4Z2PA

Crystal structure of short hoefavidin-hoef-peptide(l9f) complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
SPDMKLLAGASNWVNQSGSVAQFVFTPSPTQPQTYEVSGNYINNAQGTGCKGTPYPLSGAYYSGNQIISFSVVWSNASANCQSATGWTGYFDFSGSQAVLKTDWNLAFYSGSTPAIQQGQDDFMQSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Avidin family
publication title Hoefavidin: A dimeric bacterial avidin with a C-terminal binding tail.
pubmed doi rcsb
source organism Hoeflea phototrophica dfl-43
molecule tags Biotin binding protein
total genus 28
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 4z2pA00
1VWJB 2RTOB 1AVEA 1RXJA 3WZNA 1SRIA 1SWSA 1I9HA 1SLDB 1SWUA 1VWNB 2IZKA 3RDXA 2BC3A 4Y5DA 3RDQA 2Y3FA 5K68A 1MOYA 2FHLA 1NQMA 3RE6A 4CPHB 4CPEA 4DNEA 2QCBA 2RTJA 1MK5A 1STRB 1VYOA 1KL3A 1RXHA 5CSEA 3SZIA 4BX7A 4BX5B 2C1QA 1SWEA 4Z2VA 4Y59A 1VWOB 3WYQA 1HY2A 4IRWA 5B5GA 3VGWA 1VWEB 2OFAA 1VWCB 1IJ8A 1STPA 1SWJA 2RTQB 1SREA 1SWDA 4CPHA 4U46A 1SWQA 1KL5A 1N43A 1VWDB 4YVBA 1SLFB 1RAVA 1PTSA 1SWNA 1Y55X 4BX5A 2RTDB 3FDCA 1AVDA 4BX7B 3RY1A 2IZJA 4Z27A 4GJSA 1SRGA 2JGSA 2RTHB 1N9YA 1LELA 1VWAB 3RDMA 1SWTA 5CHKA 3T2WA 3X00A 3T6LA 3SZJA 1STSB 1NBXA 2Y32A 3T6FA 2RTRB 3VHHA 2IZEB 3RDSA 4GJVA 1NDJA 2F01A 1VWQB 1SWCA 2RTGB 1DF8A 2A5CA 2OF8A 3RY2A 3SZHA 1N9MA 4GGTA 5IRUA 2OFBA 1LUQA 3WZQA 2IZAA 2GH7A 2IZIA 1SWFA 1SWRA 3MM0A 3RDOA 4Z2OA 2RTMA 2CAMA 1HQQA 1Y52X 1NQNA 1VWLB 3RDUA 1SWGA 1LDQA 1SWHA 5JD2A 1KFFA 1SWOA 2RTBB 4I60A 3MG5A 2IZBA 2FHNX 2RTAA 2RTLA 1KL4A 1SLEB 2AVIA 5K67A 1RXKA 3VHMA 1N7YA 4GGRA 2MF6A 4CPIA 4EKVA 1NC9A 4JHQA 4BBOA 4BX6B 3PK2A 1VWBB 1HXLA 2C1SA 2IZHB 1SWBA 3WZOA 1SRJA 4JNJA 2ZSCA 3T2XA 1Y53X 1VWHB 2RTNB 1HXZA 5IRWA 2RTKA 5L3YA 1VWIB 2IZCB 4Z28A 3WZPA 4GGZA 1LCWA 4BX6A 2RTCB 1LDOA 5IRAA 4Z6JA 1N4JA 4CPFA 3WYPA 2UZ2A 3VHIA 4Z2PA 1SWPA 1VWMB 1MM9A 2IZGB 2RTIB 3EW1A 5B5FA 4GDAA 1RSUB 1LCZA 3RE5A 4BJ8A 2RTPB 1MEPA 2IZDB 1SWKA 2UYWA 1VWGB 2Y3EA 1LCVA 2RTFB 4OKAA 2A8GA 1SRHA 1SRFA 1SWAA 2RTEB 4GD9A 1RSTB 1SWLA 4BCSA 3EW2A 2C4IA 2WPUA 1SLGB 2IZLB 1VWFB 2OF9A 2IZFB 1VWPB 1VWRB 5F2BA 2G5LA 4JO6A 1WBIA 1VWKB 2A5BA
chains in the Genus database with same CATH superfamily
3HWGA 1TW4A 4UU2A 4YCHA 4IB9A 5HBSA 3VG3A 4C5PA 2L5PA 4CDEA 1SLDB 5LKEA 2BT9A 1ERBA 1SWUA 1UREA 1ZNEA 1DZMA 1RBPA 4OMWA 1BSOA 4GETA 3RDXA 2AKQA 3WJCA 3EC5A 5BVSA 1SY0A 1KGLA 3P6HA 3FELA 1D2UA 5K68A 4CV7A 1NP4A 3KZAA 1EXSA 2FLJA 3ZUOA 1EALA 2RTJA 3P24A 1VYOA 3GE2A 5CSEA 1QQSA 3EBKA 3NQ3A 3BLGA 3N91A 1EQDA 5H9LA 1SA8A 2F09A 5EZ2A 3RZYA 1P6PA 1GX9A 5EPQA 4BX5B 2OVAA 2K62A 4Z2VA 4LZVA 4KC8A 5D8JA 1KT6A 4DCBA 4NV7A 1EIOA 3OJYC 5IXGA 3HOLA 3P6GA 4NW4A 3APVA 4ALOA 1SWJA 2OL7A 4YGHA 1FELA 4LQZA 1SWQA 4U46A 3F9DA 3IA8A 3P02A 4TKHA 4XMDA 1RAVA 4TJZA 2AH7X 4YBPA 1WUBA 4BX5A 1DZKA 2Q2PA 2XKLA 2RTDB 1IIUA 4KH8A 4IAWA 1T8VA 2HMBA 4GU8A 5B3MO 3RY1A 4B55A 1NP1A 3D9WA 5HWZA 3AKNA 1N9YA 1O1UA 4NLJA 1LELA 1GT1A 1BRQA 1VYFA 2L67A 3FIQA 3FR2A 4NYQA 1G5WA 2WUTA 2R74A 3BX8A 3T6LA 4K19A 2L68A 1NBXA 4XMCA 4ORRA 1ADLA 1ICMA 2ZAGA 3LHNA 4GKCA 3NPOA 2JU8A 5HZ8A 4GE1A 1FENA 4U8UN 1K3BA 1HMSA 3FYFA 3FW4A 3PQUA 1SWCA 2RTGB 1DF8A 4NNSA 2G7BA 1N9MA 3KQ0A 4XMHA 2NNQA 2OFBA 4O4OA 3FW5A 1X89A 2X8SA 4HPAA 3HOEA 2BLGA 4YFQA 1HQQA 3RSWA 1O8VA 1SXUA 1LDQA 3LTWA 1QABE 3UEVA 3UEUA 2POAA 4OMXA 1U17A 1OSPO 3CQNA 1KL4A 4NYRA 2KT4B 1E06A 1RXKA 1N7YA 5KHPA 3D96A 3P6FA 1G74A 3PDFA 5HCDC 4ZGFA 2AMMX 1EPAA 4M7MA 4OELA 2A2UA 4YFRA 1GM6A 1DFVA 3PK2A 1LIBA 1HXLA 4ORUA 4AYHA 1SWBA 5KICA 4TKJA 4D6AA 1HMTA 1YWDA 1QWDA 2ZSCA 4HPCA 1XKIA 1NGLA 5L8OA 1RLBE 1VWIB 1YWCA 4Z28A 1JMZA 2XSTA 3U9PC 1QG5A 3HK1A 3WZPA 4RUNA 3IFBA 1Y0GA 2CZUA 2OVEA 1B8EA 4AW8A 4YKMA 3NBXX 5KIDA 1BM5A 2IFBA 1EPBA 5D47A 5FENA 5EDCA 3WYPA 3VHIA 2IZGB 3PH5A 3PH6A 2RTIB 3I0AA 1BEBA 1LICA 3EBWA 1B56A 4GNYA 2JN3A 2Q39A 3RBYA 1SY2A 1JV4A 2L9CA 2OFMX 5C0NA 1LCZA 3KFGA 5BYPA 3HWFA 4TKBA 3CKFA 2EU7X 3BSZE 2RTFB 3I17A 1OEJA 4YMYA 3EMMA 1RSTB 3NADA 2CZTA 4IB7A 3VG6A 2KD2A 3FA8A 5EEDA 5IO7A 2QO6A 2OF9A 2QMIA 4EEJA 3ZW2A 5F2BA 2RCQA 3HPEA 1WBIA 3NR3A 1VWKB 2A5BA 2ASNX 2E4JA 1OPBA 1AVEA 2X56A 1AELA 4QZTA 2Q9SA 3O2YA 1ZNDA 2VDFA 2IZKA 4Y0RA 1ZNHA 2LKKA 4ZHHA 3OD9A 1OBQA 4I9RA 2CM9A 4I9SA 4OEMA 4ALBA 1AQBA 2FHLA 2W2AA 4ZH6A 3U03A 2FWVA 4XMFA 4CPHB 1KXOA 4ES7A 2OVDA 2OL6O 2X34A 2M4LA 2ZAIA 4ZHFA 1ML7A 1MK5A 1STRB 3U0DA 3B2HA 3SZIA 3WXQA 3QKGA 5HA1A 4BX7A 3EM0A 3RKGA 3WYQA 5B5GA 2AT0X 4L1NA 2OFAA 1GGLA 3PPTA 5B11O 4KC7A 1JJJA 3PP6A 2OFRX 2WQ9A 4CPHA 1G85A 4BVMA 4CDCA 3KFIA 2JU3A 1I04A 3MX7A 1KL5A 1N43A 1VWDB 4KIIA 1SLFB 5BVQA 4YVBA 4TNNA 4A8ZA 3NQKA 1PTSA 2G79A 2NP1A 1QY1A 2G78A 1AVDA 2HNXA 2LB6A 4U8UM 3VG7A 2IZJA 3BU9A 4Z27A 1SRGA 4MVIA 2JGSA 3MVFA 4ZJ0A 2RTHB 4ZGUA 2FRSA 2NNDA 2GTFX 5HCEC 2X55A 3T2WA 3X00A 1JIWI 2HZRA 3CBSA 4ORYA 1JQPA 2MJIA 4RUUA 1S2PA 2LBAA 1JYJA 1SMPI 1W4TA 4D6BA 3C76X 1ERXA 3L4RA 1VWQB 2F73A 3F6ZB 3P6EA 4QAEA 4KT5A 4JGLA 2BSZA 3APUA 3FLLA 4ZHDA 1GX8A 2FT9A 3ELXA 3FR5A 2IZAA 5FQ6E 1X71A 4ORXA 1SWFA 1VYGA 4ODDA 1LIDA 1LFOA 5JD2A 4PJ2A 3D4RA 2ANSA 2KTDA 2N93A 5CE4A 2IZBA 2RTLA 3JS1A 4A60A 1YWBA 3WBGA 1SLEB 2LA7A 2X45A 3CWKA 2GJ5A 3VHMA 2RQ0A 1Y9LA 4QGVA 2MF6A 4A1YA 1TOWA 4CPIA 3ELZA 3KFHA 2HKDA 1NC9A 3PECA 4GZVA 4U9CA 4BBOA 1ALBA 1S44A 1HN2A 4BX6B 4CK4A 1AVGI 1EW3A 3HWDA 4IB6A 4NP1A 4ZH9A 4CDFA 1LPJA 1X8OA 2C1SA 3OBLA 5F1EA 5FAZA 5LJBA 4AZMA 4GUZA 2X4MA 4WFUA 4FBOA 4U8UO 2RTNB 4YGZA 5H9KA 2IZCB 3D97A 5K06A 3VG2A 4GGZA 3VE2A 4LKPA 2RTCB 4BX6A 1LDOA 3C77X 3STMX 5IRAA 3JQOA 5HZ9A 3F8AA 1VPRA 2A13A 4GRJA 1TXLA 2KW1A 4ZCBA 1DV9A 4YKOA 3VG5A 1CBQA 1VWMB 5LJGA 1SY1A 4DQ4A 1HQPA 4YFPA 3CBCA 4GDAA 1PBYA 4BGFA 1X8PA 1JYDA 3AUMO 4IMOA 4MISA 4N7DA 5AJBA 1B0OA 4OS0A 4R0BA 5HTDA 2Q4NA 2UYWA 1VWGB 3CQRA 1DC9A 1LCVA 1O1VA 1R0UA 3EYCA 1KQXA 2QOMA 4UU3A 1KT4A 2YG2A 5HAEA 2RTEB 1SWLA 5LJEA 2MM3A 3ZUIA 1OEKA 4ZR2A 4GH7A 3EW2A 4QRLA 4CSBA 4FBRA 2C4IA 1X8QA 2WPUA 5H9NA 1CBSA 1BLRA 1JZUA 1CRBA 3NX1A 1EI5A 1OBPA 2IZFB 5AJCA 1AB0A 1MDCA 1VWPB 1CJ5A 2G5LA 3B2IA 4JO6A 1ZNKA 1RXJA 2FGSA 1SRIA 1SWSA 1W5RA 4AZRA 3PQSA 3P6CA 1I9HA 1X8UA 3TF6A 4BOEA 2OY7A 3WOVA 4ZHCA 1JJXA 3SLTA 2BC3A 2LFOA 3RDQA 1B4MA 1ZRYA 5DG4A 2OVSA 1MOYA 5B10O 3RE6A 1L6MA 5HA0A 1HMRA 4QNIA 3FA7A 4CPEA 2QCBA 3ZZVA 1LIEA 2W2FA 3B2KA 4YDBA 2VFBA 4I95A 3VPJE 3WZQA 2C1QA 1ICNA 1SWEA 4O4SA 1A3YA 5EDBA 1HY2A 4IRWA 3VGWA 1VWEB 3BDRA 3ZW0B 2PI3O 3O22A 2PY1A 1GT4A 3TGBA 1IJ8A 1STPA 3HTYA 4WHIA 3APXA 2RTQB 1SREA 1FDQA 2JU7A 1SXWA 2OZQA 2AF5A 3FEPA 4FGIB 5D4AA 3S5VA 1PM1X 1IKJA 3STKA 4O3XB 3NQ9A 4ARHA 1N0SA 1G7NA 3ZW1B 1GXAA 4BX7B 1JJUA 4I6SA 2OY8A 4GJSA 4GNWA 3ZW0A 4FBVA 1U0XA 1EUOA 5B29A 1YP7A 1E00A 3RDMA 5AQ6A 5HTEA 3RWXA 4QYPA 1MVGA 1ZNLA 3SZJA 3CKGA 3T6FA 2RTRB 1I78A 2WR6A 1D3SA 2IZEB 3RDSA 4GJVA 1NDJA 3VHHA 5CYBA 3ZW1A 2F01A 5DPQA 4DQ3A 2A5CA 2OYBO 3RY2A 3B2JA 5IRUA 4AZPA 4O9SA 1T68X 4KCAA 1LUQA 1YP6A 4MVKA 4Y0PA 4YBUA 3SAOA 1JMXA 2GH7A 2HZQA 4IAXA 1LF7A 2K23A 1SWRA 2RCTA 4NNTA 3RDOA 1Z24A 4MVEA 2WSJA 2RTMA 2CAMA 4M6SA 2YMSA 4O49A 1NQNA 1VWLB 3RDUA 1SWHA 4Z2PA 5B2AO 1SWOA 2RTBB 4I3DA 3MG5A 3AEHA 2FHNX 2FR3A 2RTAA 3S5XA 3ZQ3A 4YGGA 4HFOA 2AVIA 3FA6A 4GK9A 5K67A 3UAQA 1YUPA 1IFBA 4GGRA 2FKJA 3QQ2A 1SXYA 5B27A 2AT8X 4EKVA 1UZ2X 1KT3A 2Z4HA 3B2LA 4JHQA 4Y0QA 3SLJA 4TQ2A 2GTLN 2DJFA 1A2DA 1VWBB 3PEDA 2X8TA 3NX2A 1ZNGA 1SRJA 4QQ1A 3Q34A 3T2XA 4L3RA 1VWHB 3Q6LA 2WEWA 5HZQA 5L3YA 1BJ7A 4HPBA 5D48A 2BS5A 2VFCA 1FTPA 3APWA 3D95A 4QZUA 5LJDA 1LCWA 2JOZA 1KT5A 1LKEA 1SY3A 1N4JA 4O4UA 1X8NA 5D45A 1BSQA 1CBIA 2AT6X 3UEWA 4CPFA 1MM9A 1UYOX 2WQAE 1TVQA 1RSUB 2CBSA 5LJCA 3RE5A 2AT5X 4FQBB 2BHVA 4BJ8A 2WEXA 4OKAA 3VU1A 2Y3EA 4GDZA 3WJEA 1SRHA 2KTSA 2OY1O 4ID2A 1FE3A 4BCSA 1GKAB 2Z4IA 2ALLX 1SLGB 2W2BA 3FR4A 2IZLB 3CMPA 1HBPA 3FIDA 1MX8A 1OEEA 1OPAA 4ZHGA 2NNEA 4EQAC 1GX3A 3FDCA 1LIFA 1BSYA 2DM5A 1VWJB 2RTOB 2HLVA 3P6DA 4ORWA 3GAQA 4Y0SA 1YIVA 3WJFA 3WZNA 3DSZA 4YDAA 1MUPA 1GKAA 4LKTA 4TLJA 3C78X 2P8GA 3TGCA 1VWNB 1XCAA 2CBRA 3V8UA 2I5VO 4COTA 4YCEA 1EIIA 5BVTA 4Y5DA 2Y3FA 4CDDA 1NQMA 1S7DA 3KVNA 2X46A 4NLIA 4DNEA 4IMNA 5F58A 1PBOA 4EXZA 3BX7A 4ON1A 3TGAA 4ZFXA 3E3CA 1KL3A 1RXHA 4BQUA 4Z2OA 5F7GA 5L8IA 4O3YA 2LBVA 3AKMA 4Y59A 1VWOB 4NV8A 3TZSA 2QO5A 5IO5A 4U3QA 5IO6A 4QGXA 4IB8A 1VWCB 1FEMA 1GT3A 2QO4A 2FKGA 1SWDA 1YWAA 3CR6A 2ACPX 1PEEA 4QGWA 4WBKA 3ZWEA 2FR2A 5FQ7E 1SWNA 1Y55X 4AZQA 1JBHA 4IABA 1MX7A 1E2TA 2A2GA 3H3IA 1KZXA 4OS3A 2RD7C 1IFCA 1QFVA 5JR8A 1DF3A 1T0VA 1VWAB 1SWTA 5CHKA 4AZOA 3FENA 3MBTA 2AT3X 1STSB 3SLOA 5F6BA 4AZNA 2Y32A 5EEEA 2Q2MA 1U18A 4I3BA 4PSQA 2AL0X 1PMPA 1ACDA 1BBPA 2MO5A 2RN4A 3K3LA 3WJDA 5HCCC 1KQWA 4N7CA 5L8NA 2OF8A 3SZHA 4HPDA 4IBAA 3BS2A 4GGTA 4I3CA 1H91A 2IZIA 2A0AA 1E5PA 2BS6A 4XMEA 3MM0A 2GTLM 1Y52X 3LV4A 3NP1A 4YH0A 1QY2A 1SWGA 4O3ZA 1LNMA 1KFFA 4I60A 5HZ6A 4OS8A 5H8TA 1CBRA 4EDEA 1BWYA 1DZJA 5AEOA 4A1HA 5FFHA 1IW2A 3S60A 4ORSA 3DTQA 2X32A 3WJGA 2QOSC 1Y9TA 3OE3A 3BY0A 4XMGA 3WZOA 2IZHB 4EFGA 2JMBA 4JNJA 3JSQA 1Y53X 4O3WA 1I05A 4LZUA 3STNA 1HXZA 5IRWA 1QY0A 2RTKA 1GT5A 1DZPA 1SXXA 5H9AA 1I4UA 2FS6A 1A18A 1QFTA 2QM9A 3FMZA 4MVLA 1OBUA 2X8FA 2OL8O 1I06A 3UEXA 3T1DA 4HWMA 5LKFA 3VG4A 4Z6JA 2UZ2A 2I5ZO 3KFFA 1SWPA 3EW1A 3SOTA 5B5FA 2WWPA 2MHDA 2GC9A 3WVMA 3VE1A 1FJ1E 3ZI8A 2JW1A 1W6FA 2G8CO 1K24A 3O19A 4WFVA 2A3FX 4ML7B 2RTPB 3BU1A 1KOIA 2HYSA 1MEPA 2IZDB 1SWKA 4QYNA 4O4XA 4MIRA 5F6ZA 2OY5O 1KT7A 3S26A 4INNA 2R56A 2A8GA 2RA6A 3BRNA 1SRFA 1SWAA 3HWEA 3FA9A 4GD9A 1UYNX 5HZ5A 3WJBA 1HBQA 2GTLO 5LJHA 2ACOA 1BRPA 2FTBA 1KZWA 2CM4A 4MEEA 1TOUA 3G7XA 1VWFB 2DJGA 1IKEA 5FQ8E 1E02A 1VWRB 2FS7A 2MWHA 3FEKA 2O62A 2R73A 5LJKA 1A57A
chains in the Genus database with same CATH topology
1VWJB 2RTOB 1AVEA 1RXJA 3WZNA 1SRIA 1SWSA 1I9HA 1SLDB 1SWUA 1VWNB 2IZKA 3RDXA 2BC3A 4Y5DA 3RDQA 2Y3FA 5K68A 1MOYA 2FHLA 1NQMA 3RE6A 4CPHB 4CPEA 4DNEA 2QCBA 2RTJA 1MK5A 1STRB 1VYOA 1KL3A 1RXHA 5CSEA 3SZIA 4BX7A 4BX5B 2C1QA 1SWEA 4Z2VA 4Y59A 1VWOB 3WYQA 1HY2A 4IRWA 5B5GA 3VGWA 1VWEB 2OFAA 1VWCB 1IJ8A 1STPA 1SWJA 2RTQB 1SREA 1SWDA 4CPHA 4U46A 1SWQA 1KL5A 1N43A 1VWDB 4YVBA 1SLFB 1RAVA 1PTSA 1SWNA 1Y55X 4BX5A 2RTDB 3FDCA 1AVDA 4BX7B 3RY1A 2IZJA 4Z27A 4GJSA 1SRGA 2JGSA 2RTHB 1N9YA 1LELA 1VWAB 3RDMA 1SWTA 5CHKA 3T2WA 3X00A 3T6LA 3SZJA 1STSB 1NBXA 2Y32A 3T6FA 2RTRB 3VHHA 2IZEB 3RDSA 4GJVA 1NDJA 2F01A 1VWQB 1SWCA 2RTGB 1DF8A 2A5CA 2OF8A 3RY2A 3SZHA 1N9MA 4GGTA 5IRUA 2OFBA 1LUQA 3WZQA 2IZAA 2GH7A 2IZIA 1SWFA 1SWRA 3MM0A 3RDOA 4Z2OA 2RTMA 2CAMA 1HQQA 1Y52X 1NQNA 1VWLB 3RDUA 1SWGA 1LDQA 1SWHA 5JD2A 1KFFA 1SWOA 2RTBB 4I60A 3MG5A 2IZBA 2FHNX 2RTAA 2RTLA 1KL4A 1SLEB 2AVIA 5K67A 1RXKA 3VHMA 1N7YA 4GGRA 2MF6A 4CPIA 4EKVA 1NC9A 4JHQA 4BBOA 4BX6B 3PK2A 1VWBB 1HXLA 2C1SA 2IZHB 1SWBA 3WZOA 1SRJA 4JNJA 2ZSCA 3T2XA 1Y53X 1VWHB 2RTNB 1HXZA 5IRWA 2RTKA 5L3YA 1VWIB 2IZCB 4Z28A 3WZPA 4GGZA 1LCWA 4BX6A 2RTCB 1LDOA 5IRAA 4Z6JA 1N4JA 4CPFA 3WYPA 2UZ2A 3VHIA 4Z2PA 1SWPA 1VWMB 1MM9A 2IZGB 2RTIB 3EW1A 5B5FA 4GDAA 1RSUB 1LCZA 3RE5A 4BJ8A 2RTPB 1MEPA 2IZDB 1SWKA 2UYWA 1VWGB 2Y3EA 1LCVA 2RTFB 4OKAA 2A8GA 1SRHA 1SRFA 1SWAA 2RTEB 4GD9A 1RSTB 1SWLA 4BCSA 3EW2A 2C4IA 2WPUA 1SLGB 2IZLB 1VWFB 2OF9A 2IZFB 1VWPB 1VWRB 5F2BA 2G5LA 4JO6A 1WBIA 1VWKB 2A5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VWJ B;  2RTO B;  1AVE A;  1RXJ A;  3WZN A;  1SRI A;  1SWS A;  1I9H A;  1SLD B;  1SWU A;  1VWN B;  2IZK A;  3RDX A;  2BC3 A;  4Y5D A;  3RDQ A;  2Y3F A;  5K68 A;  1MOY A;  2FHL A;  1NQM A;  3RE6 A;  4CPH B;  4CPE A;  4DNE A;  2QCB A;  2RTJ A;  1MK5 A;  1STR B;  1VYO A;  1KL3 A;  1RXH A;  5CSE A;  3SZI A;  4BX7 A;  4BX5 B;  2C1Q A;  1SWE A;  4Z2V A;  4Y59 A;  1VWO B;  3WYQ A;  1HY2 A;  4IRW A;  5B5G A;  3VGW A;  1VWE B;  2OFA A;  1VWC B;  1IJ8 A;  1STP A;  1SWJ A;  2RTQ B;  1SRE A;  1SWD A;  4CPH A;  4U46 A;  1SWQ A;  1KL5 A;  1N43 A;  1VWD B;  4YVB A;  1SLF B;  1RAV A;  1PTS A;  1SWN A;  1Y55 X;  4BX5 A;  2RTD B;  3FDC A;  1AVD A;  4BX7 B;  3RY1 A;  2IZJ A;  4Z27 A;  4GJS A;  1SRG A;  2JGS A;  2RTH B;  1N9Y A;  1LEL A;  1VWA B;  3RDM A;  1SWT A;  5CHK A;  3T2W A;  3X00 A;  3T6L A;  3SZJ A;  1STS B;  1NBX A;  2Y32 A;  3T6F A;  2RTR B;  3VHH A;  2IZE B;  3RDS A;  4GJV A;  1NDJ A;  2F01 A;  1VWQ B;  1SWC A;  2RTG B;  1DF8 A;  2A5C A;  2OF8 A;  3RY2 A;  3SZH A;  1N9M A;  4GGT A;  5IRU A;  2OFB A;  1LUQ A;  3WZQ A;  2IZA A;  2GH7 A;  2IZI A;  1SWF A;  1SWR A;  3MM0 A;  3RDO A;  4Z2O A;  2RTM A;  2CAM A;  1HQQ A;  1Y52 X;  1NQN A;  1VWL B;  3RDU A;  1SWG A;  1LDQ A;  1SWH A;  5JD2 A;  1KFF A;  1SWO A;  2RTB B;  4I60 A;  3MG5 A;  2IZB A;  2FHN X;  2RTA A;  2RTL A;  1KL4 A;  1SLE B;  2AVI A;  5K67 A;  1RXK A;  3VHM A;  1N7Y A;  4GGR A;  2MF6 A;  4CPI A;  4EKV A;  1NC9 A;  4JHQ A;  4BBO A;  4BX6 B;  3PK2 A;  1VWB B;  1HXL A;  2C1S A;  2IZH B;  1SWB A;  3WZO A;  1SRJ A;  4JNJ A;  2ZSC A;  3T2X A;  1Y53 X;  1VWH B;  2RTN B;  1HXZ A;  5IRW A;  2RTK A;  5L3Y A;  1VWI B;  2IZC B;  4Z28 A;  3WZP A;  4GGZ A;  1LCW A;  4BX6 A;  2RTC B;  1LDO A;  5IRA A;  4Z6J A;  1N4J A;  4CPF A;  3WYP A;  2UZ2 A;  3VHI A;  4Z2P A;  1SWP A;  1VWM B;  1MM9 A;  2IZG B;  2RTI B;  3EW1 A;  5B5F A;  4GDA A;  1RSU B;  1LCZ A;  3RE5 A;  4BJ8 A;  2RTP B;  1MEP A;  2IZD B;  1SWK A;  2UYW A;  1VWG B;  2Y3E A;  1LCV A;  2RTF B;  4OKA A;  2A8G A;  1SRH A;  1SRF A;  1SWA A;  2RTE B;  4GD9 A;  1RST B;  1SWL A;  4BCS A;  3EW2 A;  2C4I A;  2WPU A;  1SLG B;  2IZL B;  1VWF B;  2OF9 A;  2IZF B;  1VWP B;  1VWR B;  5F2B A;  2G5L A;  4JO6 A;  1WBI A;  1VWK B;  2A5B A; 
#chains in the Genus database with same CATH topology
 3HWG A;  1TW4 A;  4UU2 A;  4YCH A;  4IB9 A;  5HBS A;  3VG3 A;  4C5P A;  2L5P A;  4CDE A;  1SLD B;  5LKE A;  2BT9 A;  1ERB A;  1SWU A;  1URE A;  1ZNE A;  1DZM A;  1RBP A;  4OMW A;  1BSO A;  4GET A;  3RDX A;  2AKQ A;  3WJC A;  3EC5 A;  5BVS A;  1SY0 A;  1KGL A;  3P6H A;  3FEL A;  1D2U A;  5K68 A;  4CV7 A;  1NP4 A;  3KZA A;  1EXS A;  2FLJ A;  3ZUO A;  1EAL A;  2RTJ A;  3P24 A;  1VYO A;  3GE2 A;  5CSE A;  1QQS A;  3EBK A;  3NQ3 A;  3BLG A;  3N91 A;  1EQD A;  5H9L A;  1SA8 A;  2F09 A;  5EZ2 A;  3RZY A;  1P6P A;  1GX9 A;  5EPQ A;  4BX5 B;  2OVA A;  2K62 A;  4Z2V A;  4LZV A;  4KC8 A;  5D8J A;  1KT6 A;  4DCB A;  4NV7 A;  1EIO A;  3OJY C;  5IXG A;  3HOL A;  3P6G A;  4NW4 A;  3APV A;  4ALO A;  1SWJ A;  2OL7 A;  4YGH A;  1FEL A;  4LQZ A;  1SWQ A;  4U46 A;  3F9D A;  3IA8 A;  3P02 A;  4TKH A;  4XMD A;  1RAV A;  4TJZ A;  2AH7 X;  4YBP A;  1WUB A;  4BX5 A;  1DZK A;  2Q2P A;  2XKL A;  2RTD B;  1IIU A;  4KH8 A;  4IAW A;  1T8V A;  2HMB A;  4GU8 A;  5B3M O;  3RY1 A;  4B55 A;  1NP1 A;  3D9W A;  5HWZ A;  3AKN A;  1N9Y A;  1O1U A;  4NLJ A;  1LEL A;  1GT1 A;  1BRQ A;  1VYF A;  2L67 A;  3FIQ A;  3FR2 A;  4NYQ A;  1G5W A;  2WUT A;  2R74 A;  3BX8 A;  3T6L A;  4K19 A;  2L68 A;  1NBX A;  4XMC A;  4ORR A;  1ADL A;  1ICM A;  2ZAG A;  3LHN A;  4GKC A;  3NPO A;  2JU8 A;  5HZ8 A;  4GE1 A;  1FEN A;  4U8U N;  1K3B A;  1HMS A;  3FYF A;  3FW4 A;  3PQU A;  1SWC A;  2RTG B;  1DF8 A;  4NNS A;  2G7B A;  1N9M A;  3KQ0 A;  4XMH A;  2NNQ A;  2OFB A;  4O4O A;  3FW5 A;  1X89 A;  2X8S A;  4HPA A;  3HOE A;  2BLG A;  4YFQ A;  1HQQ A;  3RSW A;  1O8V A;  1SXU A;  1LDQ A;  3LTW A;  1QAB E;  3UEV A;  3UEU A;  2POA A;  4OMX A;  1U17 A;  1OSP O;  3CQN A;  1KL4 A;  4NYR A;  2KT4 B;  1E06 A;  1RXK A;  1N7Y A;  5KHP A;  3D96 A;  3P6F A;  1G74 A;  3PDF A;  5HCD C;  4ZGF A;  2AMM X;  1EPA A;  4M7M A;  4OEL A;  2A2U A;  4YFR A;  1GM6 A;  1DFV A;  3PK2 A;  1LIB A;  1HXL A;  4ORU A;  4AYH A;  1SWB A;  5KIC A;  4TKJ A;  4D6A A;  1HMT A;  1YWD A;  1QWD A;  2ZSC A;  4HPC A;  1XKI A;  1NGL A;  5L8O A;  1RLB E;  1VWI B;  1YWC A;  4Z28 A;  1JMZ A;  2XST A;  3U9P C;  1QG5 A;  3HK1 A;  3WZP A;  4RUN A;  3IFB A;  1Y0G A;  2CZU A;  2OVE A;  1B8E A;  4AW8 A;  4YKM A;  3NBX X;  5KID A;  1BM5 A;  2IFB A;  1EPB A;  5D47 A;  5FEN A;  5EDC A;  3WYP A;  3VHI A;  2IZG B;  3PH5 A;  3PH6 A;  2RTI B;  3I0A A;  1BEB A;  1LIC A;  3EBW A;  1B56 A;  4GNY A;  2JN3 A;  2Q39 A;  3RBY A;  1SY2 A;  1JV4 A;  2L9C A;  2OFM X;  5C0N A;  1LCZ A;  3KFG A;  5BYP A;  3HWF A;  4TKB A;  3CKF A;  2EU7 X;  3BSZ E;  2RTF B;  3I17 A;  1OEJ A;  4YMY A;  3EMM A;  1RST B;  3NAD A;  2CZT A;  4IB7 A;  3VG6 A;  2KD2 A;  3FA8 A;  5EED A;  5IO7 A;  2QO6 A;  2OF9 A;  2QMI A;  4EEJ A;  3ZW2 A;  5F2B A;  2RCQ A;  3HPE A;  1WBI A;  3NR3 A;  1VWK B;  2A5B A;  2ASN X;  2E4J A;  1OPB A;  1AVE A;  2X56 A;  1AEL A;  4QZT A;  2Q9S A;  3O2Y A;  1ZND A;  2VDF A;  2IZK A;  4Y0R A;  1ZNH A;  2LKK A;  4ZHH A;  3OD9 A;  1OBQ A;  4I9R A;  2CM9 A;  4I9S A;  4OEM A;  4ALB A;  1AQB A;  2FHL A;  2W2A A;  4ZH6 A;  3U03 A;  2FWV A;  4XMF A;  4CPH B;  1KXO A;  4ES7 A;  2OVD A;  2OL6 O;  2X34 A;  2M4L A;  2ZAI A;  4ZHF A;  1ML7 A;  1MK5 A;  1STR B;  3U0D A;  3B2H A;  3SZI A;  3WXQ A;  3QKG A;  5HA1 A;  4BX7 A;  3EM0 A;  3RKG A;  3WYQ A;  5B5G A;  2AT0 X;  4L1N A;  2OFA A;  1GGL A;  3PPT A;  5B11 O;  4KC7 A;  1JJJ A;  3PP6 A;  2OFR X;  2WQ9 A;  4CPH A;  1G85 A;  4BVM A;  4CDC A;  3KFI A;  2JU3 A;  1I04 A;  3MX7 A;  1KL5 A;  1N43 A;  1VWD B;  4KII A;  1SLF B;  5BVQ A;  4YVB A;  4TNN A;  4A8Z A;  3NQK A;  1PTS A;  2G79 A;  2NP1 A;  1QY1 A;  2G78 A;  1AVD A;  2HNX A;  2LB6 A;  4U8U M;  3VG7 A;  2IZJ A;  3BU9 A;  4Z27 A;  1SRG A;  4MVI A;  2JGS A;  3MVF A;  4ZJ0 A;  2RTH B;  4ZGU A;  2FRS A;  2NND A;  2GTF X;  5HCE C;  2X55 A;  3T2W A;  3X00 A;  1JIW I;  2HZR A;  3CBS A;  4ORY A;  1JQP A;  2MJI A;  4RUU A;  1S2P A;  2LBA A;  1JYJ A;  1SMP I;  1W4T A;  4D6B A;  3C76 X;  1ERX A;  3L4R A;  1VWQ B;  2F73 A;  3F6Z B;  3P6E A;  4QAE A;  4KT5 A;  4JGL A;  2BSZ A;  3APU A;  3FLL A;  4ZHD A;  1GX8 A;  2FT9 A;  3ELX A;  3FR5 A;  2IZA A;  5FQ6 E;  1X71 A;  4ORX A;  1SWF A;  1VYG A;  4ODD A;  1LID A;  1LFO A;  5JD2 A;  4PJ2 A;  3D4R A;  2ANS A;  2KTD A;  2N93 A;  5CE4 A;  2IZB A;  2RTL A;  3JS1 A;  4A60 A;  1YWB A;  3WBG A;  1SLE B;  2LA7 A;  2X45 A;  3CWK A;  2GJ5 A;  3VHM A;  2RQ0 A;  1Y9L A;  4QGV A;  2MF6 A;  4A1Y A;  1TOW A;  4CPI A;  3ELZ A;  3KFH A;  2HKD A;  1NC9 A;  3PEC A;  4GZV A;  4U9C A;  4BBO A;  1ALB A;  1S44 A;  1HN2 A;  4BX6 B;  4CK4 A;  1AVG I;  1EW3 A;  3HWD A;  4IB6 A;  4NP1 A;  4ZH9 A;  4CDF A;  1LPJ A;  1X8O A;  2C1S A;  3OBL A;  5F1E A;  5FAZ A;  5LJB A;  4AZM A;  4GUZ A;  2X4M A;  4WFU A;  4FBO A;  4U8U O;  2RTN B;  4YGZ A;  5H9K A;  2IZC B;  3D97 A;  5K06 A;  3VG2 A;  4GGZ A;  3VE2 A;  4LKP A;  2RTC B;  4BX6 A;  1LDO A;  3C77 X;  3STM X;  5IRA A;  3JQO A;  5HZ9 A;  3F8A A;  1VPR A;  2A13 A;  4GRJ A;  1TXL A;  2KW1 A;  4ZCB A;  1DV9 A;  4YKO A;  3VG5 A;  1CBQ A;  1VWM B;  5LJG A;  1SY1 A;  4DQ4 A;  1HQP A;  4YFP A;  3CBC A;  4GDA A;  1PBY A;  4BGF A;  1X8P A;  1JYD A;  3AUM O;  4IMO A;  4MIS A;  4N7D A;  5AJB A;  1B0O A;  4OS0 A;  4R0B A;  5HTD A;  2Q4N A;  2UYW A;  1VWG B;  3CQR A;  1DC9 A;  1LCV A;  1O1V A;  1R0U A;  3EYC A;  1KQX A;  2QOM A;  4UU3 A;  1KT4 A;  2YG2 A;  5HAE A;  2RTE B;  1SWL A;  5LJE A;  2MM3 A;  3ZUI A;  1OEK A;  4ZR2 A;  4GH7 A;  3EW2 A;  4QRL A;  4CSB A;  4FBR A;  2C4I A;  1X8Q A;  2WPU A;  5H9N A;  1CBS A;  1BLR A;  1JZU A;  1CRB A;  3NX1 A;  1EI5 A;  1OBP A;  2IZF B;  5AJC A;  1AB0 A;  1MDC A;  1VWP B;  1CJ5 A;  2G5L A;  3B2I A;  4JO6 A;  1ZNK A;  1RXJ A;  2FGS A;  1SRI A;  1SWS A;  1W5R A;  4AZR A;  3PQS A;  3P6C A;  1I9H A;  1X8U A;  3TF6 A;  4BOE A;  2OY7 A;  3WOV A;  4ZHC A;  1JJX A;  3SLT A;  2BC3 A;  2LFO A;  3RDQ A;  1B4M A;  1ZRY A;  5DG4 A;  2OVS A;  1MOY A;  5B10 O;  3RE6 A;  1L6M A;  5HA0 A;  1HMR A;  4QNI A;  3FA7 A;  4CPE A;  2QCB A;  3ZZV A;  1LIE A;  2W2F A;  3B2K A;  4YDB A;  2VFB A;  4I95 A;  3VPJ E;  3WZQ A;  2C1Q A;  1ICN A;  1SWE A;  4O4S A;  1A3Y A;  5EDB A;  1HY2 A;  4IRW A;  3VGW A;  1VWE B;  3BDR A;  3ZW0 B;  2PI3 O;  3O22 A;  2PY1 A;  1GT4 A;  3TGB A;  1IJ8 A;  1STP A;  3HTY A;  4WHI A;  3APX A;  2RTQ B;  1SRE A;  1FDQ A;  2JU7 A;  1SXW A;  2OZQ A;  2AF5 A;  3FEP A;  4FGI B;  5D4A A;  3S5V A;  1PM1 X;  1IKJ A;  3STK A;  4O3X B;  3NQ9 A;  4ARH A;  1N0S A;  1G7N A;  3ZW1 B;  1GXA A;  4BX7 B;  1JJU A;  4I6S A;  2OY8 A;  4GJS A;  4GNW A;  3ZW0 A;  4FBV A;  1U0X A;  1EUO A;  5B29 A;  1YP7 A;  1E00 A;  3RDM A;  5AQ6 A;  5HTE A;  3RWX A;  4QYP A;  1MVG A;  1ZNL A;  3SZJ A;  3CKG A;  3T6F A;  2RTR B;  1I78 A;  2WR6 A;  1D3S A;  2IZE B;  3RDS A;  4GJV A;  1NDJ A;  3VHH A;  5CYB A;  3ZW1 A;  2F01 A;  5DPQ A;  4DQ3 A;  2A5C A;  2OYB O;  3RY2 A;  3B2J A;  5IRU A;  4AZP A;  4O9S A;  1T68 X;  4KCA A;  1LUQ A;  1YP6 A;  4MVK A;  4Y0P A;  4YBU A;  3SAO A;  1JMX A;  2GH7 A;  2HZQ A;  4IAX A;  1LF7 A;  2K23 A;  1SWR A;  2RCT A;  4NNT A;  3RDO A;  1Z24 A;  4MVE A;  2WSJ A;  2RTM A;  2CAM A;  4M6S A;  2YMS A;  4O49 A;  1NQN A;  1VWL B;  3RDU A;  1SWH A;  4Z2P A;  5B2A O;  1SWO A;  2RTB B;  4I3D A;  3MG5 A;  3AEH A;  2FHN X;  2FR3 A;  2RTA A;  3S5X A;  3ZQ3 A;  4YGG A;  4HFO A;  2AVI A;  3FA6 A;  4GK9 A;  5K67 A;  3UAQ A;  1YUP A;  1IFB A;  4GGR A;  2FKJ A;  3QQ2 A;  1SXY A;  5B27 A;  2AT8 X;  4EKV A;  1UZ2 X;  1KT3 A;  2Z4H A;  3B2L A;  4JHQ A;  4Y0Q A;  3SLJ A;  4TQ2 A;  2GTL N;  2DJF A;  1A2D A;  1VWB B;  3PED A;  2X8T A;  3NX2 A;  1ZNG A;  1SRJ A;  4QQ1 A;  3Q34 A;  3T2X A;  4L3R A;  1VWH B;  3Q6L A;  2WEW A;  5HZQ A;  5L3Y A;  1BJ7 A;  4HPB A;  5D48 A;  2BS5 A;  2VFC A;  1FTP A;  3APW A;  3D95 A;  4QZU A;  5LJD A;  1LCW A;  2JOZ A;  1KT5 A;  1LKE A;  1SY3 A;  1N4J A;  4O4U A;  1X8N A;  5D45 A;  1BSQ A;  1CBI A;  2AT6 X;  3UEW A;  4CPF A;  1MM9 A;  1UYO X;  2WQA E;  1TVQ A;  1RSU B;  2CBS A;  5LJC A;  3RE5 A;  2AT5 X;  4FQB B;  2BHV A;  4BJ8 A;  2WEX A;  4OKA A;  3VU1 A;  2Y3E A;  4GDZ A;  3WJE A;  1SRH A;  2KTS A;  2OY1 O;  4ID2 A;  1FE3 A;  4BCS A;  1GKA B;  2Z4I A;  2ALL X;  1SLG B;  2W2B A;  3FR4 A;  2IZL B;  3CMP A;  1HBP A;  3FID A;  1MX8 A;  1OEE A;  1OPA A;  4ZHG A;  2NNE A;  4EQA C;  1GX3 A;  3FDC A;  1LIF A;  1BSY A;  2DM5 A;  1VWJ B;  2RTO B;  2HLV A;  3P6D A;  4ORW A;  3GAQ A;  4Y0S A;  1YIV A;  3WJF A;  3WZN A;  3DSZ A;  4YDA A;  1MUP A;  1GKA A;  4LKT A;  4TLJ A;  3C78 X;  2P8G A;  3TGC A;  1VWN B;  1XCA A;  2CBR A;  3V8U A;  2I5V O;  4COT A;  4YCE A;  1EII A;  5BVT A;  4Y5D A;  2Y3F A;  4CDD A;  1NQM A;  1S7D A;  3KVN A;  2X46 A;  4NLI A;  4DNE A;  4IMN A;  5F58 A;  1PBO A;  4EXZ A;  3BX7 A;  4ON1 A;  3TGA A;  4ZFX A;  3E3C A;  1KL3 A;  1RXH A;  4BQU A;  4Z2O A;  5F7G A;  5L8I A;  4O3Y A;  2LBV A;  3AKM A;  4Y59 A;  1VWO B;  4NV8 A;  3TZS A;  2QO5 A;  5IO5 A;  4U3Q A;  5IO6 A;  4QGX A;  4IB8 A;  1VWC B;  1FEM A;  1GT3 A;  2QO4 A;  2FKG A;  1SWD A;  1YWA A;  3CR6 A;  2ACP X;  1PEE A;  4QGW A;  4WBK A;  3ZWE A;  2FR2 A;  5FQ7 E;  1SWN A;  1Y55 X;  4AZQ A;  1JBH A;  4IAB A;  1MX7 A;  1E2T A;  2A2G A;  3H3I A;  1KZX A;  4OS3 A;  2RD7 C;  1IFC A;  1QFV A;  5JR8 A;  1DF3 A;  1T0V A;  1VWA B;  1SWT A;  5CHK A;  4AZO A;  3FEN A;  3MBT A;  2AT3 X;  1STS B;  3SLO A;  5F6B A;  4AZN A;  2Y32 A;  5EEE A;  2Q2M A;  1U18 A;  4I3B A;  4PSQ A;  2AL0 X;  1PMP A;  1ACD A;  1BBP A;  2MO5 A;  2RN4 A;  3K3L A;  3WJD A;  5HCC C;  1KQW A;  4N7C A;  5L8N A;  2OF8 A;  3SZH A;  4HPD A;  4IBA A;  3BS2 A;  4GGT A;  4I3C A;  1H91 A;  2IZI A;  2A0A A;  1E5P A;  2BS6 A;  4XME A;  3MM0 A;  2GTL M;  1Y52 X;  3LV4 A;  3NP1 A;  4YH0 A;  1QY2 A;  1SWG A;  4O3Z A;  1LNM A;  1KFF A;  4I60 A;  5HZ6 A;  4OS8 A;  5H8T A;  1CBR A;  4EDE A;  1BWY A;  1DZJ A;  5AEO A;  4A1H A;  5FFH A;  1IW2 A;  3S60 A;  4ORS A;  3DTQ A;  2X32 A;  3WJG A;  2QOS C;  1Y9T A;  3OE3 A;  3BY0 A;  4XMG A;  3WZO A;  2IZH B;  4EFG A;  2JMB A;  4JNJ A;  3JSQ A;  1Y53 X;  4O3W A;  1I05 A;  4LZU A;  3STN A;  1HXZ A;  5IRW A;  1QY0 A;  2RTK A;  1GT5 A;  1DZP A;  1SXX A;  5H9A A;  1I4U A;  2FS6 A;  1A18 A;  1QFT A;  2QM9 A;  3FMZ A;  4MVL A;  1OBU A;  2X8F A;  2OL8 O;  1I06 A;  3UEX A;  3T1D A;  4HWM A;  5LKF A;  3VG4 A;  4Z6J A;  2UZ2 A;  2I5Z O;  3KFF A;  1SWP A;  3EW1 A;  3SOT A;  5B5F A;  2WWP A;  2MHD A;  2GC9 A;  3WVM A;  3VE1 A;  1FJ1 E;  3ZI8 A;  2JW1 A;  1W6F A;  2G8C O;  1K24 A;  3O19 A;  4WFV A;  2A3F X;  4ML7 B;  2RTP B;  3BU1 A;  1KOI A;  2HYS A;  1MEP A;  2IZD B;  1SWK A;  4QYN A;  4O4X A;  4MIR A;  5F6Z A;  2OY5 O;  1KT7 A;  3S26 A;  4INN A;  2R56 A;  2A8G A;  2RA6 A;  3BRN A;  1SRF A;  1SWA A;  3HWE A;  3FA9 A;  4GD9 A;  1UYN X;  5HZ5 A;  3WJB A;  1HBQ A;  2GTL O;  5LJH A;  2ACO A;  1BRP A;  2FTB A;  1KZW A;  2CM4 A;  4MEE A;  1TOU A;  3G7X A;  1VWF B;  2DJG A;  1IKE A;  5FQ8 E;  1E02 A;  1VWR B;  2FS7 A;  2MWH A;  3FEK A;  2O62 A;  2R73 A;  5LJK A;  1A57 A; 
#chains in the Genus database with same CATH homology
 1VWJ B;  2RTO B;  1AVE A;  1RXJ A;  3WZN A;  1SRI A;  1SWS A;  1I9H A;  1SLD B;  1SWU A;  1VWN B;  2IZK A;  3RDX A;  2BC3 A;  4Y5D A;  3RDQ A;  2Y3F A;  5K68 A;  1MOY A;  2FHL A;  1NQM A;  3RE6 A;  4CPH B;  4CPE A;  4DNE A;  2QCB A;  2RTJ A;  1MK5 A;  1STR B;  1VYO A;  1KL3 A;  1RXH A;  5CSE A;  3SZI A;  4BX7 A;  4BX5 B;  2C1Q A;  1SWE A;  4Z2V A;  4Y59 A;  1VWO B;  3WYQ A;  1HY2 A;  4IRW A;  5B5G A;  3VGW A;  1VWE B;  2OFA A;  1VWC B;  1IJ8 A;  1STP A;  1SWJ A;  2RTQ B;  1SRE A;  1SWD A;  4CPH A;  4U46 A;  1SWQ A;  1KL5 A;  1N43 A;  1VWD B;  4YVB A;  1SLF B;  1RAV A;  1PTS A;  1SWN A;  1Y55 X;  4BX5 A;  2RTD B;  3FDC A;  1AVD A;  4BX7 B;  3RY1 A;  2IZJ A;  4Z27 A;  4GJS A;  1SRG A;  2JGS A;  2RTH B;  1N9Y A;  1LEL A;  1VWA B;  3RDM A;  1SWT A;  5CHK A;  3T2W A;  3X00 A;  3T6L A;  3SZJ A;  1STS B;  1NBX A;  2Y32 A;  3T6F A;  2RTR B;  3VHH A;  2IZE B;  3RDS A;  4GJV A;  1NDJ A;  2F01 A;  1VWQ B;  1SWC A;  2RTG B;  1DF8 A;  2A5C A;  2OF8 A;  3RY2 A;  3SZH A;  1N9M A;  4GGT A;  5IRU A;  2OFB A;  1LUQ A;  3WZQ A;  2IZA A;  2GH7 A;  2IZI A;  1SWF A;  1SWR A;  3MM0 A;  3RDO A;  4Z2O A;  2RTM A;  2CAM A;  1HQQ A;  1Y52 X;  1NQN A;  1VWL B;  3RDU A;  1SWG A;  1LDQ A;  1SWH A;  5JD2 A;  1KFF A;  1SWO A;  2RTB B;  4I60 A;  3MG5 A;  2IZB A;  2FHN X;  2RTA A;  2RTL A;  1KL4 A;  1SLE B;  2AVI A;  5K67 A;  1RXK A;  3VHM A;  1N7Y A;  4GGR A;  2MF6 A;  4CPI A;  4EKV A;  1NC9 A;  4JHQ A;  4BBO A;  4BX6 B;  3PK2 A;  1VWB B;  1HXL A;  2C1S A;  2IZH B;  1SWB A;  3WZO A;  1SRJ A;  4JNJ A;  2ZSC A;  3T2X A;  1Y53 X;  1VWH B;  2RTN B;  1HXZ A;  5IRW A;  2RTK A;  5L3Y A;  1VWI B;  2IZC B;  4Z28 A;  3WZP A;  4GGZ A;  1LCW A;  4BX6 A;  2RTC B;  1LDO A;  5IRA A;  4Z6J A;  1N4J A;  4CPF A;  3WYP A;  2UZ2 A;  3VHI A;  4Z2P A;  1SWP A;  1VWM B;  1MM9 A;  2IZG B;  2RTI B;  3EW1 A;  5B5F A;  4GDA A;  1RSU B;  1LCZ A;  3RE5 A;  4BJ8 A;  2RTP B;  1MEP A;  2IZD B;  1SWK A;  2UYW A;  1VWG B;  2Y3E A;  1LCV A;  2RTF B;  4OKA A;  2A8G A;  1SRH A;  1SRF A;  1SWA A;  2RTE B;  4GD9 A;  1RST B;  1SWL A;  4BCS A;  3EW2 A;  2C4I A;  2WPU A;  1SLG B;  2IZL B;  1VWF B;  2OF9 A;  2IZF B;  1VWP B;  1VWR B;  5F2B A;  2G5L A;  4JO6 A;  1WBI A;  1VWK B;  2A5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...