4Z27A

Crystal structure of apo short hoefavidin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
124
structure length
124
Chain Sequence
b'DMKLLAGASNWVNQSGSVAQFVFTPSPTQPQTYEVSGNYINNAQGTGCKGTPYPLSGAYYSGNQIISFSVVWSNASANCQSATGWTGYFDFSGSQAVLKTDWNLAFYSGSTPAIQQGQDDFMQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avidin family
publication title Hoefavidin: A dimeric bacterial avidin with a C-terminal binding tail.
pubmed doi rcsb
source organism Hoeflea phototrophica dfl-43
molecule tags Biotin-binding protein
total genus 28
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4z27A00
5IRUA 1SWRA 4GGZA 5K68A 4Z6JA 2C1SA 4BBOA 1SWCA 1VWJB 1Y53X 4Y59A 1HY2A 3RDQA 1VWCB 3EW1A 4BX6B 1STRB 2RTAA 3VHIA 4Z2VA 2A8GA 1RAVA 4CPIA 3SZHA 3MM0A 2MF6A 2RTNB 4JHQA 1VWLB 1N4JA 1N43A 2WPUA 1LDOA 2JGSA 2A5BA 1NQMA 1SWSA 4BX5A 1Y55X 2OF8A 1NBXA 2RTDB 1MM9A 2Y32A 1RXJA 3WZQA 4GGTA 1LCWA 1SWJA 5CHKA 1KFFA 4BX7A 1SWEA 2RTRB 4CPFA 3WZPA 2IZEB 1LUQA 4DNEA 1RXKA 1SLGB 1PTSA 2QCBA 2Y3FA 4GJSA 5IRAA 3RDXA 3T2XA 1WBIA 2CAMA 2IZAA 2IZKA 5B5FA 4GDAA 3T2WA 2C4IA 4GJVA 4CPHA 2RTGB 1SRHA 1NQNA 2IZHB 3RDOA 1VWFB 1AVDA 1VWPB 1LELA 4I60A 5K67A 1MOYA 1AVEA 1STSB 1SWLA 1VWIB 1LCZA 3WYQA 3WYPA 4BCSA 3RY1A 1N7YA 3VHMA 4CPEA 3RE5A 1SREA 5F2BA 1MK5A 4Z2OA 4JNJA 1SWOA 3RDSA 1SWPA 1KL5A 2IZLB 2RTIB 3RDMA 2RTQB 3PK2A 3T6LA 2OFAA 2FHLA 3FDCA 1VWGB 1RSUB 1VWEB 4OKAA 2RTOB 1SWNA 2F01A 1RXHA 1DF8A 3VGWA 1IJ8A 1SWBA 1VWKB 2IZBA 1SRGA 2FHNX 1N9YA 2BC3A 4YVBA 1VWRB 1KL3A 1RSTB 2IZCB 2IZGB 1Y52X 2RTJA 3SZJA 1SLFB 2OFBA 1SRJA 1N9MA 4Z27A 4BX6A 4BJ8A 1LCVA 1SWAA 3RE6A 2IZFB 5IRWA 1VWQB 2RTKA 2G5LA 5JD2A 4JO6A 2RTCB 1I9HA 1VWOB 4Z28A 2RTEB 1SRFA 4EKVA 2IZIA 4CPHB 1SWDA 1NC9A 2OF9A 1VYOA 2RTPB 4IRWA 2UZ2A 5L3YA 1SWTA 3RY2A 3WZNA 2ZSCA 1VWHB 1VWMB 3EW2A 1HXLA 3WZOA 1SLDB 2C1QA 5B5GA 1SWGA 4GGRA 1SWHA 4Z2PA 1NDJA 2AVIA 1MEPA 1SWUA 2RTHB 2IZJA 2RTBB 1VWDB 4BX5B 1VWAB 3X00A 3RDUA 1VWBB 1HXZA 2GH7A 3SZIA 1SWKA 4U46A 2A5CA 1LDQA 4GD9A 1SRIA 2RTFB 1STPA 4BX7B 1SLEB 5CSEA 1VWNB 1HQQA 3VHHA 2Y3EA 1SWQA 2IZDB 2RTLA 2UYWA 1KL4A 2RTMA 1SWFA 3T6FA 4Y5DA 3MG5A
chains in the Genus database with same CATH superfamily
1ICMA 1TOWA 5FENA 2A2GA 2OY1O 1EPBA 1SWRA 4GGZA 4Z6JA 3WJBA 5FFHA 1TVQA 1WUBA 3HOLA 1OPAA 2FWVA 1SA8A 4IB8A 2BSZA 3RDQA 4XMHA 2G79A 1MVGA 1STRB 5B11O 1I05A 1JMZA 2HZRA 3C77X 3FELA 1SY0A 3KFFA 3CQNA 5L8IA 5B2AO 3VG4A 1BM5A 1EUOA 5KHPA 2RTNB 4JHQA 4I9SA 2F73A 2WPUA 5D45A 1LDOA 4QAEA 4UU3A 4AW8A 4ON1A 1I78A 2OF8A 2R56A 2JN3A 3TZSA 4O4OA 1MM9A 5FQ8E 1B8EA 1EPAA 1RXJA 4MVIA 3TGAA 3ZW1B 1CBQA 4CSBA 5LJBA 3ZI8A 3KQ0A 5HZ5A 1W4TA 4NV8A 5EZ2A 5AEOA 1NP4A 3WZPA 1X8QA 2QCBA 2HLVA 2Z4IA 5IRAA 2CAMA 1VYFA 4C5PA 5LKEA 4GDAA 3NX2A 4IMNA 2RD7C 1ACDA 4OS0A 1LPJA 5LJDA 3T2WA 1DZMA 1MUPA 4HPCA 2RTGB 1K3BA 2LBAA 3VU1A 1BJ7A 1QFTA 4I60A 5K67A 3D95A 4WFUA 2HMBA 1RBPA 2AMMX 1LIDA 1QY1A 4TLJA 1AVEA 1VWIB 3F8AA 5D4AA 4BCSA 1W6FA 3VE1A 4AZPA 3NR3A 3FR5A 3VHMA 3RE5A 5F2BA 2RCQA 5F6BA 3RDSA 2RQ0A 1FENA 2RTIB 4ZJ0A 1UYNX 3QKGA 3P6EA 2L67A 2LA7A 2NNEA 4LKTA 2FRSA 2KD2A 4XMGA 2M4LA 2FHLA 3NQKA 3VG5A 1VWEB 2E4JA 4O9SA 4MISA 4JGLA 3JQOA 3FENA 1SWBA 1VWKB 1QY2A 4KT5A 5BVSA 5BVQA 2IZBA 2FHNX 1KOIA 1HN2A 1NP1A 4O3ZA 2I5VO 1VWRB 5HZ8A 1JQPA 4OS8A 5LJHA 1E5PA 2ACOA 5C0NA 2IZGB 4MIRA 4U3QA 1KQXA 4AZMA 3WJCA 2OL8O 2X34A 1OEKA 2FR3A 3D4RA 2A2UA 2K23A 2W2BA 3PDFA 5F7GA 1IKEA 4BX6A 4KH8A 4ZHCA 2GTLN 1EIOA 3Q6LA 1IKJA 4OEMA 2MM3A 1VWQB 2RTKA 1FEMA 1S44A 1BEBA 1JJUA 1RLBE 4ZR2A 3RKGA 1D2UA 1Y9TA 1VWOB 1GM6A 2LBVA 3IFBA 1NC9A 2QO5A 1LF7A 1VYOA 2UZ2A 5EPQA 4D6BA 4RUUA 2CBSA 5LKFA 4FBVA 3MVFA 3MX7A 2OL7A 1IFBA 1SWGA 1YWCA 2KTDA 1SWHA 2CM9A 5IO6A 2CBRA 1OPBA 3WXQA 5B10O 1SXYA 1MX7A 2AVIA 1SWUA 3WOVA 2RTHB 2JOZA 3S5XA 3BRNA 4YKOA 2Q9SA 4KCAA 4ID2A 4CDFA 2GH7A 1X8PA 5HZQA 3TF6A 3TGBA 1LIFA 3HWEA 1QG5A 1H91A 2OY8A 2A5CA 1P6PA 1ALBA 1ZRYA 3PPTA 2RTFB 1BRPA 3K3LA 4ORWA 4YGZA 5CSEA 4NNTA 1Z24A 4EQAC 3VHHA 2GC9A 3PECA 2GTLM 2QMIA 2QO6A 2Z4HA 4PJ2A 4QGWA 2VFCA 2WWPA 5H9KA 2QM9A 3CBCA 3O19A 3EMMA 5HCDC 3T6FA 4YKMA 1DZKA 1SXXA 4IAWA 3ZWEA 4HPBA 4BBOA 1A57A 1HY2A 3EW1A 3P02A 1HMSA 3H3IA 3L4RA 3VHIA 1DFVA 4ZH6A 4LKPA 5LJGA 4OMWA 4CPIA 3VG6A 2L9CA 2MF6A 5HTEA 3VG2A 1VWLB 1N43A 4MEEA 3APUA 1KT4A 4YDAA 1OEJA 4ZHGA 1NQMA 2Q39A 3FW4A 2L68A 4I95A 2JU3A 4BX5A 4ZGFA 3U03A 3WJEA 4FQBB 4TKJA 2POAA 1NBXA 1GT4A 4IBAA 4A8ZA 3ZW0B 1B0OA 3AKNA 2ALLX 4ML7B 3CKFA 4FGIB 3FEPA 3BSZE 3UEVA 5D47A 1SWEA 2F09A 3DTQA 3ZUOA 2IZEB 1LUQA 3FA9A 1BRQA 4NV7A 2IZAA 3P6GA 4WFVA 2GTLO 1G7NA 4GJVA 3BX7A 3IA8A 3FA6A 4CPHA 3FR4A 1KT7A 2MWHA 1BSQA 3C78X 2ZAGA 4ORUA 4N7CA 3VPJE 5HZ9A 1AVDA 1HMTA 1GGLA 1QQSA 4Y0PA 2G78A 2N93A 1SXWA 2X8SA 4INNA 3NX1A 3WYQA 3WYPA 2HZQA 4CPEA 1VPRA 4XMCA 3AKMA 3PP6A 3FLLA 2PI3O 4I3CA 3UEXA 1LIBA 5DG4A 1ZNDA 1B4MA 1JV4A 1X71A 3PK2A 3CR6A 4WBKA 2OFAA 1AELA 2AL0X 3B2KA 2FS6A 3SLTA 2RTOB 1ZNLA 4QYNA 4LQZA 1IJ8A 2X8TA 4CDCA 1DV9A 4ORSA 5AQ6A 3ZW2A 1G74A 2X55A 4IABA 4YVBA 3EBKA 4GH7A 4AYHA 3JS1A 4ZFXA 2IZCB 2CZTA 4LZUA 4MVLA 4HPAA 4I3DA 1ZNGA 1LKEA 1Y52X 3P6FA 1D3SA 1GX8A 2AH7X 3SLOA 3STNA 3SZJA 4BVMA 4YFRA 1SRJA 5LJCA 1JJJA 1N9MA 5CE4A 2FTBA 1O1VA 3B2LA 1LICA 3QQ2A 3RE6A 2IZFB 5IRWA 2JU7A 5HCCC 4JO6A 2RTCB 1I9HA 4Z28A 4XMDA 1KZWA 1DZPA 2HKDA 2XKLA 4QGVA 4IRWA 1YWBA 2OF9A 3NADA 4GDZA 2OVEA 5L3YA 3EW2A 2WQAE 3CMPA 3WZOA 4CK4A 2FLJA 3ELXA 4R0BA 3B2IA 5EEDA 1HMRA 3B2JA 4Z2PA 1JYDA 5H9LA 5CYBA 2RTBB 3FYFA 3V8UA 1NGLA 3F9DA 1SWKA 1SY1A 1LDQA 4O3XB 1YUPA 1SRIA 3P6HA 1STPA 4M7MA 1A18A 4B55A 1N0SA 3OD9A 2OFRX 4AZNA 4BX7B 4YMYA 3S5VA 3WJGA 4ORRA 5FQ6E 4YBPA 4CDDA 3STKA 1SWQA 1T68X 1T8VA 1U0XA 2RTLA 2UYWA 1YWAA 5DPQA 5FAZA 1LFOA 2MO5A 2OVSA 1I4UA 5BVTA 3TGCA 2LB6A 1T0VA 1OBUA 1YP6A 5IO7A 3HTYA 4ALOA 5KIDA 3CQRA 1CBIA 2NNQA 4KC8A 5K68A 2C1SA 4IB9A 1VWJB 1Y53X 2JU8A 4N7DA 2ANSA 2WR6A 3S26A 1UZ2X 1OBQA 2AT6X 2MHDA 4BX6B 4Z2VA 2A8GA 1RAVA 1HBQA 3FW5A 1ZNHA 2EU7X 3HWDA 1XKIA 1IIUA 4HWMA 3MM0A 3SAOA 4TJZA 5HTDA 1CJ5A 4IMOA 3ZQ3A 2PY1A 2KTSA 1X8NA 2ASNX 3LHNA 1G85A 3BU1A 2JGSA 2A5BA 1HBPA 4A1YA 1EIIA 3KFIA 1SWSA 4I6SA 1S2PA 4ZGUA 1Y55X 2VFBA 1GX9A 2Y32A 5KICA 3NQ9A 4GK9A 3AEHA 1GKAA 3WZQA 4EXZA 1G5WA 4HFOA 1SWJA 1TXLA 4MVEA 5CHKA 2RTRB 3F6ZB 4YBUA 1DZJA 3PEDA 4YFPA 4DNEA 2Y3FA 1PTSA 3RSWA 2BS6A 1R0UA 4GJSA 3RDXA 3T2XA 3ZUIA 5B5FA 4CV7A 3PH5A 2IZKA 2BLGA 4GNWA 4NNSA 2R73A 3HWGA 2LKKA 4QQ1A 5K06A 1OBPA 4GUZA 1GT3A 4I9RA 4IAXA 4BX5B 2RCTA 1YP7A 4QZTA 2WQ9A 1E02A 2JMBA 1A2DA 5AJCA 4FBRA 4ES7A 5EEEA 3T1DA 3Q34A 3BU9A 1LCZA 1JJXA 1K24A 3RY1A 3FIQA 1MK5A 4Z2OA 5H9NA 3ELZA 1FDQA 3NQ3A 3U9PC 2RTQB 3T6LA 2GTFX 3WJDA 3GAQA 3FDCA 1VWGB 2QOSC 4ZCBA 4QYPA 2NP1A 3HOEA 4EDEA 1KQWA 2HNXA 3U0DA 5F1EA 1RXHA 2AKQA 1PEEA 3ZW0A 1ERBA 2W2FA 2FKJA 2A3FX 4QNIA 1B56A 1FELA 4WHIA 1XCAA 4OELA 1YIVA 1I06A 2FKGA 4MVKA 4FBOA 4HPDA 2X32A 4O4SA 3RWXA 2A13A 4GRJA 4U8UN 4D6AA 3OE3A 4AZOA 4Z27A 3P6DA 2W2AA 4NYQA 4BJ8A 5IXGA 3UEUA 4GZVA 4KIIA 1GT1A 1ML7A 2G5LA 2LFOA 1QWDA 1TW4A 3CBSA 3GE2A 1S7DA 4GETA 1CBSA 2OVDA 3BDRA 4A60A 4TKBA 5EDBA 2RTEB 4Y0QA 1MDCA 4QRLA 4YH0A 1U17A 2IZIA 4CPHB 4EKVA 1SWDA 2WUTA 3B2HA 4BQUA 1SWTA 2CZUA 4IB7A 2Q2PA 4XMEA 3PQSA 1SLDB 5B5GA 2K62A 3APXA 4GGRA 4O4XA 4O4UA 2VDFA 1IW2A 5BYPA 1EALA 1MEPA 2QOMA 4GKCA 2GJ5A 1BSYA 2FGSA 3BLGA 1SXUA 5LJEA 1CBRA 1KT6A 1VWAB 1BSOA 5HAEA 3LV4A 4NYRA 3BX8A 2WSJA 2X4MA 3P24A 4YGGA 4ZHHA 1KT5A 1MX8A 5L8OA 1I04A 1UYOX 3CWKA 4GD9A 3WZNA 4GU8A 3APVA 4O3YA 1SY2A 2R74A 1HQPA 1SLEB 4U8UM 3SOTA 1EW3A 4K19A 2AT5X 3EBWA 2DJFA 5HBSA 1VYGA 2X46A 3G7XA 2OYBO 4AZQA 2OVAA 1KL4A 3VG3A 4DQ3A 2G7BA 4Y0SA 1PBOA 2RTMA 1SWFA 2ZAIA 2X8FA 3MBTA 1X89A 4ORXA 3MG5A 4Y5DA 1O8VA 3OJYC 1PMPA 4TKHA 5IRUA 2OY5O 3S60A 3FEKA 4ORYA 1SWCA 4Y59A 2MJIA 1W5RA 3APWA 1VWCB 2Q2MA 2RTAA 1X8UA 5D48A 4RUNA 2OZQA 3SZHA 4EFGA 2CM4A 5H8TA 1E00A 3FR2A 4YGHA 4ALBA 1SMPI 1FJ1E 1N4JA 2BT9A 4NLIA 4QZUA 1YWDA 4NW4A 2KW1A 3HPEA 5D8JA 2OY7A 2RTDB 1ADLA 2YMSA 1KZXA 1JYJA 2X56A 1GT5A 4GGTA 3N91A 1LCWA 3KVNA 1Y0GA 1EI5A 1KFFA 1OSPO 1PBYA 4BX7A 4CPFA 1KT3A 2Q4NA 3EYCA 1RXKA 1SLGB 3O2YA 4U8UO 5IO5A 1OEEA 2AT3X 2OFMX 2X45A 3P6CA 1WBIA 1EXSA 5B27A 3SLJA 2C4IA 2WEXA 4UU2A 1Y9LA 4XMFA 4U9CA 4YDBA 1SRHA 1NQNA 2IZHB 2IFBA 4O49A 3RDOA 1GXAA 1VWPB 1JIWI 1VWFB 1LELA 2P8GA 3JSQA 3FIDA 4IB6A 4CDEA 1MOYA 5HCEC 3STMX 2L5PA 1LIEA 1STSB 1SWLA 1FE3A 4O3WA 2RA6A 5HWZA 3RBYA 3ZW1A 1N7YA 1SREA 3D96A 4JNJA 1SWOA 3KZAA 5B3MO 1DC9A 1SWPA 2FR2A 3EC5A 3KFHA 3OBLA 1AVGI 3NBXX 1KL5A 1UREA 1FTPA 2IZLB 1L6MA 3D97A 3RDMA 1QY0A 5B29A 2AT0X 4GNYA 4OS3A 1X8OA 4TNNA 4OKAA 1RSUB 2DM5A 1A3YA 1QABE 2AT8X 4GE1A 1SWNA 4I3BA 2F01A 4DQ4A 1DF8A 5F6ZA 3VG7A 4M6SA 3VGWA 2BHVA 3I17A 4L3RA 1JZUA 1BLRA 2AF5A 1SRGA 1N9YA 2BC3A 4A1HA 1KL3A 2OL6O 1RSTB 1BWYA 4ODDA 3RZYA 5LJKA 4ARHA 3PQUA 2I5ZO 2JW1A 2RTJA 3EM0A 1LNMA 4DCBA 1SLFB 3D9WA 2OFBA 3E3CA 4YCHA 3FA8A 1GKAB 1KXOA 4OMXA 3UEWA 2FT9A 3HK1A 1E06A 4LZVA 1EQDA 3DSZA 3FA7A 1DF3A 3O22A 4KC7A 1LCVA 5HZ6A 1SWAA 2ACPX 5FQ7E 3UAQA 1PM1X 1JBHA 3PH6A 5JD2A 1ZNKA 1KGLA 1IFCA 3CKGA 4BGFA 1ERXA 1SRFA 3NPOA 2RN4A 2G8CO 2RTPB 4PSQA 3NP1A 2HYSA 5EDCA 2BS5A 5H9AA 3RY2A 2ZSCA 1ICNA 1VWHB 1VWMB 2NNDA 1HXLA 3KFGA 3LTWA 4QGXA 2QO4A 2C1QA 2YG2A 1U18A 1AB0A 5F58A 4ZHFA 1NDJA 2FS7A 1JMXA 3ZZVA 4Y0RA 1AQBA 2IZJA 3WBGA 2XSTA 3VE2A 3WVMA 2DJGA 1VWDB 4NLJA 1GX3A 2A0AA 3RDUA 1VWBB 4YCEA 3I0AA 3X00A 1HXZA 1SY3A 1CRBA 3BS2A 1BBPA 3SZIA 3FMZA 4L1NA 5AJBA 1E2TA 4U46A 4ZH9A 5L8NA 1VWNB 1HQQA 1O1UA 5HA1A 3HWFA 2WEWA 2Y3EA 1ZNEA 2O62A 4NP1A 4YFQA 3WJFA 4BOEA 2IZDB 5JR8A 4ZHDA 4TQ2A 1TOUA 5HA0A 3AUMO 4COTA 2KT4B 3BY0A 3C76X 4AZRA 4EEJA 1QFVA
chains in the Genus database with same CATH topology
5IRUA 1SWRA 4GGZA 5K68A 4Z6JA 2C1SA 4BBOA 1SWCA 1VWJB 1Y53X 4Y59A 1HY2A 3RDQA 1VWCB 3EW1A 4BX6B 1STRB 2RTAA 3VHIA 4Z2VA 2A8GA 1RAVA 4CPIA 3SZHA 3MM0A 2MF6A 2RTNB 4JHQA 1VWLB 1N4JA 1N43A 2WPUA 1LDOA 2JGSA 2A5BA 1NQMA 1SWSA 4BX5A 1Y55X 2OF8A 1NBXA 2RTDB 1MM9A 2Y32A 1RXJA 3WZQA 4GGTA 1LCWA 1SWJA 5CHKA 1KFFA 4BX7A 1SWEA 2RTRB 4CPFA 3WZPA 2IZEB 1LUQA 4DNEA 1RXKA 1SLGB 1PTSA 2QCBA 2Y3FA 4GJSA 5IRAA 3RDXA 3T2XA 1WBIA 2CAMA 2IZAA 2IZKA 5B5FA 4GDAA 3T2WA 2C4IA 4GJVA 4CPHA 2RTGB 1SRHA 1NQNA 2IZHB 3RDOA 1VWFB 1AVDA 1VWPB 1LELA 4I60A 5K67A 1MOYA 1AVEA 1STSB 1SWLA 1VWIB 1LCZA 3WYQA 3WYPA 4BCSA 3RY1A 1N7YA 3VHMA 4CPEA 3RE5A 1SREA 5F2BA 1MK5A 4Z2OA 4JNJA 1SWOA 3RDSA 1SWPA 1KL5A 2IZLB 2RTIB 3RDMA 2RTQB 3PK2A 3T6LA 2OFAA 2FHLA 3FDCA 1VWGB 1RSUB 1VWEB 4OKAA 2RTOB 1SWNA 2F01A 1RXHA 1DF8A 3VGWA 1IJ8A 1SWBA 1VWKB 2IZBA 1SRGA 2FHNX 1N9YA 2BC3A 4YVBA 1VWRB 1KL3A 1RSTB 2IZCB 2IZGB 1Y52X 2RTJA 3SZJA 1SLFB 2OFBA 1SRJA 1N9MA 4Z27A 4BX6A 4BJ8A 1LCVA 1SWAA 3RE6A 2IZFB 5IRWA 1VWQB 2RTKA 2G5LA 5JD2A 4JO6A 2RTCB 1I9HA 1VWOB 4Z28A 2RTEB 1SRFA 4EKVA 2IZIA 4CPHB 1SWDA 1NC9A 2OF9A 1VYOA 2RTPB 4IRWA 2UZ2A 5L3YA 1SWTA 3RY2A 3WZNA 2ZSCA 1VWHB 1VWMB 3EW2A 1HXLA 3WZOA 1SLDB 2C1QA 5B5GA 1SWGA 4GGRA 1SWHA 4Z2PA 1NDJA 2AVIA 1MEPA 1SWUA 2RTHB 2IZJA 2RTBB 1VWDB 4BX5B 1VWAB 3X00A 3RDUA 1VWBB 1HXZA 2GH7A 3SZIA 1SWKA 4U46A 2A5CA 1LDQA 4GD9A 1SRIA 2RTFB 1STPA 4BX7B 1SLEB 5CSEA 1VWNB 1HQQA 3VHHA 2Y3EA 1SWQA 2IZDB 2RTLA 2UYWA 1KL4A 2RTMA 1SWFA 3T6FA 4Y5DA 3MG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IRU A;  1SWR A;  4GGZ A;  5K68 A;  4Z6J A;  2C1S A;  4BBO A;  1SWC A;  1VWJ B;  1Y53 X;  4Y59 A;  1HY2 A;  3RDQ A;  1VWC B;  3EW1 A;  4BX6 B;  1STR B;  2RTA A;  3VHI A;  4Z2V A;  2A8G A;  1RAV A;  4CPI A;  3SZH A;  3MM0 A;  2MF6 A;  2RTN B;  4JHQ A;  1VWL B;  1N4J A;  1N43 A;  2WPU A;  1LDO A;  2JGS A;  2A5B A;  1NQM A;  1SWS A;  4BX5 A;  1Y55 X;  2OF8 A;  1NBX A;  2RTD B;  1MM9 A;  2Y32 A;  1RXJ A;  3WZQ A;  4GGT A;  1LCW A;  1SWJ A;  5CHK A;  1KFF A;  4BX7 A;  1SWE A;  2RTR B;  4CPF A;  3WZP A;  2IZE B;  1LUQ A;  4DNE A;  1RXK A;  1SLG B;  1PTS A;  2QCB A;  2Y3F A;  4GJS A;  5IRA A;  3RDX A;  3T2X A;  1WBI A;  2CAM A;  2IZA A;  2IZK A;  5B5F A;  4GDA A;  3T2W A;  2C4I A;  4GJV A;  4CPH A;  2RTG B;  1SRH A;  1NQN A;  2IZH B;  3RDO A;  1VWF B;  1AVD A;  1VWP B;  1LEL A;  4I60 A;  5K67 A;  1MOY A;  1AVE A;  1STS B;  1SWL A;  1VWI B;  1LCZ A;  3WYQ A;  3WYP A;  4BCS A;  3RY1 A;  1N7Y A;  3VHM A;  4CPE A;  3RE5 A;  1SRE A;  5F2B A;  1MK5 A;  4Z2O A;  4JNJ A;  1SWO A;  3RDS A;  1SWP A;  1KL5 A;  2IZL B;  2RTI B;  3RDM A;  2RTQ B;  3PK2 A;  3T6L A;  2OFA A;  2FHL A;  3FDC A;  1VWG B;  1RSU B;  1VWE B;  4OKA A;  2RTO B;  1SWN A;  2F01 A;  1RXH A;  1DF8 A;  3VGW A;  1IJ8 A;  1SWB A;  1VWK B;  2IZB A;  1SRG A;  2FHN X;  1N9Y A;  2BC3 A;  4YVB A;  1VWR B;  1KL3 A;  1RST B;  2IZC B;  2IZG B;  1Y52 X;  2RTJ A;  3SZJ A;  1SLF B;  2OFB A;  1SRJ A;  1N9M A;  4Z27 A;  4BX6 A;  4BJ8 A;  1LCV A;  1SWA A;  3RE6 A;  2IZF B;  5IRW A;  1VWQ B;  2RTK A;  2G5L A;  5JD2 A;  4JO6 A;  2RTC B;  1I9H A;  1VWO B;  4Z28 A;  2RTE B;  1SRF A;  4EKV A;  2IZI A;  4CPH B;  1SWD A;  1NC9 A;  2OF9 A;  1VYO A;  2RTP B;  4IRW A;  2UZ2 A;  5L3Y A;  1SWT A;  3RY2 A;  3WZN A;  2ZSC A;  1VWH B;  1VWM B;  3EW2 A;  1HXL A;  3WZO A;  1SLD B;  2C1Q A;  5B5G A;  1SWG A;  4GGR A;  1SWH A;  4Z2P A;  1NDJ A;  2AVI A;  1MEP A;  1SWU A;  2RTH B;  2IZJ A;  2RTB B;  1VWD B;  4BX5 B;  1VWA B;  3X00 A;  3RDU A;  1VWB B;  1HXZ A;  2GH7 A;  3SZI A;  1SWK A;  4U46 A;  2A5C A;  1LDQ A;  4GD9 A;  1SRI A;  2RTF B;  1STP A;  4BX7 B;  1SLE B;  5CSE A;  1VWN B;  1HQQ A;  3VHH A;  2Y3E A;  1SWQ A;  2IZD B;  2RTL A;  2UYW A;  1KL4 A;  2RTM A;  1SWF A;  3T6F A;  4Y5D A;  3MG5 A; 
#chains in the Genus database with same CATH topology
 1ICM A;  1TOW A;  5FEN A;  2A2G A;  2OY1 O;  1EPB A;  1SWR A;  4GGZ A;  4Z6J A;  3WJB A;  5FFH A;  1TVQ A;  1WUB A;  3HOL A;  1OPA A;  2FWV A;  1SA8 A;  4IB8 A;  2BSZ A;  3RDQ A;  4XMH A;  2G79 A;  1MVG A;  1STR B;  5B11 O;  1I05 A;  1JMZ A;  2HZR A;  3C77 X;  3FEL A;  1SY0 A;  3KFF A;  3CQN A;  5L8I A;  5B2A O;  3VG4 A;  1BM5 A;  1EUO A;  5KHP A;  2RTN B;  4JHQ A;  4I9S A;  2F73 A;  2WPU A;  5D45 A;  1LDO A;  4QAE A;  4UU3 A;  4AW8 A;  4ON1 A;  1I78 A;  2OF8 A;  2R56 A;  2JN3 A;  3TZS A;  4O4O A;  1MM9 A;  5FQ8 E;  1B8E A;  1EPA A;  1RXJ A;  4MVI A;  3TGA A;  3ZW1 B;  1CBQ A;  4CSB A;  5LJB A;  3ZI8 A;  3KQ0 A;  5HZ5 A;  1W4T A;  4NV8 A;  5EZ2 A;  5AEO A;  1NP4 A;  3WZP A;  1X8Q A;  2QCB A;  2HLV A;  2Z4I A;  5IRA A;  2CAM A;  1VYF A;  4C5P A;  5LKE A;  4GDA A;  3NX2 A;  4IMN A;  2RD7 C;  1ACD A;  4OS0 A;  1LPJ A;  5LJD A;  3T2W A;  1DZM A;  1MUP A;  4HPC A;  2RTG B;  1K3B A;  2LBA A;  3VU1 A;  1BJ7 A;  1QFT A;  4I60 A;  5K67 A;  3D95 A;  4WFU A;  2HMB A;  1RBP A;  2AMM X;  1LID A;  1QY1 A;  4TLJ A;  1AVE A;  1VWI B;  3F8A A;  5D4A A;  4BCS A;  1W6F A;  3VE1 A;  4AZP A;  3NR3 A;  3FR5 A;  3VHM A;  3RE5 A;  5F2B A;  2RCQ A;  5F6B A;  3RDS A;  2RQ0 A;  1FEN A;  2RTI B;  4ZJ0 A;  1UYN X;  3QKG A;  3P6E A;  2L67 A;  2LA7 A;  2NNE A;  4LKT A;  2FRS A;  2KD2 A;  4XMG A;  2M4L A;  2FHL A;  3NQK A;  3VG5 A;  1VWE B;  2E4J A;  4O9S A;  4MIS A;  4JGL A;  3JQO A;  3FEN A;  1SWB A;  1VWK B;  1QY2 A;  4KT5 A;  5BVS A;  5BVQ A;  2IZB A;  2FHN X;  1KOI A;  1HN2 A;  1NP1 A;  4O3Z A;  2I5V O;  1VWR B;  5HZ8 A;  1JQP A;  4OS8 A;  5LJH A;  1E5P A;  2ACO A;  5C0N A;  2IZG B;  4MIR A;  4U3Q A;  1KQX A;  4AZM A;  3WJC A;  2OL8 O;  2X34 A;  1OEK A;  2FR3 A;  3D4R A;  2A2U A;  2K23 A;  2W2B A;  3PDF A;  5F7G A;  1IKE A;  4BX6 A;  4KH8 A;  4ZHC A;  2GTL N;  1EIO A;  3Q6L A;  1IKJ A;  4OEM A;  2MM3 A;  1VWQ B;  2RTK A;  1FEM A;  1S44 A;  1BEB A;  1JJU A;  1RLB E;  4ZR2 A;  3RKG A;  1D2U A;  1Y9T A;  1VWO B;  1GM6 A;  2LBV A;  3IFB A;  1NC9 A;  2QO5 A;  1LF7 A;  1VYO A;  2UZ2 A;  5EPQ A;  4D6B A;  4RUU A;  2CBS A;  5LKF A;  4FBV A;  3MVF A;  3MX7 A;  2OL7 A;  1IFB A;  1SWG A;  1YWC A;  2KTD A;  1SWH A;  2CM9 A;  5IO6 A;  2CBR A;  1OPB A;  3WXQ A;  5B10 O;  1SXY A;  1MX7 A;  2AVI A;  1SWU A;  3WOV A;  2RTH B;  2JOZ A;  3S5X A;  3BRN A;  4YKO A;  2Q9S A;  4KCA A;  4ID2 A;  4CDF A;  2GH7 A;  1X8P A;  5HZQ A;  3TF6 A;  3TGB A;  1LIF A;  3HWE A;  1QG5 A;  1H91 A;  2OY8 A;  2A5C A;  1P6P A;  1ALB A;  1ZRY A;  3PPT A;  2RTF B;  1BRP A;  3K3L A;  4ORW A;  4YGZ A;  5CSE A;  4NNT A;  1Z24 A;  4EQA C;  3VHH A;  2GC9 A;  3PEC A;  2GTL M;  2QMI A;  2QO6 A;  2Z4H A;  4PJ2 A;  4QGW A;  2VFC A;  2WWP A;  5H9K A;  2QM9 A;  3CBC A;  3O19 A;  3EMM A;  5HCD C;  3T6F A;  4YKM A;  1DZK A;  1SXX A;  4IAW A;  3ZWE A;  4HPB A;  4BBO A;  1A57 A;  1HY2 A;  3EW1 A;  3P02 A;  1HMS A;  3H3I A;  3L4R A;  3VHI A;  1DFV A;  4ZH6 A;  4LKP A;  5LJG A;  4OMW A;  4CPI A;  3VG6 A;  2L9C A;  2MF6 A;  5HTE A;  3VG2 A;  1VWL B;  1N43 A;  4MEE A;  3APU A;  1KT4 A;  4YDA A;  1OEJ A;  4ZHG A;  1NQM A;  2Q39 A;  3FW4 A;  2L68 A;  4I95 A;  2JU3 A;  4BX5 A;  4ZGF A;  3U03 A;  3WJE A;  4FQB B;  4TKJ A;  2POA A;  1NBX A;  1GT4 A;  4IBA A;  4A8Z A;  3ZW0 B;  1B0O A;  3AKN A;  2ALL X;  4ML7 B;  3CKF A;  4FGI B;  3FEP A;  3BSZ E;  3UEV A;  5D47 A;  1SWE A;  2F09 A;  3DTQ A;  3ZUO A;  2IZE B;  1LUQ A;  3FA9 A;  1BRQ A;  4NV7 A;  2IZA A;  3P6G A;  4WFV A;  2GTL O;  1G7N A;  4GJV A;  3BX7 A;  3IA8 A;  3FA6 A;  4CPH A;  3FR4 A;  1KT7 A;  2MWH A;  1BSQ A;  3C78 X;  2ZAG A;  4ORU A;  4N7C A;  3VPJ E;  5HZ9 A;  1AVD A;  1HMT A;  1GGL A;  1QQS A;  4Y0P A;  2G78 A;  2N93 A;  1SXW A;  2X8S A;  4INN A;  3NX1 A;  3WYQ A;  3WYP A;  2HZQ A;  4CPE A;  1VPR A;  4XMC A;  3AKM A;  3PP6 A;  3FLL A;  2PI3 O;  4I3C A;  3UEX A;  1LIB A;  5DG4 A;  1ZND A;  1B4M A;  1JV4 A;  1X71 A;  3PK2 A;  3CR6 A;  4WBK A;  2OFA A;  1AEL A;  2AL0 X;  3B2K A;  2FS6 A;  3SLT A;  2RTO B;  1ZNL A;  4QYN A;  4LQZ A;  1IJ8 A;  2X8T A;  4CDC A;  1DV9 A;  4ORS A;  5AQ6 A;  3ZW2 A;  1G74 A;  2X55 A;  4IAB A;  4YVB A;  3EBK A;  4GH7 A;  4AYH A;  3JS1 A;  4ZFX A;  2IZC B;  2CZT A;  4LZU A;  4MVL A;  4HPA A;  4I3D A;  1ZNG A;  1LKE A;  1Y52 X;  3P6F A;  1D3S A;  1GX8 A;  2AH7 X;  3SLO A;  3STN A;  3SZJ A;  4BVM A;  4YFR A;  1SRJ A;  5LJC A;  1JJJ A;  1N9M A;  5CE4 A;  2FTB A;  1O1V A;  3B2L A;  1LIC A;  3QQ2 A;  3RE6 A;  2IZF B;  5IRW A;  2JU7 A;  5HCC C;  4JO6 A;  2RTC B;  1I9H A;  4Z28 A;  4XMD A;  1KZW A;  1DZP A;  2HKD A;  2XKL A;  4QGV A;  4IRW A;  1YWB A;  2OF9 A;  3NAD A;  4GDZ A;  2OVE A;  5L3Y A;  3EW2 A;  2WQA E;  3CMP A;  3WZO A;  4CK4 A;  2FLJ A;  3ELX A;  4R0B A;  3B2I A;  5EED A;  1HMR A;  3B2J A;  4Z2P A;  1JYD A;  5H9L A;  5CYB A;  2RTB B;  3FYF A;  3V8U A;  1NGL A;  3F9D A;  1SWK A;  1SY1 A;  1LDQ A;  4O3X B;  1YUP A;  1SRI A;  3P6H A;  1STP A;  4M7M A;  1A18 A;  4B55 A;  1N0S A;  3OD9 A;  2OFR X;  4AZN A;  4BX7 B;  4YMY A;  3S5V A;  3WJG A;  4ORR A;  5FQ6 E;  4YBP A;  4CDD A;  3STK A;  1SWQ A;  1T68 X;  1T8V A;  1U0X A;  2RTL A;  2UYW A;  1YWA A;  5DPQ A;  5FAZ A;  1LFO A;  2MO5 A;  2OVS A;  1I4U A;  5BVT A;  3TGC A;  2LB6 A;  1T0V A;  1OBU A;  1YP6 A;  5IO7 A;  3HTY A;  4ALO A;  5KID A;  3CQR A;  1CBI A;  2NNQ A;  4KC8 A;  5K68 A;  2C1S A;  4IB9 A;  1VWJ B;  1Y53 X;  2JU8 A;  4N7D A;  2ANS A;  2WR6 A;  3S26 A;  1UZ2 X;  1OBQ A;  2AT6 X;  2MHD A;  4BX6 B;  4Z2V A;  2A8G A;  1RAV A;  1HBQ A;  3FW5 A;  1ZNH A;  2EU7 X;  3HWD A;  1XKI A;  1IIU A;  4HWM A;  3MM0 A;  3SAO A;  4TJZ A;  5HTD A;  1CJ5 A;  4IMO A;  3ZQ3 A;  2PY1 A;  2KTS A;  1X8N A;  2ASN X;  3LHN A;  1G85 A;  3BU1 A;  2JGS A;  2A5B A;  1HBP A;  4A1Y A;  1EII A;  3KFI A;  1SWS A;  4I6S A;  1S2P A;  4ZGU A;  1Y55 X;  2VFB A;  1GX9 A;  2Y32 A;  5KIC A;  3NQ9 A;  4GK9 A;  3AEH A;  1GKA A;  3WZQ A;  4EXZ A;  1G5W A;  4HFO A;  1SWJ A;  1TXL A;  4MVE A;  5CHK A;  2RTR B;  3F6Z B;  4YBU A;  1DZJ A;  3PED A;  4YFP A;  4DNE A;  2Y3F A;  1PTS A;  3RSW A;  2BS6 A;  1R0U A;  4GJS A;  3RDX A;  3T2X A;  3ZUI A;  5B5F A;  4CV7 A;  3PH5 A;  2IZK A;  2BLG A;  4GNW A;  4NNS A;  2R73 A;  3HWG A;  2LKK A;  4QQ1 A;  5K06 A;  1OBP A;  4GUZ A;  1GT3 A;  4I9R A;  4IAX A;  4BX5 B;  2RCT A;  1YP7 A;  4QZT A;  2WQ9 A;  1E02 A;  2JMB A;  1A2D A;  5AJC A;  4FBR A;  4ES7 A;  5EEE A;  3T1D A;  3Q34 A;  3BU9 A;  1LCZ A;  1JJX A;  1K24 A;  3RY1 A;  3FIQ A;  1MK5 A;  4Z2O A;  5H9N A;  3ELZ A;  1FDQ A;  3NQ3 A;  3U9P C;  2RTQ B;  3T6L A;  2GTF X;  3WJD A;  3GAQ A;  3FDC A;  1VWG B;  2QOS C;  4ZCB A;  4QYP A;  2NP1 A;  3HOE A;  4EDE A;  1KQW A;  2HNX A;  3U0D A;  5F1E A;  1RXH A;  2AKQ A;  1PEE A;  3ZW0 A;  1ERB A;  2W2F A;  2FKJ A;  2A3F X;  4QNI A;  1B56 A;  1FEL A;  4WHI A;  1XCA A;  4OEL A;  1YIV A;  1I06 A;  2FKG A;  4MVK A;  4FBO A;  4HPD A;  2X32 A;  4O4S A;  3RWX A;  2A13 A;  4GRJ A;  4U8U N;  4D6A A;  3OE3 A;  4AZO A;  4Z27 A;  3P6D A;  2W2A A;  4NYQ A;  4BJ8 A;  5IXG A;  3UEU A;  4GZV A;  4KII A;  1GT1 A;  1ML7 A;  2G5L A;  2LFO A;  1QWD A;  1TW4 A;  3CBS A;  3GE2 A;  1S7D A;  4GET A;  1CBS A;  2OVD A;  3BDR A;  4A60 A;  4TKB A;  5EDB A;  2RTE B;  4Y0Q A;  1MDC A;  4QRL A;  4YH0 A;  1U17 A;  2IZI A;  4CPH B;  4EKV A;  1SWD A;  2WUT A;  3B2H A;  4BQU A;  1SWT A;  2CZU A;  4IB7 A;  2Q2P A;  4XME A;  3PQS A;  1SLD B;  5B5G A;  2K62 A;  3APX A;  4GGR A;  4O4X A;  4O4U A;  2VDF A;  1IW2 A;  5BYP A;  1EAL A;  1MEP A;  2QOM A;  4GKC A;  2GJ5 A;  1BSY A;  2FGS A;  3BLG A;  1SXU A;  5LJE A;  1CBR A;  1KT6 A;  1VWA B;  1BSO A;  5HAE A;  3LV4 A;  4NYR A;  3BX8 A;  2WSJ A;  2X4M A;  3P24 A;  4YGG A;  4ZHH A;  1KT5 A;  1MX8 A;  5L8O A;  1I04 A;  1UYO X;  3CWK A;  4GD9 A;  3WZN A;  4GU8 A;  3APV A;  4O3Y A;  1SY2 A;  2R74 A;  1HQP A;  1SLE B;  4U8U M;  3SOT A;  1EW3 A;  4K19 A;  2AT5 X;  3EBW A;  2DJF A;  5HBS A;  1VYG A;  2X46 A;  3G7X A;  2OYB O;  4AZQ A;  2OVA A;  1KL4 A;  3VG3 A;  4DQ3 A;  2G7B A;  4Y0S A;  1PBO A;  2RTM A;  1SWF A;  2ZAI A;  2X8F A;  3MBT A;  1X89 A;  4ORX A;  3MG5 A;  4Y5D A;  1O8V A;  3OJY C;  1PMP A;  4TKH A;  5IRU A;  2OY5 O;  3S60 A;  3FEK A;  4ORY A;  1SWC A;  4Y59 A;  2MJI A;  1W5R A;  3APW A;  1VWC B;  2Q2M A;  2RTA A;  1X8U A;  5D48 A;  4RUN A;  2OZQ A;  3SZH A;  4EFG A;  2CM4 A;  5H8T A;  1E00 A;  3FR2 A;  4YGH A;  4ALB A;  1SMP I;  1FJ1 E;  1N4J A;  2BT9 A;  4NLI A;  4QZU A;  1YWD A;  4NW4 A;  2KW1 A;  3HPE A;  5D8J A;  2OY7 A;  2RTD B;  1ADL A;  2YMS A;  1KZX A;  1JYJ A;  2X56 A;  1GT5 A;  4GGT A;  3N91 A;  1LCW A;  3KVN A;  1Y0G A;  1EI5 A;  1KFF A;  1OSP O;  1PBY A;  4BX7 A;  4CPF A;  1KT3 A;  2Q4N A;  3EYC A;  1RXK A;  1SLG B;  3O2Y A;  4U8U O;  5IO5 A;  1OEE A;  2AT3 X;  2OFM X;  2X45 A;  3P6C A;  1WBI A;  1EXS A;  5B27 A;  3SLJ A;  2C4I A;  2WEX A;  4UU2 A;  1Y9L A;  4XMF A;  4U9C A;  4YDB A;  1SRH A;  1NQN A;  2IZH B;  2IFB A;  4O49 A;  3RDO A;  1GXA A;  1VWP B;  1JIW I;  1VWF B;  1LEL A;  2P8G A;  3JSQ A;  3FID A;  4IB6 A;  4CDE A;  1MOY A;  5HCE C;  3STM X;  2L5P A;  1LIE A;  1STS B;  1SWL A;  1FE3 A;  4O3W A;  2RA6 A;  5HWZ A;  3RBY A;  3ZW1 A;  1N7Y A;  1SRE A;  3D96 A;  4JNJ A;  1SWO A;  3KZA A;  5B3M O;  1DC9 A;  1SWP A;  2FR2 A;  3EC5 A;  3KFH A;  3OBL A;  1AVG I;  3NBX X;  1KL5 A;  1URE A;  1FTP A;  2IZL B;  1L6M A;  3D97 A;  3RDM A;  1QY0 A;  5B29 A;  2AT0 X;  4GNY A;  4OS3 A;  1X8O A;  4TNN A;  4OKA A;  1RSU B;  2DM5 A;  1A3Y A;  1QAB E;  2AT8 X;  4GE1 A;  1SWN A;  4I3B A;  2F01 A;  4DQ4 A;  1DF8 A;  5F6Z A;  3VG7 A;  4M6S A;  3VGW A;  2BHV A;  3I17 A;  4L3R A;  1JZU A;  1BLR A;  2AF5 A;  1SRG A;  1N9Y A;  2BC3 A;  4A1H A;  1KL3 A;  2OL6 O;  1RST B;  1BWY A;  4ODD A;  3RZY A;  5LJK A;  4ARH A;  3PQU A;  2I5Z O;  2JW1 A;  2RTJ A;  3EM0 A;  1LNM A;  4DCB A;  1SLF B;  3D9W A;  2OFB A;  3E3C A;  4YCH A;  3FA8 A;  1GKA B;  1KXO A;  4OMX A;  3UEW A;  2FT9 A;  3HK1 A;  1E06 A;  4LZV A;  1EQD A;  3DSZ A;  3FA7 A;  1DF3 A;  3O22 A;  4KC7 A;  1LCV A;  5HZ6 A;  1SWA A;  2ACP X;  5FQ7 E;  3UAQ A;  1PM1 X;  1JBH A;  3PH6 A;  5JD2 A;  1ZNK A;  1KGL A;  1IFC A;  3CKG A;  4BGF A;  1ERX A;  1SRF A;  3NPO A;  2RN4 A;  2G8C O;  2RTP B;  4PSQ A;  3NP1 A;  2HYS A;  5EDC A;  2BS5 A;  5H9A A;  3RY2 A;  2ZSC A;  1ICN A;  1VWH B;  1VWM B;  2NND A;  1HXL A;  3KFG A;  3LTW A;  4QGX A;  2QO4 A;  2C1Q A;  2YG2 A;  1U18 A;  1AB0 A;  5F58 A;  4ZHF A;  1NDJ A;  2FS7 A;  1JMX A;  3ZZV A;  4Y0R A;  1AQB A;  2IZJ A;  3WBG A;  2XST A;  3VE2 A;  3WVM A;  2DJG A;  1VWD B;  4NLJ A;  1GX3 A;  2A0A A;  3RDU A;  1VWB B;  4YCE A;  3I0A A;  3X00 A;  1HXZ A;  1SY3 A;  1CRB A;  3BS2 A;  1BBP A;  3SZI A;  3FMZ A;  4L1N A;  5AJB A;  1E2T A;  4U46 A;  4ZH9 A;  5L8N A;  1VWN B;  1HQQ A;  1O1U A;  5HA1 A;  3HWF A;  2WEW A;  2Y3E A;  1ZNE A;  2O62 A;  4NP1 A;  4YFQ A;  3WJF A;  4BOE A;  2IZD B;  5JR8 A;  4ZHD A;  4TQ2 A;  1TOU A;  5HA0 A;  3AUM O;  4COT A;  2KT4 B;  3BY0 A;  3C76 X;  4AZR A;  4EEJ A;  1QFV A; 
#chains in the Genus database with same CATH homology
 5IRU A;  1SWR A;  4GGZ A;  5K68 A;  4Z6J A;  2C1S A;  4BBO A;  1SWC A;  1VWJ B;  1Y53 X;  4Y59 A;  1HY2 A;  3RDQ A;  1VWC B;  3EW1 A;  4BX6 B;  1STR B;  2RTA A;  3VHI A;  4Z2V A;  2A8G A;  1RAV A;  4CPI A;  3SZH A;  3MM0 A;  2MF6 A;  2RTN B;  4JHQ A;  1VWL B;  1N4J A;  1N43 A;  2WPU A;  1LDO A;  2JGS A;  2A5B A;  1NQM A;  1SWS A;  4BX5 A;  1Y55 X;  2OF8 A;  1NBX A;  2RTD B;  1MM9 A;  2Y32 A;  1RXJ A;  3WZQ A;  4GGT A;  1LCW A;  1SWJ A;  5CHK A;  1KFF A;  4BX7 A;  1SWE A;  2RTR B;  4CPF A;  3WZP A;  2IZE B;  1LUQ A;  4DNE A;  1RXK A;  1SLG B;  1PTS A;  2QCB A;  2Y3F A;  4GJS A;  5IRA A;  3RDX A;  3T2X A;  1WBI A;  2CAM A;  2IZA A;  2IZK A;  5B5F A;  4GDA A;  3T2W A;  2C4I A;  4GJV A;  4CPH A;  2RTG B;  1SRH A;  1NQN A;  2IZH B;  3RDO A;  1VWF B;  1AVD A;  1VWP B;  1LEL A;  4I60 A;  5K67 A;  1MOY A;  1AVE A;  1STS B;  1SWL A;  1VWI B;  1LCZ A;  3WYQ A;  3WYP A;  4BCS A;  3RY1 A;  1N7Y A;  3VHM A;  4CPE A;  3RE5 A;  1SRE A;  5F2B A;  1MK5 A;  4Z2O A;  4JNJ A;  1SWO A;  3RDS A;  1SWP A;  1KL5 A;  2IZL B;  2RTI B;  3RDM A;  2RTQ B;  3PK2 A;  3T6L A;  2OFA A;  2FHL A;  3FDC A;  1VWG B;  1RSU B;  1VWE B;  4OKA A;  2RTO B;  1SWN A;  2F01 A;  1RXH A;  1DF8 A;  3VGW A;  1IJ8 A;  1SWB A;  1VWK B;  2IZB A;  1SRG A;  2FHN X;  1N9Y A;  2BC3 A;  4YVB A;  1VWR B;  1KL3 A;  1RST B;  2IZC B;  2IZG B;  1Y52 X;  2RTJ A;  3SZJ A;  1SLF B;  2OFB A;  1SRJ A;  1N9M A;  4Z27 A;  4BX6 A;  4BJ8 A;  1LCV A;  1SWA A;  3RE6 A;  2IZF B;  5IRW A;  1VWQ B;  2RTK A;  2G5L A;  5JD2 A;  4JO6 A;  2RTC B;  1I9H A;  1VWO B;  4Z28 A;  2RTE B;  1SRF A;  4EKV A;  2IZI A;  4CPH B;  1SWD A;  1NC9 A;  2OF9 A;  1VYO A;  2RTP B;  4IRW A;  2UZ2 A;  5L3Y A;  1SWT A;  3RY2 A;  3WZN A;  2ZSC A;  1VWH B;  1VWM B;  3EW2 A;  1HXL A;  3WZO A;  1SLD B;  2C1Q A;  5B5G A;  1SWG A;  4GGR A;  1SWH A;  4Z2P A;  1NDJ A;  2AVI A;  1MEP A;  1SWU A;  2RTH B;  2IZJ A;  2RTB B;  1VWD B;  4BX5 B;  1VWA B;  3X00 A;  3RDU A;  1VWB B;  1HXZ A;  2GH7 A;  3SZI A;  1SWK A;  4U46 A;  2A5C A;  1LDQ A;  4GD9 A;  1SRI A;  2RTF B;  1STP A;  4BX7 B;  1SLE B;  5CSE A;  1VWN B;  1HQQ A;  3VHH A;  2Y3E A;  1SWQ A;  2IZD B;  2RTL A;  2UYW A;  1KL4 A;  2RTM A;  1SWF A;  3T6F A;  4Y5D A;  3MG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...