4Z2MG

Crystal structure of human spt16 mid-aid/h3-h4 tetramer fact histone complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
b'TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated molecular mechanism directing nucleosome reorganization by human FACT.
pubmed doi rcsb
molecule keywords FACT complex subunit SPT16
source organism Homo sapiens
molecule tags Transcription/dna binding protein
total genus 26
structure length 77
sequence length 77
chains with identical sequence I
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z2mG00
1P3AA 2FJ7A 3AZGD 3AZJA 5B2JD 2HIOB 4R8PC 5CPJA 4AWLC 5GXQC 5GSUB 3W99A 4QLCB 2AROA 1KX4A 5FUGA 1P3AC 3TU4D 3AZJC 3UTAA 1B67A 4CSRA 3X1UB 5BNVA 3O62A 5B24B 1U35D 3LZ1B 3X1TB 1ZLAA 3VH6A 2BYKA 5DNMA 4E45A 3UTAC 5CHLB 3KSYA 3WTPB 3REKC 3WAAD 4HGAB 1P3OB 5DNNB 5B0ZB 3O62C 3LJAD 4EO5C 5AY8A 4ZUXB 5DNMC 1JFIB 4WU9A 5JRGB 1ULYA 3AN2A 5B32B 4KHAB 1F66A 3W98D 2JSSA 3AZFD 3WKJD 1P3IB 5F99C 4LD9A 3MGSA 4WU9C 3REJD 4R8PB 5GXQD 3VH5A 1WWIA 4J8XB 3REIC 1P3AD 4NE3A 2F8NA 3AZJD 2FJ7B 3A6NA 1M1AB 3B0CW 3AZMA 5AV5A 3KWQC 5CPJB 4YS3A 1P3MA 3UTBA 3X1SB 3AZEA 3W99B 4UUZB 2AROB 1KX4B 1HQ3B 3B6GD 3MVDA 4J8VB 3UTAD 3AZMC 4CSRB 3REKD 1EQZA 5AV5C 4X23D 4YS3C 5AV8A 5BNVB 4XZQD 3UTBC 3O62B 4XUJA 1P3GA 1ZLAB 4Z2MG 2BYKB 5DNMB 3AZIA 1EQZC 5AV9D 2HIOA 4XUJC 3AZKD 5CP6C 1P3GC 4H9RB 5F99D 5BO0A 5AY8B 3AFAB 4QLCA 5B40D 4KGCD 4WU9D 3MGQA 3AZIC 5B1LB 5B2IA 3AN2B 1F66B 1KX3A 2HIOC 5BT1C 3R45A 3W96A 5GSUC 4QLCC 3REID 3UT9D 4LD9B 3MGQC 3MGSB 5B2IC 3KWQD 3X1UC 3X1VD 1BH8B 1S32D 3W96C 5B24C 1M18A 3LELA 5B33A 2F8NB 4ZUXA 3A6NB 3AZMD 3AV2B 1P3BD 5AV5B 5JRGA 3LZ0A 3REHA 4HGAC 4KHAA 5E5AA 5B32A 5DNNC 3UTBD 1P3MB 1P3OC 3AZEB 1P3PB 3MGPA 1P3FA 3MVDB 3LELC 5B33C 4ZUXC 1EQZD 3MGRA 3KUYD 5JRGC 4ZBJB 5B32C 5E5AC 3WA9B 5AV8B 4XUJD 1BFMA 5CP6D 3MGPC 1P3GD 1P3FC 5AVCA 1ID3D 4H9SC 3AZIB 3MGRC 1M1AA 3AYWA 2HIOD 5BT1D 5B0YA 4E44A 5BO0B 5GSUD 4QLCD 5AVCC 3X1SA 4UUZA 1TZYD 3MGQB 4J8XC 1HQ3A 5B2IB 4J8VA 3NQUA 2FJ7C 1M1AC 1KX3B 3X1UD 5CPJC 3R45B 3W96B 5B24D 3W99C 4YM6A 3LZ1D 4Z66B 3X1TD 3X1SC 2AROC 1KX4C 1HQ3C 3W97A 5AVBA 4J8VC 2YFVA 3WTPD 2NZDA 1P3OD 5DNND 5B0ZD 2PYOA 4YM6C 4H9NA 5KDMA 5AV6A 1M18B 4H9RA 3AFAA 5B33B 3LELB 1ZLAC 5AVBC 1H3OB 1P34A 4M6BA 5JRGD 5B1LA 3LZ0B 3REHB 5E5AB 2PYOC 3MGPB 1P3FB 4H9OA 1P3ID 5AY8C 3KXBA 3AFAC 4JJNA 3B6FB 3C1BA 4NE5A 3AZNA 4J8UB 3MGRB 5B1LC 3AN2C 4NE6A 1F66C 2CWEA 4R8PD 5G49A 1AOIA 1BH8A 2HUEB 5AVCB 3C1BC 3AZNC 4J8XD 1KU5A 4LD9C 3MGSC 5GT0B 2FJ7D 1M1AD 3AYWB 3AV2A 5B0YB 5CPJD 3AZHB 3W99D 3X1SD 5B31B 4G92B 2AROD 1P3PA 1KX4D 1HQ3D 4J8VD 4KUDA 4J8WB 5B1MA 3NQUB 3A6NC 3AV2C 1KX5A 2NQBA 3REJB 3WA9A 1P3MC 3O62D 4WV4B 4YM6B 3AZEC 2CV5A 1P3PC 1ZLAD 5CPIA 3MVDC 3W97B 5AVBB 5DNMD 1KX5C 2YFVB 2NZDB 5CPKA 3MNNA 4ZBJC 3WA9C 1Q9CA 4Z5TB 5AV8C 2PYOB 2CV5C 4H9NB 5AY8D 5KDMB 5AV6B 5CPIC 3B6GB 1P34B 5B1LD 1P3LB 3AV1A 5CPKC 3MNNC 3AN2D 1F66D 5GT3A 4H9OB 4XZQB 3KXBB 4JJNB 1P3KB 3C1CA 3C1BB 3AZNB 4Z66A 4LD9D 3AZLA 3MGSD 3AV1C 1KX3C 5G49B 3AZGA 1AOIB 1M19B 4Z66C 3AZLC 4WZSB 5B32G 2F8ND 3A6ND 3AV2D 1H3OA 3TU4A 5AV5D 2BYMB 3AZGC 4YS3D 1P3MD 4Z2MH 3AZED 1P3PD 3MVDD 2YFWA 1M18C 3B6FA 4KUDB 5B1MB 3UT9B 1U35A 1KX5B 4J8UA 2NQBB 3WA9D 3LZ0C 5AV8D 3REHC 1F1EA 1TAFA 2CV5B 3X1VB 5CPIB 3B6FC 3LJAA 1U35C 3AZID 4J8UC 5CPKB 3MNNB 3RELB 5GT0A 3W98A 3AZFA 3AZHA 3LJAC 2HUEC 5B31A 5BNXB 3MGQD 3V9RA 5B2ID 3AV1B 5GT0C 4J8WA 4G91B 1KX3D 3AYWC 5JA4B 2RVQC 5GT3B 5B0YC 3REJA 3AZHC 3W96D 3B0DB 3C1CB 5B31C 4Z66D 4G92C 5GXQA 3AZLB 4CAYB 4J8WC 4WU8B 3AZGB 3REJC 5B2JB 4Z5TA 1M18D 3LELD 5B33D 4ZUXD 3W97C 1TZYB 3B6GA 3TU4B 1P3LA 2NZDC 3LZ0D 3REHD 5B32D 5E5AD 4Z5TC 3REKA 1BH9A 3MGPD 4X23A 1P3FD 5AV6C 2YFWB 3B6FD 4XZQA 1P3KA 1R4VA 1U35B 4J8UD 3B6GC 3WTPE 1P34C 3MGRD 1P3LC 1N1JA 1TAFB 4NFTA 4X23C 3WAAB 5AV9A 2F8NG 1M19A 4XZQC 3KXBC 4JJNC 5AVCD 3LJAB 1P3KC 3NQJB 3AZKA 5C3IB 5F99A 3B0CT 5GT0D 5B40A 2IO5C 3AYWD 2RVQD 4KGCA 4WNNB 4H9QA 5B0YD 5AV9C 2BYMA 3AZHD 3AZFB 1AOIC 1M19C 3W98B 2LY8A 5B31D 3WKJB 3AZKC 3V9RB 4J8WD 5B40C 3REIA 3UT9A 4KGCC 4YM6D 3KWQA 4AWLB 5GXQB 3X1VA 1S32A 3W97D 5AVBD 4KUDC 5B1MC 3UT9C 1P3AB 2NZDD 3B0BA 1B6WA 3RELA 3AZJB 2NQBC 5BS7A 4Z5TD 2PYOD 1P3BA 5AV6D 3X1VC 3AFAD 1S32C 4DRAA 5FUGB 1P34D 5BNXA 4DRBA 1P3LD 1HTAA 3RELC 5BS7C 3UTAB 2F8NH 4H9PA 5JA4A 3REKB 1BH9B 1P3BC 3KUYA 4X23B 3KXBD 4JJND 1P3KD 3VH6T 3C1BD 4EO5B 5CP6A 3AZND 4CAYA 2IO5B 4G91C 1ID3A 4WU8A 1N1JB 3KUYC 5GT3C 1AOID 5AV9B 1M19D 1WWSA 5B2JA 3B0DC 3C1CC 3AZKB 5F99B 5GSUA 5B40B 1ID3C 4KGCB 1TZYA 4WU8C 4H9QB 4WU9B 1A7WA 5B2JC 3X1UA 4KUDD 5B1MD 5B24A 3LZ1A 3REIB 3X1TA 1TZYC 3VH6W 1KX5D 3TU4C 2NQBD 3WTPA 3VH5T 2CV5D 3KWQB 1P3OA 3WAAA 5DNNA 5B0ZA 5CPID 1S32B 3LZ1C 3X1TC 3NQJA 2F8NK 5CPKD 3MNND 3RELD 3AZMB 1JFIA 5B31G 4WNNA 3WTPC 1P3BB 4YS3B 3WAAC 5B0ZC 3UTBB 3WKJA 1P3IA 5C3IC 2L5AA 3AV1D 4H9PB 4H9SA 1EQZB 5GT3D 3KUYB 3W98C 3AZFC 3C1CD 4XUJB 4R8PA 5CP6B 1P3GB 3WKJC 3AZLD 1P3IC 3VH5W 4WU8D 4J8XA 1ID3B
chains in the Genus database with same CATH superfamily
1P3AA 2FJ7A 3AZGD 3AZJA 5B2JD 2HIOB 3A1KA 4R8PC 5CPJA 2JCHA 4AWLC 5GXQC 5GSUB 3W99A 4QLCB 2AROA 1KX4A 5FUGA 1P3AC 3TU4D 2Y2QA 1PZRA 3AZJC 3UTAA 1B67A 4CSRA 3X1UB 5BNVA 3O62A 5B24B 1U35D 3LZ1B 3X1TB 1ZLAA 3VH6A 2BYKA 5DNMA 4E45A 2Y2OA 3UTAC 5CHLB 3KSYA 3WTPB 3REKC 3WAAD 4HGAB 1P3OB 5DNNB 5B0ZB 3O62C 3LJAD 4EO5C 5AY8A 4ZUXB 5DNMC 1JFIB 4WU9A 5JRGB 1ULYA 3AN2A 5B32B 4KHAB 1F66A 3W98D 2JSSA 3AZFD 2ZM5A 3WKJD 1P3IB 5F99C 4LD9A 3MGSA 4WU9C 3REJD 4R8PB 5GXQD 3VH5A 1WWIA 4J8XB 3REIC 1P3AD 4NE3A 2F8NA 3AZJD 2FJ7B 3A6NA 1M1AB 3B0CW 3AZMA 5AV5A 3KWQC 5CPJB 4YS3A 1P3MA 3UTBA 3X1SB 3AZEA 3W99B 4UUZB 2FFFB 2AROB 1KX4B 1HQ3B 3B6GD 3MVDA 4J8VB 3UTAD 3AZMC 4CSRB 3REKD 1EQZA 5AV5C 4X23D 4YS3C 5AV8A 5BNVB 4XZQD 3UTBC 3O62B 4XUJA 1P3GA 1ZLAB 4Z2MG 4WJ3C 2BYKB 5DNMB 3IP4C 3AZIA 1EQZC 5AV9D 2HIOA 4XUJC 3AZKD 5CP6C 1P3GC 4H9RB 5F99D 5BO0A 5AY8B 3AFAB 2Y2JA 4QLCA 5B40D 1Z2CB 4KGCD 4WU9D 3MGQA 3AZIC 5B1LB 2JE5A 5B2IA 3AN2B 1F66B 1KX3A 2ZY4A 2HIOC 5BT1C 2G5HC 3R45A 3W96A 5GSUC 4QLCC 3REID 3UT9D 4LD9B 3MGQC 3MGSB 5B2IC 3KWQD 3X1UC 3X1VD 1BH8B 1S32D 3W96C 2Y2GA 5B24C 1M18A 3LELA 5B33A 2F8NB 4ZUXA 3A6NB 3AZMD 3AV2B 1P3BD 5AV5B 5JRGA 3LZ0A 3REHA 4HGAC 4KHAA 5E5AA 5B32A 5DNNC 3UTBD 1P3MB 1P3OC 3AZEB 1P3PB 2RIQA 3MGPA 1P3FA 3MVDB 3LELC 5B33C 4ZUXC 4DQYB 2BG1A 1EQZD 3MGRA 3KUYD 5JRGC 4ZBJB 1W2EA 5E5AC 5B32C 5AV8B 3WA9B 4XUJD 1BFMA 3F6TA 5CP6D 3MGPC 1P3GD 1P3FC 5AVCA 1ID3D 4H9SC 3AZIB 3MGRC 1M1AA 3AYWA 2HIOD 5BT1D 5B0YA 2ZY3A 4E44A 5BO0B 5GSUD 4QLCD 5AVCC 3X1SA 4UUZA 2XD1A 1TZYD 3MGQB 4J8XC 1HQ3A 5B2IB 4J8VA 3NQUA 2FJ7C 1M1AC 1KX3B 3X1UD 5CPJC 3R45B 3W96B 5B24D 3W99C 4YM6A 3LZ1D 4Z66B 3X1TD 3X1SC 2AROC 1KX4C 1HQ3C 3W97A 5AVBA 4J8VC 2YFVA 3WTPD 2NZDA 1P3OD 5DNND 5B0ZD 2PYOA 4YM6C 4H9NA 5KDMA 5AV6A 1M18B 4H9RA 3AFAA 5B33B 3LELB 1ZLAC 5AVBC 1H3OB 1P34A 4M6BA 5JRGD 5B1LA 3LZ0B 3REHB 5E5AB 2PYOC 3MGPB 2ZY2A 1P3FB 4H9OA 1P3ID 2Y2LA 5AY8C 3KXBA 3AFAC 4JJNA 3B6FB 3C1BA 4NE5A 3AZNA 4J8UB 3MGRB 5B1LC 3AN2C 4NE6A 1F66C 2CWEA 1T3UA 4R8PD 2Y2NA 5G49A 1AOIA 1BH8A 2HUEB 5AVCB 3C1BC 3AL0C 3AZNC 4J8XD 1KU5A 4LD9C 3MGSC 3H0RC 5GT0B 2FJ7D 1M1AD 3AYWB 3AV2A 3FDDA 5B0YB 5CPJD 3AZHB 3W99D 2Y2KA 3X1SD 5B31B 4G92B 2AROD 1P3PA 1KX4D 1HQ3D 4J8VD 4KUDA 4J8WB 5B1MA 3NQUB 3A6NC 3AV2C 1KX5A 2NQBA 3REJB 2Y2HA 1P3MC 3WA9A 3O62D 4WV4B 4YM6B 3AZEC 2CV5A 1P3PC 1ZLAD 5CPIA 3MVDC 3W97B 5AVBB 5DNMD 1KX5C 2YFVB 2NZDB 5CPKA 3MNNA 4ZBJC 3KFUG 3WA9C 1Q9CA 4Z5TB 5AV8C 2PYOB 2CV5C 4H9NB 5AY8D 5KDMB 5AV6B 5CPIC 3B6GB 1P34B 5B1LD 1P3LB 3AV1A 5CPKC 3MNNC 3AN2D 1F66D 5GT3A 4H9OB 4XZQB 3KXBB 4JJNB 1P3KB 3C1CA 3C1BB 3AZNB 4Z66A 4LD9D 3AZLA 3MGSD 3AV1C 3A1IA 1KX3C 5G49B 3AZGA 1AOIB 1M19B 3H0LC 4Z66C 3AZLC 4WZSB 5B32G 2F8ND 3A6ND 3AV2D 1H3OA 3TU4A 5AV5D 2BYMB 3AZGC 4YS3D 1P3MD 4Z2MH 3AZED 1P3PD 3MVDD 2YFWA 2ZY5A 1M18C 3B6FA 4KUDB 5B1MB 3UT9B 1U35A 1KX5B 4J8UA 2NQBB 3WA9D 3LZ0C 5AV8D 3REHC 1F1EA 1TAFA 2CV5B 3X1VB 5CPIB 3B6FC 3LJAA 1U35C 3AZID 4J8UC 5CPKB 3MNNB 3RELB 5GT0A 2Y2IA 3W98A 3AZFA 3AZHA 3LJAC 2HUEC 5B31A 5BNXB 3MGQD 3V9RA 5B2ID 3AV1B 5GT0C 4J8WA 4G91B 1KX3D 2XD5A 5JA4B 2RVQC 3AYWC 5GT3B 5B0YC 3REJA 3AZHC 3W96D 3B0DB 3C1CB 2W8SA 5B31C 4Z66D 4G92C 5GXQA 3AZLB 4CAYB 4J8WC 4WU8B 2F2AC 3AZGB 3REJC 5B2JB 4Z5TA 1M18D 3LELD 5B33D 4ZUXD 3W97C 1TZYB 3B6GA 3TU4B 1P3LA 2NZDC 3LZ0D 3REHD 5B32D 5E5AD 4Z5TC 3REKA 1BH9A 2VQRA 3MGPD 4X23A 1P3FD 5AV6C 2YFWB 3B6FD 4XZQA 1P3KA 1R4VA 3P5JB 1U35B 2J8PA 4J8UD 3B6GC 3WTPE 1P34C 3MGRD 1P3LC 2UWXA 1N1JA 1TAFB 4NFTA 4X23C 3WAAB 5AV9A 2F8NG 1M19A 4XZQC 3KXBC 4JJNC 5AVCD 3LJAB 3EPJA 1P3KC 3NQJB 3AZKA 5C3IB 5F99A 3B0CT 3EG5B 5GT0D 5B40A 2IO5C 3AYWD 2RVQD 4KGCA 4WNNB 4H9QA 2DF4C 5B0YD 3H0MC 5AV9C 2BYMA 3AZHD 3AZFB 1AOIC 1M19C 3W98B 2LY8A 5B31D 3WKJB 3AZKC 3V9RB 4J8WD 5B40C 3REIA 3UT9A 4KGCC 4YM6D 3KWQA 4AWLB 5GXQB 3X1VA 1S32A 3W97D 5AVBD 4KUDC 5B1MC 3UT9C 1P3AB 2NZDD 3B0BA 1B6WA 2Y2MA 3RELA 3AZJB 5BS7A 2NQBC 4Z5TD 3EPKA 2PYOD 1P3BA 5AV6D 3X1VC 3AFAD 1S32C 4DRAA 5FUGB 1P34D 5BNXA 4DRBA 1P3LD 1HTAA 3EPLA 3RELC 5BS7C 3UTAB 2F8NH 4H9PA 5JA4A 3REKB 1BH9B 1P3BC 3KUYA 4X23B 3KXBD 4JJND 1P3KD 2DQNC 3VH6T 4EO5B 5CP6A 3C1BD 3AZND 2G5IC 4UPKA 2IO5B 4CAYA 4G91C 1ID3A 4WU8A 1N1JB 3KUYC 5GT3C 1AOID 5AV9B 1M19D 1WWSA 5B2JA 3B0DC 3C1CC 3AZKB 5F99B 5GSUA 5B40B 1ID3C 4KGCB 1TZYA 4WU8C 4H9QB 4WU9B 1A7WA 5B2JC 3X1UA 4KUDD 5B1MD 5B24A 3LZ1A 3REIB 3X1TA 2Y2PA 1TZYC 3VH6W 1KX5D 3TU4C 2NQBD 3WTPA 3VH5T 2CV5D 3KWQB 1P3OA 3WAAA 5DNNA 5B0ZA 5CPID 1S32B 3LZ1C 3X1TC 3NQJA 2F8NK 5CPKD 3MNND 3RELD 3AZMB 1JFIA 5B31G 4WNNA 3WTPC 1P3BB 4YS3B 3WAAC 5B0ZC 3UTBB 3WKJA 1P3IA 5C3IC 2L5AA 3AV1D 4H9PB 4H9SA 1EQZB 3EPHA 5GT3D 3KUYB 3W98C 3AZFC 3C1CD 4XUJB 4R8PA 5CP6B 1P3GB 3WKJC 3AZLD 1P3IC 3VH5W 4WU8D 4J8XA 1ID3B
chains in the Genus database with same CATH topology
1P3AA 2FJ7A 3AZGD 3AZJA 5B2JD 2HIOB 3A1KA 4R8PC 5CPJA 2JCHA 4AWLC 5GXQC 5GSUB 3W99A 4QLCB 2AROA 1KX4A 5FUGA 1P3AC 3TU4D 2Y2QA 1PZRA 3AZJC 3UTAA 1B67A 4CSRA 3X1UB 5BNVA 3O62A 5B24B 1U35D 3LZ1B 3X1TB 1ZLAA 3VH6A 2BYKA 5DNMA 4E45A 2Y2OA 3UTAC 5CHLB 3KSYA 3WTPB 3REKC 3WAAD 4HGAB 1P3OB 5DNNB 5B0ZB 3O62C 3LJAD 4EO5C 5AY8A 4ZUXB 5DNMC 1JFIB 4WU9A 5JRGB 1ULYA 3AN2A 5B32B 4KHAB 1F66A 3W98D 2JSSA 3AZFD 2ZM5A 3WKJD 1P3IB 5F99C 4LD9A 3MGSA 4WU9C 3REJD 4R8PB 5GXQD 3VH5A 1WWIA 4J8XB 3REIC 1P3AD 4NE3A 2F8NA 3AZJD 2FJ7B 3A6NA 1M1AB 3B0CW 3AZMA 5AV5A 3KWQC 5CPJB 4YS3A 1P3MA 3UTBA 3X1SB 3AZEA 3W99B 4UUZB 2FFFB 2AROB 1KX4B 1HQ3B 3B6GD 3MVDA 4J8VB 3UTAD 3AZMC 4CSRB 3REKD 1EQZA 5AV5C 4X23D 4YS3C 5AV8A 5BNVB 4XZQD 3UTBC 3O62B 4XUJA 1P3GA 1ZLAB 4Z2MG 4WJ3C 2BYKB 5DNMB 3IP4C 3AZIA 1EQZC 5AV9D 2HIOA 4XUJC 3AZKD 5CP6C 1P3GC 4H9RB 5F99D 5BO0A 5AY8B 3AFAB 2Y2JA 4QLCA 5B40D 1Z2CB 4KGCD 4WU9D 3MGQA 3AZIC 5B1LB 2JE5A 5B2IA 3AN2B 1F66B 1KX3A 2ZY4A 2HIOC 5BT1C 2G5HC 3R45A 3W96A 5GSUC 4QLCC 3REID 3UT9D 4LD9B 3MGQC 3MGSB 5B2IC 3KWQD 3X1UC 3X1VD 1BH8B 1S32D 3W96C 2Y2GA 5B24C 1M18A 3LELA 5B33A 2F8NB 4ZUXA 3A6NB 3AZMD 3AV2B 1P3BD 5AV5B 5JRGA 3LZ0A 3REHA 4HGAC 4KHAA 5E5AA 5B32A 5DNNC 3UTBD 1P3MB 1P3OC 3AZEB 1P3PB 2RIQA 3MGPA 1P3FA 3MVDB 3LELC 5B33C 4ZUXC 4DQYB 2BG1A 1EQZD 3MGRA 3KUYD 5JRGC 4ZBJB 1W2EA 5E5AC 5B32C 5AV8B 3WA9B 4XUJD 1BFMA 3F6TA 5CP6D 3MGPC 1P3GD 1P3FC 5AVCA 1ID3D 4H9SC 3AZIB 3MGRC 1M1AA 3AYWA 2HIOD 5BT1D 5B0YA 2ZY3A 4E44A 5BO0B 5GSUD 4QLCD 5AVCC 3X1SA 4UUZA 2XD1A 1TZYD 3MGQB 4J8XC 1HQ3A 5B2IB 4J8VA 3NQUA 2FJ7C 1M1AC 1KX3B 3X1UD 5CPJC 3R45B 3W96B 5B24D 3W99C 4YM6A 3LZ1D 4Z66B 3X1TD 3X1SC 2AROC 1KX4C 1HQ3C 3W97A 5AVBA 4J8VC 2YFVA 3WTPD 2NZDA 1P3OD 5DNND 5B0ZD 2PYOA 4YM6C 4H9NA 5KDMA 5AV6A 1M18B 4H9RA 3AFAA 5B33B 3LELB 1ZLAC 5AVBC 1H3OB 1P34A 4M6BA 5JRGD 5B1LA 3LZ0B 3REHB 5E5AB 2PYOC 3MGPB 2ZY2A 1P3FB 4H9OA 1P3ID 2Y2LA 5AY8C 3KXBA 3AFAC 4JJNA 3B6FB 3C1BA 4NE5A 3AZNA 4J8UB 3MGRB 5B1LC 3AN2C 4NE6A 1F66C 2CWEA 1T3UA 4R8PD 2Y2NA 5G49A 1AOIA 1BH8A 2HUEB 5AVCB 3C1BC 3AL0C 3AZNC 4J8XD 1KU5A 4LD9C 3MGSC 3H0RC 5GT0B 2FJ7D 1M1AD 3AYWB 3AV2A 3FDDA 5B0YB 5CPJD 3AZHB 3W99D 2Y2KA 3X1SD 5B31B 4G92B 2AROD 1P3PA 1KX4D 1HQ3D 4J8VD 4KUDA 4J8WB 5B1MA 3NQUB 3A6NC 3AV2C 1KX5A 2NQBA 3REJB 2Y2HA 1P3MC 3WA9A 3O62D 4WV4B 4YM6B 3AZEC 2CV5A 1P3PC 1ZLAD 5CPIA 3MVDC 3W97B 5AVBB 5DNMD 1KX5C 2YFVB 2NZDB 5CPKA 3MNNA 4ZBJC 3KFUG 3WA9C 1Q9CA 4Z5TB 5AV8C 2PYOB 2CV5C 4H9NB 5AY8D 5KDMB 5AV6B 5CPIC 3B6GB 1P34B 5B1LD 1P3LB 3AV1A 5CPKC 3MNNC 3AN2D 1F66D 5GT3A 4H9OB 4XZQB 3KXBB 4JJNB 1P3KB 3C1CA 3C1BB 3AZNB 4Z66A 4LD9D 3AZLA 3MGSD 3AV1C 3A1IA 1KX3C 5G49B 3AZGA 1AOIB 1M19B 3H0LC 4Z66C 3AZLC 4WZSB 5B32G 2F8ND 3A6ND 3AV2D 1H3OA 3TU4A 5AV5D 2BYMB 3AZGC 4YS3D 1P3MD 4Z2MH 3AZED 1P3PD 3MVDD 2YFWA 2ZY5A 1M18C 3B6FA 4KUDB 5B1MB 3UT9B 1U35A 1KX5B 4J8UA 2NQBB 3WA9D 3LZ0C 5AV8D 3REHC 1F1EA 1TAFA 2CV5B 3X1VB 5CPIB 3B6FC 3LJAA 1U35C 3AZID 4J8UC 5CPKB 3MNNB 3RELB 5GT0A 2Y2IA 3W98A 3AZFA 3AZHA 3LJAC 2HUEC 5B31A 5BNXB 3MGQD 3V9RA 5B2ID 3AV1B 5GT0C 4J8WA 4G91B 1KX3D 2XD5A 5JA4B 2RVQC 3AYWC 5GT3B 5B0YC 3REJA 3AZHC 3W96D 3B0DB 3C1CB 2W8SA 5B31C 4Z66D 4G92C 5GXQA 3AZLB 4CAYB 4J8WC 4WU8B 2F2AC 3AZGB 3REJC 5B2JB 4Z5TA 1M18D 3LELD 5B33D 4ZUXD 3W97C 1TZYB 3B6GA 3TU4B 1P3LA 2NZDC 3LZ0D 3REHD 5B32D 5E5AD 4Z5TC 3REKA 1BH9A 2VQRA 3MGPD 4X23A 1P3FD 5AV6C 2YFWB 3B6FD 4XZQA 1P3KA 1R4VA 3P5JB 1U35B 2J8PA 4J8UD 3B6GC 3WTPE 1P34C 3MGRD 1P3LC 2UWXA 1N1JA 1TAFB 4NFTA 4X23C 3WAAB 5AV9A 2F8NG 1M19A 4XZQC 3KXBC 4JJNC 5AVCD 3LJAB 3EPJA 1P3KC 3NQJB 3AZKA 5C3IB 5F99A 3B0CT 3EG5B 5GT0D 5B40A 2IO5C 3AYWD 2RVQD 4KGCA 4WNNB 4H9QA 2DF4C 5B0YD 3H0MC 5AV9C 2BYMA 3AZHD 3AZFB 1AOIC 1M19C 3W98B 2LY8A 5B31D 3WKJB 3AZKC 3V9RB 4J8WD 5B40C 3REIA 3UT9A 4KGCC 4YM6D 3KWQA 4AWLB 5GXQB 3X1VA 1S32A 3W97D 5AVBD 4KUDC 5B1MC 3UT9C 1P3AB 2NZDD 3B0BA 1B6WA 2Y2MA 3RELA 3AZJB 5BS7A 2NQBC 4Z5TD 3EPKA 2PYOD 1P3BA 5AV6D 3X1VC 3AFAD 1S32C 4DRAA 5FUGB 1P34D 5BNXA 4DRBA 1P3LD 1HTAA 3EPLA 3RELC 5BS7C 3UTAB 2F8NH 4H9PA 5JA4A 3REKB 1BH9B 1P3BC 3KUYA 4X23B 3KXBD 4JJND 1P3KD 2DQNC 3VH6T 4EO5B 5CP6A 3C1BD 3AZND 2G5IC 4UPKA 2IO5B 4CAYA 4G91C 1ID3A 4WU8A 1N1JB 3KUYC 5GT3C 1AOID 5AV9B 1M19D 1WWSA 5B2JA 3B0DC 3C1CC 3AZKB 5F99B 5GSUA 5B40B 1ID3C 4KGCB 1TZYA 4WU8C 4H9QB 4WU9B 1A7WA 5B2JC 3X1UA 4KUDD 5B1MD 5B24A 3LZ1A 3REIB 3X1TA 2Y2PA 1TZYC 3VH6W 1KX5D 3TU4C 2NQBD 3WTPA 3VH5T 2CV5D 3KWQB 1P3OA 3WAAA 5DNNA 5B0ZA 5CPID 1S32B 3LZ1C 3X1TC 3NQJA 2F8NK 5CPKD 3MNND 3RELD 3AZMB 1JFIA 5B31G 4WNNA 3WTPC 1P3BB 4YS3B 3WAAC 5B0ZC 3UTBB 3WKJA 1P3IA 5C3IC 2L5AA 3AV1D 4H9PB 4H9SA 1EQZB 3EPHA 5GT3D 3KUYB 3W98C 3AZFC 3C1CD 4XUJB 4R8PA 5CP6B 1P3GB 3WKJC 3AZLD 1P3IC 3VH5W 4WU8D 4J8XA 1ID3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A A;  2FJ7 A;  3AZG D;  3AZJ A;  5B2J D;  2HIO B;  4R8P C;  5CPJ A;  4AWL C;  5GXQ C;  5GSU B;  3W99 A;  4QLC B;  2ARO A;  1KX4 A;  5FUG A;  1P3A C;  3TU4 D;  3AZJ C;  3UTA A;  1B67 A;  4CSR A;  3X1U B;  5BNV A;  3O62 A;  5B24 B;  1U35 D;  3LZ1 B;  3X1T B;  1ZLA A;  3VH6 A;  2BYK A;  5DNM A;  4E45 A;  3UTA C;  5CHL B;  3KSY A;  3WTP B;  3REK C;  3WAA D;  4HGA B;  1P3O B;  5DNN B;  5B0Z B;  3O62 C;  3LJA D;  4EO5 C;  5AY8 A;  4ZUX B;  5DNM C;  1JFI B;  4WU9 A;  5JRG B;  1ULY A;  3AN2 A;  5B32 B;  4KHA B;  1F66 A;  3W98 D;  2JSS A;  3AZF D;  3WKJ D;  1P3I B;  5F99 C;  4LD9 A;  3MGS A;  4WU9 C;  3REJ D;  4R8P B;  5GXQ D;  3VH5 A;  1WWI A;  4J8X B;  3REI C;  1P3A D;  4NE3 A;  2F8N A;  3AZJ D;  2FJ7 B;  3A6N A;  1M1A B;  3B0C W;  3AZM A;  5AV5 A;  3KWQ C;  5CPJ B;  4YS3 A;  1P3M A;  3UTB A;  3X1S B;  3AZE A;  3W99 B;  4UUZ B;  2ARO B;  1KX4 B;  1HQ3 B;  3B6G D;  3MVD A;  4J8V B;  3UTA D;  3AZM C;  4CSR B;  3REK D;  1EQZ A;  5AV5 C;  4X23 D;  4YS3 C;  5AV8 A;  5BNV B;  4XZQ D;  3UTB C;  3O62 B;  4XUJ A;  1P3G A;  1ZLA B;  4Z2M G;  2BYK B;  5DNM B;  3AZI A;  1EQZ C;  5AV9 D;  2HIO A;  4XUJ C;  3AZK D;  5CP6 C;  1P3G C;  4H9R B;  5F99 D;  5BO0 A;  5AY8 B;  3AFA B;  4QLC A;  5B40 D;  4KGC D;  4WU9 D;  3MGQ A;  3AZI C;  5B1L B;  5B2I A;  3AN2 B;  1F66 B;  1KX3 A;  2HIO C;  5BT1 C;  3R45 A;  3W96 A;  5GSU C;  4QLC C;  3REI D;  3UT9 D;  4LD9 B;  3MGQ C;  3MGS B;  5B2I C;  3KWQ D;  3X1U C;  3X1V D;  1BH8 B;  1S32 D;  3W96 C;  5B24 C;  1M18 A;  3LEL A;  5B33 A;  2F8N B;  4ZUX A;  3A6N B;  3AZM D;  3AV2 B;  1P3B D;  5AV5 B;  5JRG A;  3LZ0 A;  3REH A;  4HGA C;  4KHA A;  5E5A A;  5B32 A;  5DNN C;  3UTB D;  1P3M B;  1P3O C;  3AZE B;  1P3P B;  3MGP A;  1P3F A;  3MVD B;  3LEL C;  5B33 C;  4ZUX C;  1EQZ D;  3MGR A;  3KUY D;  5JRG C;  4ZBJ B;  5B32 C;  5E5A C;  3WA9 B;  5AV8 B;  4XUJ D;  1BFM A;  5CP6 D;  3MGP C;  1P3G D;  1P3F C;  5AVC A;  1ID3 D;  4H9S C;  3AZI B;  3MGR C;  1M1A A;  3AYW A;  2HIO D;  5BT1 D;  5B0Y A;  4E44 A;  5BO0 B;  5GSU D;  4QLC D;  5AVC C;  3X1S A;  4UUZ A;  1TZY D;  3MGQ B;  4J8X C;  1HQ3 A;  5B2I B;  4J8V A;  3NQU A;  2FJ7 C;  1M1A C;  1KX3 B;  3X1U D;  5CPJ C;  3R45 B;  3W96 B;  5B24 D;  3W99 C;  4YM6 A;  3LZ1 D;  4Z66 B;  3X1T D;  3X1S C;  2ARO C;  1KX4 C;  1HQ3 C;  3W97 A;  5AVB A;  4J8V C;  2YFV A;  3WTP D;  2NZD A;  1P3O D;  5DNN D;  5B0Z D;  2PYO A;  4YM6 C;  4H9N A;  5KDM A;  5AV6 A;  1M18 B;  4H9R A;  3AFA A;  5B33 B;  3LEL B;  1ZLA C;  5AVB C;  1H3O B;  1P34 A;  4M6B A;  5JRG D;  5B1L A;  3LZ0 B;  3REH B;  5E5A B;  2PYO C;  3MGP B;  1P3F B;  4H9O A;  1P3I D;  5AY8 C;  3KXB A;  3AFA C;  4JJN A;  3B6F B;  3C1B A;  4NE5 A;  3AZN A;  4J8U B;  3MGR B;  5B1L C;  3AN2 C;  4NE6 A;  1F66 C;  2CWE A;  4R8P D;  5G49 A;  1AOI A;  1BH8 A;  2HUE B;  5AVC B;  3C1B C;  3AZN C;  4J8X D;  1KU5 A;  4LD9 C;  3MGS C;  5GT0 B;  2FJ7 D;  1M1A D;  3AYW B;  3AV2 A;  5B0Y B;  5CPJ D;  3AZH B;  3W99 D;  3X1S D;  5B31 B;  4G92 B;  2ARO D;  1P3P A;  1KX4 D;  1HQ3 D;  4J8V D;  4KUD A;  4J8W B;  5B1M A;  3NQU B;  3A6N C;  3AV2 C;  1KX5 A;  2NQB A;  3REJ B;  3WA9 A;  1P3M C;  3O62 D;  4WV4 B;  4YM6 B;  3AZE C;  2CV5 A;  1P3P C;  1ZLA D;  5CPI A;  3MVD C;  3W97 B;  5AVB B;  5DNM D;  1KX5 C;  2YFV B;  2NZD B;  5CPK A;  3MNN A;  4ZBJ C;  3WA9 C;  1Q9C A;  4Z5T B;  5AV8 C;  2PYO B;  2CV5 C;  4H9N B;  5AY8 D;  5KDM B;  5AV6 B;  5CPI C;  3B6G B;  1P34 B;  5B1L D;  1P3L B;  3AV1 A;  5CPK C;  3MNN C;  3AN2 D;  1F66 D;  5GT3 A;  4H9O B;  4XZQ B;  3KXB B;  4JJN B;  1P3K B;  3C1C A;  3C1B B;  3AZN B;  4Z66 A;  4LD9 D;  3AZL A;  3MGS D;  3AV1 C;  1KX3 C;  5G49 B;  3AZG A;  1AOI B;  1M19 B;  4Z66 C;  3AZL C;  4WZS B;  5B32 G;  2F8N D;  3A6N D;  3AV2 D;  1H3O A;  3TU4 A;  5AV5 D;  2BYM B;  3AZG C;  4YS3 D;  1P3M D;  4Z2M H;  3AZE D;  1P3P D;  3MVD D;  2YFW A;  1M18 C;  3B6F A;  4KUD B;  5B1M B;  3UT9 B;  1U35 A;  1KX5 B;  4J8U A;  2NQB B;  3WA9 D;  3LZ0 C;  5AV8 D;  3REH C;  1F1E A;  1TAF A;  2CV5 B;  3X1V B;  5CPI B;  3B6F C;  3LJA A;  1U35 C;  3AZI D;  4J8U C;  5CPK B;  3MNN B;  3REL B;  5GT0 A;  3W98 A;  3AZF A;  3AZH A;  3LJA C;  2HUE C;  5B31 A;  5BNX B;  3MGQ D;  3V9R A;  5B2I D;  3AV1 B;  5GT0 C;  4J8W A;  4G91 B;  1KX3 D;  3AYW C;  5JA4 B;  2RVQ C;  5GT3 B;  5B0Y C;  3REJ A;  3AZH C;  3W96 D;  3B0D B;  3C1C B;  5B31 C;  4Z66 D;  4G92 C;  5GXQ A;  3AZL B;  4CAY B;  4J8W C;  4WU8 B;  3AZG B;  3REJ C;  5B2J B;  4Z5T A;  1M18 D;  3LEL D;  5B33 D;  4ZUX D;  3W97 C;  1TZY B;  3B6G A;  3TU4 B;  1P3L A;  2NZD C;  3LZ0 D;  3REH D;  5B32 D;  5E5A D;  4Z5T C;  3REK A;  1BH9 A;  3MGP D;  4X23 A;  1P3F D;  5AV6 C;  2YFW B;  3B6F D;  4XZQ A;  1P3K A;  1R4V A;  1U35 B;  4J8U D;  3B6G C;  3WTP E;  1P34 C;  3MGR D;  1P3L C;  1N1J A;  1TAF B;  4NFT A;  4X23 C;  3WAA B;  5AV9 A;  2F8N G;  1M19 A;  4XZQ C;  3KXB C;  4JJN C;  5AVC D;  3LJA B;  1P3K C;  3NQJ B;  3AZK A;  5C3I B;  5F99 A;  3B0C T;  5GT0 D;  5B40 A;  2IO5 C;  3AYW D;  2RVQ D;  4KGC A;  4WNN B;  4H9Q A;  5B0Y D;  5AV9 C;  2BYM A;  3AZH D;  3AZF B;  1AOI C;  1M19 C;  3W98 B;  2LY8 A;  5B31 D;  3WKJ B;  3AZK C;  3V9R B;  4J8W D;  5B40 C;  3REI A;  3UT9 A;  4KGC C;  4YM6 D;  3KWQ A;  4AWL B;  5GXQ B;  3X1V A;  1S32 A;  3W97 D;  5AVB D;  4KUD C;  5B1M C;  3UT9 C;  1P3A B;  2NZD D;  3B0B A;  1B6W A;  3REL A;  3AZJ B;  2NQB C;  5BS7 A;  4Z5T D;  2PYO D;  1P3B A;  5AV6 D;  3X1V C;  3AFA D;  1S32 C;  4DRA A;  5FUG B;  1P34 D;  5BNX A;  4DRB A;  1P3L D;  1HTA A;  3REL C;  5BS7 C;  3UTA B;  2F8N H;  4H9P A;  5JA4 A;  3REK B;  1BH9 B;  1P3B C;  3KUY A;  4X23 B;  3KXB D;  4JJN D;  1P3K D;  3VH6 T;  3C1B D;  4EO5 B;  5CP6 A;  3AZN D;  4CAY A;  2IO5 B;  4G91 C;  1ID3 A;  4WU8 A;  1N1J B;  3KUY C;  5GT3 C;  1AOI D;  5AV9 B;  1M19 D;  1WWS A;  5B2J A;  3B0D C;  3C1C C;  3AZK B;  5F99 B;  5GSU A;  5B40 B;  1ID3 C;  4KGC B;  1TZY A;  4WU8 C;  4H9Q B;  4WU9 B;  1A7W A;  5B2J C;  3X1U A;  4KUD D;  5B1M D;  5B24 A;  3LZ1 A;  3REI B;  3X1T A;  1TZY C;  3VH6 W;  1KX5 D;  3TU4 C;  2NQB D;  3WTP A;  3VH5 T;  2CV5 D;  3KWQ B;  1P3O A;  3WAA A;  5DNN A;  5B0Z A;  5CPI D;  1S32 B;  3LZ1 C;  3X1T C;  3NQJ A;  2F8N K;  5CPK D;  3MNN D;  3REL D;  3AZM B;  1JFI A;  5B31 G;  4WNN A;  3WTP C;  1P3B B;  4YS3 B;  3WAA C;  5B0Z C;  3UTB B;  3WKJ A;  1P3I A;  5C3I C;  2L5A A;  3AV1 D;  4H9P B;  4H9S A;  1EQZ B;  5GT3 D;  3KUY B;  3W98 C;  3AZF C;  3C1C D;  4XUJ B;  4R8P A;  5CP6 B;  1P3G B;  3WKJ C;  3AZL D;  1P3I C;  3VH5 W;  4WU8 D;  4J8X A;  1ID3 B; 
#chains in the Genus database with same CATH topology
 1P3A A;  2FJ7 A;  3AZG D;  3AZJ A;  5B2J D;  2HIO B;  3A1K A;  4R8P C;  5CPJ A;  2JCH A;  4AWL C;  5GXQ C;  5GSU B;  3W99 A;  4QLC B;  2ARO A;  1KX4 A;  5FUG A;  1P3A C;  3TU4 D;  2Y2Q A;  1PZR A;  3AZJ C;  3UTA A;  1B67 A;  4CSR A;  3X1U B;  5BNV A;  3O62 A;  5B24 B;  1U35 D;  3LZ1 B;  3X1T B;  1ZLA A;  3VH6 A;  2BYK A;  5DNM A;  4E45 A;  2Y2O A;  3UTA C;  5CHL B;  3KSY A;  3WTP B;  3REK C;  3WAA D;  4HGA B;  1P3O B;  5DNN B;  5B0Z B;  3O62 C;  3LJA D;  4EO5 C;  5AY8 A;  4ZUX B;  5DNM C;  1JFI B;  4WU9 A;  5JRG B;  1ULY A;  3AN2 A;  5B32 B;  4KHA B;  1F66 A;  3W98 D;  2JSS A;  3AZF D;  2ZM5 A;  3WKJ D;  1P3I B;  5F99 C;  4LD9 A;  3MGS A;  4WU9 C;  3REJ D;  4R8P B;  5GXQ D;  3VH5 A;  1WWI A;  4J8X B;  3REI C;  1P3A D;  4NE3 A;  2F8N A;  3AZJ D;  2FJ7 B;  3A6N A;  1M1A B;  3B0C W;  3AZM A;  5AV5 A;  3KWQ C;  5CPJ B;  4YS3 A;  1P3M A;  3UTB A;  3X1S B;  3AZE A;  3W99 B;  4UUZ B;  2FFF B;  2ARO B;  1KX4 B;  1HQ3 B;  3B6G D;  3MVD A;  4J8V B;  3UTA D;  3AZM C;  4CSR B;  3REK D;  1EQZ A;  5AV5 C;  4X23 D;  4YS3 C;  5AV8 A;  5BNV B;  4XZQ D;  3UTB C;  3O62 B;  4XUJ A;  1P3G A;  1ZLA B;  4Z2M G;  4WJ3 C;  2BYK B;  5DNM B;  3IP4 C;  3AZI A;  1EQZ C;  5AV9 D;  2HIO A;  4XUJ C;  3AZK D;  5CP6 C;  1P3G C;  4H9R B;  5F99 D;  5BO0 A;  5AY8 B;  3AFA B;  2Y2J A;  4QLC A;  5B40 D;  1Z2C B;  4KGC D;  4WU9 D;  3MGQ A;  3AZI C;  5B1L B;  2JE5 A;  5B2I A;  3AN2 B;  1F66 B;  1KX3 A;  2ZY4 A;  2HIO C;  5BT1 C;  2G5H C;  3R45 A;  3W96 A;  5GSU C;  4QLC C;  3REI D;  3UT9 D;  4LD9 B;  3MGQ C;  3MGS B;  5B2I C;  3KWQ D;  3X1U C;  3X1V D;  1BH8 B;  1S32 D;  3W96 C;  2Y2G A;  5B24 C;  1M18 A;  3LEL A;  5B33 A;  2F8N B;  4ZUX A;  3A6N B;  3AZM D;  3AV2 B;  1P3B D;  5AV5 B;  5JRG A;  3LZ0 A;  3REH A;  4HGA C;  4KHA A;  5E5A A;  5B32 A;  5DNN C;  3UTB D;  1P3M B;  1P3O C;  3AZE B;  1P3P B;  2RIQ A;  3MGP A;  1P3F A;  3MVD B;  3LEL C;  5B33 C;  4ZUX C;  4DQY B;  2BG1 A;  1EQZ D;  3MGR A;  3KUY D;  5JRG C;  4ZBJ B;  1W2E A;  5E5A C;  5B32 C;  5AV8 B;  3WA9 B;  4XUJ D;  1BFM A;  3F6T A;  5CP6 D;  3MGP C;  1P3G D;  1P3F C;  5AVC A;  1ID3 D;  4H9S C;  3AZI B;  3MGR C;  1M1A A;  3AYW A;  2HIO D;  5BT1 D;  5B0Y A;  2ZY3 A;  4E44 A;  5BO0 B;  5GSU D;  4QLC D;  5AVC C;  3X1S A;  4UUZ A;  2XD1 A;  1TZY D;  3MGQ B;  4J8X C;  1HQ3 A;  5B2I B;  4J8V A;  3NQU A;  2FJ7 C;  1M1A C;  1KX3 B;  3X1U D;  5CPJ C;  3R45 B;  3W96 B;  5B24 D;  3W99 C;  4YM6 A;  3LZ1 D;  4Z66 B;  3X1T D;  3X1S C;  2ARO C;  1KX4 C;  1HQ3 C;  3W97 A;  5AVB A;  4J8V C;  2YFV A;  3WTP D;  2NZD A;  1P3O D;  5DNN D;  5B0Z D;  2PYO A;  4YM6 C;  4H9N A;  5KDM A;  5AV6 A;  1M18 B;  4H9R A;  3AFA A;  5B33 B;  3LEL B;  1ZLA C;  5AVB C;  1H3O B;  1P34 A;  4M6B A;  5JRG D;  5B1L A;  3LZ0 B;  3REH B;  5E5A B;  2PYO C;  3MGP B;  2ZY2 A;  1P3F B;  4H9O A;  1P3I D;  2Y2L A;  5AY8 C;  3KXB A;  3AFA C;  4JJN A;  3B6F B;  3C1B A;  4NE5 A;  3AZN A;  4J8U B;  3MGR B;  5B1L C;  3AN2 C;  4NE6 A;  1F66 C;  2CWE A;  1T3U A;  4R8P D;  2Y2N A;  5G49 A;  1AOI A;  1BH8 A;  2HUE B;  5AVC B;  3C1B C;  3AL0 C;  3AZN C;  4J8X D;  1KU5 A;  4LD9 C;  3MGS C;  3H0R C;  5GT0 B;  2FJ7 D;  1M1A D;  3AYW B;  3AV2 A;  3FDD A;  5B0Y B;  5CPJ D;  3AZH B;  3W99 D;  2Y2K A;  3X1S D;  5B31 B;  4G92 B;  2ARO D;  1P3P A;  1KX4 D;  1HQ3 D;  4J8V D;  4KUD A;  4J8W B;  5B1M A;  3NQU B;  3A6N C;  3AV2 C;  1KX5 A;  2NQB A;  3REJ B;  2Y2H A;  1P3M C;  3WA9 A;  3O62 D;  4WV4 B;  4YM6 B;  3AZE C;  2CV5 A;  1P3P C;  1ZLA D;  5CPI A;  3MVD C;  3W97 B;  5AVB B;  5DNM D;  1KX5 C;  2YFV B;  2NZD B;  5CPK A;  3MNN A;  4ZBJ C;  3KFU G;  3WA9 C;  1Q9C A;  4Z5T B;  5AV8 C;  2PYO B;  2CV5 C;  4H9N B;  5AY8 D;  5KDM B;  5AV6 B;  5CPI C;  3B6G B;  1P34 B;  5B1L D;  1P3L B;  3AV1 A;  5CPK C;  3MNN C;  3AN2 D;  1F66 D;  5GT3 A;  4H9O B;  4XZQ B;  3KXB B;  4JJN B;  1P3K B;  3C1C A;  3C1B B;  3AZN B;  4Z66 A;  4LD9 D;  3AZL A;  3MGS D;  3AV1 C;  3A1I A;  1KX3 C;  5G49 B;  3AZG A;  1AOI B;  1M19 B;  3H0L C;  4Z66 C;  3AZL C;  4WZS B;  5B32 G;  2F8N D;  3A6N D;  3AV2 D;  1H3O A;  3TU4 A;  5AV5 D;  2BYM B;  3AZG C;  4YS3 D;  1P3M D;  4Z2M H;  3AZE D;  1P3P D;  3MVD D;  2YFW A;  2ZY5 A;  1M18 C;  3B6F A;  4KUD B;  5B1M B;  3UT9 B;  1U35 A;  1KX5 B;  4J8U A;  2NQB B;  3WA9 D;  3LZ0 C;  5AV8 D;  3REH C;  1F1E A;  1TAF A;  2CV5 B;  3X1V B;  5CPI B;  3B6F C;  3LJA A;  1U35 C;  3AZI D;  4J8U C;  5CPK B;  3MNN B;  3REL B;  5GT0 A;  2Y2I A;  3W98 A;  3AZF A;  3AZH A;  3LJA C;  2HUE C;  5B31 A;  5BNX B;  3MGQ D;  3V9R A;  5B2I D;  3AV1 B;  5GT0 C;  4J8W A;  4G91 B;  1KX3 D;  2XD5 A;  5JA4 B;  2RVQ C;  3AYW C;  5GT3 B;  5B0Y C;  3REJ A;  3AZH C;  3W96 D;  3B0D B;  3C1C B;  2W8S A;  5B31 C;  4Z66 D;  4G92 C;  5GXQ A;  3AZL B;  4CAY B;  4J8W C;  4WU8 B;  2F2A C;  3AZG B;  3REJ C;  5B2J B;  4Z5T A;  1M18 D;  3LEL D;  5B33 D;  4ZUX D;  3W97 C;  1TZY B;  3B6G A;  3TU4 B;  1P3L A;  2NZD C;  3LZ0 D;  3REH D;  5B32 D;  5E5A D;  4Z5T C;  3REK A;  1BH9 A;  2VQR A;  3MGP D;  4X23 A;  1P3F D;  5AV6 C;  2YFW B;  3B6F D;  4XZQ A;  1P3K A;  1R4V A;  3P5J B;  1U35 B;  2J8P A;  4J8U D;  3B6G C;  3WTP E;  1P34 C;  3MGR D;  1P3L C;  2UWX A;  1N1J A;  1TAF B;  4NFT A;  4X23 C;  3WAA B;  5AV9 A;  2F8N G;  1M19 A;  4XZQ C;  3KXB C;  4JJN C;  5AVC D;  3LJA B;  3EPJ A;  1P3K C;  3NQJ B;  3AZK A;  5C3I B;  5F99 A;  3B0C T;  3EG5 B;  5GT0 D;  5B40 A;  2IO5 C;  3AYW D;  2RVQ D;  4KGC A;  4WNN B;  4H9Q A;  2DF4 C;  5B0Y D;  3H0M C;  5AV9 C;  2BYM A;  3AZH D;  3AZF B;  1AOI C;  1M19 C;  3W98 B;  2LY8 A;  5B31 D;  3WKJ B;  3AZK C;  3V9R B;  4J8W D;  5B40 C;  3REI A;  3UT9 A;  4KGC C;  4YM6 D;  3KWQ A;  4AWL B;  5GXQ B;  3X1V A;  1S32 A;  3W97 D;  5AVB D;  4KUD C;  5B1M C;  3UT9 C;  1P3A B;  2NZD D;  3B0B A;  1B6W A;  2Y2M A;  3REL A;  3AZJ B;  5BS7 A;  2NQB C;  4Z5T D;  3EPK A;  2PYO D;  1P3B A;  5AV6 D;  3X1V C;  3AFA D;  1S32 C;  4DRA A;  5FUG B;  1P34 D;  5BNX A;  4DRB A;  1P3L D;  1HTA A;  3EPL A;  3REL C;  5BS7 C;  3UTA B;  2F8N H;  4H9P A;  5JA4 A;  3REK B;  1BH9 B;  1P3B C;  3KUY A;  4X23 B;  3KXB D;  4JJN D;  1P3K D;  2DQN C;  3VH6 T;  4EO5 B;  5CP6 A;  3C1B D;  3AZN D;  2G5I C;  4UPK A;  2IO5 B;  4CAY A;  4G91 C;  1ID3 A;  4WU8 A;  1N1J B;  3KUY C;  5GT3 C;  1AOI D;  5AV9 B;  1M19 D;  1WWS A;  5B2J A;  3B0D C;  3C1C C;  3AZK B;  5F99 B;  5GSU A;  5B40 B;  1ID3 C;  4KGC B;  1TZY A;  4WU8 C;  4H9Q B;  4WU9 B;  1A7W A;  5B2J C;  3X1U A;  4KUD D;  5B1M D;  5B24 A;  3LZ1 A;  3REI B;  3X1T A;  2Y2P A;  1TZY C;  3VH6 W;  1KX5 D;  3TU4 C;  2NQB D;  3WTP A;  3VH5 T;  2CV5 D;  3KWQ B;  1P3O A;  3WAA A;  5DNN A;  5B0Z A;  5CPI D;  1S32 B;  3LZ1 C;  3X1T C;  3NQJ A;  2F8N K;  5CPK D;  3MNN D;  3REL D;  3AZM B;  1JFI A;  5B31 G;  4WNN A;  3WTP C;  1P3B B;  4YS3 B;  3WAA C;  5B0Z C;  3UTB B;  3WKJ A;  1P3I A;  5C3I C;  2L5A A;  3AV1 D;  4H9P B;  4H9S A;  1EQZ B;  3EPH A;  5GT3 D;  3KUY B;  3W98 C;  3AZF C;  3C1C D;  4XUJ B;  4R8P A;  5CP6 B;  1P3G B;  3WKJ C;  3AZL D;  1P3I C;  3VH5 W;  4WU8 D;  4J8X A;  1ID3 B; 
#chains in the Genus database with same CATH homology
 1P3A A;  2FJ7 A;  3AZG D;  3AZJ A;  5B2J D;  2HIO B;  3A1K A;  4R8P C;  5CPJ A;  2JCH A;  4AWL C;  5GXQ C;  5GSU B;  3W99 A;  4QLC B;  2ARO A;  1KX4 A;  5FUG A;  1P3A C;  3TU4 D;  2Y2Q A;  1PZR A;  3AZJ C;  3UTA A;  1B67 A;  4CSR A;  3X1U B;  5BNV A;  3O62 A;  5B24 B;  1U35 D;  3LZ1 B;  3X1T B;  1ZLA A;  3VH6 A;  2BYK A;  5DNM A;  4E45 A;  2Y2O A;  3UTA C;  5CHL B;  3KSY A;  3WTP B;  3REK C;  3WAA D;  4HGA B;  1P3O B;  5DNN B;  5B0Z B;  3O62 C;  3LJA D;  4EO5 C;  5AY8 A;  4ZUX B;  5DNM C;  1JFI B;  4WU9 A;  5JRG B;  1ULY A;  3AN2 A;  5B32 B;  4KHA B;  1F66 A;  3W98 D;  2JSS A;  3AZF D;  2ZM5 A;  3WKJ D;  1P3I B;  5F99 C;  4LD9 A;  3MGS A;  4WU9 C;  3REJ D;  4R8P B;  5GXQ D;  3VH5 A;  1WWI A;  4J8X B;  3REI C;  1P3A D;  4NE3 A;  2F8N A;  3AZJ D;  2FJ7 B;  3A6N A;  1M1A B;  3B0C W;  3AZM A;  5AV5 A;  3KWQ C;  5CPJ B;  4YS3 A;  1P3M A;  3UTB A;  3X1S B;  3AZE A;  3W99 B;  4UUZ B;  2FFF B;  2ARO B;  1KX4 B;  1HQ3 B;  3B6G D;  3MVD A;  4J8V B;  3UTA D;  3AZM C;  4CSR B;  3REK D;  1EQZ A;  5AV5 C;  4X23 D;  4YS3 C;  5AV8 A;  5BNV B;  4XZQ D;  3UTB C;  3O62 B;  4XUJ A;  1P3G A;  1ZLA B;  4Z2M G;  4WJ3 C;  2BYK B;  5DNM B;  3IP4 C;  3AZI A;  1EQZ C;  5AV9 D;  2HIO A;  4XUJ C;  3AZK D;  5CP6 C;  1P3G C;  4H9R B;  5F99 D;  5BO0 A;  5AY8 B;  3AFA B;  2Y2J A;  4QLC A;  5B40 D;  1Z2C B;  4KGC D;  4WU9 D;  3MGQ A;  3AZI C;  5B1L B;  2JE5 A;  5B2I A;  3AN2 B;  1F66 B;  1KX3 A;  2ZY4 A;  2HIO C;  5BT1 C;  2G5H C;  3R45 A;  3W96 A;  5GSU C;  4QLC C;  3REI D;  3UT9 D;  4LD9 B;  3MGQ C;  3MGS B;  5B2I C;  3KWQ D;  3X1U C;  3X1V D;  1BH8 B;  1S32 D;  3W96 C;  2Y2G A;  5B24 C;  1M18 A;  3LEL A;  5B33 A;  2F8N B;  4ZUX A;  3A6N B;  3AZM D;  3AV2 B;  1P3B D;  5AV5 B;  5JRG A;  3LZ0 A;  3REH A;  4HGA C;  4KHA A;  5E5A A;  5B32 A;  5DNN C;  3UTB D;  1P3M B;  1P3O C;  3AZE B;  1P3P B;  2RIQ A;  3MGP A;  1P3F A;  3MVD B;  3LEL C;  5B33 C;  4ZUX C;  4DQY B;  2BG1 A;  1EQZ D;  3MGR A;  3KUY D;  5JRG C;  4ZBJ B;  1W2E A;  5E5A C;  5B32 C;  5AV8 B;  3WA9 B;  4XUJ D;  1BFM A;  3F6T A;  5CP6 D;  3MGP C;  1P3G D;  1P3F C;  5AVC A;  1ID3 D;  4H9S C;  3AZI B;  3MGR C;  1M1A A;  3AYW A;  2HIO D;  5BT1 D;  5B0Y A;  2ZY3 A;  4E44 A;  5BO0 B;  5GSU D;  4QLC D;  5AVC C;  3X1S A;  4UUZ A;  2XD1 A;  1TZY D;  3MGQ B;  4J8X C;  1HQ3 A;  5B2I B;  4J8V A;  3NQU A;  2FJ7 C;  1M1A C;  1KX3 B;  3X1U D;  5CPJ C;  3R45 B;  3W96 B;  5B24 D;  3W99 C;  4YM6 A;  3LZ1 D;  4Z66 B;  3X1T D;  3X1S C;  2ARO C;  1KX4 C;  1HQ3 C;  3W97 A;  5AVB A;  4J8V C;  2YFV A;  3WTP D;  2NZD A;  1P3O D;  5DNN D;  5B0Z D;  2PYO A;  4YM6 C;  4H9N A;  5KDM A;  5AV6 A;  1M18 B;  4H9R A;  3AFA A;  5B33 B;  3LEL B;  1ZLA C;  5AVB C;  1H3O B;  1P34 A;  4M6B A;  5JRG D;  5B1L A;  3LZ0 B;  3REH B;  5E5A B;  2PYO C;  3MGP B;  2ZY2 A;  1P3F B;  4H9O A;  1P3I D;  2Y2L A;  5AY8 C;  3KXB A;  3AFA C;  4JJN A;  3B6F B;  3C1B A;  4NE5 A;  3AZN A;  4J8U B;  3MGR B;  5B1L C;  3AN2 C;  4NE6 A;  1F66 C;  2CWE A;  1T3U A;  4R8P D;  2Y2N A;  5G49 A;  1AOI A;  1BH8 A;  2HUE B;  5AVC B;  3C1B C;  3AL0 C;  3AZN C;  4J8X D;  1KU5 A;  4LD9 C;  3MGS C;  3H0R C;  5GT0 B;  2FJ7 D;  1M1A D;  3AYW B;  3AV2 A;  3FDD A;  5B0Y B;  5CPJ D;  3AZH B;  3W99 D;  2Y2K A;  3X1S D;  5B31 B;  4G92 B;  2ARO D;  1P3P A;  1KX4 D;  1HQ3 D;  4J8V D;  4KUD A;  4J8W B;  5B1M A;  3NQU B;  3A6N C;  3AV2 C;  1KX5 A;  2NQB A;  3REJ B;  2Y2H A;  1P3M C;  3WA9 A;  3O62 D;  4WV4 B;  4YM6 B;  3AZE C;  2CV5 A;  1P3P C;  1ZLA D;  5CPI A;  3MVD C;  3W97 B;  5AVB B;  5DNM D;  1KX5 C;  2YFV B;  2NZD B;  5CPK A;  3MNN A;  4ZBJ C;  3KFU G;  3WA9 C;  1Q9C A;  4Z5T B;  5AV8 C;  2PYO B;  2CV5 C;  4H9N B;  5AY8 D;  5KDM B;  5AV6 B;  5CPI C;  3B6G B;  1P34 B;  5B1L D;  1P3L B;  3AV1 A;  5CPK C;  3MNN C;  3AN2 D;  1F66 D;  5GT3 A;  4H9O B;  4XZQ B;  3KXB B;  4JJN B;  1P3K B;  3C1C A;  3C1B B;  3AZN B;  4Z66 A;  4LD9 D;  3AZL A;  3MGS D;  3AV1 C;  3A1I A;  1KX3 C;  5G49 B;  3AZG A;  1AOI B;  1M19 B;  3H0L C;  4Z66 C;  3AZL C;  4WZS B;  5B32 G;  2F8N D;  3A6N D;  3AV2 D;  1H3O A;  3TU4 A;  5AV5 D;  2BYM B;  3AZG C;  4YS3 D;  1P3M D;  4Z2M H;  3AZE D;  1P3P D;  3MVD D;  2YFW A;  2ZY5 A;  1M18 C;  3B6F A;  4KUD B;  5B1M B;  3UT9 B;  1U35 A;  1KX5 B;  4J8U A;  2NQB B;  3WA9 D;  3LZ0 C;  5AV8 D;  3REH C;  1F1E A;  1TAF A;  2CV5 B;  3X1V B;  5CPI B;  3B6F C;  3LJA A;  1U35 C;  3AZI D;  4J8U C;  5CPK B;  3MNN B;  3REL B;  5GT0 A;  2Y2I A;  3W98 A;  3AZF A;  3AZH A;  3LJA C;  2HUE C;  5B31 A;  5BNX B;  3MGQ D;  3V9R A;  5B2I D;  3AV1 B;  5GT0 C;  4J8W A;  4G91 B;  1KX3 D;  2XD5 A;  5JA4 B;  2RVQ C;  3AYW C;  5GT3 B;  5B0Y C;  3REJ A;  3AZH C;  3W96 D;  3B0D B;  3C1C B;  2W8S A;  5B31 C;  4Z66 D;  4G92 C;  5GXQ A;  3AZL B;  4CAY B;  4J8W C;  4WU8 B;  2F2A C;  3AZG B;  3REJ C;  5B2J B;  4Z5T A;  1M18 D;  3LEL D;  5B33 D;  4ZUX D;  3W97 C;  1TZY B;  3B6G A;  3TU4 B;  1P3L A;  2NZD C;  3LZ0 D;  3REH D;  5B32 D;  5E5A D;  4Z5T C;  3REK A;  1BH9 A;  2VQR A;  3MGP D;  4X23 A;  1P3F D;  5AV6 C;  2YFW B;  3B6F D;  4XZQ A;  1P3K A;  1R4V A;  3P5J B;  1U35 B;  2J8P A;  4J8U D;  3B6G C;  3WTP E;  1P34 C;  3MGR D;  1P3L C;  2UWX A;  1N1J A;  1TAF B;  4NFT A;  4X23 C;  3WAA B;  5AV9 A;  2F8N G;  1M19 A;  4XZQ C;  3KXB C;  4JJN C;  5AVC D;  3LJA B;  3EPJ A;  1P3K C;  3NQJ B;  3AZK A;  5C3I B;  5F99 A;  3B0C T;  3EG5 B;  5GT0 D;  5B40 A;  2IO5 C;  3AYW D;  2RVQ D;  4KGC A;  4WNN B;  4H9Q A;  2DF4 C;  5B0Y D;  3H0M C;  5AV9 C;  2BYM A;  3AZH D;  3AZF B;  1AOI C;  1M19 C;  3W98 B;  2LY8 A;  5B31 D;  3WKJ B;  3AZK C;  3V9R B;  4J8W D;  5B40 C;  3REI A;  3UT9 A;  4KGC C;  4YM6 D;  3KWQ A;  4AWL B;  5GXQ B;  3X1V A;  1S32 A;  3W97 D;  5AVB D;  4KUD C;  5B1M C;  3UT9 C;  1P3A B;  2NZD D;  3B0B A;  1B6W A;  2Y2M A;  3REL A;  3AZJ B;  5BS7 A;  2NQB C;  4Z5T D;  3EPK A;  2PYO D;  1P3B A;  5AV6 D;  3X1V C;  3AFA D;  1S32 C;  4DRA A;  5FUG B;  1P34 D;  5BNX A;  4DRB A;  1P3L D;  1HTA A;  3EPL A;  3REL C;  5BS7 C;  3UTA B;  2F8N H;  4H9P A;  5JA4 A;  3REK B;  1BH9 B;  1P3B C;  3KUY A;  4X23 B;  3KXB D;  4JJN D;  1P3K D;  2DQN C;  3VH6 T;  4EO5 B;  5CP6 A;  3C1B D;  3AZN D;  2G5I C;  4UPK A;  2IO5 B;  4CAY A;  4G91 C;  1ID3 A;  4WU8 A;  1N1J B;  3KUY C;  5GT3 C;  1AOI D;  5AV9 B;  1M19 D;  1WWS A;  5B2J A;  3B0D C;  3C1C C;  3AZK B;  5F99 B;  5GSU A;  5B40 B;  1ID3 C;  4KGC B;  1TZY A;  4WU8 C;  4H9Q B;  4WU9 B;  1A7W A;  5B2J C;  3X1U A;  4KUD D;  5B1M D;  5B24 A;  3LZ1 A;  3REI B;  3X1T A;  2Y2P A;  1TZY C;  3VH6 W;  1KX5 D;  3TU4 C;  2NQB D;  3WTP A;  3VH5 T;  2CV5 D;  3KWQ B;  1P3O A;  3WAA A;  5DNN A;  5B0Z A;  5CPI D;  1S32 B;  3LZ1 C;  3X1T C;  3NQJ A;  2F8N K;  5CPK D;  3MNN D;  3REL D;  3AZM B;  1JFI A;  5B31 G;  4WNN A;  3WTP C;  1P3B B;  4YS3 B;  3WAA C;  5B0Z C;  3UTB B;  3WKJ A;  1P3I A;  5C3I C;  2L5A A;  3AV1 D;  4H9P B;  4H9S A;  1EQZ B;  3EPH A;  5GT3 D;  3KUY B;  3W98 C;  3AZF C;  3C1C D;  4XUJ B;  4R8P A;  5CP6 B;  1P3G B;  3WKJ C;  3AZL D;  1P3I C;  3VH5 W;  4WU8 D;  4J8X A;  1ID3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...