4Z2MG

Crystal structure of human spt16 mid-aid/h3-h4 tetramer fact histone complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACT complex subunit SPT16
publication title Integrated molecular mechanism directing nucleosome reorganization by human FACT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna binding protein
total genus 26
structure length 77
sequence length 77
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z2mG00
1N1JB 1N1JA 3AN2D 5B31G 5B1MC 4XZQA 5B2ID 3A6NB 4YS3C 3MGSC 1P3PB 1AOID 4Z66A 2F8NG 3AYWB 4KUDA 4JJNA 4CAYB 4UUZB 4ZUXA 3X1SB 2RVQC 3W98B 3REJD 4WU8D 4M6BA 3AZND 3LELC 1KX4D 2BYMA 5GT3D 3AZKB 1KX5A 4QLCD 3C1CB 1KX5B 3X1TA 1EQZA 3TU4D 2NQBA 4H9RB 4J8XC 3VH5T 1HQ3A 5CP6A 5B0ZB 5DNND 3KUYB 3AZEB 5F99B 1P3GC 1P3MA 1KX3D 3AZHB 3AZHA 3MVDD 5CPKA 2L5AA 5AY8A 3WA9D 4J8UD 3R45A 5GSUD 3A6NC 3MGQB 1P3PC 1ID3D 3REKD 3LZ1B 3W96B 3AYWC 3X1SC 3W98C 1JFIA 5B24B 5C3IC 3X1UD 3AZKC 1KX5C 3C1CC 5B2JD 3WAAB 3UTAA 5CPIA 1P3IB 4LD9D 3AZGA 3UTBB 3REHD 3UTBA 4HGAC 4Z5TD 1F66B 5B0ZC 3MGPB 3KUYC 3AZEC 5F99C 1M18A 1M18B 1P3BA 2AROB 4Z66D 1P3AA 3B6FB 3KXBD 4KUDD 1KU5A 3UT9D 4WU9A 2FJ7B 3AZMA 3B6GD 3MGQC 5AV8D 3O62A 3W96C 3LZ1C 2BYKA 2BYKB 1WWIA 4EO5B 4CSRB 3X1TD 5B33A 5B24C 5B40A 1HQ3D 5CP6D 1P34B 2JSSA 5E5AA 3NQUA 3WAAC 4J8VB 5CPKD 1P3IC 3VH6A 5BNXB 3UTBC 3AV1D 2F8NB 1F66C 3RELA 3MGPC 2YFVA 1M18C 2AROC 3B6FC 1P3KB 3AZIB 3AZLD 5B0YA 5B0YB 4KGCC 5AV9B 2FJ7C 3AV2A 2NZDB 2HIOA 2HIOB 4XUJA 5GXQA 4AWLB 5JRGD 3WKJB 4EO5C 4X23D 3MNNB 5CPID 4Z2MG 1TAFB 4YM6A 5FUGA 1HTAA 3LZ0B 3AZGD 1BH9A 3LJAA 1P34C 3B0BA 4J8VC 1BH8B 5B1MA 4H9QB 4YS3A 3MGSA 4WU9D 1S32B 3REID 3AZFB 3KSYA 3O62D 3WTPD 3AZIC 1U35B 1P3KC 1P3FD 1M1AD 1BFMA 5B0YC 3W99D 5AV9C 3LELA 1ZLAD 3AZNB 3AFAB 2NZDC 2HIOC 4AWLC 4J8XA 4WNNB 3WKJC 5AVCB 3MNNC 5BO0A 3LZ0C 1P3GA 3RELD 3MVDB 3A6NA 1P3PA 3AZJB 2PYOA 5AV5D 3AV2D 1S32C 1ID3B 2PYOB 3AZFC 3REKB 3AYWA 4CAYA 4UUZA 3KWQD 3X1SA 1TZYD 3W98A 5GXQD 1U35C 1P3LD 3NQJB 3NQJA 5C3IB 3AZNC 1A7WA 3B0CW 3X1UB 3AFAC 3C1CA 3AZKA 3X1VD 5DNMD 3LJAD 4H9RA 4LD9B 4HGAB 3REHB 5B0ZA 3MGRD 5B1MD 4Z5TB 5AVCC 3KUYA 3AZEA 4YS3D 3MGSD 5F99A 5B32D 1P3OA 1P3OB 5GT0B 3W97B 3MVDC 3KXBB 3UT9B 4KHAB 3MGQA 3B6GB 5AV8B 3LELD 3AZJC 2PYOC 1ID3C 3W96A 3LZ1A 3REKC 1M19A 1M19B 5BS7C 4G92B 3V9RB 1F1EA 5B24A 4H9PB 4H9OB 4H9PA 3X1UC 5CPJB 1P3GD 4R8PB 3WAAA 4NFTA 1P3IA 5B1LB 4LD9C 3REHC 1F66A 3MGPA 4Z5TC 4XZQD 3A6ND 4H9SC 1P3OC 2AROA 5GT0C 3B6FA 5B32G 3W97C 2LY8A 4JJND 4ZUXD 3KXBC 2FJ7A 4KGCB 4KGCA 3UT9C 3B6GC 5AV8C 4J8WB 3C1BB 3AZKD 1KX5D 1M19C 5JRGB 4CSRA 4G92C 1EQZD 4X23B 2NQBD 5B0ZD 1P34A 3KUYD 5F99D 1P3MD 5CPJC 5B31A 5B31B 4R8PC 3VH5W 5AV6B 4J8VA 3AZHD 5BNXA 5B1LC 3AV1C 2F8NA 5AY8D 1P3KA 3LZ1D 3AZIA 5AVBB 3WTPB 1M1AB 1H3OB 5AV9A 2YFWB 3W99B 3B0DB 2CV5B 5B24D 1ZLAB 2NZDA 4J8WC 3C1BC 3WKJA 5JRGC 3WAAD 3MNNA 3UTAD 5BT1C 4X23C 3LZ0A 1TAFA 3UTBD 1F66D 3MGPD 5B31C 1M18D 1P3BD 2AROD 1BH8A 5AV6C 1P3AD 3AN2B 4H9QA 5B2IB 5BNVB 1S32A 3AZMD 1AOIB 3AZFA 3REIC 3KWQB 3VH6T 1TZYB 1U35A 3REJB 5AVBC 3WTPC 1M1AC 4WU8B 1P3LB 5B33D 3W99C 3B0DC 3AZNA 1KX4B 3AFAA 2CV5C 1ZLAC 5B40D 5GT3B 4QLCA 4QLCB 5JA4A 5JA4B 5DNMB 3X1VB 1P34D 3WTPE 3TU4A 3TU4B 5E5AD 4WNNA 5AVCA 5G49B 5DNNB 2F8NH 5B32B 1KX3B 4NE3A 3MVDA 3AN2C 2CWEA 3WA9B 3AZID 4J8UB 5B2IC 5GSUB 5GSUA 5B0YD 5AV9D 3AZJA 1ID3A 1AOIC 5AV5C 3REKA 5BS7A 2HIOD 1R4VA 4XUJD 3KWQC 1TZYC 3REJC 4WU8C 3MNND 1P3LC 1KX4C 4YM6D 3X1UA 5GT3C 4QLCC 5B2JB 5DNMC 3X1VC 3TU4C 4LD9A 3REHA 4Z5TA 3MGRC 4H9SA 4XZQB 5DNNC 5GT0A 5B32C 1S32D 3W97A 3AZFD 4Z66B 1KX3C 3KXBA 4KUDB 2RVQD 4JJNB 3UT9A 4NE5A 4ZUXB 4KHAA 1U35D 3WA9C 4J8UC 3B6GA 1WWSA 5GSUC 5AV8A 3VH6W 3AFAD 2BYMB 3V9RA 1ULYA 3X1TB 1EQZB 4H9NB 4H9NA 4J8XD 2NQBB 2IO5B 5AVCD 1HQ3B 4H9OA 5CP6B 5CPJA 4R8PA 4E45A 1P3MB 5B2JC 5CPKB 5B1LA 3AV1B 3AV1A 5AY8B 3R45B 4XZQC 1P3PD 3AZJD 2PYOD 4Z66C 3AYWD 3X1SD 4KUDC 4JJNC 3AZLB 3AZLA 4ZUXC 3W98D 5CHLB 1JFIB 4J8WA 3C1BA 3C1CD 5JRGA 4X23A 3UTAB 3X1TC 5CPIB 1EQZC 3AZGB 2NQBC 2IO5C 3AZED 1HQ3C 5CP6C 1P3OD 5AV6A 5GT0D 1P3MC 1P3BB 3W97D 1P3AB 3AZHC 5CPKC 2HUEB 4WU9B 5AY8C 3AZMB 3MGQD 2F8NK 3REIA 3REIB 3O62B 3W96D 1M19D 5AVBA 3WTPA 1P3FA 1H3OA 4Z2MH 1P3FB 3AZLC 2YFWA 1M1AA 3W99A 5B33B 2CV5A 1ZLAA 5B40B 4ZBJB 5CPJD 4R8PD 5E5AB 3NQUB 5CPIC 3UTAC 1P3ID 5B1LD 3AZGC 4WV4B 3RELB 2YFVB 3B6FD 3AN2A 1P3BC 5B2IA 1P3AC 5BNVA 4DRAA 2FJ7D 4KGCD 2HUEC 4WU9C 1AOIA 5AV5A 5AV5B 3AV2B 3AZMC 3KWQA 4J8WD 4XUJB 3C1BD 1Q9CA 1TZYA 3O62C 5GXQB 4DRBA 3REJA 3B0CT 1P3FC 4WU8A 1P3LA 5BT1D 1KX4A 4G91B 5B33C 5FUGB 5GT3A 4YM6B 1BH9B 5B40C 3X1VA 5DNMA 3LJAB 4NE6A 4ZBJC 5B31D 5E5AC 5AV6D 4J8VD 3MGRB 5B1MB 5G49A 5DNNA 4WZSB 3MGRA 4YS3B 3MGSB 5B32A 2F8ND 1KX3A 3RELC 1P3KD 3WA9A 4J8UA 5AVBD 1B6WA 3LELB 3AV2C 3VH5A 2CV5D 2NZDD 4XUJC 5GXQC 3WKJD 4J8XB 3LZ0D 5KDMB 4G91C 5KDMA 5BO0B 4YM6C 1P3GB 4E44A 5B2JA 3LJAC 1B67A
chains in the Genus database with same CATH superfamily
1N1JB 1N1JA 3AN2D 5B31G 5B1MC 4XZQA 1Z2CB 5B2ID 3A6NB 4YS3C 3MGSC 1P3PB 1AOID 4Z66A 2F8NG 3AYWB 4KUDA 4JJNA 4CAYB 4UUZB 4ZUXA 3X1SB 2RVQC 3W98B 3REJD 4WU8D 4M6BA 3AZND 3LELC 1KX4D 2BYMA 5GT3D 3AZKB 1KX5A 4QLCD 3C1CB 1KX5B 3X1TA 1EQZA 3TU4D 2NQBA 4H9RB 4J8XC 3VH5T 1HQ3A 5CP6A 5B0ZB 5DNND 3KUYB 3AZEB 5F99B 1P3GC 1P3MA 1KX3D 3AZHB 3AZHA 3MVDD 5CPKA 3EPHA 2L5AA 5AY8A 2JE5A 3WA9D 4J8UD 3R45A 5GSUD 3A6NC 3MGQB 1P3PC 1ID3D 3REKD 3LZ1B 3W96B 3AYWC 2ZM5A 4DQYB 3X1SC 3W98C 1JFIA 5B24B 5C3IC 3X1UD 3AZKC 1KX5C 2JCHA 3C1CC 5B2JD 3WAAB 3UTAA 5CPIA 1P3IB 4LD9D 3AZGA 3UTBB 3REHD 3UTBA 4HGAC 4Z5TD 1F66B 5B0ZC 3MGPB 3KUYC 3AZEC 5F99C 1M18A 1M18B 1P3BA 2AROB 4Z66D 1P3AA 3EPLA 3B6FB 3KXBD 4KUDD 1KU5A 3UT9D 4WU9A 2FJ7B 3AZMA 3A1IA 3B6GD 3MGQC 2G5HC 5AV8D 3O62A 3W96C 3LZ1C 2BYKA 2BYKB 1WWIA 4EO5B 4CSRB 3X1TD 5B33A 2Y2HA 5B24C 5B40A 1HQ3D 5CP6D 1P34B 2JSSA 2Y2GA 5E5AA 3NQUA 3WAAC 4J8VB 5CPKD 1P3IC 3VH6A 5BNXB 3UTBC 3AV1D 2F8NB 1F66C 3RELA 3H0MC 3MGPC 1PZRA 2YFVA 1M18C 2Y2PA 2AROC 3B6FC 1P3KB 3AZIB 3AZLD 5B0YA 5B0YB 4KGCC 5AV9B 2FJ7C 3AV2A 2ZY2A 2NZDB 2HIOA 2HIOB 4XUJA 5GXQA 4AWLB 5JRGD 2VQRA 3WKJB 4EO5C 4X23D 3MNNB 5CPID 1T3UA 4Z2MG 1TAFB 5FUGA 1HTAA 4YM6A 3LZ0B 3AZGD 1BH9A 3LJAA 1P34C 3B0BA 4J8VC 1BH8B 5B1MA 4H9QB 4YS3A 3MGSA 4WU9D 1S32B 3REID 3AZFB 3KSYA 3O62D 3WTPD 3AZIC 1U35B 1P3KC 1P3FD 1M1AD 1BFMA 5B0YC 3W99D 5AV9C 3LELA 3EPKA 1ZLAD 2ZY4A 3AZNB 3AFAB 2NZDC 2HIOC 4AWLC 4J8XA 4WNNB 3WKJC 5AVCB 3MNNC 5BO0A 3LZ0C 1P3GA 3RELD 3MVDB 3A6NA 1P3PA 3AZJB 2PYOA 5AV5D 3AV2D 1S32C 1ID3B 2PYOB 2FFFB 3AZFC 3REKB 3AYWA 4CAYA 4UUZA 3KWQD 3X1SA 1TZYD 3W98A 5GXQD 1U35C 1P3LD 2Y2JA 3NQJB 3NQJA 5C3IB 3AZNC 1A7WA 2Y2MA 3B0CW 3X1UB 3AFAC 3C1CA 3AZKA 5DNMD 3X1VD 3LJAD 4H9RA 4LD9B 4HGAB 3REHB 5B0ZA 3MGRD 5B1MD 4Z5TB 5AVCC 3KUYA 3AZEA 4YS3D 3MGSD 5F99A 5B32D 1P3OA 1P3OB 5GT0B 3W97B 3MVDC 3KXBB 3UT9B 4KHAB 3KFUG 3MGQA 3B6GB 5AV8B 3LELD 3AZJC 2PYOC 1ID3C 3W96A 3LZ1A 3REKC 1M19A 1M19B 5BS7C 3EG5B 3V9RB 4G92B 1F1EA 5B24A 3H0RC 4H9PB 4H9OB 4H9PA 3X1UC 5CPJB 1P3GD 4R8PB 3WAAA 4NFTA 1P3IA 5B1LB 4LD9C 3REHC 1F66A 3MGPA 4Z5TC 4XZQD 3A6ND 4H9SC 1P3OC 2AROA 5GT0C 3B6FA 5B32G 3W97C 2LY8A 4JJND 4ZUXD 3KXBC 2FJ7A 4KGCB 4KGCA 3UT9C 3B6GC 5AV8C 4J8WB 3C1BB 3AL0C 3AZKD 1KX5D 1M19C 5JRGB 4CSRA 4G92C 1EQZD 4X23B 2NQBD 5B0ZD 2Y2IA 1P34A 3KUYD 5F99D 1P3MD 5CPJC 5B31A 5B31B 4R8PC 3VH5W 5AV6B 4J8VA 3AZHD 5BNXA 5B1LC 3AV1C 2F8NA 5AY8D 2W8SA 1P3KA 3LZ1D 3AZIA 5AVBB 3WTPB 2G5IC 1H3OB 5AV9A 1M1AB 2YFWB 3W99B 3B0DB 2CV5B 5B24D 1ZLAB 2NZDA 2UWXA 4J8WC 3C1BC 3WKJA 5JRGC 3WAAD 3MNNA 3UTAD 5BT1C 4X23C 3LZ0A 1TAFA 3UTBD 1F66D 2F2AC 3MGPD 5B31C 1M18D 1P3BD 2AROD 1BH8A 5AV6C 3EPJA 3AN2B 4H9QA 1P3AD 5B2IB 5BNVB 1S32A 3AZMD 1AOIB 3AZFA 3IP4C 3REIC 3KWQB 3VH6T 1TZYB 1U35A 3REJB 5AVBC 3WTPC 1M1AC 4WU8B 1P3LB 5B33D 3W99C 3B0DC 3AZNA 1KX4B 3AFAA 2CV5C 1ZLAC 5B40D 5GT3B 4QLCA 4QLCB 5JA4A 5JA4B 5DNMB 3X1VB 1P34D 3A1KA 3WTPE 3TU4A 3TU4B 5E5AD 4WNNA 5AVCA 3P5JB 5G49B 5DNNB 2F8NH 5B32B 1KX3B 4NE3A 3MVDA 2ZY5A 3AN2C 2CWEA 3WA9B 3AZID 4J8UB 5B2IC 5GSUB 5GSUA 5B0YD 5AV9D 3AZJA 1ID3A 1AOIC 5AV5C 3REKA 5BS7A 2HIOD 1R4VA 4XUJD 3KWQC 1TZYC 2Y2LA 3REJC 2Y2KA 3MNND 4WU8C 1P3LC 1KX4C 4YM6D 3X1UA 5GT3C 4QLCC 5B2JB 5DNMC 3X1VC 3TU4C 4LD9A 3REHA 3FDDA 4Z5TA 1W2EA 3MGRC 4H9SA 4XZQB 5DNNC 5GT0A 2XD5A 5B32C 1S32D 3W97A 3AZFD 4Z66B 1KX3C 3KXBA 4KUDB 2RVQD 4JJNB 3UT9A 4NE5A 4ZUXB 2Y2OA 4KHAA 1U35D 3WA9C 4J8UC 3B6GA 1WWSA 5GSUC 5AV8A 3VH6W 3AFAD 2BYMB 3V9RA 1ULYA 3X1TB 1EQZB 4H9NB 4H9NA 4J8XD 2NQBB 2IO5B 5AVCD 1HQ3B 4H9OA 5CP6B 5CPJA 4R8PA 4E45A 1P3MB 5B2JC 5CPKB 5B1LA 3AV1B 3AV1A 5AY8B 3R45B 4XZQC 1P3PD 3AZJD 2PYOD 4Z66C 3AYWD 3X1SD 4KUDC 2ZY3A 4JJNC 3AZLB 4ZUXC 3AZLA 3W98D 5CHLB 1JFIB 4UPKA 4J8WA 3C1BA 3C1CD 5JRGA 2XD1A 4X23A 3UTAB 3X1TC 5CPIB 1EQZC 3AZGB 2NQBC 2IO5C 3AZED 1HQ3C 5CP6C 1P3OD 5AV6A 5GT0D 1P3MC 1P3BB 3W97D 1P3AB 3AZHC 5CPKC 2HUEB 4WU9B 5AY8C 3AZMB 3MGQD 2F8NK 3REIA 3REIB 3H0LC 2RIQA 3O62B 3W96D 2BG1A 1M19D 5AVBA 3WTPA 1P3FA 1H3OA 4Z2MH 1P3FB 2Y2NA 2YFWA 3AZLC 1M1AA 3W99A 5B33B 2CV5A 1ZLAA 2Y2QA 5B40B 4ZBJB 5CPJD 4R8PD 5E5AB 3NQUB 5CPIC 3UTAC 1P3ID 5B1LD 3AZGC 4WV4B 3RELB 2YFVB 3B6FD 3AN2A 1P3BC 5B2IA 1P3AC 5BNVA 4DRAA 2FJ7D 4KGCD 2HUEC 4WU9C 1AOIA 2DF4C 5AV5A 5AV5B 3AZMC 3AV2B 3KWQA 4J8WD 4XUJB 3C1BD 2DQNC 1Q9CA 1TZYA 3O62C 5GXQB 4DRBA 3REJA 3B0CT 1P3FC 4WU8A 1P3LA 5BT1D 1KX4A 4G91B 5B33C 2J8PA 5FUGB 5GT3A 4YM6B 4WJ3C 1BH9B 5B40C 3X1VA 5DNMA 3LJAB 4NE6A 4ZBJC 5B31D 5E5AC 5AV6D 4J8VD 3MGRB 5B1MB 5G49A 5DNNA 4WZSB 3MGRA 4YS3B 3MGSB 5B32A 2F8ND 1KX3A 3RELC 1P3KD 3WA9A 4J8UA 5AVBD 1B6WA 3LELB 3AV2C 3VH5A 2CV5D 2NZDD 4XUJC 5GXQC 3WKJD 4J8XB 3F6TA 3LZ0D 5KDMB 4G91C 5KDMA 5BO0B 4YM6C 1P3GB 4E44A 5B2JA 3LJAC 1B67A
chains in the Genus database with same CATH topology
1N1JB 1N1JA 3AN2D 5B31G 5B1MC 4XZQA 1Z2CB 5B2ID 3A6NB 4YS3C 3MGSC 1P3PB 1AOID 4Z66A 2F8NG 3AYWB 4KUDA 4JJNA 4CAYB 4UUZB 4ZUXA 3X1SB 2RVQC 3W98B 3REJD 4WU8D 4M6BA 3AZND 3LELC 1KX4D 2BYMA 5GT3D 3AZKB 1KX5A 4QLCD 3C1CB 1KX5B 3X1TA 1EQZA 3TU4D 2NQBA 4H9RB 4J8XC 3VH5T 1HQ3A 5CP6A 5B0ZB 5DNND 3KUYB 3AZEB 5F99B 1P3GC 1P3MA 1KX3D 3AZHB 3AZHA 3MVDD 5CPKA 3EPHA 2L5AA 5AY8A 2JE5A 3WA9D 4J8UD 3R45A 5GSUD 3A6NC 3MGQB 1P3PC 1ID3D 3REKD 3LZ1B 3W96B 3AYWC 2ZM5A 4DQYB 3X1SC 3W98C 1JFIA 5B24B 5C3IC 3X1UD 3AZKC 1KX5C 2JCHA 3C1CC 5B2JD 3WAAB 3UTAA 5CPIA 1P3IB 4LD9D 3AZGA 3UTBB 3REHD 3UTBA 4HGAC 4Z5TD 1F66B 5B0ZC 3MGPB 3KUYC 3AZEC 5F99C 1M18A 1M18B 1P3BA 2AROB 4Z66D 1P3AA 3EPLA 3B6FB 3KXBD 4KUDD 1KU5A 3UT9D 4WU9A 2FJ7B 3AZMA 3A1IA 3B6GD 3MGQC 2G5HC 5AV8D 3O62A 3W96C 3LZ1C 2BYKA 2BYKB 1WWIA 4EO5B 4CSRB 3X1TD 5B33A 2Y2HA 5B24C 5B40A 1HQ3D 5CP6D 1P34B 2JSSA 2Y2GA 5E5AA 3NQUA 3WAAC 4J8VB 5CPKD 1P3IC 3VH6A 5BNXB 3UTBC 3AV1D 2F8NB 1F66C 3RELA 3H0MC 3MGPC 1PZRA 2YFVA 1M18C 2Y2PA 2AROC 3B6FC 1P3KB 3AZIB 3AZLD 5B0YA 5B0YB 4KGCC 5AV9B 2FJ7C 3AV2A 2ZY2A 2NZDB 2HIOA 2HIOB 4XUJA 5GXQA 4AWLB 5JRGD 2VQRA 3WKJB 4EO5C 4X23D 3MNNB 5CPID 1T3UA 4Z2MG 1TAFB 5FUGA 1HTAA 4YM6A 3LZ0B 3AZGD 1BH9A 3LJAA 1P34C 3B0BA 4J8VC 1BH8B 5B1MA 4H9QB 4YS3A 3MGSA 4WU9D 1S32B 3REID 3AZFB 3KSYA 3O62D 3WTPD 3AZIC 1U35B 1P3KC 1P3FD 1M1AD 1BFMA 5B0YC 3W99D 5AV9C 3LELA 3EPKA 1ZLAD 2ZY4A 3AZNB 3AFAB 2NZDC 2HIOC 4AWLC 4J8XA 4WNNB 3WKJC 5AVCB 3MNNC 5BO0A 3LZ0C 1P3GA 3RELD 3MVDB 3A6NA 1P3PA 3AZJB 2PYOA 5AV5D 3AV2D 1S32C 1ID3B 2PYOB 2FFFB 3AZFC 3REKB 3AYWA 4CAYA 4UUZA 3KWQD 3X1SA 1TZYD 3W98A 5GXQD 1U35C 1P3LD 2Y2JA 3NQJB 3NQJA 5C3IB 3AZNC 1A7WA 2Y2MA 3B0CW 3X1UB 3AFAC 3C1CA 3AZKA 5DNMD 3X1VD 3LJAD 4H9RA 4LD9B 4HGAB 3REHB 5B0ZA 3MGRD 5B1MD 4Z5TB 5AVCC 3KUYA 3AZEA 4YS3D 3MGSD 5F99A 5B32D 1P3OA 1P3OB 5GT0B 3W97B 3MVDC 3KXBB 3UT9B 4KHAB 3KFUG 3MGQA 3B6GB 5AV8B 3LELD 3AZJC 2PYOC 1ID3C 3W96A 3LZ1A 3REKC 1M19A 1M19B 5BS7C 3EG5B 3V9RB 4G92B 1F1EA 5B24A 3H0RC 4H9PB 4H9OB 4H9PA 3X1UC 5CPJB 1P3GD 4R8PB 3WAAA 4NFTA 1P3IA 5B1LB 4LD9C 3REHC 1F66A 3MGPA 4Z5TC 4XZQD 3A6ND 4H9SC 1P3OC 2AROA 5GT0C 3B6FA 5B32G 3W97C 2LY8A 4JJND 4ZUXD 3KXBC 2FJ7A 4KGCB 4KGCA 3UT9C 3B6GC 5AV8C 4J8WB 3C1BB 3AL0C 3AZKD 1KX5D 1M19C 5JRGB 4CSRA 4G92C 1EQZD 4X23B 2NQBD 5B0ZD 2Y2IA 1P34A 3KUYD 5F99D 1P3MD 5CPJC 5B31A 5B31B 4R8PC 3VH5W 5AV6B 4J8VA 3AZHD 5BNXA 5B1LC 3AV1C 2F8NA 5AY8D 2W8SA 1P3KA 3LZ1D 3AZIA 5AVBB 3WTPB 2G5IC 1H3OB 5AV9A 1M1AB 2YFWB 3W99B 3B0DB 2CV5B 5B24D 1ZLAB 2NZDA 2UWXA 4J8WC 3C1BC 3WKJA 5JRGC 3WAAD 3MNNA 3UTAD 5BT1C 4X23C 3LZ0A 1TAFA 3UTBD 1F66D 2F2AC 3MGPD 5B31C 1M18D 1P3BD 2AROD 1BH8A 5AV6C 3EPJA 3AN2B 4H9QA 1P3AD 5B2IB 5BNVB 1S32A 3AZMD 1AOIB 3AZFA 3IP4C 3REIC 3KWQB 3VH6T 1TZYB 1U35A 3REJB 5AVBC 3WTPC 1M1AC 4WU8B 1P3LB 5B33D 3W99C 3B0DC 3AZNA 1KX4B 3AFAA 2CV5C 1ZLAC 5B40D 5GT3B 4QLCA 4QLCB 5JA4A 5JA4B 5DNMB 3X1VB 1P34D 3A1KA 3WTPE 3TU4A 3TU4B 5E5AD 4WNNA 5AVCA 3P5JB 5G49B 5DNNB 2F8NH 5B32B 1KX3B 4NE3A 3MVDA 2ZY5A 3AN2C 2CWEA 3WA9B 3AZID 4J8UB 5B2IC 5GSUB 5GSUA 5B0YD 5AV9D 3AZJA 1ID3A 1AOIC 5AV5C 3REKA 5BS7A 2HIOD 1R4VA 4XUJD 3KWQC 1TZYC 2Y2LA 3REJC 2Y2KA 3MNND 4WU8C 1P3LC 1KX4C 4YM6D 3X1UA 5GT3C 4QLCC 5B2JB 5DNMC 3X1VC 3TU4C 4LD9A 3REHA 3FDDA 4Z5TA 1W2EA 3MGRC 4H9SA 4XZQB 5DNNC 5GT0A 2XD5A 5B32C 1S32D 3W97A 3AZFD 4Z66B 1KX3C 3KXBA 4KUDB 2RVQD 4JJNB 3UT9A 4NE5A 4ZUXB 2Y2OA 4KHAA 1U35D 3WA9C 4J8UC 3B6GA 1WWSA 5GSUC 5AV8A 3VH6W 3AFAD 2BYMB 3V9RA 1ULYA 3X1TB 1EQZB 4H9NB 4H9NA 4J8XD 2NQBB 2IO5B 5AVCD 1HQ3B 4H9OA 5CP6B 5CPJA 4R8PA 4E45A 1P3MB 5B2JC 5CPKB 5B1LA 3AV1B 3AV1A 5AY8B 3R45B 4XZQC 1P3PD 3AZJD 2PYOD 4Z66C 3AYWD 3X1SD 4KUDC 2ZY3A 4JJNC 3AZLB 4ZUXC 3AZLA 3W98D 5CHLB 1JFIB 4UPKA 4J8WA 3C1BA 3C1CD 5JRGA 2XD1A 4X23A 3UTAB 3X1TC 5CPIB 1EQZC 3AZGB 2NQBC 2IO5C 3AZED 1HQ3C 5CP6C 1P3OD 5AV6A 5GT0D 1P3MC 1P3BB 3W97D 1P3AB 3AZHC 5CPKC 2HUEB 4WU9B 5AY8C 3AZMB 3MGQD 2F8NK 3REIA 3REIB 3H0LC 2RIQA 3O62B 3W96D 2BG1A 1M19D 5AVBA 3WTPA 1P3FA 1H3OA 4Z2MH 1P3FB 2Y2NA 2YFWA 3AZLC 1M1AA 3W99A 5B33B 2CV5A 1ZLAA 2Y2QA 5B40B 4ZBJB 5CPJD 4R8PD 5E5AB 3NQUB 5CPIC 3UTAC 1P3ID 5B1LD 3AZGC 4WV4B 3RELB 2YFVB 3B6FD 3AN2A 1P3BC 5B2IA 1P3AC 5BNVA 4DRAA 2FJ7D 4KGCD 2HUEC 4WU9C 1AOIA 2DF4C 5AV5A 5AV5B 3AZMC 3AV2B 3KWQA 4J8WD 4XUJB 3C1BD 2DQNC 1Q9CA 1TZYA 3O62C 5GXQB 4DRBA 3REJA 3B0CT 1P3FC 4WU8A 1P3LA 5BT1D 1KX4A 4G91B 5B33C 2J8PA 5FUGB 5GT3A 4YM6B 4WJ3C 1BH9B 5B40C 3X1VA 5DNMA 3LJAB 4NE6A 4ZBJC 5B31D 5E5AC 5AV6D 4J8VD 3MGRB 5B1MB 5G49A 5DNNA 4WZSB 3MGRA 4YS3B 3MGSB 5B32A 2F8ND 1KX3A 3RELC 1P3KD 3WA9A 4J8UA 5AVBD 1B6WA 3LELB 3AV2C 3VH5A 2CV5D 2NZDD 4XUJC 5GXQC 3WKJD 4J8XB 3F6TA 3LZ0D 5KDMB 4G91C 5KDMA 5BO0B 4YM6C 1P3GB 4E44A 5B2JA 3LJAC 1B67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1J B;  1N1J A;  3AN2 D;  5B31 G;  5B1M C;  4XZQ A;  5B2I D;  3A6N B;  4YS3 C;  3MGS C;  1P3P B;  1AOI D;  4Z66 A;  2F8N G;  3AYW B;  4KUD A;  4JJN A;  4CAY B;  4UUZ B;  4ZUX A;  3X1S B;  2RVQ C;  3W98 B;  3REJ D;  4WU8 D;  4M6B A;  3AZN D;  3LEL C;  1KX4 D;  2BYM A;  5GT3 D;  3AZK B;  1KX5 A;  4QLC D;  3C1C B;  1KX5 B;  3X1T A;  1EQZ A;  3TU4 D;  2NQB A;  4H9R B;  4J8X C;  3VH5 T;  1HQ3 A;  5CP6 A;  5B0Z B;  5DNN D;  3KUY B;  3AZE B;  5F99 B;  1P3G C;  1P3M A;  1KX3 D;  3AZH B;  3AZH A;  3MVD D;  5CPK A;  2L5A A;  5AY8 A;  3WA9 D;  4J8U D;  3R45 A;  5GSU D;  3A6N C;  3MGQ B;  1P3P C;  1ID3 D;  3REK D;  3LZ1 B;  3W96 B;  3AYW C;  3X1S C;  3W98 C;  1JFI A;  5B24 B;  5C3I C;  3X1U D;  3AZK C;  1KX5 C;  3C1C C;  5B2J D;  3WAA B;  3UTA A;  5CPI A;  1P3I B;  4LD9 D;  3AZG A;  3UTB B;  3REH D;  3UTB A;  4HGA C;  4Z5T D;  1F66 B;  5B0Z C;  3MGP B;  3KUY C;  3AZE C;  5F99 C;  1M18 A;  1M18 B;  1P3B A;  2ARO B;  4Z66 D;  1P3A A;  3B6F B;  3KXB D;  4KUD D;  1KU5 A;  3UT9 D;  4WU9 A;  2FJ7 B;  3AZM A;  3B6G D;  3MGQ C;  5AV8 D;  3O62 A;  3W96 C;  3LZ1 C;  2BYK A;  2BYK B;  1WWI A;  4EO5 B;  4CSR B;  3X1T D;  5B33 A;  5B24 C;  5B40 A;  1HQ3 D;  5CP6 D;  1P34 B;  2JSS A;  5E5A A;  3NQU A;  3WAA C;  4J8V B;  5CPK D;  1P3I C;  3VH6 A;  5BNX B;  3UTB C;  3AV1 D;  2F8N B;  1F66 C;  3REL A;  3MGP C;  2YFV A;  1M18 C;  2ARO C;  3B6F C;  1P3K B;  3AZI B;  3AZL D;  5B0Y A;  5B0Y B;  4KGC C;  5AV9 B;  2FJ7 C;  3AV2 A;  2NZD B;  2HIO A;  2HIO B;  4XUJ A;  5GXQ A;  4AWL B;  5JRG D;  3WKJ B;  4EO5 C;  4X23 D;  3MNN B;  5CPI D;  4Z2M G;  1TAF B;  4YM6 A;  5FUG A;  1HTA A;  3LZ0 B;  3AZG D;  1BH9 A;  3LJA A;  1P34 C;  3B0B A;  4J8V C;  1BH8 B;  5B1M A;  4H9Q B;  4YS3 A;  3MGS A;  4WU9 D;  1S32 B;  3REI D;  3AZF B;  3KSY A;  3O62 D;  3WTP D;  3AZI C;  1U35 B;  1P3K C;  1P3F D;  1M1A D;  1BFM A;  5B0Y C;  3W99 D;  5AV9 C;  3LEL A;  1ZLA D;  3AZN B;  3AFA B;  2NZD C;  2HIO C;  4AWL C;  4J8X A;  4WNN B;  3WKJ C;  5AVC B;  3MNN C;  5BO0 A;  3LZ0 C;  1P3G A;  3REL D;  3MVD B;  3A6N A;  1P3P A;  3AZJ B;  2PYO A;  5AV5 D;  3AV2 D;  1S32 C;  1ID3 B;  2PYO B;  3AZF C;  3REK B;  3AYW A;  4CAY A;  4UUZ A;  3KWQ D;  3X1S A;  1TZY D;  3W98 A;  5GXQ D;  1U35 C;  1P3L D;  3NQJ B;  3NQJ A;  5C3I B;  3AZN C;  1A7W A;  3B0C W;  3X1U B;  3AFA C;  3C1C A;  3AZK A;  3X1V D;  5DNM D;  3LJA D;  4H9R A;  4LD9 B;  4HGA B;  3REH B;  5B0Z A;  3MGR D;  5B1M D;  4Z5T B;  5AVC C;  3KUY A;  3AZE A;  4YS3 D;  3MGS D;  5F99 A;  5B32 D;  1P3O A;  1P3O B;  5GT0 B;  3W97 B;  3MVD C;  3KXB B;  3UT9 B;  4KHA B;  3MGQ A;  3B6G B;  5AV8 B;  3LEL D;  3AZJ C;  2PYO C;  1ID3 C;  3W96 A;  3LZ1 A;  3REK C;  1M19 A;  1M19 B;  5BS7 C;  4G92 B;  3V9R B;  1F1E A;  5B24 A;  4H9P B;  4H9O B;  4H9P A;  3X1U C;  5CPJ B;  1P3G D;  4R8P B;  3WAA A;  4NFT A;  1P3I A;  5B1L B;  4LD9 C;  3REH C;  1F66 A;  3MGP A;  4Z5T C;  4XZQ D;  3A6N D;  4H9S C;  1P3O C;  2ARO A;  5GT0 C;  3B6F A;  5B32 G;  3W97 C;  2LY8 A;  4JJN D;  4ZUX D;  3KXB C;  2FJ7 A;  4KGC B;  4KGC A;  3UT9 C;  3B6G C;  5AV8 C;  4J8W B;  3C1B B;  3AZK D;  1KX5 D;  1M19 C;  5JRG B;  4CSR A;  4G92 C;  1EQZ D;  4X23 B;  2NQB D;  5B0Z D;  1P34 A;  3KUY D;  5F99 D;  1P3M D;  5CPJ C;  5B31 A;  5B31 B;  4R8P C;  3VH5 W;  5AV6 B;  4J8V A;  3AZH D;  5BNX A;  5B1L C;  3AV1 C;  2F8N A;  5AY8 D;  1P3K A;  3LZ1 D;  3AZI A;  5AVB B;  3WTP B;  1M1A B;  1H3O B;  5AV9 A;  2YFW B;  3W99 B;  3B0D B;  2CV5 B;  5B24 D;  1ZLA B;  2NZD A;  4J8W C;  3C1B C;  3WKJ A;  5JRG C;  3WAA D;  3MNN A;  3UTA D;  5BT1 C;  4X23 C;  3LZ0 A;  1TAF A;  3UTB D;  1F66 D;  3MGP D;  5B31 C;  1M18 D;  1P3B D;  2ARO D;  1BH8 A;  5AV6 C;  1P3A D;  3AN2 B;  4H9Q A;  5B2I B;  5BNV B;  1S32 A;  3AZM D;  1AOI B;  3AZF A;  3REI C;  3KWQ B;  3VH6 T;  1TZY B;  1U35 A;  3REJ B;  5AVB C;  3WTP C;  1M1A C;  4WU8 B;  1P3L B;  5B33 D;  3W99 C;  3B0D C;  3AZN A;  1KX4 B;  3AFA A;  2CV5 C;  1ZLA C;  5B40 D;  5GT3 B;  4QLC A;  4QLC B;  5JA4 A;  5JA4 B;  5DNM B;  3X1V B;  1P34 D;  3WTP E;  3TU4 A;  3TU4 B;  5E5A D;  4WNN A;  5AVC A;  5G49 B;  5DNN B;  2F8N H;  5B32 B;  1KX3 B;  4NE3 A;  3MVD A;  3AN2 C;  2CWE A;  3WA9 B;  3AZI D;  4J8U B;  5B2I C;  5GSU B;  5GSU A;  5B0Y D;  5AV9 D;  3AZJ A;  1ID3 A;  1AOI C;  5AV5 C;  3REK A;  5BS7 A;  2HIO D;  1R4V A;  4XUJ D;  3KWQ C;  1TZY C;  3REJ C;  4WU8 C;  3MNN D;  1P3L C;  1KX4 C;  4YM6 D;  3X1U A;  5GT3 C;  4QLC C;  5B2J B;  5DNM C;  3X1V C;  3TU4 C;  4LD9 A;  3REH A;  4Z5T A;  3MGR C;  4H9S A;  4XZQ B;  5DNN C;  5GT0 A;  5B32 C;  1S32 D;  3W97 A;  3AZF D;  4Z66 B;  1KX3 C;  3KXB A;  4KUD B;  2RVQ D;  4JJN B;  3UT9 A;  4NE5 A;  4ZUX B;  4KHA A;  1U35 D;  3WA9 C;  4J8U C;  3B6G A;  1WWS A;  5GSU C;  5AV8 A;  3VH6 W;  3AFA D;  2BYM B;  3V9R A;  1ULY A;  3X1T B;  1EQZ B;  4H9N B;  4H9N A;  4J8X D;  2NQB B;  2IO5 B;  5AVC D;  1HQ3 B;  4H9O A;  5CP6 B;  5CPJ A;  4R8P A;  4E45 A;  1P3M B;  5B2J C;  5CPK B;  5B1L A;  3AV1 B;  3AV1 A;  5AY8 B;  3R45 B;  4XZQ C;  1P3P D;  3AZJ D;  2PYO D;  4Z66 C;  3AYW D;  3X1S D;  4KUD C;  4JJN C;  3AZL B;  3AZL A;  4ZUX C;  3W98 D;  5CHL B;  1JFI B;  4J8W A;  3C1B A;  3C1C D;  5JRG A;  4X23 A;  3UTA B;  3X1T C;  5CPI B;  1EQZ C;  3AZG B;  2NQB C;  2IO5 C;  3AZE D;  1HQ3 C;  5CP6 C;  1P3O D;  5AV6 A;  5GT0 D;  1P3M C;  1P3B B;  3W97 D;  1P3A B;  3AZH C;  5CPK C;  2HUE B;  4WU9 B;  5AY8 C;  3AZM B;  3MGQ D;  2F8N K;  3REI A;  3REI B;  3O62 B;  3W96 D;  1M19 D;  5AVB A;  3WTP A;  1P3F A;  1H3O A;  4Z2M H;  1P3F B;  3AZL C;  2YFW A;  1M1A A;  3W99 A;  5B33 B;  2CV5 A;  1ZLA A;  5B40 B;  4ZBJ B;  5CPJ D;  4R8P D;  5E5A B;  3NQU B;  5CPI C;  3UTA C;  1P3I D;  5B1L D;  3AZG C;  4WV4 B;  3REL B;  2YFV B;  3B6F D;  3AN2 A;  1P3B C;  5B2I A;  1P3A C;  5BNV A;  4DRA A;  2FJ7 D;  4KGC D;  2HUE C;  4WU9 C;  1AOI A;  5AV5 A;  5AV5 B;  3AV2 B;  3AZM C;  3KWQ A;  4J8W D;  4XUJ B;  3C1B D;  1Q9C A;  1TZY A;  3O62 C;  5GXQ B;  4DRB A;  3REJ A;  3B0C T;  1P3F C;  4WU8 A;  1P3L A;  5BT1 D;  1KX4 A;  4G91 B;  5B33 C;  5FUG B;  5GT3 A;  4YM6 B;  1BH9 B;  5B40 C;  3X1V A;  5DNM A;  3LJA B;  4NE6 A;  4ZBJ C;  5B31 D;  5E5A C;  5AV6 D;  4J8V D;  3MGR B;  5B1M B;  5G49 A;  5DNN A;  4WZS B;  3MGR A;  4YS3 B;  3MGS B;  5B32 A;  2F8N D;  1KX3 A;  3REL C;  1P3K D;  3WA9 A;  4J8U A;  5AVB D;  1B6W A;  3LEL B;  3AV2 C;  3VH5 A;  2CV5 D;  2NZD D;  4XUJ C;  5GXQ C;  3WKJ D;  4J8X B;  3LZ0 D;  5KDM B;  4G91 C;  5KDM A;  5BO0 B;  4YM6 C;  1P3G B;  4E44 A;  5B2J A;  3LJA C;  1B67 A; 
#chains in the Genus database with same CATH topology
 1N1J B;  1N1J A;  3AN2 D;  5B31 G;  5B1M C;  4XZQ A;  1Z2C B;  5B2I D;  3A6N B;  4YS3 C;  3MGS C;  1P3P B;  1AOI D;  4Z66 A;  2F8N G;  3AYW B;  4KUD A;  4JJN A;  4CAY B;  4UUZ B;  4ZUX A;  3X1S B;  2RVQ C;  3W98 B;  3REJ D;  4WU8 D;  4M6B A;  3AZN D;  3LEL C;  1KX4 D;  2BYM A;  5GT3 D;  3AZK B;  1KX5 A;  4QLC D;  3C1C B;  1KX5 B;  3X1T A;  1EQZ A;  3TU4 D;  2NQB A;  4H9R B;  4J8X C;  3VH5 T;  1HQ3 A;  5CP6 A;  5B0Z B;  5DNN D;  3KUY B;  3AZE B;  5F99 B;  1P3G C;  1P3M A;  1KX3 D;  3AZH B;  3AZH A;  3MVD D;  5CPK A;  3EPH A;  2L5A A;  5AY8 A;  2JE5 A;  3WA9 D;  4J8U D;  3R45 A;  5GSU D;  3A6N C;  3MGQ B;  1P3P C;  1ID3 D;  3REK D;  3LZ1 B;  3W96 B;  3AYW C;  2ZM5 A;  4DQY B;  3X1S C;  3W98 C;  1JFI A;  5B24 B;  5C3I C;  3X1U D;  3AZK C;  1KX5 C;  2JCH A;  3C1C C;  5B2J D;  3WAA B;  3UTA A;  5CPI A;  1P3I B;  4LD9 D;  3AZG A;  3UTB B;  3REH D;  3UTB A;  4HGA C;  4Z5T D;  1F66 B;  5B0Z C;  3MGP B;  3KUY C;  3AZE C;  5F99 C;  1M18 A;  1M18 B;  1P3B A;  2ARO B;  4Z66 D;  1P3A A;  3EPL A;  3B6F B;  3KXB D;  4KUD D;  1KU5 A;  3UT9 D;  4WU9 A;  2FJ7 B;  3AZM A;  3A1I A;  3B6G D;  3MGQ C;  2G5H C;  5AV8 D;  3O62 A;  3W96 C;  3LZ1 C;  2BYK A;  2BYK B;  1WWI A;  4EO5 B;  4CSR B;  3X1T D;  5B33 A;  2Y2H A;  5B24 C;  5B40 A;  1HQ3 D;  5CP6 D;  1P34 B;  2JSS A;  2Y2G A;  5E5A A;  3NQU A;  3WAA C;  4J8V B;  5CPK D;  1P3I C;  3VH6 A;  5BNX B;  3UTB C;  3AV1 D;  2F8N B;  1F66 C;  3REL A;  3H0M C;  3MGP C;  1PZR A;  2YFV A;  1M18 C;  2Y2P A;  2ARO C;  3B6F C;  1P3K B;  3AZI B;  3AZL D;  5B0Y A;  5B0Y B;  4KGC C;  5AV9 B;  2FJ7 C;  3AV2 A;  2ZY2 A;  2NZD B;  2HIO A;  2HIO B;  4XUJ A;  5GXQ A;  4AWL B;  5JRG D;  2VQR A;  3WKJ B;  4EO5 C;  4X23 D;  3MNN B;  5CPI D;  1T3U A;  4Z2M G;  1TAF B;  5FUG A;  1HTA A;  4YM6 A;  3LZ0 B;  3AZG D;  1BH9 A;  3LJA A;  1P34 C;  3B0B A;  4J8V C;  1BH8 B;  5B1M A;  4H9Q B;  4YS3 A;  3MGS A;  4WU9 D;  1S32 B;  3REI D;  3AZF B;  3KSY A;  3O62 D;  3WTP D;  3AZI C;  1U35 B;  1P3K C;  1P3F D;  1M1A D;  1BFM A;  5B0Y C;  3W99 D;  5AV9 C;  3LEL A;  3EPK A;  1ZLA D;  2ZY4 A;  3AZN B;  3AFA B;  2NZD C;  2HIO C;  4AWL C;  4J8X A;  4WNN B;  3WKJ C;  5AVC B;  3MNN C;  5BO0 A;  3LZ0 C;  1P3G A;  3REL D;  3MVD B;  3A6N A;  1P3P A;  3AZJ B;  2PYO A;  5AV5 D;  3AV2 D;  1S32 C;  1ID3 B;  2PYO B;  2FFF B;  3AZF C;  3REK B;  3AYW A;  4CAY A;  4UUZ A;  3KWQ D;  3X1S A;  1TZY D;  3W98 A;  5GXQ D;  1U35 C;  1P3L D;  2Y2J A;  3NQJ B;  3NQJ A;  5C3I B;  3AZN C;  1A7W A;  2Y2M A;  3B0C W;  3X1U B;  3AFA C;  3C1C A;  3AZK A;  5DNM D;  3X1V D;  3LJA D;  4H9R A;  4LD9 B;  4HGA B;  3REH B;  5B0Z A;  3MGR D;  5B1M D;  4Z5T B;  5AVC C;  3KUY A;  3AZE A;  4YS3 D;  3MGS D;  5F99 A;  5B32 D;  1P3O A;  1P3O B;  5GT0 B;  3W97 B;  3MVD C;  3KXB B;  3UT9 B;  4KHA B;  3KFU G;  3MGQ A;  3B6G B;  5AV8 B;  3LEL D;  3AZJ C;  2PYO C;  1ID3 C;  3W96 A;  3LZ1 A;  3REK C;  1M19 A;  1M19 B;  5BS7 C;  3EG5 B;  3V9R B;  4G92 B;  1F1E A;  5B24 A;  3H0R C;  4H9P B;  4H9O B;  4H9P A;  3X1U C;  5CPJ B;  1P3G D;  4R8P B;  3WAA A;  4NFT A;  1P3I A;  5B1L B;  4LD9 C;  3REH C;  1F66 A;  3MGP A;  4Z5T C;  4XZQ D;  3A6N D;  4H9S C;  1P3O C;  2ARO A;  5GT0 C;  3B6F A;  5B32 G;  3W97 C;  2LY8 A;  4JJN D;  4ZUX D;  3KXB C;  2FJ7 A;  4KGC B;  4KGC A;  3UT9 C;  3B6G C;  5AV8 C;  4J8W B;  3C1B B;  3AL0 C;  3AZK D;  1KX5 D;  1M19 C;  5JRG B;  4CSR A;  4G92 C;  1EQZ D;  4X23 B;  2NQB D;  5B0Z D;  2Y2I A;  1P34 A;  3KUY D;  5F99 D;  1P3M D;  5CPJ C;  5B31 A;  5B31 B;  4R8P C;  3VH5 W;  5AV6 B;  4J8V A;  3AZH D;  5BNX A;  5B1L C;  3AV1 C;  2F8N A;  5AY8 D;  2W8S A;  1P3K A;  3LZ1 D;  3AZI A;  5AVB B;  3WTP B;  2G5I C;  1H3O B;  5AV9 A;  1M1A B;  2YFW B;  3W99 B;  3B0D B;  2CV5 B;  5B24 D;  1ZLA B;  2NZD A;  2UWX A;  4J8W C;  3C1B C;  3WKJ A;  5JRG C;  3WAA D;  3MNN A;  3UTA D;  5BT1 C;  4X23 C;  3LZ0 A;  1TAF A;  3UTB D;  1F66 D;  2F2A C;  3MGP D;  5B31 C;  1M18 D;  1P3B D;  2ARO D;  1BH8 A;  5AV6 C;  3EPJ A;  3AN2 B;  4H9Q A;  1P3A D;  5B2I B;  5BNV B;  1S32 A;  3AZM D;  1AOI B;  3AZF A;  3IP4 C;  3REI C;  3KWQ B;  3VH6 T;  1TZY B;  1U35 A;  3REJ B;  5AVB C;  3WTP C;  1M1A C;  4WU8 B;  1P3L B;  5B33 D;  3W99 C;  3B0D C;  3AZN A;  1KX4 B;  3AFA A;  2CV5 C;  1ZLA C;  5B40 D;  5GT3 B;  4QLC A;  4QLC B;  5JA4 A;  5JA4 B;  5DNM B;  3X1V B;  1P34 D;  3A1K A;  3WTP E;  3TU4 A;  3TU4 B;  5E5A D;  4WNN A;  5AVC A;  3P5J B;  5G49 B;  5DNN B;  2F8N H;  5B32 B;  1KX3 B;  4NE3 A;  3MVD A;  2ZY5 A;  3AN2 C;  2CWE A;  3WA9 B;  3AZI D;  4J8U B;  5B2I C;  5GSU B;  5GSU A;  5B0Y D;  5AV9 D;  3AZJ A;  1ID3 A;  1AOI C;  5AV5 C;  3REK A;  5BS7 A;  2HIO D;  1R4V A;  4XUJ D;  3KWQ C;  1TZY C;  2Y2L A;  3REJ C;  2Y2K A;  3MNN D;  4WU8 C;  1P3L C;  1KX4 C;  4YM6 D;  3X1U A;  5GT3 C;  4QLC C;  5B2J B;  5DNM C;  3X1V C;  3TU4 C;  4LD9 A;  3REH A;  3FDD A;  4Z5T A;  1W2E A;  3MGR C;  4H9S A;  4XZQ B;  5DNN C;  5GT0 A;  2XD5 A;  5B32 C;  1S32 D;  3W97 A;  3AZF D;  4Z66 B;  1KX3 C;  3KXB A;  4KUD B;  2RVQ D;  4JJN B;  3UT9 A;  4NE5 A;  4ZUX B;  2Y2O A;  4KHA A;  1U35 D;  3WA9 C;  4J8U C;  3B6G A;  1WWS A;  5GSU C;  5AV8 A;  3VH6 W;  3AFA D;  2BYM B;  3V9R A;  1ULY A;  3X1T B;  1EQZ B;  4H9N B;  4H9N A;  4J8X D;  2NQB B;  2IO5 B;  5AVC D;  1HQ3 B;  4H9O A;  5CP6 B;  5CPJ A;  4R8P A;  4E45 A;  1P3M B;  5B2J C;  5CPK B;  5B1L A;  3AV1 B;  3AV1 A;  5AY8 B;  3R45 B;  4XZQ C;  1P3P D;  3AZJ D;  2PYO D;  4Z66 C;  3AYW D;  3X1S D;  4KUD C;  2ZY3 A;  4JJN C;  3AZL B;  4ZUX C;  3AZL A;  3W98 D;  5CHL B;  1JFI B;  4UPK A;  4J8W A;  3C1B A;  3C1C D;  5JRG A;  2XD1 A;  4X23 A;  3UTA B;  3X1T C;  5CPI B;  1EQZ C;  3AZG B;  2NQB C;  2IO5 C;  3AZE D;  1HQ3 C;  5CP6 C;  1P3O D;  5AV6 A;  5GT0 D;  1P3M C;  1P3B B;  3W97 D;  1P3A B;  3AZH C;  5CPK C;  2HUE B;  4WU9 B;  5AY8 C;  3AZM B;  3MGQ D;  2F8N K;  3REI A;  3REI B;  3H0L C;  2RIQ A;  3O62 B;  3W96 D;  2BG1 A;  1M19 D;  5AVB A;  3WTP A;  1P3F A;  1H3O A;  4Z2M H;  1P3F B;  2Y2N A;  2YFW A;  3AZL C;  1M1A A;  3W99 A;  5B33 B;  2CV5 A;  1ZLA A;  2Y2Q A;  5B40 B;  4ZBJ B;  5CPJ D;  4R8P D;  5E5A B;  3NQU B;  5CPI C;  3UTA C;  1P3I D;  5B1L D;  3AZG C;  4WV4 B;  3REL B;  2YFV B;  3B6F D;  3AN2 A;  1P3B C;  5B2I A;  1P3A C;  5BNV A;  4DRA A;  2FJ7 D;  4KGC D;  2HUE C;  4WU9 C;  1AOI A;  2DF4 C;  5AV5 A;  5AV5 B;  3AZM C;  3AV2 B;  3KWQ A;  4J8W D;  4XUJ B;  3C1B D;  2DQN C;  1Q9C A;  1TZY A;  3O62 C;  5GXQ B;  4DRB A;  3REJ A;  3B0C T;  1P3F C;  4WU8 A;  1P3L A;  5BT1 D;  1KX4 A;  4G91 B;  5B33 C;  2J8P A;  5FUG B;  5GT3 A;  4YM6 B;  4WJ3 C;  1BH9 B;  5B40 C;  3X1V A;  5DNM A;  3LJA B;  4NE6 A;  4ZBJ C;  5B31 D;  5E5A C;  5AV6 D;  4J8V D;  3MGR B;  5B1M B;  5G49 A;  5DNN A;  4WZS B;  3MGR A;  4YS3 B;  3MGS B;  5B32 A;  2F8N D;  1KX3 A;  3REL C;  1P3K D;  3WA9 A;  4J8U A;  5AVB D;  1B6W A;  3LEL B;  3AV2 C;  3VH5 A;  2CV5 D;  2NZD D;  4XUJ C;  5GXQ C;  3WKJ D;  4J8X B;  3F6T A;  3LZ0 D;  5KDM B;  4G91 C;  5KDM A;  5BO0 B;  4YM6 C;  1P3G B;  4E44 A;  5B2J A;  3LJA C;  1B67 A; 
#chains in the Genus database with same CATH homology
 1N1J B;  1N1J A;  3AN2 D;  5B31 G;  5B1M C;  4XZQ A;  1Z2C B;  5B2I D;  3A6N B;  4YS3 C;  3MGS C;  1P3P B;  1AOI D;  4Z66 A;  2F8N G;  3AYW B;  4KUD A;  4JJN A;  4CAY B;  4UUZ B;  4ZUX A;  3X1S B;  2RVQ C;  3W98 B;  3REJ D;  4WU8 D;  4M6B A;  3AZN D;  3LEL C;  1KX4 D;  2BYM A;  5GT3 D;  3AZK B;  1KX5 A;  4QLC D;  3C1C B;  1KX5 B;  3X1T A;  1EQZ A;  3TU4 D;  2NQB A;  4H9R B;  4J8X C;  3VH5 T;  1HQ3 A;  5CP6 A;  5B0Z B;  5DNN D;  3KUY B;  3AZE B;  5F99 B;  1P3G C;  1P3M A;  1KX3 D;  3AZH B;  3AZH A;  3MVD D;  5CPK A;  3EPH A;  2L5A A;  5AY8 A;  2JE5 A;  3WA9 D;  4J8U D;  3R45 A;  5GSU D;  3A6N C;  3MGQ B;  1P3P C;  1ID3 D;  3REK D;  3LZ1 B;  3W96 B;  3AYW C;  2ZM5 A;  4DQY B;  3X1S C;  3W98 C;  1JFI A;  5B24 B;  5C3I C;  3X1U D;  3AZK C;  1KX5 C;  2JCH A;  3C1C C;  5B2J D;  3WAA B;  3UTA A;  5CPI A;  1P3I B;  4LD9 D;  3AZG A;  3UTB B;  3REH D;  3UTB A;  4HGA C;  4Z5T D;  1F66 B;  5B0Z C;  3MGP B;  3KUY C;  3AZE C;  5F99 C;  1M18 A;  1M18 B;  1P3B A;  2ARO B;  4Z66 D;  1P3A A;  3EPL A;  3B6F B;  3KXB D;  4KUD D;  1KU5 A;  3UT9 D;  4WU9 A;  2FJ7 B;  3AZM A;  3A1I A;  3B6G D;  3MGQ C;  2G5H C;  5AV8 D;  3O62 A;  3W96 C;  3LZ1 C;  2BYK A;  2BYK B;  1WWI A;  4EO5 B;  4CSR B;  3X1T D;  5B33 A;  2Y2H A;  5B24 C;  5B40 A;  1HQ3 D;  5CP6 D;  1P34 B;  2JSS A;  2Y2G A;  5E5A A;  3NQU A;  3WAA C;  4J8V B;  5CPK D;  1P3I C;  3VH6 A;  5BNX B;  3UTB C;  3AV1 D;  2F8N B;  1F66 C;  3REL A;  3H0M C;  3MGP C;  1PZR A;  2YFV A;  1M18 C;  2Y2P A;  2ARO C;  3B6F C;  1P3K B;  3AZI B;  3AZL D;  5B0Y A;  5B0Y B;  4KGC C;  5AV9 B;  2FJ7 C;  3AV2 A;  2ZY2 A;  2NZD B;  2HIO A;  2HIO B;  4XUJ A;  5GXQ A;  4AWL B;  5JRG D;  2VQR A;  3WKJ B;  4EO5 C;  4X23 D;  3MNN B;  5CPI D;  1T3U A;  4Z2M G;  1TAF B;  5FUG A;  1HTA A;  4YM6 A;  3LZ0 B;  3AZG D;  1BH9 A;  3LJA A;  1P34 C;  3B0B A;  4J8V C;  1BH8 B;  5B1M A;  4H9Q B;  4YS3 A;  3MGS A;  4WU9 D;  1S32 B;  3REI D;  3AZF B;  3KSY A;  3O62 D;  3WTP D;  3AZI C;  1U35 B;  1P3K C;  1P3F D;  1M1A D;  1BFM A;  5B0Y C;  3W99 D;  5AV9 C;  3LEL A;  3EPK A;  1ZLA D;  2ZY4 A;  3AZN B;  3AFA B;  2NZD C;  2HIO C;  4AWL C;  4J8X A;  4WNN B;  3WKJ C;  5AVC B;  3MNN C;  5BO0 A;  3LZ0 C;  1P3G A;  3REL D;  3MVD B;  3A6N A;  1P3P A;  3AZJ B;  2PYO A;  5AV5 D;  3AV2 D;  1S32 C;  1ID3 B;  2PYO B;  2FFF B;  3AZF C;  3REK B;  3AYW A;  4CAY A;  4UUZ A;  3KWQ D;  3X1S A;  1TZY D;  3W98 A;  5GXQ D;  1U35 C;  1P3L D;  2Y2J A;  3NQJ B;  3NQJ A;  5C3I B;  3AZN C;  1A7W A;  2Y2M A;  3B0C W;  3X1U B;  3AFA C;  3C1C A;  3AZK A;  5DNM D;  3X1V D;  3LJA D;  4H9R A;  4LD9 B;  4HGA B;  3REH B;  5B0Z A;  3MGR D;  5B1M D;  4Z5T B;  5AVC C;  3KUY A;  3AZE A;  4YS3 D;  3MGS D;  5F99 A;  5B32 D;  1P3O A;  1P3O B;  5GT0 B;  3W97 B;  3MVD C;  3KXB B;  3UT9 B;  4KHA B;  3KFU G;  3MGQ A;  3B6G B;  5AV8 B;  3LEL D;  3AZJ C;  2PYO C;  1ID3 C;  3W96 A;  3LZ1 A;  3REK C;  1M19 A;  1M19 B;  5BS7 C;  3EG5 B;  3V9R B;  4G92 B;  1F1E A;  5B24 A;  3H0R C;  4H9P B;  4H9O B;  4H9P A;  3X1U C;  5CPJ B;  1P3G D;  4R8P B;  3WAA A;  4NFT A;  1P3I A;  5B1L B;  4LD9 C;  3REH C;  1F66 A;  3MGP A;  4Z5T C;  4XZQ D;  3A6N D;  4H9S C;  1P3O C;  2ARO A;  5GT0 C;  3B6F A;  5B32 G;  3W97 C;  2LY8 A;  4JJN D;  4ZUX D;  3KXB C;  2FJ7 A;  4KGC B;  4KGC A;  3UT9 C;  3B6G C;  5AV8 C;  4J8W B;  3C1B B;  3AL0 C;  3AZK D;  1KX5 D;  1M19 C;  5JRG B;  4CSR A;  4G92 C;  1EQZ D;  4X23 B;  2NQB D;  5B0Z D;  2Y2I A;  1P34 A;  3KUY D;  5F99 D;  1P3M D;  5CPJ C;  5B31 A;  5B31 B;  4R8P C;  3VH5 W;  5AV6 B;  4J8V A;  3AZH D;  5BNX A;  5B1L C;  3AV1 C;  2F8N A;  5AY8 D;  2W8S A;  1P3K A;  3LZ1 D;  3AZI A;  5AVB B;  3WTP B;  2G5I C;  1H3O B;  5AV9 A;  1M1A B;  2YFW B;  3W99 B;  3B0D B;  2CV5 B;  5B24 D;  1ZLA B;  2NZD A;  2UWX A;  4J8W C;  3C1B C;  3WKJ A;  5JRG C;  3WAA D;  3MNN A;  3UTA D;  5BT1 C;  4X23 C;  3LZ0 A;  1TAF A;  3UTB D;  1F66 D;  2F2A C;  3MGP D;  5B31 C;  1M18 D;  1P3B D;  2ARO D;  1BH8 A;  5AV6 C;  3EPJ A;  3AN2 B;  4H9Q A;  1P3A D;  5B2I B;  5BNV B;  1S32 A;  3AZM D;  1AOI B;  3AZF A;  3IP4 C;  3REI C;  3KWQ B;  3VH6 T;  1TZY B;  1U35 A;  3REJ B;  5AVB C;  3WTP C;  1M1A C;  4WU8 B;  1P3L B;  5B33 D;  3W99 C;  3B0D C;  3AZN A;  1KX4 B;  3AFA A;  2CV5 C;  1ZLA C;  5B40 D;  5GT3 B;  4QLC A;  4QLC B;  5JA4 A;  5JA4 B;  5DNM B;  3X1V B;  1P34 D;  3A1K A;  3WTP E;  3TU4 A;  3TU4 B;  5E5A D;  4WNN A;  5AVC A;  3P5J B;  5G49 B;  5DNN B;  2F8N H;  5B32 B;  1KX3 B;  4NE3 A;  3MVD A;  2ZY5 A;  3AN2 C;  2CWE A;  3WA9 B;  3AZI D;  4J8U B;  5B2I C;  5GSU B;  5GSU A;  5B0Y D;  5AV9 D;  3AZJ A;  1ID3 A;  1AOI C;  5AV5 C;  3REK A;  5BS7 A;  2HIO D;  1R4V A;  4XUJ D;  3KWQ C;  1TZY C;  2Y2L A;  3REJ C;  2Y2K A;  3MNN D;  4WU8 C;  1P3L C;  1KX4 C;  4YM6 D;  3X1U A;  5GT3 C;  4QLC C;  5B2J B;  5DNM C;  3X1V C;  3TU4 C;  4LD9 A;  3REH A;  3FDD A;  4Z5T A;  1W2E A;  3MGR C;  4H9S A;  4XZQ B;  5DNN C;  5GT0 A;  2XD5 A;  5B32 C;  1S32 D;  3W97 A;  3AZF D;  4Z66 B;  1KX3 C;  3KXB A;  4KUD B;  2RVQ D;  4JJN B;  3UT9 A;  4NE5 A;  4ZUX B;  2Y2O A;  4KHA A;  1U35 D;  3WA9 C;  4J8U C;  3B6G A;  1WWS A;  5GSU C;  5AV8 A;  3VH6 W;  3AFA D;  2BYM B;  3V9R A;  1ULY A;  3X1T B;  1EQZ B;  4H9N B;  4H9N A;  4J8X D;  2NQB B;  2IO5 B;  5AVC D;  1HQ3 B;  4H9O A;  5CP6 B;  5CPJ A;  4R8P A;  4E45 A;  1P3M B;  5B2J C;  5CPK B;  5B1L A;  3AV1 B;  3AV1 A;  5AY8 B;  3R45 B;  4XZQ C;  1P3P D;  3AZJ D;  2PYO D;  4Z66 C;  3AYW D;  3X1S D;  4KUD C;  2ZY3 A;  4JJN C;  3AZL B;  4ZUX C;  3AZL A;  3W98 D;  5CHL B;  1JFI B;  4UPK A;  4J8W A;  3C1B A;  3C1C D;  5JRG A;  2XD1 A;  4X23 A;  3UTA B;  3X1T C;  5CPI B;  1EQZ C;  3AZG B;  2NQB C;  2IO5 C;  3AZE D;  1HQ3 C;  5CP6 C;  1P3O D;  5AV6 A;  5GT0 D;  1P3M C;  1P3B B;  3W97 D;  1P3A B;  3AZH C;  5CPK C;  2HUE B;  4WU9 B;  5AY8 C;  3AZM B;  3MGQ D;  2F8N K;  3REI A;  3REI B;  3H0L C;  2RIQ A;  3O62 B;  3W96 D;  2BG1 A;  1M19 D;  5AVB A;  3WTP A;  1P3F A;  1H3O A;  4Z2M H;  1P3F B;  2Y2N A;  2YFW A;  3AZL C;  1M1A A;  3W99 A;  5B33 B;  2CV5 A;  1ZLA A;  2Y2Q A;  5B40 B;  4ZBJ B;  5CPJ D;  4R8P D;  5E5A B;  3NQU B;  5CPI C;  3UTA C;  1P3I D;  5B1L D;  3AZG C;  4WV4 B;  3REL B;  2YFV B;  3B6F D;  3AN2 A;  1P3B C;  5B2I A;  1P3A C;  5BNV A;  4DRA A;  2FJ7 D;  4KGC D;  2HUE C;  4WU9 C;  1AOI A;  2DF4 C;  5AV5 A;  5AV5 B;  3AZM C;  3AV2 B;  3KWQ A;  4J8W D;  4XUJ B;  3C1B D;  2DQN C;  1Q9C A;  1TZY A;  3O62 C;  5GXQ B;  4DRB A;  3REJ A;  3B0C T;  1P3F C;  4WU8 A;  1P3L A;  5BT1 D;  1KX4 A;  4G91 B;  5B33 C;  2J8P A;  5FUG B;  5GT3 A;  4YM6 B;  4WJ3 C;  1BH9 B;  5B40 C;  3X1V A;  5DNM A;  3LJA B;  4NE6 A;  4ZBJ C;  5B31 D;  5E5A C;  5AV6 D;  4J8V D;  3MGR B;  5B1M B;  5G49 A;  5DNN A;  4WZS B;  3MGR A;  4YS3 B;  3MGS B;  5B32 A;  2F8N D;  1KX3 A;  3REL C;  1P3K D;  3WA9 A;  4J8U A;  5AVB D;  1B6W A;  3LEL B;  3AV2 C;  3VH5 A;  2CV5 D;  2NZD D;  4XUJ C;  5GXQ C;  3WKJ D;  4J8X B;  3F6T A;  3LZ0 D;  5KDM B;  4G91 C;  5KDM A;  5BO0 B;  4YM6 C;  1P3G B;  4E44 A;  5B2J A;  3LJA C;  1B67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...