2BNQE 3IE4A 3OR7A 4NI6A 1QQDA 3VXSB 3HI5L 3FUIA 3HG2A 1FGNL 4Q74A 4FLHA 1DSFL 2WCGA 3GSUB 5D70L 4BKLA 4AYGA 1GOHA 5DC9B 5AWNL 2BHUA 4DP5X 5L6YL 2QJDA 1NWOA 1XH3A 4IM8A 1E50A 4JGNA 4Z0BL 2EVHA 5EU6D 3B2VH 1TQSA 5DTFB 4YEFA 3NFSH 3H42H 4Y1SA 5KZCD 3QJOA 2YRBA 1I1AC 2J88H 3STLA 1ORQB 2V5YA 2XZAL 1YNTA 4MS8C 5A2AA 1ZVNA 4H13C 4DGVL 4NWUL 4EIBA 4OY9A 1UCBH 3QEUB 2DWTA 2J8HA 5T1KD 4XMTA 2NY6B 1FWXA 3MRFB 2BVEA 2X4UA 3GMQB 4KKRA 2X4QB 1WT5C 4JDZA 3ARGC 2I9LB 2BY1A 5FYLE 2HVBA 2K9FB 3T1FB 3FQXA 1OPGL 1EDHA 2XX1A 4UYPA 1KCWA 3QJQB 2OYKA 1GJWA 3L1EA 1A7PL 4WEBL 2M83A 1WICA 1MCWM 2O30A 1WFNA 3IWUA 4MRBA 4BQCA 3KWVA 3QRLA 2HMID 2XVGA 1JMZA 5ID0A 3FQTA 1C5DB 5BRPA 3X1FA 1KDJA 3RY4A 2OMTA 5B38B 3KJ4C 1FFNA 5KJ7E 1UTDA 3QH3A 1J0HA 1MFAH 2Y7NA 4YHYC 2K4AA 2WN3A 2AXJA 2VLJD 3CK0H 4M6ML 4N8CL 2BW5A 3ZKND 1H5BB 1ECYA 1JNNH 4M8VA 2D9CA 3I6LE 1BVNP 1YNKH 4PWHA 1USZA 1XSKA 4Q2ZA 4UT9A 4TQEL 3DJ9A 4NZRH 3BGMB 2ESVB 4N2AA 3B56A 1T89C 3B9KC 4ZSOE 4K2UL 1R34A 1W2KT 2D3LA 3KLKA 4ZODA 5J7CC 4P05A 5EIIG 4N5EC 4F9LC 1SYVB 1BF5A 3VFMA 5I1GL 2BNUA 1UZ6F 4A39A 3HEIB 2XN9A 5IW3A 2I27N 1RZFL 3GPEA 4LQ1A 2DIAA 1EEQA 4GQ9H 3TZVA 4CNIB 1IGTA 5DVPA 5IG7A 2BSTB 2C3WA 1BFOA 4JZOB 4UQ2B 1PLGH 4O4YH 4L3ED 1BVKA 4G8IB 2KC0A 4RIRA 3H2QA 8CGTA 3T0EB 4B9CA 3ARTA 4F37F 1OAUL 3C5SA 3KXFA 1NICA 4F7CB 1ZMYA 2CAKA 5A7EA 3VRJB 4ORZC 3WIAA 1MRDL 4JY6A 4F5CE 1MOEA 3GI8H 4QHUA 2VSDA 4HKZA 3L3DA 2PYEE 4V2CB 2Z7UA 3K8LA 4FQLH 1E4HA 2J4WL 3AREA 1PL3A 4Y1AB 1YA5A 3VGBA 3KYOB 4LXFA 5E99L 3BFWA 4D7PA 5T1MA 2XWZA 4UMGA 2IV9A 2OZ4H 4H88H 4UV7H 3ZTJH 3V0FA 1KACB 2NPLX 3JXAA 3E7JA 5I0XA 3V4PL 2EH8H 4QF1B 3BT0A 2FBJH 3ET9F 5FCUL 5M94B 2GI0A 4M1CD 3UDWC 4MJ4A 1NGXA 3IN2A 4OZFH 4BXSV 4NKIH 4BA0A 4K0OA 3PUUA 1JNLH 4L29A 3VM5A 4OCSL 1A7QH 4JY4A 2D0GA 2HAZA 4WVRA 5SWSA 7FABH 1FVCA 4L4VE 4B95C 1OK8A 4H1LH 1AKJB 1VZIA 4MA1C 2RQ8A 2X1QA 2ZOLA 2MWCA 3U46A 2HRLA 2WAHA 1I3RA 4KXZI 4A6YA 2F54B 1YEKL 1GXEA 2CKBH 3FUFA 3SJVD 1GKEA 2H4EA 4UOZA 4ORGA 2FDBP 3DX6A 4NN5B 1LDSA 3ILQD 4FI6A 4HOWA 3MODL 5I17B 1JN6B 4LCYB 2UZYB 3WHXA 4K5NA 3ML8A 4R7VA 5CEZL 3AS2A 3CX5K 2F74A 3DVIA 1K2DA 4DN4H 1B2WH 2WXNA 3O6FA 5D7JD 3SE6A 3RVXD 4TVPL 4NRZB 1NAKL 1YJDH 3FTUA 4IEFA 1X5KA 2A74B 4PJ8D 4AXWA 4B50A 4F8NA 8FABA 2ID5A 4PJAB 4NM4H 3OSVA 1BZ7B 2DLTA 4HJ1A 2GG1A 4GKLA 2VW7A 3GNML 2A6KA 4JAMA 3ORJA 1DVSA 3N85L 1OP5H 5FGCB 5D1QA 2XTJD 4P3CH 1NL0H 4UWQB 3SQOL 2ZP0T 2XWBB 2UWEA 2PR9A 3ABGA 1V3JA 2O5XH 1PG7H 5E5RB 4NJ9L 4P5SA 3D4GA 4CRPA 1SXBA 4JHUA 2EACA 2XN2A 4FFWC 4KGJA 1P7KA 4ONFL 3MV7E 4X8CA 3D50A 5C07B 4L4TA 3T6ZA 4D9RE 4KK5C 1PIGA 3BAEL 3EJYD 4Q56A 4UUJA 4WFED 5I71B 3DUSB 4XPTL 4MNQE 1I1AB 3L17A 3GSOB 5JOFA 1YPZA 1CL7H 2D3JA 3CXHJ 5DZPA 3BO8A 3A23A 4XNMB 4AI7A 2ZCHL 1WD9A 3MNWA 3KYMB 3PV6B 4GSDL 4PLJD 4BFNA 5EOQH 1CR9H 4IIQB 2JI1A 4R2GC 1LD9B 1L9OA 3ZMEA 3P9LB 2H1LM 1WFOA 1JNHB 1ZWIA 4JGMA 3T6VA 2R8SL 3UJIH 3EJJX 4XP6H 3HS0B 4JZNA 4LVNB 4N2OA 2NY0C 5IQ9A 4L2YA 4C55A 3LIZH 1S5IL 3RKDD 3T8XA 4Z7UE 2A9NH 1UWGL 3NESA 4JFXB 4NQCA 4XC3H 2GK0A 1QZ1A 2ZXWB 3WFBH 1IGIH 3IMSA 1VCBC 3CGTA 3B8YA 5D4IA 4L37A 5BQ7B 4KTDH 2WGXA 3Q9PA 1KJ2B 4B7IA 4RGOL 1J48A 4B9KC 4ZTOL 3NEEA 4XI5D 3D51A 1XCQA 1K4DA 4BFRA 4AOFA 2FYYB 3R0MA 3VFUA 2E9WA 1WITA 2WMPA 4HWBL 4MX7A 2H2SC 1T6BX 2VN5A 2XQYG 4UV4L 4RGNC 2FQGA 3AVEA 4CBZA 3FO1A 5DQJB 1KPRB 1KLFB 1FFTB 25C8H 3D06A 3HG1D 4FXTA 3BZEB 2JIXA 1IBHA 3QCUL 1R24A 1A1MA 4WI3A 3QPXH 1ODUA 4LCUA 4YSCA 5EEYA 5KZCB 4M9PA 4L5FL 2F1AA 3QZLA 4OJFL 3MCKA 4HCFA 2L3BA 2FD6H 5CHNA 1JTOA 1MFBH 1SY6H 3SE3A 3WFEH 1I7TB 1OAQL 5DFVC 3ZTDC 5FO8B 2BVUA 3L3GB 5DJ0B 3V5KB 1ZE3C 5GISL 4TS6A 5T1KB 3MLWH 4O2FB 1KGJA 1IC0A 3MLTA 4PY7A 1M1SA 3P9WB 3G5XA 4PJEB 3V79C 3BPCB 2YLHA 4HUWB 1K4CB 1OHQA 1UT2A 4EDXB 2Q20A 4HPHA 1TUPA 4G1EA 4LLVB 1YEFL 3MACL 2EVFA 2IQ9H 3BFQG 5K9JL 3IFPA 2APTA 5TE7H 1RZJH 2YK1H 5C7XL 3U7WL 3SDAC 4Y16D 5ICXB 1MUJA 1QHOA 2HG0A 3VMPA 4HWEH 5JW4Q 3UZEA 4BZ2L 1BVLB 2A3TA 4Z7VB 3ULUL 1CDIA 3B2XA 4LCCA 2R29A 2BHFA 4MLSA 3VFSA 1QRND 1CXEA 4WSJA 4LRIA 3BYTA 4ZO9A 4N3UA 5DD5L 1TZHB 2IQAA 4J6RL 2CSPA 4FQQB 4G5ZH 4JMNA 3GDCA 4HCRH 2VLJB 3HE7C 3GXUB 3TEZA 1W16A 4K5OA 2WD0A 5LXGH 1WBZB 4I3SH 4Y5VB 3FF7A 1NDGB 2VUYA 4JR9H 4LEEA 5DUJA 3FU9A 4OFPA 1AE6L 5AB9A 2VXUH 3GBDA 1I9IH 1NCBL 2YUWA 3NJGA 4KXCA 5HDBB 2WOYA 1S9XB 3F84A 3RWDB 5B39B 4XXCA 5INDA 2F8IA 5F7DB 1TTGA 3HUJA 3DJRA 1CFQA 1J11A 5BMFH 4IOIB 4PWFA 1SJEB 3ULVF 1HHJB 3C6LD 5GRJH 1H8OA 2J20A 4Y2DA 2P45B 3N1PC 5HDOA 3MRHB 1HZHL 43C9A 1XR9A 2XV3A 4MBRA 4LZKA 1FA4A 2OSXA 4OKDA 3OKLA 3SBWC 4N8VA 4B97A 3U36A 1FNGB 5KSUB 5C3TA 2EAEA 1TEYA 1BLNA 2QDVA 3TO4A 3K0WA 4FFTA 4C58B 2W9EH 2ZICA 4CKVX 2VXQH 1CD1B 5D7IA 4CMMA 1IVTA 4FQIH 4N9GA 2XJKA 3HN5A 3BP6B 3MBEC 5HDLA 4C56A 4YHOH 3V0AC 1JL8A 3TF7C 2EDQA 4KWUA 3SGKC 2X41A 2VDNB 1UD6A 3H4HA 3KW8A 3LQZA 2WQXA 2BFVL 4X6EB 4TTDC 2DF3A 1KZYA 2Y23A 1HZLA 32C2B 3OQRA 5J06A 3ZT7A 1X5AA 5KSVA 2XPZA 3RILA 3RUGB 3P3RA 4J28A 1UT9A 4HK3N 4PIRF 4IBQA 4Z8FH 1EJFA 3EJQA 1TTUA 2F68X 3FPYA 1QO3A 4DKTA 2ZWNA 2WZPA 5FXCH 4FAAB 4IMKC 2MPVA 5AW2B 1IC7H 1PZ3A 2X4NA 4MNHB 1PSKL 5F3FA 1GJUA 4C54A 5CEZE 1BP3B 4GW1B 3RDTA 2IXQB 4JPQA 4Z7OE 3RWEB 2OMZA 1HL5A 4M1DH 4MNGB 3QXDB 3V2AR 3L4YA 2VJ0A 4YC2B 4ES9A 4TVPE 2PCYA 3QUML 3ME0B 1I1FA 1UA7A 2HTKD 1Q9OB 2VLME 3SJVB 5MERA 1YMMD 3IETB 3QWOA 1KWKA 3MLVL 2V9RA 1OCWH 4IK7A 4R2GB 4RZCA 1F11B 2E0PA 2R56H 3RZCC 1DLHA 1PKQE 3FB5B 4AC2A 4Z7NB 2XG5B 5IROA 3Q3GB 4LF3B 3EDKA 2VAAA 5EZJA 1V54B 3HG5A 5DCCA 1CLYH 2ICWB 2QADC 3L48A 5AW4B 5D7JB 5BUPA 5IM7B 1OO2A 3KVQA 3SO3B 4PJ8B 3LKQB 4R3SA 1LLAA 4Y8AA 4WAFA 5CILL 3A24A 1ID5I 2HH0H 3T3MB 4DN3L 1NIFA 5CFHA 2IGTA 4YEEA 1OOWA 4G9DA 5I1EH 3WGUB 3BIKA 3NRFA 5HXMA 3CUPA 4Q8BA 2CDEA 4J6IA 5CEXA 4PJXB 2XTJB 1OTTD 4KY2A 3RNQA 4PTUB 2DJSA 4P4RA 4QRPA 1TQCC 1AI1H 5EZOH 1HHIA 1HJCA 5F7NC 3E6FA 2X53A 3GINA 5C0AE 5AENA 3UTOA 1EBAA 5E9DD 3EGDA 3T77B 1WQVT 4APXA 3U0PB 4WW1A 2VSKB 2BOBA 3RWIB 3ARYA 1M2VA 2R9HD 4WWOA 1T4WA 4CJ1A 3E3QC 4LSPH 4S2SA 2XA8L 1F42A 4FYTA 4G5AA 5TE4L 4RX4D 4WNSA 3U82B 3D2UA 4PRDB 1V27A 4FMKA 4UT6H 2CO6B 2CBTA 3WNPA 4CUCA 2TSAA 3G5ZB 3FT4B 1NEZG 4FQ1L 4GBXD 4FYSA 5C2UB 1P0SE 4AJYV 5BZWA 4J1UA 1PCSA 4X2UA 4EOWL 4OM1H 4FQHA 2FGZA 2LVEA 5BZXA 3QDJA 1AGFB 5HHQB 4IU2A 1KIPB 4WTQA 3VVVA 4BINA 5KVGL 5LVEA 1VADB 4H8QA 5CN2A 4GUPA 4JM4H 3LXUX 3AQYA 1UGNA 3GJEB 4MDIB 1WZAA 1G7HA 2LOEA 3LKRA 4KPHL 3H2PA 5F3BA 4DZBB 1FNSL 4OI8A 1HSBB 2BNRE 4L5FE 5HYSB 3GIZL 2X88A 3UIYA 1FZOA 5T8IA 1MLBB 4EIUA 5L2KA 5HYFA 1ZA6A 2FZ3B 1HSAB 2IAMD 2XQ0A 4L2LA 2VDQB 2Q6WA 4MA3B 3BVDB 1HHGB 3ARDC 3L16A 2QSQA 3OC5A 2B9BA 1AD9B 5HHXL 3F7QA 3HG1B 4NQXA 1MWAH 4YR6B 2JMRA 4RETB 2XG4A 1NCDL 5I5MA 2ADJB 3HRPA 2VWEC 4Z0XA 3T5WA 1ZAGA 4XNUL 3TH2T 1QI4A 2AQQA 1UD4A 1QWHA 3KCPA 1S9YB 3PHQA 5GHWL 5L8LB 1WF5A 4EUPG 4KKZA 5H37H 1AR1C 2AQPA 4XCCH 5HHVL 4CAGA 2OX5A 4JRYD 4XO9A 1UCTA 2TSBA 1RIHH 5D7SH 4AC4A 3O8XD 1FI8C 3E6HA 3CLFL 2NY4D 4RWYH 3ULUE 3RVVD 1F1DA 3CE1A 3K6SB 3QUYC 1CDJA 2VLKA 5BJTA 4HX1A 2KZBA 5GRWA 2EYSB 1KENH 1MVYA 3QXAA 4LCWA 3NIGF 5FV2A 3QXWA 4AV4A 4KKLC 4OR1A 3TCTA 1LO2L 3DBXB 4DK5A 4P59H 1IQWH 5KOVC 2OA9A 3JT0A 4TNWF 3DRQB 4F2MB 1KSRA 2IMMA 1SDDA 4PRAB 1TQTA 1KGCE 2B59B 2PYFA 3MBEB 4UT9L 3DIFA 4JFFA 4MD0B 4WO4D 2PCXA 4IRZL 2VN7A 3CAFA 4PRNA 5HGHA 3JWOL 3ETBJ 5HBBA 1DQML 1QUNB 3LZQA 3HBQA 1XDTT 4WGWB 5G4MA 1QRNB 1TCRB 3DX1A 4PHZA 2CJSA 1UACH 1OLZA 4ZOBA 1N8ZB 5HDQL 5IMMB 3HE6C 4AQEA 2C9PA 4F37K 3LZRA 4MQ7B 1U95A 1X6NA 1GSKA 4KQ4H 3J27A 3WMQA 3H56A 3MBWA 2FHCA 5KSBE 1BFTA 1CE1L 2BIHA 1T1WB 3HZMA 5CP3H 2DD8L 3VXMA 5E24E 3IDIB 1FHGA 3BYYA 4WI8A 3VJ6B 3KVPA 4A7TA 5FKPB 4Y5XB 1ZIAA 5EORH 2WXFA 2VLRA 3MC0A 4C47A 3VFNA 4UDTA 2N1KA 3C6LB 5ANME 3SDDD 1KN2H 2LQRA 2AI0L 5CIPA 3EOYG 4FL4C 3NK3A 2DI9A 1DJIA 2EZ0C 1JCVA 1ZTMA 2C4FT 5F7HA 1WIUA 4PGDB 2ZXDA 2DV6A 3RZWA 3MLYL 1T3FA 2VMDA 5TGBA 3UYOD 1RK1B 1HKLH 1PD1A 3EO9L 1GOFA 4YDJB 1QSFE 3FUNA 3ULVC 1KBBA 4FQXA 5C08E 4JREC 3E38A 2ZXBA 3WJLA 4RDQF 3RGBA 5JNYB 3H9SE 4A6YL 3A6BL 3D09A 4HJJL 3LV3B 4MMXB 1OZUA 2XVLA 3OMAB 5J9PA 4TQPA 2IH1A 4XE5B 2ZSVA 3RYMA 1NTDA 3BC9A 4IDJH 1E5CA 2WSPA 3SPCA 5TQ0L 4UB0L 1D5MB 2WBJD 3L13A 5BS0E 4FHKA 1R3KA 3SYCA 2R2CA 3DXAD 2YMXH 1E6OL 3TIEB 1N68A 1OY3B 4M7KH 4Y4HD 4D9QD 1MAMH 2AQ2A 4CJ0A 3WUWB 2V5SA 3KLAB 3RL2A 2EVIA 1YMMB 4PJ5D 1EX0A 3MVSA 2R1WA 4F3FB 3H6JA 4OJYA 4PV1C 5C0ND 3O9WC 1DJYA 2ZAHA 4Y4FB 5MP6H 2MCMA 4G8GA 5CBAB 3IAQA 2CGZA 2GUOA 3MRQB 2WK2A 1K8IB 3QPQC 4YSTA 2EUZA 3DTDA 5AOIA 1EXHA 5DZJA 2P80D 3ESUF 3P9MA 3U7YL 4HG4K 3VFPB 1NQBA 4P5TC 2A99A 3LNDA 2Q2LA 3ELQA 1TMCB 1AR2A 3UACA 3WD5L 1CTNA 1KG0A 3KYNA 1UVQB 4FZEL 3POHA 2FL5B 3VA6A 4W70A 4AEIL 5FOBA 3RWFB 1EK3A 5KSAB 3BAYA 3WTVA 4ZAKA 4MXWL 3Q01A 2NUTB 4LP4A 3OJMB 4P8QA 3CFJA 2TRHA 3Q9QA 1JI1A 1YN6B 3BQUD 1E0OB 4TOYL 1NJ9B 1VCAA 4KOBA 1EMTL 2AK4E 2IF7A 2B1HH 4GXUN 4JFZH 4HUUB 5GGTH 3NH7H 5KVGE 3U1SL 2X2IA 3ILEA 4FXGC 4N20A 4OT1L 3LEVL 1JVKA 2NW3A 4WU7A 3TH4T 4L05A 4XP1H 1EVUA 2ZWSA 4GBXB 2D31A 1OTSD 1EFXA 4WI9A 4DGWC 1PNCA 3HPJB 3QQDB 3EFFA 3A4FA 3H7LA 3MV9A 3Q2CA 4WHCA 5GZNC 4XVUD 4KKPA 4PFEA 3MRGB 4I2XE 4JKKA 4LLDA 4XZUB 3VWKC 5E6IA 4XMVA 4JPWL 3BN9C 4KZCA 2GC4C 3GSRA 3GXPA 4BFFA 2YEVB 3CFBB 5AYUL 1S9KC 3RWCA 5CSGA 3BPOB 4WI6A 3GKWH 1NC2D 4U1NB 1QSED 5FK9B 4EBQH 4K3EL 5JUEH 2XICA 4JO3L 1YUHA 2Z0BA 2NLJB 2W0FB 1ZTXH 3FSVA 2GTWB 3OWEA 3W11D 1SQ2N 2EXWC 3B7TA 3HA0A 4NLHA 5E4AA 3ATDA 5IHHA 4JO1L 4ABQA 4XWOD 1HYSC 4YHLL 1P4LA 5GRZA 1D6EB 3UPCA 2E59A 2QVIA 2HJKB 2A9BA 3C5ZA 1WA0X 1KPUB 1JXKA 2DTML 5IBUG 2DWXA 3P1VA 2CK2A 2G5BB 1CGSH 4G9FA 2YZ1A 5JZ7C 2J1KA 1A14H 1B3IA 3NAAH 4JVUA 3HPLB 5FYKU 3O3AB 5E03A 4U2YA 2YD8A 3SKMB 4DVBB 1R3IL 3AM8A 3O8XB 1ZK5A 5K9QI 2NY4B 1AGCA 3CBJB 3GHBL 1S7TB 4QRSB 2XN9E 4FL4B 4G6KL 4N6RB 4R5VA 1L3WA 4E9XA 3C12A 4AMXA 5ITFB 2X6CA 2BWDA 4LKCB 1K5NB 2DQTL 4M6AA 1ZANL 4WI2A 4OLYH 1R0AH 2XWJA 5KVMC 3QQ4B 5E94B 1E65A 4NCDA 1I4FB 3GS0A 4WO4B 1WS8A 4XPHH 1KNOA 1KGYE 3KXFE 1HQRB 2A9ML 2SODB 4FS0A 4XRCB 5HHOE 5BOPA 2Z91B 5EU4B 5D6DA 4BFKA 1BWWA 4H20H 5ADPL 4OB5L 5DMKB 1NEUA 2VABB 4JO4L 4DQOL 4X4YB 3ARVA 1NC4A 2EC9T 3E8VA 3L4UA 5HYEA 3HVNA 5KBPA 1ITCA 2P47B 4WNQB 1P69B 3UMTA 1G7MA 4HIHB 4Q0XL 3CPUA 3TYGL 5BVPH 4BV1A 2XQBL 4MA7H 1GGIH 5GZOC 5CINL 2BIQA 1L9PA 3IN0A 4HU2A 5DHVB 3VGFA 3WOVA 5FW6A 3BHBB 3NACL 5EFIA 4JHZA 1Z3GH 1T1ZA 2FH6A 3RI5F 3W2DL 5SWSE 1AHWB 2VDOL 3N43B 4XH2B 2E75C 1X4ZA 4MJIB 2QKIB 2MNJB 1WWWX 3FNKA 5DVOA 3FO9B 5KAQF 1EHKB 1W0WA 4PJDA 3P4OA 4LHUG 1HEZB 4TNGA 1A3RL 3DSNB 3LXCA 3V0WL 3BESR 4GG6F 2Q1EA 4A2LA 1FDLH 3UBFA 3BQVA 4ZPTA 3W5MA 2WUCL 1H9VA 1RSFA 3QZNA 3FU7B 2BVOB 4NXKA 3O6KL 2QELA 1OZTG 1AG6A 1QSVA 4OLZH 1MWOA 4KH9A 3HI6L 1NLBL 2GJZB 1EZSA 8PAZA 3FL7A 3QIBA 4CSPA 2HYMA 1DUYA 3ES6A 2D4FA 4RMBA 4JCMA 1JGVH 2OXHB 2FB4L 1VB9A 2NY2C 5T3ZL 5C0IB 3NABL 5E8OB 3FFCA 3TPUA 5C09A 1J5OH 4N22A 3DLQR 3N9GL 1S78D 4HD9A 5FUZL 3OR6A 1KB9K 5J0BA 3TCLB 4P2YA 3JYBA 2WBJB 4NSKA 5D1QE 1IBGL 2DQ6A 5FO9A 3DROB 4OZHB 4RBPK 4ATWA 4ZI8A 4D94A 3DXAB 4M4PA 3UEZA 1HEHC 5E8EB 1T03H 4LFHG 4PGCA 4Y4HB 3ISYA 4KUCD 4QXGH 5C0BD 1J1PL 3O4LB 2WTOA 3DV6A 3K2UH 5I1JH 3NGBB 3WY3A 3ZOAA 4Y9BA 5CCKL 3BZFB 3K74B 4FFZL 1JAEA 4H5SB 4J3OG 4PJ5B 2W1NA 4OCYH 3GSWA 3MLSH 4JHAL 2AXGB 4FE9A 1UFUA 1FJ1A 1YPZE 2RQEA 3VGEA 3SGDI 1A6ZB 4IRSD 1NLDH 4CADA 1G0YR 1G7LB 2NUPB 3GZQA 4PJFB 5FB8A 1XGYL 1I8KA 4ZX5A 1PG7X 5IEHB 3SE8L 5KG9B 2QPFA 4HF5H 4ZUVB 3MV8A 1FL3B 2B5IC 4HIEA 2B4CC 4QHKI 4XMWA 3LZPA 3ZDXF 3CVDA 3TVMC 3WLWD 4NQCE 2X4RB 4K7PH 4MJJA 2L0DA 4DPAX 4YE0A 5CEYB 2BSEA 3VTMA 4BWUA 2B3RA 4JO8A 3MHZA 4F92B 4RRPG 7CGTA 1CFVH 1PYWB 1QBBA 4N1EA 1PFOA 4YGVA 5F93C 3TTSA 2IDFA 2P26A 5GGUB 3VNYA 3IGAA 2PW2B 5AOKA 4XOAA 2QGBA 4P5KB 2FWUA 3HNSL 4HBCH 1AS7A 1NBZB 2RGSA 2WP3T 2YIHA 4NQEA 4HCGA 5A6IA 1XEDA 4Z7WA 2QMJA 5DI8B 3LKOA 4ZTPL 1INQB 4ONGL 1GY1A 4M5YL 4NJAL 4X9IA 2Z7ZA 5E2WL 5SX4I 1QG3A 1NGPH 2ERJC 1L9TA 2R0ZL 3LN9A 3VSVA 4GRWE 1M6OB 1JOIA 4HAFA 4WO0A 4HV8A 3ELAT 2V7HA 5GGVH 1N0LA 1T0NB 4M7ZB 4MSWA 4RISL 3U83A 3QDMA 4PVLA 1JPTL 5LNEA 3WJJC 1IM9A 3GHEH 4GO8A 1RUML 2GKIA 4WUKL 4PS8A 2ZKXA 1JRHI 4N0YH 2Q2EB 4MZ2A 5F96L 3H3KA 3STBA 2WWNA 4LASH 3EIFA 4GKZB 9PCYA 4QWWC 1LO4H 1T1YB 4F8OA 1DDHB 3VGHA 4DKFH 1WE5A 1NC2B 3PGCA 1QSEB 1BOGB 4BQ9A 5JYMA 2PR4L 1QABA 1A6TA 3AAZA 3W81A 5DK2A 3NFPA 2Y7QA 2SEBA 4G8EB 1UFGA 4YBQC 1AJ7L 2AF2A 3UO1L 4NUPA 2XWRA 3O4OB 5FYKL 4JFYA 1QFPA 1IFRA 2P24B 1AQDB 1JHLH 4CC4A 5A2KH 1BEXA 3ULSB 5IEKB 2A83A 1ILSA 1CLZH 3BVVA 3NJJA 1VFBA 3OXSB 4ZPVA 3T4AC 2NZ9C 3O2DH 4QOKD 3W0WA 4ABUA 3DX3A 4HLZG 4KQ3H 1MF2L 3WCYA 1NGZA 5T3XH 2KS0A 4ADJA 3IRZA 4NS0A 4Q9CA 2YPVH 4Y8DC 2AEPL 3GMMA 1ACYL 1QP1A 4JPIB 3TBSA 4E41A 1A3LL 3F7KA 3JWDH 5DJ8A 2AANA 4X6DF 2EKSB 2H32H 3HRZC 2OMUA 2PKDA 2Y7SA 2D7PA 4TQIA 4OFYD 4X6CB 5CGMA 3HUJE 1IAIM 5I19L 4GAJL 5GJSL 3VXSA 3SQRA 4ZS7H 4IGBC 1N5YL 3JBG7 5JHAA 2CLVA 3GSUA 4NXSA 4EN3D 1Q1PA 2VMFA 4MJ2A 4NNPH 3X3FH 1AQ8A 1DQQB 1U93B 4E0RA 3PP4L 3CFMA 1NGYB 3TBWB 1TJMA 4ALAH 1ET5A 1R6VA 5T1LD 3POCA 4C56E 4BD4A 4X9GA 4HJ0D 4KK8C 5BRZD 3WHE1 3CHQA 2F2HA 2R0LH 2DQGH 2Z31C 1LVEA 1QPXA 3FQ1A 3QEUA 4KHTH 4UYQA 5F71A 1NUFA 5FYJH 1QBLL 1FE8H 2M1KA 1R3JB 3GMQA 5EU7C 4I8DA 1INEH 2X4QA 2YR3A 1IKNA 3P3SA 3SDYL 4KI5F 1UXWA 2GY5A 3U7AA 3T1FA 2GIMA 3U25A 3M17A 3HBGA 4BCXA 4KAQH 1KOAA 1TQUA 3VG9B 1FGVH 3IT8D 3PAUA 4XVJH 1CYWA 3ENEA 1F4WL 4TNEA 2J6EL 1BD2B 4O2EA 2XWCA 4PP1D 4YDVA 2FJUB 5EBGA 3P0VH 1ET7A 4PJGA 4Q9BA 4RZKA 4ABWA 1FFOB 4LSTH 5B38A 5E0QA 1G6RB 4O00A 1CXKA 3IAPA 4TLKA 4WQOA 2YPLD 4WJKB 5ILTL 5T3ZE 2QQKL 4AJVA 3VD4A 3EJSA 4Y4KD 3ZVVA 1U3HB 1B4JH 3CDGB 3WN5C 5I6LA 1RAMA 3ZHLA 5IQNA 2NR6A 4YBLC 1NKRA 1DZ0A 5KVFH 5DWUH 1WVZA 5L8JB 4B0MB 3LD8C 4APQD 3HB3B 4L9DA 3U0WH 2Q8AL 3ZT5A 3ESVF 2BRRL 4OGYL 1BGXH 1GRWA 3ESNA 1DJZA 1QEWB 2LVCA 2NTSP 4UILL 2BVQB 3MA7A 1TITA 4CNIA 4RA3A 5LXVA 4JZOA 1LO0L 4HBQA 4UQ2A 3EXLA 1P2CA 1TJGL 1G1OA 1XAKA 3MNMA 4OZFA 4AW4A 4M6NL 4C83B 2ED7A 1GR7A 1HINL 3EG9B 4QHNB 4PWIA 4CL7A 4DUWA 4F7CA 1S7VB 4FA7B 3VRJA 1MCLA 1PZSA 3GB7A 4H8WH 1DBBH 4JFEB 4DF9A 5JPNB 5KJRL 1GL4B 2AEQL 4WY7H 1ZSDA 4K71B 4NNYA 5JHLH 1CGXA 4Y1AA 3GMPA 4QXUH 1YEDA 3KYOA 1S7RB 3QUKA 3WFCH 5JIKA 1J7VR 3T3PB 1D5IH 5D93C 2YD6A 2N7BA 3HHMA 5JO5B 4GKNB 4BELD 4IRSB 1D9KC 4MMYB 4AYEC 4U6HB 1HESA 2WLIA 5FKAA 4QF1A 4ZW7A 3SKOB 4I85A 2GTQA 1SRDA 5A2JH 2CR0A 3D07A 4UI2A 4BZ1H 4YLCA 2WXKA 4KKQA 1MFMA 3K5RA 4KNSA 5IHZB 3QDJE 4S0TD 4B41A 3BAXA 3L3IA 1XL4A 2UZXA 2AHIA 1FC2D 1I3GH 5IGXH 3IJHB 5D2NC 2OSYA 3BPLC 3OF6D 1CDHA 1XGPB 5HGBB 1W8EA 2E27H 3QFJB 1QFOA 3O81A 1HVXA 1PD6A 2CO2A 4MYWB 4OTXL 4QPEA 3I2CL 2VC2H 3LB6D 4MQXC 1ETB1 3PLYA 2F54A 3N1GC 5AYQA 3B3BA 4ANWA 3F7RA 2L04A 1NEZB 3QI9C 1O9VA 1SF5A 3BZ4B 4IS6B 2H1XA 4L18A 1JN6A 2WSDA 4LCYA 4U1MB 2UZYA 3P77B 1SN0A 4G80A 1EUUA 2JNZA 4CMHB 2D73A 5GRVL 1IAKB 4AGQA 3OAZH 5IP4A 3QUXD 2AMUA 4M8RA 3S5LA 4NRZA 2A74A 4UQBA 3QZWB 2WN2A 4PJAA 3WNNA 1BZ7A 2NCMA 3HCVB 1CJYA 4MYPA 1I9JH 2OW6A 3PWPA 2YGQA 4M02A 3M8OH 4WFFD 3LN5B 5D4HA 4M5SA 3FHAA 2HKHL 1F4XH 2WZ0A 3BW9B 4XPFH 5FYKE 3JT2A 2HG5B 1A7RH 1MCPH 3LIZA 2VLKE 4QHPA 2VDRL 4BBWA 2CWRA 2RD0A 1OP3H 1J10A 5C07A 2MCAA 1R3LA 1JPGB 4P2RD 1GC1H 5EU5A 1MPAL 1X7TA 1MCSA 3MUGB 1IGML 1U8LA 2FATH 3DUSA 4RMTA 4RQQB 4EUPB 2DN7A 2PO6C 5DJDB 4HG4J 4GT0A 4J39A 3PV6A 3VTAA 3KYMA 4W9DC 2VH5L 4PTTA 5SWZD 2CM5A 4IIQA 5DR5H 3N0AA 4AYBA 4O9HL 1N6VA 4LNVA 4P48A 2ZG1A 3VFGH 1JNHA 3P0YL 1MREH 3BP4B 3DIDA 3KPLA 3BKJL 2Y3AA 3HS0A 3ZMRA 4QOKB 1U3JA 3AB0B 5ICYB 4NX0A 4OCXH 3GMNB 4JFXA 4LEBA 1HQ4B 1KC5L 1KCVH 1DBMH 2ADIB 4PRHA 4QYOA 4PGEA 2RMNA 1MHPH 3Q2LA 4GFXA 4NBXB 5BQ7A 1BM7A 4XHJD 3H7BB 4X6BB 1IKFL 1U36A 4CVWA 3FONB 3VXME 3CDCA 4BIKA 2CRYA 2W38A 3RVUD 5J56B 3W39B 3BLPX 2OAAA 1A65A 3EDFA 3MXVL 3TGXA 4N0CC 4KROC 1CZ8H 2FYYA 2VLRE 3OKEB 4NO3A 1I3UA 2NY1C 1ZT4A 4OZ4A 3E9UA 3I6SA 1NCAH 2CCWA 4HEPG 4MLIA 3TV8A 3SQBB 4EN3B 1LDPH 1L0PA 1ZIBA 1KPRA 5DQJA 1KLFA 3S3CB 4LK4A 1QATA 1BBDH 5HHMD 1Q1JL 3VYPA 4LIQH 3REVB 4GMSL 1FFRA 5EU6A 3RWHB 3C9NB 2QT6A 3TYFB 5D4QA 2DQFB 4TQ8A 4DW2H 1PDKB 2W59A 2FK9A 4Z76B 1HAUA 5T1LB 1G1YA 1A9EA 3T0BA 1I7TA 5BRZB 2JI3A 1P5UA 3NZ8B 3PQYA 3L3GA 4HUNB 4H25A 5DJ0A 4GG6B 1OGAA 4OH2A 2R1XB 5K39A 3UAEA 4J23A 5T1KA 4O2FA 4FNPA 3SBPA 3DRTB 3QJUB 4PJEA 5GRYA 4F7EB 3BPCA 2YEZB 1EAJA 4HC1A 3V7AG 4HUWA 1K4CA 3K6OA 3O41B 4EDXA 2XNAB 4X4XB 1Q72L 2XN1A 2ZP9A 1T80A 1L9SA 4LLVA 5AB1A 3WO3B 2NW2A 1T4KB 2GQHA 2A73B 3ECVA 3IGFA 4NKMB 4Z95H 4Z9KB 5CKAA 3MDJA 3ZTEA 1ORSA 2J5WA 5ICXA 1MCHA 4GXVL 1JPSH 1CU4L 3RWJA 5D6CB 1RQ5A 4XCFH 1BVLA 1AZNA 1DN0B 4Z7VA 1AKPA 4EI0A 1OGPA 2DQDH 1L7IL 2JFCA 5D93B 2DKMA 2ZX6A 2PP7A 4KI5C 1OSZB 2J2ZA 2Q3ZA 4CW1A 4OZGB 4KKAD 2IDQA 2X6MA 1GPOH 3LNGA 3B4NA 2EILB 3GEFA 2CLZA 3BSHA 4M48H 3PG2A 1B4RA 4Y5VA 3SCMC 5GS0D 1NDGA 5BPPA 3BIAX 3BH8B 1J8RA 4XP4L 1J8HD 3D39E 4EZLA 4Q9QL 5JW5A 4Q58C 5AAWA 4F7PB 1CBJA 2BX5A 2OR9H 5C0GB 4LFHD 5B39A 3UCQA 3N55A 3CFEB 3OB8A 3EGXB 2H2PC 1SJEA 4ZS6D 1HHJA 4J3OD 5K5YA 5B4MC 3QNFA 5FGRA 1D5ZB 4L3EA 1RU9H 1ZJAA 3DMMC 2XZZA 2V2XB 2XWXA 5CGYD 3RRQA 2B1AH 4JFDB 1HU8A 4P3WA 5CWSA 3L2MA 1U8HB 1FYTD 1P5VA 1W0YT 4LSSL 4YHML 5J12B 2K3TA 3AWEA 4AMKL 2PCFB 2HZHA 2VDKB 3C60C 3CWGA 3VW3H 3PL6D 5EEWA 2ZNXA 3FCSA 4X6EA 4P2OC 4XPAH 5DUPL 5SWQA 4B9GA 32C2A 2K1MA 4L3AA 4HPOL 1IE5A 2H3XC 2VXSL 3DHUA 1FAKT 2HFGH 3Q8CA 3RUGA 5EIQA 2CRZA 1BREA 3LS5L 3T0VA 4JM2D 2F8XC 1ZS8B 3LNFA 3RBGA 3HAEH 2KZWA 1NOAA 3F01A 2X9ZA 1NM9A 3W9DB 1O5DT 3MLZL 1ZSHA 3QB7C 3WFHA 5BV7C 3VXPB 2BERA 1KIUA 4FTDA 1VGKB 1I7ZB 4OCNC 5AL8A 1XH1A 3I9PA 1AYOA 4IRJA 1MFVA 5LNGA 3HTLX 3MBXL 2IXQA 3RWEA 3TNMB 4KVNH 2X7LA 4MNGA 3QXDA 1X5ZA 1ZLDA 1II4E 4NIYE 4GAGL 3K6IA 1Q9OA 3SJVA 1UZ8B 3IETA 5IHUH 5LG6A 5E2VL 2X3CA 3U48A 1F11A 3N40P 3FB5A 3I75B 4JRXD 3L3KB 5CXPA 5SV3A 5CO1A 3TA3C 3LH2H 3Q3GA 2YUZA 4LF3A 1KB9J 2WQSA 1CL7I 1NCHA 4FP8H 3K4DA 5JMRA 4PJ8A 3LKQA 4OCMC 1FLRL 3DTXB 3CDYA 4YPJA 2D7MA 1HOEA 1TZOA 2HJLB 2ZXAA 2P28B 3MUHL 4JQXA 3ULUF 1XZWA 1N12A 1OL0A 4G9FE 4EDWL 5G4OA 4F8QA 3LZLA 4AGPA 4ICWA 5TF1H 3RJQB 4KK6C 4PJXA 3O3DB 5L7XL 1MDAA 3KBHE 4PTUA 1BMZA 2OBGA 2M26A 2JTYA 2EYRB 1WEJL 1R5VB 1FORL 3ZDYE 4N2EA 1ZHBA 5D1ZC 3T77A 4XNDA 3U0PA 2X10A 3AY4C 3GUFA 1GYVA 3ZT6A 3DARA 1HWHB 4P2RB 3L1FA 3VXOB 2HVKB 1G1CA 1JVLA 1ZVSB 1SN5A 4X6DB 1KELH 4R0LC 4KJQD 4ODTL 4YE4L 1OM3H 1M7DA 3TNNB 3G5ZA 5SWZB 4U6XB 1FIGH 3FT1A 1E2WA 3CSTA 5KVEH 3SPHA 1RIVL 4LL4A 3HFMH 3VFOA 5B1JC 4I9WE 4K7FB 5KSBF 1LMIA 1BQLL 5DYOB 1VLXA 5DHDA 3KS0J 2MPAH 5AOJA 1AGFA 5EUKB 1X3DA 5HHQA 4F7TA 1KIPA 1KCUL 1QNIA 1OGSA 5HI3D 1I9RH 1VADA 4R4BB 5D7KD 2FJHB 4N25A 4YNYA 1ND0B 2OP4L 5IF0B 3D0LA 4WK4B 3GJEA 4MDIA 3GGWA 3ZL4H 1FVDA 3WIHA 3CFCH 4W9HC 5MI0C 2E7LC 2ETWA 4NUMA 4UQ3B 2WLKA 4DZBA 2X9XA 2X2UA 5L9DL 4F80A 2YAQA 5MEND 3KDMB 2QSCL 1IIIA 4NN7B 1RULH 4PHXA 1DLFH 1HSAA 1TLMA 1U6AL 3BT2L 3DJZA 4MA3A 3GMRB 1AAJA 4L3FA 1HHGA 3MX0B 1D7DA 4NENA 3BLBA 3FF8A 2OSWA 2ARWA 2AV1B 5TDOB 2L7JA 4XR8C 5HHMB 4GJTB 4YR6A 4I5BB 2QLVB 2ORBL 1XSJA 3HN8A 2ADJA 3KD4A 5MHSE 4XBGA 4L23A 2BVYA 2HKAA 4LGPB 1RMFH 1N0XL 1J0YA 2XZQH 2VDLH 5IFJB 2PPAA 4UM9D 4X5WB 2R69H 1XIWC 3WS6C 4M3JA 1QTSA 3T2NH 5F0PB 3CZKA 5ESAB 1TF4A 1I7UA 3MFGB 4YDZA 1KEGL 2EYSA 1DFXA 1EH9A 3WYRA 5I1CH 5EU3B 3VRLE 4OLXH 5C09E 3VXTA 5KYUA 1BSIA 1AXSB 2CDGB 4ZYKB 2Y7MA 2Z7WA 3MKKA 4HJTA 3ZR6A 3PDOB 3VXUA 2X42A 2C9SA 4MD0A 4Y16A 2CE6A 3UAFA 1CE6A 3UIZA 3V5DB 1I75A 1CGYA 4P2OB 1TLKA 2K6WA 5I76B 1PCXA 4PV8B 2E3VA 1QFWH 2NOYA 1M57B 4P9HL 3Q43A 3RVTC 4M5ZH 2N56A 4X9BA 5IMMA 3KAAA 2XI9A 4MJHA 3X3GL 4JY5H 1GTFA 1JZ4A 3CSPA 5CAYB 4MD5B 3OHXA 2IH8A 5EBMB 2DI8A 2ZOOA 2A6JB 4H8VA 4H7VA 4EQ3A 1KWGA 2UXVA 5HY9A 2GSIB 5C0RL 5BZZA 1KYDA 3LHPL 3IDIA 3UG4A 4G7YH 4X7CC 3WO4B 1Y0LB 2ZXEB 3MLXL 1C08B 4KV5E 5IKCB 3A67L 5DEFB 1YDPB 4Y5XA 3GXDA 4PRPD 2XXCB 4YHZH 1QBAA 2DM4A 4TNVF 2R23B 2A4EA 5HYJD 3WKML 4JHWH 2ZUTA 5CJQH 2DEXX 3NA4A 4R4FL 4ZTEA 3PY9A 2I5YL 2ENJA 1CGVA 1I8IB 1REIA 2TAAA 4ZFQA 3TA3B 2R59A 5GS0H 2ZUQB 4G7QB 3QNYB 1I85A 3DYPA 1FYTB 4TN9A 4YK4B 3RA7L 5IOKA 4WENB 5J57B 5GS1C 3P3YA 1CDBA 1RK1A 2Z8SA 4NQEE 2MNWA 3FFDA 3MR9A 2AKRB 3A22A 5FC9A 4PJHE 5FWQA 2WZ6A 4K7PX 1E5ZA 1E8YA 4FFVD 3OX8B 2Q8BH 1YCSA 1YNTF 4TULH 5JQHC 1USQA 5JNYA 3CIAA 4PWGA 3ZDZE 3MJWA 3LV3A 2VDPH 4MMXA 1S5HB 4KMQA 4O02H 4A7SA 4JM2B 4LU5L 1SM3H 4TUJA 4DIXA 3MRDB 3L95B 4NNXB 3QDME 2NSQA 2N3JA 3FN0H 3QRBA 4IBTA 5K93A 3MUZ1 4OVUA 4UT7H 4PJBB 4FJZA 3EYVB 3QXTA 1T1XA 2JVUA 4KJYA 4EE2A 4F15C 1OSPL 2C9AA 3HKFA 3SPVA 2VW4A 1NFAA 3RL1B 3V4VH 3B1UA 3B9EA 5AG8A 2DQUL 1G7IB 1WZ1L 1OAYH 3P11L 3VXRD 1FVEB 2X12A 3DJTA 5HVGB 2I26N 4GAYA 4Q6IC 3JUYA 3B9DA 1SUHA 4AG4H 1A6UL 1YMMA 3N04A 2YWYA 3FN9A 1J05B 2EADA 3G6JE 2QDWA 3GZPA 1UB5B 4GIAA 1LP9B 4F3FA 4JRXB 3QIWD 4XN4A 1DSYA 1R5IB 3F7VB 4LLQB 3PGFL 4S1QL 2AERT 2NXYC 4XN8A 3ARBD 4GKSB 3WSQH 4Z77A 2WLNA 1K8DB 4E9VA 3MRQA 3X1NA 1RUKL 1RJZB 3I9GH 2K8MA 1XTLA 3PWJA 4PS4L 5C6TH 2QHRL 1AD0B 5MI0B 5A6LA 1LE5B 3LTVA 2FTAA 1FPTL 1AP2B 4AUJA 3VFPA 1UVQA 4NAJA 3P4NA 2FL5A 1KYOJ 4KNUA 3HZKB 2FBOJ 3QWNA 3RWFA 1SHWA 1ZE3H 5E9DA 3GBNH 4KUZH 2NUTA 3OBAA 1QFHA 2M8XA 5EA0H 1M6UA 1MZYA 4Y9FA 2G2RB 3L6FB 3VDBA 1NJ9A 3ULUC 1WAEA 1RZGA 1WFUA 4G6MH 5LGHH 5DGQA 4ZFOB 4HUUA 2YMOA 4XN2A 4MCZB 1VFAB 4RX4A 2R4RL 4M1GL 3NZHL 5GGSA 5IVOA 4P5MB 1RH8A 2A6DB 4J27A 4JCWA 4MZ3A 1KJ2L 3AXLB 2J55A 2IPKB 4QRAA 4PY8I 1XF5B 2WLHA 1Q4NX 3D85D 5ELIA 4HXBL 3HPJA 3QQDA 1T83C 3F7PC 2OK0H 4DP2X 1U8NB 5HD8D 5F3HA 3G6AB 4P4KC 4KRPC 1ONQB 3VH8A 1X5XA 3MRGA 2BDNL 4XZUA 3Q7JA 1A0QL 3NYKA 1QEXA 4AYSA 1EWHA 4B60A 3WU1A 1A4JB 4LAQH 3BAKA 2KH2B 3BFOA 4GG8B 1X4XA 2DLGA 2PWGA 3CFBA 4NT6B 3ATAA 3ZE1B 3MA9H 1ETZB 1NANH 1Q9LA 4NPKA 1XGTB 4PU2A 4D9LH 3GTVA 5I75B 1CQKA 3EHBD 4BEIA 5FK9A 1F45A 2H1PH 3BOVA 1R75A 4FKEA 1TJHH 2NLJA 2ENQA 2W0FA 1KV3A 4N8PA 1KDIA 4HLJA 2GTWA 2IAMA 3SBQA 1YY8B 5D2LE 1I1CA 1NFDB 1QD0A 4MKMA 4U1SB 4UAOC 1YNLH 5F1SA 1R5WB 1F4HA 4R26L 4HC1L 1KGWA 3ZKQD 2CHNA 1U8OB 1ASPA 3TX4A 3S8GB 1FP5A 1KCSL 3NIDB 2WLJA 4R97B 2A38A 1KPUA 2W60B 4NM8H 2A7BA 2WTRB 4DHLA 2IG2L 1Z5LB 4CKQA 5CJXA 4B0MM 3MOAH 4JRYA 4YBHA 4MJ6A 4UM9B 3HPLA 4WUUA 1I1RA 2ESVE 4DVBA 3O8XA 2MQ3A 4UANA 5ABDE 1J5CA 4OM0L 1FL5B 4AV0A 1ZCRA 2ZUSA 1Q0EA 2ZYSA 1S6NA 4GAAA 5C1MB 4G82A 1HS6A 2OL3B 2VZSA 2Y22A 7PCYA 1S7TA 4QO1B 3BUYB 1DBKL 4N6RA 1F4YH 2NXZC 5ITFA 4XCYB 2UWEF 1D6VH 1K5NA 4MHHI 4AIEA 3HC0B 1I4FA 5L88H 3G5YB 5GGQH 5B1KA 1KLUA 3T0EE 3O6MH 1ZA3B 1J86A 4J3WA 1KEML 1F8TH 4W4OC 3DYMA 5EEZA 1NIBA 1LEIB 2CH8A 5CZXD 3SKJL 1YPZF 3IDYB 1N19A 3RVWC 1MZZA 3AQXA 3HIZA