4Z2XA

Crystal structure of a rna binding domain of a u2 small nuclear ribonucleoprotein auxiliary factor 2 (u2af) from mouse at 2.15 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from mouse at 2.15 A resolution
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 29
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4z2xA00
5LSOA 4IO9Q 2MKSA 2AYGA 2CQPA 2LEAA 1DZ5A 2RQCA 2XNRA 1X4GA 3S6EA 1AUDA 5LXRA 3P6YC 4Z2XA 2DGTA 2RS8A 3G8SA 4PKDB 2KG1A 4C4WA 2DNOA 2WBRA 2N3LA 3Q2SC 4IOAQ 3CD6S 3MUTP 2DK2A 2M8DB 1M90T 3UCUP 1K73T 1VQ9S 2D3OR 3UCGA 1VBXA 1H2UX 3VAFA 2ADCA 2X1GA 2BZ2A 2NZ4A 2RNEA 4M5DB 4WFAQ 3HHNB 1WI6A 3BO2A 1YI2S 3NMRA 1UP1A 1KD1T 2XSFA 1FT8A 4ZKAA 2D9PA 1KC8T 2CPFA 1U1MA 1X4EA 3OW2R 2XS5A 2XNQA 2KM8C 2ZJQQ 2E5IA 1OIAA 5DDPC 3CCJS 4IUFA 1DRZA 5D77A 2NLWA 2RVJA 1WHXA 2KRRA 2E5GA 3L3CA 2DHGA 3H2VE 3IRWP 2DNKA 2DHXA 1URNA 3DXBA 1NO8A 3VAIA 2J0QD 2JX2A 3VAJA 2MHNA 1QVGR 2OJ3A 1M5VC 4CQ1A 2LXUA 3LPYA 1KOOA 2CQGA 3H2UB 2MZQA 1H2VZ 2OTJS 1S72S 2XS7A 2KM8B 2AYEA 3I55S 1PGZA 4WIIA 1JMTA 1QVFR 2O3DA 1P1TA 2MMYA 5DDQC 2DH8A 2KYXA 4CH0S 2ERRA 1VQMS 1SJRA 2DGOA 1VC0A 2RUGA 2DNMA 5IM0A 3CCUS 2KT5A 2MGZA 2MZRA 2MQPA 2KI2A 3MUMP 1SJ4P 1N8RT 2DIVA 2MZ1A 3CMAS 2L08A 2AYMA 4Y00A 2OIHA 3CCRS 2JWNA 2J0SD 1OWXA 1X4BA 2CQHA 2D9OA 4W90B 2M2BA 3UD4P 1SJ3P 1DBDA 3THPA 3G4SS 2CPIA 4V19X 4F02A 1VQKS 2J8AA 5LXYA 5IQQA 2XS2A 2M7SA 2CQ4A 3EGNA 2JVRA 3PIPQ 4FXWA 1HA1A 1VQPS 1X5OA 2KXNB 2RRAA 2E5JA 1VBZA 2MQQA 4WFBQ 3CTRA 1CVJA 1YWXA 2CQ2A 4TU9A 4IOCQ 5CXTA 1OO0B 3MXHP 2VODA 1HL6A 1O0PA 3S8SA 2MKJA 3CMES 1HD1A 2CPHA 1S79A 1UAWA 4Y0FA 2DNYA 3CXCR 2LA6A 5GVQA 4PR6A 1YTYA 1X5SA 1L3KA 1NU4A 2ZJPQ 3SDEB 1U1LA 3CUNA 2MQOA 4WFNQ 4WKRA 5H1SV 3CF5Q 3D2WA 2QFJA 4C7QA 2QEXS 2PE8A 4PRFA 1B7FA 3EX7B 2MKHA 3BS9A 3ULHA 3MUVP 1YJWS 2GO9A 2MZSA 1VQLS 1WF2A 3CULA 2MYFA 1IQTA 3JB9k 2M70A 2DO4A 2HZCA 3CCSS 1PO6A 1VC6A 2LXIA 1N54B 3EGZA 2G0CA 2CPYA 2KXHA 3CPWR 2CQ3A 3BO3A 1YJ9S 2MXYA 1YHQS 4QPTA 5CA5A 4F25A 3PIOQ 5ITHA 1JJ4A 4U67Q 4TU8A 1JJ2R 2MPUA 3ZZZA 5CYJA 2F3JA 5DDOC 1OPIA 2E44A 5DM7Q 2HGMA 3VAHA 3TYTA 1DHMA 4A8XA 3DLLQ 2E5HA 4F26A 2AD9A 2CJKA 2CQ0A 1FHTA 3UD3P 4BS2A 1VBYA 3U1MA 2DNLA 2LMIA 3B4DA 1D8ZA 1WHVA 1SJFA 2MY7A 1KOHA 1R8HA 1WHYA 2DGQA 2CPXA 3TP2A 4C0OC 2KFYA 3P49B 1JJHA 2LQ5A 2DNHA 4P6QA 2LECA 4UQTA 2G4BA 1A9NB 2DNPA 4QU7A 2N3OA 1HD0A 4LIRA 1FJCA 2Q79A 1YJNS 2HYIB 4OZ0A 2DHSA 2XB2D 1M1KT 2RT3A 1ZH5A 3BO4A 1M5KC 2I38A 2DHAA 2RS2A 4YOEA 2MSTA 4FXVA 3G8TA 2PEHA 3R27A 4RU2A 1VQ8S 2KN4A 1BY9A 3B4MA 2U2FA 5GAHU 3I56S 2MJNA 1WEYA 5HL7Q 1YITS 5GADU 2MSSA 3FEYB 1K9MT 5DDRC 2MKKA 4J5OA 3P5TL 5DETA 3MD1A 2MJUA 5GMKa 2N82B 2DNRA 4UY8T 2CPZA 3TO8A 2EK1A 1N88A 4WF9Q 3NNCA 1Q81T 2MZTA 1VC5A 3SXLA 5D78A 2CPEA 2SXLA 2DISA 1XN9A 1UFWA 1WG1A 2U1AA 2UP1A 3G6ES 3VAGA 2VOOA 2ZJRQ 1U1RA 1U2FA 2DB1A 2CQIA 2M8HA 2HVZA 2OTLS 3SMZA 4TU7A 1M5OC 1SJQA 2M0GB 2M9KA 2KG0A 3VAMA 3R1LA 1RK8A 1VQ4S 2CQBA 2CQDA 1WWHA 2YKAA 3CC2S 3N9UC 3NNAA 2FY1A 1N52B 4QQBA 2LYVA 1VQNS 3HI9A 1ZZNA 3IWNC 2L41A 2YWKA 2MZJA 2KVIA 4TLQA 5BJRA 3CCES 1Q7YT 4CH1A 1Q82T 2DH7A 2QA4S 1K8AT 1WEXA 3CC7S 5LJ5Y 1U1OA 1WF0A 3US5A 3CCQS 2JRSA 3R1HA 5FJ4A 4LJMA 3S01A 5JVGQ 2MKCA 2OSQA 3CC4S 3G71S 1X4DA 2RU3A 2KU7A 5GAGU 2X1FA 2LKZA 2V94A 1X4HA 1X5PA 2DGXA 2MQMA 2MY8A 1W2BR 1P27B 1KQSR 3NS6A 2YH1A 1X4CA 2F9JA 4CIOA 5GAEU 2DNGA 2A3JA 2FC9A 2HGLA 3SDEA 3S7RA 3V4MA 3U1LA 1U1QA 3UCZP 1U1KA 1M5PC 1SXLA 2LEBA 5LJ3Y 2X1BA 2MB0B 3UE2A 1NJIT 1H6KX 2M4MA 3BEGB 2MGZB 3CCLS 5JVHQ 2VONA 2LCWA 2DIUA 3CCMS 2DITA 1RKJA 2K3KA 3K0JA 1ZZFA 3MURP 2CPDA 3LQVA 5EN1A 2RQ4A 3THTA 5DM6Q 2MKIA 4W92B 2LA4A 2KXFA 2X1AA 1FO1A 3Q2TC 2DGWA 2KHCA 2YH0A 2YTCA 2VOPA 2MQLA 4ED5A 2F9DA 1U6BA 2DO0A 3RW7A 2EVZA 2EK6A 3G9CA 1U6FA 1FXLA 2N7CA 1VQOS 2CQ1A 2FHOB 3UWTA 1U1PA 1X4AA 3MOJB 2DH9A 1WG5A 2DGSA 1U1NA 3NS5A 1FNXH 4QU6A 3NNHA 1Q86T 4LMZA 2DNQA 2DGVA 2K8GA 1G2EA 1WI8A 2FC8A 3G96A 1A7GE 1WG4A 2M52A 3FEXB 3RW6A 1F9FA 2L9WA 1FJ7A 5HO4A 2BOPA 3VAKA 2RRBA 1VQ5S 3MI7X 2I2YA 1WELA 5MLCV 2G1DA 1FJEB 4YB1P 5LSLA 3P3DA 2HGNA 2J76E 2KRBA 3ZZYA 2OSRA 2DNZA 2KH9A 1WEZA 1YIJS 2AYBA 3VF0B 1VQ6S 1R8PA 4EGLA 2B0GA 3MD3A 4OZ1A 5IFMA 3VALA 1WTBA 2CQCA 2GHPA 4WCEQ 3J7ZT 3CCVS 3MDFA 2ADBA 1X0FA 1X5TA 1WHWA 1D9AA 2M88A 3J7YU 2CPJA 1UW4A 1X4FA 2DNNA 2JVOA 2DGUA 4YUDA 1WF1A 1QM9A 1H2TZ 2MQNA 4ERDA 2FPHX 1VQ7S 5IM0B
chains in the Genus database with same CATH superfamily
4O4GB 1RAAB 5LSOA 2ZM6F 1FDNA 2EW9A 2RMLA 2VUGA 2ZDOA 3GPAA 5KFDA 3BSOA 2AYGA 2ZKTA 1CJVA 1S48A 1TKXB 1DZ5A 1EHWA 2XNRA 1X4GA 3PTWA 4J9RA 4JV0A 3V4IA 5HROB 3TA1A 3HSJA 4PYAA 1U8WA 2VA2A 3W9JA 4Z2XA 1H3DA 2RS8A 2UXBF 3Q86A 3OFFA 1VR6A 2W4CA 4QIFA 4MKBA 2ZZMA 4IOAQ 4OIXA 1DURA 3CD6S 2NXNA 1M90T 2AW0A 2W25A 2FJDB 4NZ0A 1GX6A 2BUNA 4FDFA 6FD1A 3UCUP 5H9EJ 1R0BG 3X3UA 1NHUA 3UCGA 3GV8B 2J9CA 3VAFA 4F3QA 1HYSB 2ZOFA 2HHVA 3C66A 3KLIB 3IS9A 3NRBA 4M5MA 2EFGA 2WVEA 2RNEA 3QT8A 4KHRA 1ROFA 3ZTQA 3NMRA 3KLGB 3BO2A 1DFDA 4RW4B 5CD4A 2D9PA 3AQPA 3K17A 3KHGA 1B64A 2UVVA 2YKMB 2F8HA 1W26A 3I6PA 1CULB 4DV6J 3OTCA 1NK9A 3HO1A 1IVZA 2CZ9A 2R7SA 2X3DA 2VFTA 2R7TA 5HJXA 3R2CJ 1RHUB 1AZSA 2VPXB 3HCXA 4K4YA 2QRRA 2YWWA 5EDWA 1C4AA 1DRZA 3CCWA 4PG4A 3IRXB 4CLUA 2YKOA 3MCSA 3UDVA 2DHGA 5K20B 2LEPA 1X9WA 1FD8A 2RQMA 2EI5A 1TUGB 4DL6A 4UZCA 2QE5A 4P74A 1TV6B 4ECQA 3RBEA 2WOMB 4KKOB 3UDEA 2JX2A 2CG4A 1S0VA 3VAJA 1HHSA 2MHNA 1ELOA 5A2QU 5BR8F 2F5GA 1PJ6A 5IT4A 5G4DA 3TANA 1S99A 4QZVB 3R7SB 2ZD1B 2B4PA 4CQ1A 4KJIA 3ELHA 2G2OA 3LPYA 2EG1A 3NGDA 2HWHA 3SIPB 1IWGA 2WVBA 4F3OA 5KFEA 1UEUA 2NXCA 3PW7A 4JUZA 5HVHA 3DFEA 2XMVA 2MEWA 2AEMA 3AJ1A 1H7XA 3VZHA 3I55S 4CT8A 4WIIA 3DOMA 2ZH4A 3VGUA 4I2PB 4DJBA 4YY3J 3PV8A 2HQIA 2B51A 2KYZA 1FRJA 2O3DA 2EPIA 4LFAJ 2HNDB 3X1LB 5HVGA 2NZCA 4BC9A 2IM2A 2Q3PA 3MR6A 1E6VB 2DH8A 2VZ9A 1MROB 4BBYA 5HLFA 4A8YA 4JI7J 2XYHB 5KG7A 5E41A 3J81Y 2WK4A 4DEZA 1FVSA 2IM3A 5I3PA 3CCUS 1LNQA 2QL9B 3DGPB 4IFVB 4KGMA 3TZYA 2MGZA 2KI2A 4NZ7A 1HPZA 1NEEA 4OI2A 4EU0A 5KFJA 3MUMP 3PJXA 5GMDA 1SJ4P 4WP9A 1FX2A 3B82A 2EC0A 4X4UA 4IOBA 5IV4A 1KN6A 1SBRA 2M3DA 1R3NA 2J0SD 3PHTA 3TZXA 3D0HE 4N8OA 3UFCX 4QYRA 3WBZA 2D9OA 4I7FA 4YR0A 1IWAA 1RAOA 2B7CB 4ZHRA 1J5OB 3UD4P 4W90B 4CLSA 3THPA 2UV8A 4JV2A 1RBOB 2AJQA 3ITHB 5E3QA 4V19X 1C2PA 1UVJA 4F02A 2ACMA 1FDBA 3M8QB 1S1UB 2J8AA 2NUUG 1RAEB 3OBIA 4CTAB 4ECYA 1CPZA 2M7SA 2JVRA 1VQPS 5KFPA 1X5OA 1RHRB 1VJQA 4ZN3A 2GMHA 2KXNB 3C46A 2WHOA 4Y34A 4JI2F 1U0SA 2C3PA 1VBZA 5KG2A 2E5LF 3D1HA 2MQQA 1FA0A 4WFBQ 3KLHA 2HRUA 3UNYA 1YWXA 2E1MC 1NJXA 2FJVA 4C8KA 3TAQA 1N0VC 1HKAA 8AT1B 5LL6d 2V50A 4CLLA 2VFUA 1YKWA 5DGBA 2BE9B 1NLKL 4OHXA 1JLEB 3Q89A 4YDXA 5A0YA 5CXTA 1HNIB 2LXFA 1OQ6A 1HNZJ 1B0PA 1RGVA 2ASDA 5IOLA 3FFIA 1LFWA 2MKYA 3HVTB 3I0RB 3SQGA 4ED6A 4FF3A 4DR4J 2WONA 3S8SA 4QR2A 1O5JA 2XY5A 2MKJA 4A8SA 4F50A 4C8OA 1XNQJ 1E6YA 1EP4A 2XHCA 3WC0A 4A8OA 1VISA 4DR2J 2HVIA 1HD1A 2HHXA 1YDLA 1TMJA 1R7IA 4ZLPA 1S79A 2UV8G 2JOQA 5ETSA 3PFOA 3OHBA 2DNYA 2XULA 2QL5B 4HT7A 4RPFA 3QZ7A 1NM2A 4ECTA 5ETRA 4ECRA 4PR6A 1S1WA 1L3KA 5H9EK 1BQNA 2OKQA 1U1LA 1WDDA 1Q8KA 5J1NA 3CUNA 4NRTA 3TJ9A 1QY7A 3ICLA 4YQWA 2XGQA 1FJ7A 1GH8A 1OYDA 3CF5Q 3BDPA 1RXOB 3D2WA 2QFJA 4C7QA 4IQXA 3BM7A 2DPJA 4PRFA 3BN7A 1LKZA 4RX6A 2GFFA 1T94A 1R8BA 4ZJOA 2Z30B 5AXMA 3U1NA 5BR8J 2MKHA 3A3NB 2RF2A 2XZTB 3ULHA 4HVZA 4QR1A 2R7XA 1Q4RA 1FNMA 2XY6A 4DV5J 2XZDB 2MYFA 1IM6A 1RACB 2JEGA 3CJRA 2YNFB 3P96A 2B6AB 2W8LA 4KH0B 4ELUA 3LGNA 3L9ZA 4O44B 4XO0A 1PSDA 1RHQB 1SI9A 1DTTA 2LXIA 1CG2A 3EGZA 3EDRB 2VQEJ 1N6QA 1KQGB 3CPWR 2CQ3A 1IBKJ 4OHWA 8RUCA 1LWEB 3JSBA 1T9TA 2BJ9A 5CYMB 2OUGA 3K5LA 2PI4A 4GKKJ 2OLWA 4DV7J 1BMQB 1LW2B 1S10A 2P9CA 4OV1A 4I6AA 1RLCL 1C0TB 4QWDA 1LXJA 3JSMB 1S5ZA 2VBZA 5C25A 3LA0A 1PBUA 5D4LA 4K0KJ 4K8RA 1DHMA 3BB5A 2IC3A 1WC1A 1S0OA 2E5HA 2OMOA 2AD9A 2J6SA 3CJ5A 4JI5F 5CYMA 4HTJA 2I0XA 4BS2A 1SL1A 4FYXB 1RCXB 1VHIA 1XQIA 1PCAA 5A76A 2HAFA 3VZIA 3K5MA 5IT9Y 1NAQA 4XPCA 1TKDA 1AA1B 2YKNA 2PI5A 3K5OA 3QPIA 1WHVA 1SJFA 1HWIA 1NZ8A 1KOHA 3C15A 3E01B 3T5HA 2LQ9A 3UI3A 3KLHB 3QIDA 4F4KA 3TP2A 2KFYA 4YB6A 2EFNA 2LQ5A 2DNHA 3HSGA 3OR1A 3GILA 2E1AA 2X51A 1LK7A 2EBGA 4QU7A 1HPZB 1TELA 4AT1B 3IA0A 2GX8A 1RTIB 2Q79A 2R8IA 4MAKA 4OZ0A 1QAIA 2XB2D 1M1KT 2H5JB 4PAAA 3BO4A 1UCNA 1IXKA 1QE1A 1RT7B 2F8MA 2LQJA 3F0NA 3GG0A 3CO9A 4WP3A 4LF7F 1HQEB 2MSTA 3BZQA 1DQ9A 4WTOB 3R27A 1BWVA 4LF8J 2P6SA 1GXLA 2YWFA 1ICEB 1YVFA 3A12A 1L3SA 3HDSA 1BY9A 1S4FA 3B4MA 2OEJA 3AOBA 2R2SA 3H90A 4CZCA 3DRXA 5KG0A 5AXNA 1MU2B 1NK4A 2HNZB 2ZE2B 4RNNA 4WE1B 4AQYJ 2CJBA 4B9LA 1IN0A 2HQFA 1A6LA 4ZPWR 5GAHU 3T1YJ 2E1CA 2BXJA 3FEYB 4B08A 4USMA 4C3MA 5ADZA 1ZAWA 4WWSA 4MIBA 1RP5A 1Y00A 1FKPA 4TKTA 2V67A 3CJKA 5GMKa 2N82B 3DGVA 1T03B 4DR1F 3N0VA 5J2QA 1E6VA 2DYAA 2NXJA 2AWZA 2EK1A 4CNZA 3GWCA 4USWA 3JYTB 2QFIA 4EK2A 3KWMA 4HYKA 2UUAJ 5I42B 2BMBA 4PPDA 1VC5A 2BJEA 4ZP9A 1H0HB 4KAIA 2UXCF 1S6QA 4RJVA 2DISA 3IG1B 2BE7D 5D4PA 1BQMB 2NXUA 4K7QA 1CJVB 5D4OA 3DLHA 3OVBA 4AFFA 3I96A 1EETA 2VG7A 3CJTA 3WX4A 1WG1A 4U9RA 1JQGA 3A13A 3EGWB 3HLUA 3VAGA 2ZJRQ 4EI2A 4EBDA 3DOLB 2AMCB 2Y8YA 1RYRA 3C6UA 2ZBPA 4R8UB 1EX8A 2XEXA 5A0YB 3TQ1A 4XDDA 1RWVB 3I5BA 3M8YA 2CQIA 2VASA 1I94F 2M8HA 2HVZA 1U26A 3NG8A 4L6V3 1RKIA 4MK7A 4OHVA 2OTLS 4DV7F 4TU7A 4OI0A 2C3OA 4EUVA 2M0GB 2M9KA 2KG0A 4OYAA 3R1LA 2ZHAA 4PUOB 1QLNA 4F67A 1KLNA 4C97A 1RK8A 2PD1A 1R43A 2CIMA 4DN9A 2BKNA 2IAJA 4UUWA 1WWHA 2YKAA 3IC1A 3N9UC 1FFWB 5L1JA 4B3OB 3NWRA 2CAJA 1N52B 4DG1A 1REVB 2HQ3A 4QWBA 3HP6A 4EYHB 2CKWA 4RW6B 1ZZNA 9ATCB 3IWNC 4NLQA 2GIQA 2MZJA 4NEYA 1TVRA 2KVIA 1XR7A 2DY9A 4WU3A 3CCES 1Q7YT 2E7VA 3SCJE 1Q82T 3FBCA 4BDPA 1WEXA 1IKVB 4OI1A 4K4TA 5B0EA 1IJFB 2E1PA 3ZTPA 2RB7A 4YHHJ 3DYAA 3FCHA 3EE3A 4LF5F 1KVJA 5LMNF 2GJIA 3FMBA 2VG5A 1KONA 2Z2ZA 1TR0A 4LFCJ 5FJ4A 1NBEB 4NA1A 5DG7A 1D3WA 1X9MA 2IIHA 3UR3C 4DUZJ 4JI4J 2WRMA 4ES1A 5JVGQ 4B3TF 1KTQA 1RZMA 1DTQB 1BQXA 2K3IA 3CC4S 3G71S 4Q8FA 4BLGA 1Y11A 1HBMA 5FD1A 1TL7B 4NLYA 5JMNA 5KT7A 3MFIA 2VF3A 4DV0J 5L46A 1T8EA 3O2IA 3I0SA 4MYTA 3KXDA 2FJAB 2GW8A 3DLGB 2R9LA 3RB4A 5M2PA 1EQ0A 2B3TB 4ED0A 2HVHA 4L3KA 1S9GB 1S9EB 3M8QA 4E2FB 2UXDF 5K14A 2L9DA 2QMWA 1FNOA 4OZ5A 3OTOF 2B4UA 3BBFA 1KWMA 3GB0A 2J9DE 1KLMB 4P73A 5J1EA 4N5SA 1VMBA 2EFVA 4AXJA 4JP8A 1J5OA 4DQPA 1NKCA 4ICLB 1RWKB 4L73A 4O44A 2A3JA 2GIRA 2FC9A 5E33A 3BF4A 5HLFB 2HQDA 2RE1A 5ETQA 3V4MA 4DXLA 5I3QA 1WSVA 3TJAA 4ECWA 3JXOA 4URGA 1U1QA 4Q5VA 4TQSA 2DY1A 1RI7A 3G82A 3UCZP 4NE9C 4ZK7M 2A1BA 1U1KA 2YKNB 1RSCA 5K9FA 4OX9F 3HJVA 2D3UA 3NP5A 1NJIT 2VONA 3R6GB 2H9ZA 1FERA 3GJTB 5JVHQ 1TL5A 3JS9A 2UXCJ 1AXQA 2P8IA 3NCPA 4G6VB 4CYUA 5RUBA 3FK4A 4TYBA 3HHLA 5F9LA 1H74A 4DN0A 5D3GA 1B70B 3O8WA 1RWNB 3CD0A 3LQVA 4UW2A 5EN1A 2B4VA 3THTA 1IQZA 3DRPB 5DM6Q 2ALYB 3PR5B 1HHTP 3J7AN 1N33F 1KHVA 1FO1A 4O4RA 3HHLD 4PCQA 2F65A 2V4RA 2E66A 2YH0A 1CS4B 5AJ3F 2FYXA 3DN9A 5AXLA 1Q78A 2JZ5A 5E7OB 2DO0A 4OL8A 1EKRA 4UOHA 3RW7A 2EK6A 2V63A 5HMYA 4J9SA 4ZPVR 4IDKA 1RWUA 2MDAA 2ZD1A 2CQ1A 4Y65A 2IAJB 3RAXA 1LQ9A 3UWTA 1TKZA 1W25A 5AT1B 3ZC4A 2C2ZB 1TL3A 1NKEA 2DH9A 2OPQB 1WG5A 3NAHA 2HNZA 3Q8SB 2HSEB 2YQ3A 1X8DA 4X4SA 2HEKA 1LWCA 1WD6A 4U96A 2HMIB 4GVBA 3POTB 4LFAF 3V2UC 4V19J 3NNHA 2K8GA 1YBAA 2DGVA 4X4PA 3G87A 5A8RA 4M5DA 2HFNA 1FRXA 3SCLE 3BQ0A 1R0AA 2W9CB 3K5NA 4LF7J 3G96A 1A7GE 2M52A 3FEXB 3IS9B 3PNIA 2MLYA 3RW6A 4C0HA 5DQGA 4ILMA 3PDNA 5EWFA 5HO4A 3SI8A 1HLWA 2XMAA 4ELVA 5HI7A 2XO6A 5F8MA 2BABA 3VAKA 3QRRA 1B99A 2RHQB 4Q0BB 4RU9A 1F3VA 4H4OA 3M8PB 2OI2A 4OX8A 4FPRA 3UDLA 3NKYA 3M8SA 3M6XA 3GQCA 1IBLF 1G4CA 3MOZA 3M32A 3T1YF 5IZHA 4LFCF 1CS4A 1FRIA 2I2YA 2VG6A 2C22A 2XWXA 2PFFB 1BC6A 4U8YA 5LSLA 3FVYA 3RR8A 2HGNA 4ZLJA 4CLKA 3ZTOA 2D3ZA 3ZZYA 3KLFA 3CDEA 2W2PP 4OLPA 3CJKB 2HFSA 2Y0SD 1DQ8A 2VKZG 4H4KC 3M8ZA 1QJHA 3D6TB 3L7UA 4LVOP 3W2VA 5ETLA 1N5YA 4B3RJ 1MW7A 3KK3B 3A8JA 2VICA 3UPFA 1SB6A 1CJTB 3VALA 1RU2A 4B9TA 3D9BA 5C7PA 3C16B 4HI1A 2KT3A 4MH8A 4I0WA 3CCVS 1U4BA 2FVSA 1EARA 1X5TA 2MHEA 1D9AA 1WC5A 1Y4ZB 2M88A 4NXNJ 3ILIA 1WOSA 2E7WA 2W9AA 2HIYA 2W2QP 1XC9A 1U0HA 2V9KA 5J2PA 4C98A 4DL0C 2DGUA 2VFVA 2YXLA 3MEDB 5E0OA 4YUDA 3SV3A 1CJTA 5L39A 1H2TZ 3B8HA 1MWZA 3MCNA 5CCMA 2Q6BA 2LVWA 3BPDA 2C2MB 4KGXB 1OY9A 5IM0B 3G8QA 3UVJA 3DHXA 3R5DA 4F0HA 4IO9Q 1QSLA 2BRLA 5IV3A 2D3O1 1NK7A 4OHZA 1TL4A 1PKUA 1UVKA 1WKLA 4BWJA 4WZMA 3NGTA 1AUDA 4BHQA 4OX7A 1N48A 1UJ5A 1YRUA 2H48B 3KYLA 2Z0GA 3BH7B 4JI8J 3HFZB 2DGTA 3G8SA 3DHWC 4MT1A 4PKDB 2DNOA 3U02A 4C4WA 1ZTTA 2XZWA 3DI6A 2JLGA 2AGQA 1YGYA 1NSAA 2A0FB 4UUXA 4F4WA 2DK2A 4DQIA 1DLOB 1GT8A 3HKWA 5AJ3J 5J1PA 1GFWB 3EVMA 1K73T 1F9HA 3Q83A 4X66J 1K44A 2FLNA 3MM9A 4IDKB 3HSDA 2DPIA 1F6TA 5C42A 2D3OR 2YWEA 1NK5A 3A3PB 3KJVB 5L1KA 4DV5F 4B02A 2DCUB 1FESA 2IVMA 3MMCA 4N7TA 1C0UB 3SYZA 1Y5LB 4O0NA 3D6FB 1V3RA 3KLGA 1X9SA 1YK9A 5DG8A 4TY9A 3JYTA 3LGMA 4JOUA 2BJ7A 2JJ4D 3AY0A 3LGHA 4WFAQ 1YI2S 1KSPA 1KD1T 4DPOA 5KT6A 2HRTA 4F0KA 1VI7A 3H8YA 4NCGB 3D54A 2QTWA 3M9MB 4I6WA 1X4EA 4KGZB 3KJVA 4X62J 2XS5A 1XWLA 3RB3A 3E2EA 2B9XA 3LP0A 1Q1KA 5DG9A 3J80U 1Z4UA 3M2VB 1N56A 1OIAA 4NOHA 3HJFA 4CCHA 4Z37A 2RRNA 2AF6A 2V0NA 4LSLB 3OR2A 2AIRB 2NLWA 3T9NA 1JLFA 3FC9A 3OLBA 2ZH7A 1IBMF 2WAQD 2B9YA 4ZVTB 2ZH2A 2GAHC 3L3CA 2UUWA 2XTJP 2HK2A 1Q0NA 4ER8A 4YB7A 1TUVA 2VDHA 1AT1B 1VRTB 2DNKA 3BGFA 3JQMA 4NMLA 2V2VA 2PMHA 3PKMA 2OFHX 4ANDA 3MR3A 5HANA 2Q6CA 3VAIA 3BR9A 2J0QD 4RNMA 4ZS6A 2HFVA 4AE5A 1QVGR 3PYFA 4WU2A 2EEYA 3JSRA 4WFXA 2OO4A 2N4DA 2WTFA 4CTAA 1VCTA 3H2UB 3ZZ0A 4B9UA 1H72C 4ZPTR 1H2VZ 1D8YA 1NHVA 1RTJA 2P9GA 3BSCA 4IYQA 4F3MA 1VQ8S 3I9V9 4O3NA 4ATNA 2YX7A 2AYEA 3GMGA 2W2MP 1NK8A 1RTDA 2W8KA 1JMTA 2CDRB 3V6JA 4QIWD 3V81A 1QVFR 3VVUA 1FDAA 1P1TA 3JSMA 2AKWB 3MM7A 3GCWP 3MEGA 5DDQC 1JLGB 5LM7E 2JLEA 3ZTRA 2ZH6A 1HI0P 1SJRA 3HHLB 1S0MA 3CDUA 4DHVA 2AZ1A 2IMWP 2RDJA 5IS2A 4FKYA 3E51A 2GHWA 3TUPA 3HVTA 3SQGB 3HT3A 3FCVA 3MPWA 4CRJA 4HACB 4EMDA 3IR5B 4FS2A 1UZHA 1XERA 3PRDA 2D69A 1KQKA 1CJKA 3W5ZA 3N5BA 2MZ1A 3CMAS 4LF8F 2OIHA 1UL3A 1B0TA 4EBEA 2NQPA 4UOCA 4KT0C 4NCAA 3EXCX 3TWZA 1TL7A 4LBHA 5HBMB 4N77A 3PO4A 4U7UD 1OYEA 2HAIA 5LOQA 3QLHB 4LFBF 1XBWA 4CO2A 5A8KB 1XJWB 1RLDA 4OZJA 1YRTA 2ATLA 1DBDA 3HVAA 1WORA 4RW6A 1YHQS 2JLFA 2NR0A 1HR0J 2DBBA 3HHEA 3M30A 4B3TJ 2ASJA 1Y3JA 2G0IA 3OTBA 2XC9A 2FGCA 4PPZA 2XY7A 4RUHA 1NJZA 3EGNA 5KG4A 2XS2A 1HA1A 2V8PA 4AUKA 3NGKA 2C2OB 3HK2A 4USUA 4P10A 5DLFA 1N4LA 2CNNB 1ZM3A 4ID5B 4EWTA 1JLBB 4KV8B 5J2MB 2IFXA 1CVJA 1IKWA 3MFHA 4TU9A 3QNWB 3DDKA 3WZ0A 3POTA 2VPZB 2GGPB 1RAJA 4B17A 4DX5A 1ZM4A 5EX3A 4ZP7A 3RBDA 1QSYA 1TZ0A 2UUBJ 4EZ6A 1O6XA 1HBUB 1OO0B 3H42A 4ENOA 2VODA 4CM0A 2W1BA 4OYWA 3LANA 1O0PA 3RUBL 3TNVA 3W9IA 3LP0B 4HKQA 2Z56B 4JB8B 3NXZA 2EFOA 2C2NA 3MGJA 4DPXA 4DL4A 1QUPA 1EQMA 3PR4A 3CSKA 1AB8A 2Z58B 2CPHA 5H9FJ 1PYTA 4PWDA 4M5JA 4Y0FA 3TJ8A 1H73A 1S1XA 4OX9J 4LBIA 1GTEA 4WYLA 1YTYA 4ZVUB 1IJEB 4B3SF 1VYAA 3I9ZA 4PXEA 2LDYA 1VRUA 3CIZA 1RAFB 3H4BA 3BYRA 2HHPA 4UOFA 4DF4A 4ECZA 1S1TA 2W9BA 2QEXS 4I69A 2RKIB 3EDQB 3GIKA 1B7FA 2B43A 4Y6IA 4R0EA 2D7SA 1FRLA 4RW8B 3T41A 1NH7A 3TR5A 3EX7B 2R7RA 3BS9A 1YQHA 2O67A 1SIZA 1HWUA 3KJQB 1EIYB 5CZXA 4DS5A 2KHDA 2V4JB 1RJJA 4J37A 5AE1A 5HSPA 4GC6A 1VQLS 3CULA 3TUJC 4PG5A 3FDSA 4YS2A 4ZCLA 2R8HA 2M70A 4NI2B 5T41A 3OVAA 2JEFA 1UMJA 1NNDA 2DO4A 2H1YA 3CCSS 4XK8C 5F0UA 4A8FA 4RW8A 1N54B 1S6UA 4KFBA 4BC7A 4RNFA 1N0UA 2G0CA 5GAGI 4R5PA 4DR6J 4ZJLA 4JI8F 4KTQA 4LF2A 2ZH5A 3MHYA 2GO8A 4OZNA 3J7Z5 1YJ9S 3TUZC 4F25A 3IG1A 3MWBA 2ZBRA 3PEHA 4X4QA 4TU8A 2ZE2A 1HWKA 2VD3A 1JJ2R 2MPUA 3UD5A 3DI6B 3DRRB 3ZZZA 3Q8QB 2XLIA 2E44A 4FYWB 2CWXA 2CWKA 2HGMA 1VIXA 3IMQJ 4UY85 5HROA 5F8GA 3TYTA 1XNQF 1YLXA 4XIUA 3KNGA 2QLWA 4U7CA 2LFVA 3BGUA 3DLLQ 1GMWD 3OTOJ 1JXVA 2CJKA 2CNOB 4K4SA 1YJVA 1Y9OA 1VBYA 4WFYA 2Z2MA 3AD8C 5K14B 3VTIA 3DMJB 5T7LB 4CWBA 2BACA 2IRUA 4DSIA 3H5XA 3QFWA 2FJBB 1KVKA 1LW0B 3K8VA 4DR5J 2ZNYA 3MEGB 1F2GA 2OHDA 2YPZA 3N6NA 3OD2A 3SSSA 5KFLA 1IR0A 1R8HA 2DGQA 2GQQA 4A46A 2VHGA 2BW7A 3O1LA 4KV8A 3OVSA 5J2MA 4DV4J 3P49B 4FBTA 3TA0A 1FRHA 1MWQA 1HFEL 4UQTA 5E3AA 2G4BA 1A9NB 2DNPA 3D3CJ 3TEGA 2P5VA 1R6YA 4AL7A 1JKHB 1FJCA 1WUUA 2PIIA 4KGVB 1M0SA 3OSNA 3QQCD 3R5JB 3BPSP 4F4XA 2H65B 3IP0A 4ZITA 1SJ1A 2RAQA 4R0JA 4KYZA 3R8YA 2F4VF 2I1RA 2I38A 4M1KA 1Y5NB 1REGX 2ZDPA 2DHAA 4FZVA 4ZIVA 3KLFB 1Y7PA 4I7FB 3DXSX 3R5BA 4J9NA 4RWXA 3T5JA 1S6OA 3TX0A 2HZVA 3PY8A 1TKTB 3BREA 1RUSA 4CO1A 4IR1A 2OFGX 1RWOB 1UFKA 3FZ2A 4LREA 4DCJB 4RWWA 5F41A 3BKFA 2C2DA 5C2CA 3SSRA 1S59A 3QJPA 3PYGA 3NMAA 4NYOA 2AT1B 2XWYA 2H5IB 1VC6A 3MECB 1H98A 4DMZA 2R7VA 5HL7Q 3ET6B 1YITS 1SKSA 2MSSA 2KT2A 1FRMA 3QGGA 5DDRC 1RWPB 3FBFA 4DX6A 4X64F 3K5PA 1SL0A 4B9SA 1VLOA 4OZLA 5DJBA 2MJUA 1RCOB 2VC1A 4ZPBA 2CPZA 4DZDA 3DRSB 5E5NA 3GJSB 3AFGA 4RW4A 3KK2A 4DQSA 3MM6A 5I42A 2KVQE 2DR8A 1RAHB 2HQGA 4IRDA 1S6PB 5C2GA 4RR5A 2LU1A 5D78A 1R8AA 3CB4A 2F8EX 2H5EA 3B78A 4GVLA 1RU1A 4J7CA 4DR3F 4DG1B 1HWJA 1I3OB 3D0IE 2FTRA 2YQ1A 4IH5A 4RZRA 1UFWA 3DDIA 3L7OA 3SBMA 3M2VA 1M5SA 2YNHB 5HN0A 4DPUA 4KHPJ 1RT2B 5GAHI 3RG6A 3GONA 4C2MA 1HBNA 2VJVA 3T5KA 3QO9A 4P7TA 1VK8A 4DUTA 2FDNA 1UETA 4Y2MA 4X65F 4MKVA 3KHHA 4A8KA 2R8KA 4TXSA 4GVBB 4HHHA 1NSKL 1M5OC 4KB7A 2F4FA 1SJQA 1U09A 2XGPA 2NSBA 4TYAA 3QGPA 4L74A 5DZ7A 1VQ4S 2GVZA 1NH8A 2CQDA 2GVDB 2KDOA 2AGPA 3ENVA 3NNAA 2BJ1A 1FI4A 2DVIA 1F1BB 1PAUB 1S7IA 3ILJA 2I6WA 2CDQA 2JC0A 2L41A 5KFGA 2FUG9 2YWKA 4DSKA 3GR0A 2C3MA 4IRCA 1KVIA 3GIIA 2YBVA 1B0VA 3CJQA 3PG9A 4J9VA 3H40A 1GMVA 4YB5A 2R42A 2VPYB 4K2JA 1UEVA 2VQFJ 1K8AT 2V8VA 2HFUA 3AH6A 1FFSB 1JXEA 1U1OA 3CJ4A 4NXMF 1U48A 2XHWA 1KLMA 3GCXP 2IBKA 2LQBA 2R8GA 5L8RC 2FJEB 3T6BA 5IQ6A 4FF2A 3NCRA 3MCMA 3D1QA 4K4ZA 4IG0B 1NKBA 3ISND 1SCJB 1SH3A 1XMOJ 2B5JA 1X0PA 2FQQB 2MKCA 3M6VA 3N6MA 4PEOA 4WK3A 4CLYA 2R8JA 4LF6F 3K2YA 4M95A 2FHKA 5IXUA 2BANA 4CLZA 1CBKA 1HW9A 2Z2YB 4UZBA 4I1TA 1U24A 1AFJA 2CADA 3KMSA 1D9FA 4ZLNA 1ZAXA 3C19A 5FLXY 2P2CB 4CH7A 2V94A 5HMZA 5F8HA 2O5DA 1CJKB 1GMWA 1AYEA 3AJ2A 5ETTA 3R97A 3TUIC 3MAQA 2ZNZA 3VGVA 3EPIA 1U8SA 7FD1A 1UWBA 3Q8YA 1KQSR 2BVZA 2V9WA 4DV1F 3NS6A 4DFMA 2YKQA 1S1TB 1VHFA 1X4CA 3SFUA 4DR2F 3GFHA 1UTAA 3L95X 5K5MA 2VKRA 3R6LB 1VGYA 3OT9A 3I4PA 4N8NA 4J9KA 1ZAVA 4AQYF 3MPYA 3BGLA 5F8LA 3MM5B 2Y3YA 3U1LA 4Q2MA 5LMUJ 1SC1B 4I2PA 3NWGA 4IFYA 1OQ3A 4IH6A 1T03A 1SXLA 5KG3A 4YR2A 3F56A 3JQKA 3T6JA 5KFQA 5LJ3Y 2RJZA 1JX4A 3ENAA 1WACA 4XAKA 2FHMA 1CC8A 2M4MA 3BEGB 3PYEA 3OPKA 4HR2A 3E8OA 1NDPA 3CIMA 1JNRB 2LLZA 2RDDA 2DJWA 4C8MA 2C2EA 2VBWA 5E3CA 1D9DA 1ZZFA 4S0MA 5IC4B 3T9ZA 3WQPA 1HNVA 2HBZB 2YPYA 3T1AA 2W2OP 3IWXA 1GXTA 3TVYA 3GYXB 5LMNJ 2MKIA 4W92B 4OZ2A 5K8OA 1S1WB 2LA4A 2KXFA 3HD2A 3TX8A 5KFWA 2DGWA 1S1XB 1VRTA 2KHCA 3FMWA 4HEA9 2PGCA 2A2CA 3UN2A 3T1HF 3J81j 1T0TV 2HNYA 2VQEF 1U6BA 3MCOA 3QATA 2HS4A 1QTMA 5KFSA 1HNXF 1FXLA 3JQJA 3F41A 3HZEA 2OH2A 2V8GA 1QAYA 2W4PA 4WFZA 5G0RB 4FXDA 2JEIA 2BM0A 2DR5A 1U1PA 3SV4A 2JFKA 3I87A 4HHUA 1S9EA 1DAXA 1S9GA 4RW9B 1TAUA 1RE1B 2KO1A 2WOMA 2DGSA 1VRUB 2GAGC 4KKOA 1FEEA 4RO0A 1FNXH 2B6AA 3DLJA 1HARA 3VVTA 2ZEJA 1IM4A 3WC2A 4QU6A 2V69A 5B0CA 1B7YB 1TL1A 1C1BB 3PM9A 1V9OA 3GE9A 3SCKE 4BCAA 2BDPA 2V2QA 5CD4H 3CMQA 1HQEA 3CVKA 4B9NA 1F9FA 2L9WA 3ZZOA 1UVMA 4PXDA 2Q1LA 3BQ2A 4RKUC 4YN3B 5KFCA 1XK8A 2BOPA 5KT5A 4M5NA 1QDUB 1SUQA 3IRXA 2RRBA 4FVCA 4Q7AA 1RTIA 3FFIB 1JKHA 4CO4A 4Q44A 2Y1IA 4G65A 2HHUA 2I8EA 2IYGA 2IVFB 1VQ5S 3GZ7A 3H7HB 3DDNA 5HMXA 3CDAA 1N5TA 3W62A 1PJ5A 5KFUA 5L1IA 2XSJA 3TQEA 4D3HA 1RT5B 1U0HB 5HP1B 3EWGA 2G1DA 1N32F 4XPEA 1TKTA 3H0PA 3P3DA 5GMEA 2J76E 1U7LA 3FRZA 5FDLA 4DCPB 2ZBQA 2QYCA 2NREA 4PG8A 2JNJA 1S1VB 2OSRA 4ZVEA 3KLEA 5DQIA 4DFJA 3QGHA 2CRLA 3ZZUA 2HFOA 1WEZA 2HURA 3BKUA 4P2MA 4F4YA 4B9VA 4C8LA 3H5YA 4ECSA 3F44A 2FLLA 1KFDA 2FIUA 3ET6A 4KRWA 4OYXA 1VQ6S 2E5LJ 2HHSA 3DM2A 1JJ4A 1HMVB 2W24A 4EGLA 5IFMA 3MM8A 4OJ1A 2CQCA 2DRDA 1MN9A 4N41A 1FEHA 1MROA 1RAGB 3MDFA 4HT5A 5CYQB 5KFVA 3G6YA 2ADBA 4Q45A 4PWUA 2ZC4A 3TAPA 2CPJA 2WB1D 4U6PA 3MM5A 2DNNA 2IPOB 1WSRA 1VQSA 2ACYA 2BQUA 1UEKA 2W4DA 3V6HA 2QA2A 1Q5VA 4P7VA 1RA7A 3LH2S 1MN7A 3DU6A 2MQNA 2OP5A 3BSAA 4E0DA 3NY0A 1IBKF 2R2UA 1VQ7S 2FD2A 4ZDNA 1PIEA 1WC3A 2QL7B 4U8VA 2R7OA 4QWEA 1FJGF 2JDJA 4DBQA 2VG5B 2IJNA 3FSIA 3K58A 2CQPA 1HWLA 2UU9F 2B8QA 5DO2A 4DFKA 4CNYA 2LEAA 3MMBA 4RUCA 2FY8A 3VQTA 4CM2A 2BEFA 5GADI 4DPWA 4J9MA 4ED8A 1QAJA 2FVPA 1Z2LA 4I68A 1RT1A 1ZM9A 2F40A 4JI1J 5LXRA 2V8DA 1RT4B 1V3ZA 3P6YC 3CJ0A 5U47A 4M8LA 4K4XA 2VG6B 1SH0A 1JK9B 2V8HA 3DNCA 4QPXA 2I5JB 2OPSA 2XCAA 2WBRA 3PFEA 2YWHA 2UVWA 1FXRA 1RQ0A 2QA1A 2M8DB 2KZZA 3HVRA 2KJWA 1FKPB 2HWIA 4RW7A 5C42B 4P52A 1VQ9S 1DY3A 3RAMA 3TVZA 2GVDA 4DLGA 1H2UX 3LW5C 3FKBA 3TVKA 2ADCA 2X1GA 3UW1A 3C3LA 4I67A 1ZS6A 3QAEA 1TAQA 3CW2C 2BZ2A 3MECA 4YP3A 2I5JA 2K06A 2OPSB 1YZ7A 2HS0A 2I9SA 3K7RA 5C24B 2NZ4A 4M5DB 5B0BA 3PJ9A 2XI2A 3V81B 3P45B 1NPPA 1VDHA 3OTEA 2VFRA 2HHWA 1JLCB 2VBXA 4NLGA 3NL0A 4ZKAA 7FDRA 4LF6J 3TEHB 1TK0A 3OW2R 3CJ3A 4OYOA 2KM8C 3J7A1 4K4VA 1RHKB 3KG1A 3M8WA 2YNHA 2GC8A 4JYAJ 1ZOTA 3MF5A 5DDPC 3AB2B 4LSNB 3LP1A 4K4WA 4IUFA 3LF0A 1AFIA 3A1YG 1WHXA 5F8NA 3T19A 2IJRA 1BQNB 3RZAA 3PW2A 4DX8H 1L3VA 3H2VE 1YX2A 3IM9A 5HBMA 2FVCA 5DGAA 1HBMB 3LPEA 1T9WA 2GQCA 3C15B 1Q95G 3E01A 3TAMA 1IKYB 1M5HA 3UO0A 3KK1B 1U47A 1SV5B 3ENQA 1FTRA 3MEKA 2ABYA 2QZ8A 5KT3A 4JV5J 4E98A 3C6TB 2PT0A 5LMUF 4P71A 5EGYA 1S1UA 2LXUA 3KK3A 4OYMA 4M94A 2KTQA 1KOOA 2CQGA 2D41A 2XMWA 4LF4J 1DLOA 1P1LA 5KOXA 4X65J 1S72S 2XS7A 1WC4A 1SVDA 4DV0F 4ZVGA 2FLOA 3QLHA 4F7VA 1PGZA 1PBAA 4KE5A 4A47A 2G0JA 2HHTA 2MMYA 1W7WA 5HQLA 4UQGA 1S7HA 3CGIA 3SFGA 1BXNA 4CH0S 4OFZA 2ERRA 1R89A 2OAUA 5H9FK 2DGOA 4UTGA 3OTDA 2RUGA 1G7CB 5IM0A 2KT5A 3I5CA 1EB0A 2R3VA 2DD8S 4Y2KA 4PQUB 4JI3J 4R25A 3NBPA 1N8RT 3MAAB 2CFXA 2ZFHA 4R5PB 2AYMA 2ILYA 4Y00A 3NGRA 4J9PA 1VQYA 1FJGJ 1WNEA 3M2RA 1PC5A 1UVLA 3O3LA 4HHJA 1RT1B 3PJWA 7AT1B 1RBLA 1T02A 5J2NB 3ILOA 5CH7B 2V6AA 3BGRB 3DRRA 1QE1B 1RT7A 4NLUA 3NEKA 1SJ3P 4JI1F 2ZH1A 3DM2B 3PRVA 2HBQB 2CPIA 2N4CA 1O51A 4MTPA 2PO4A 3WIUA 3VHQA 5IQQA 2NYIA 5LXYA 1BD6A 2K7KA 4CO0A 3EUNA 4FXWA 4NMXA 1ZTWA 1KQFB 2FZKB 3BQ1A 3FBEA 3OUYB 1N33J 1RYSA 2E5JA 2DXEA 3CCZA 3LAKA 1N5SA 1WKKA 4ZPDA 3DKDA 3KTQA 2O66A 1CSJA 3FEZA 2YX1A 3GP9A 3W5XA 1I94J 2BA9A 1Y3KA 3C8YA 3LO3A 4YHHF 1RTDB 4TVAB 4DR3J 4X4VA 4DDFA 4N56A 3DU5A 2YY3A 1TL3B 3QRQA 1E6YB 1EP4B 1I51B 1NDLA 3C14A 5I3UA 3VGTA 4EZ9A 1ZA2B 2CXEA 4M5HA 2QJ3A 2HKEA 2J0XA 1T3OA 1DARA 3IO1A 3N5FA 3UDCA 4C0BA 5AE3A 5KFBA 1GTHA 4L72B 4AL6A 4USKA 4ALZA 4DX7A 2ZHBA 3P4UB 4Y28C 1J5EF 1S6QB 4LRCA 2VC0A 3HHKA 1H38A 4ED4A 1MU2A 1RA6A 1WJ9A 1NDKA 5DS7A 1UAWA 1C0TA 2PA8D 3AOCA 4AYBD 4NLVA 3CXCR 2LA6A 5GVQA 5F3ZA 2AJFE 4PQAA 2ZJPQ 3SDEB 3D66A 1LWFB 3KHRA 1HNVB 2G2YA 3RJMB 2CVEA 3H5SA 3LUYA 2FHJA 4WFNQ 5JXSA 4DLEA 3OL9A 3FRYA 3QT6A 3CO0P 1XMBA 3I4HX 1L5UA 2C3UA 1OSDA 3CJSA 4C3KA 1IBLJ 1GMUA 3IAS9 4TLRA 4ZA1A 2B8PA 3W2WB 3RBZA 3M30B 1KTVA 1SKUB 4NEZA 5KG5A 4DV3F 2CJAA 3LTOA 4JI4F 4PUOA 3VWSA 2GO9A 2MZSA 1HR0F 1KNZA 2E9TA 4K5RA 2VQFF 3ENWA 1IQTA 4GC7A 4DCOB 2QLXA 3EVOA 3KKFA 1FE4A 1HNXJ 4NRUA 4NA2A 3M4XA 4ID5A 2UXBJ 2BKPA 2XI3A 3EPGA 3C6UB 1A0OB 1Q8BA 2HPUA 3QBCA 4NLOA 2GIFA 3QZ8A 4LSNA 2IM0A 1RHJB 5KFIA 3CJ8A 1ZA1B 4O4GA 1LXNA 1VRQC 2OEKA 2VFSA 4OYZA 4Z7YA 4GO5X 5E3RA 4C8YA 4OLOA 1GNKA 4QPTA 5CA5A 4NLPA 2R2TA 4NPOA 4YMEA 2CJQA 4U67Q 2WVCA 2R7UA 2BBEA 2OPRB 3MTJA 4E8UA 4X4OA 2HK3A 2F3JA 2IC3B 1TQLA 1ITPA 3ZFVA 5HAOA 4M5LA 5DM7Q 5KFNA 1SPBP 2COLA 2HBYB 3M2RB 3KDNA 1R8CA 4H4KA 3RRGA 3D5MA 2J9DA 2FJWA 4A8XA 3D28A 2ZH3A 4HLBA 1X7VA 4NX9A 2JHEA 4V1Ak 4F26A 4GMKA 2QN6B 2GHVC 2CQ0A 2XMMA 2YNIB 1RTJB 4RBTA 4A8WA 3UD3P 4QOTA 3U1MA 4C11B 2CG8A 2DXFA 4U7UK 3B4DA 1ZBTA 1D8ZA 1JLQA 3DLKB 5KG1A 1NXIA 3TRGA 3W64A 2W7PA 1OSCA 2GVZB 4F4ZA 2ZC3A 2HS3A 1LFPA 3PYDA 2MY7A 3KLEB 5J2PB 3CDWA 4EO8A 2KJVA 3PXGa 4LQ9A 3M9OB 2BANB 5KG6A 4F36A 2JC1A 1V5VA 2QGFB 4IRKA 1FTCA 4ZJQA 4HI2A 2W2NP 3M7VA 3PHEA 2N3OA 1XNRF 1HD0A 4LIRA 3T5LA 3IN5A 1YJNS 1NPKA 1K0TA 4X4NA 1SQGA 3BBCA 3G6VA 4JI6J 2DHSA 4QYZJ 3V6DB 2RT3A 3AT1B 1ZH5A 2HLTA 1M5KC 2GA7A 3M2UB 4YR3A 3R3TA 3TAMB 4OQJA 4NLTA 4FXVA 3G8TA 2PEHA 3GR1A 3OXGA 3QWUA 3AODA 4KGKA 1SKWA 1VFJA 4LF1A 3VR1A 2IA6A 1JJCB 3QT5A 2C28A 3ISNC 3HT0A 2HMIA 2OD4A 3HHDA 2KKHA 3NLCA 2MTLA 5L9NA 2CZVC 3GG1A 2K1RB 1WEYA 2WW8A 4CLPA 3Q23A 4B9MA 1Q8LA 1K9MT 4USHA 2MKKA 5G0RA 1F9EB 3C6TA 3W1YC 1FK9A 5DETA 3PACA 4UY8T 1HNIA 3TO8A 3DLBA 3OL7A 4QW8A 1NK6A 1N88A 4NI2A 4P2XA 3NNCA 5HQ8A 2ZVIA 1UPMB 3BJYA 4I2QA 2MZTA 3BN4A 4JI3F 2X7IA 4EFAC 3SXLA 2JL9A 3H2LA 2RHSB 1JLBA 1PC4A 4ZLLA 2PMWA 3V4IB 5D0RA 2CPEA 4A48A 1Y0HA 2W01A 3FCWA 3MR7A 4MK8A 5D3GB 1XN9A 1ACMB 2UP1A 2DR7A 3G6ES 5DRKA 4DV4F 2P6TA 4EYIB 1EKSA 1LEOA 2Z4PA 1DTTB 1YBTA 1BQMA 2DB1A 3K89A 4ILRA 3ZZRA 2BQRA 4JI2J 2BX6A 2MQ8A 2FZGB 3WHIA 1CQMA 3HULA 1VBKA 3BR8A 1YJUA 4WBFA 2F4VJ 4G3IA 3MMAB 3SMZA 5ETMA 1ZETA 4LQ3A 1Q5YA 4YFUA 4L3NA 3VAMA 4HH0A 2RF2B 4DPYA 3J80Y 1HI8A 2CQBA 3RYLA 1EAYC 2OELA 4ZVFA 4TN2A 4ECVA 1TP7A 1FXDA 2PDAA 3O6QA 1RT6B 4I6YA 4MK9A 4OJHA 3W7BA 3W8PA 4QQBA 2A10A 2DXDA 1SQEA 4C11A 4FNIA 4OMFG 1SL2A 1SC4B 1JLCA 1TU0B 2H54B 3HM9A 3CD5A 5A8KA 3BBBA 1G3OA 3BDEA 4C8NA 1TFWA 2IDLA 1KS2A 5BJRA 1KFSA 2M5YA 4CH1A 1N36F 3CT9A 2QA4S 4N76A 1UA1A 2OEMA 1QAXA 1TK5A 2YVSA 3GYGA 3DOMB 4DS4A 4O0IA 1R27B 1TVRB 5A8WA 3C16A 4DR4F 5EWGA 1WF0A 1KP6A 1IUJA 3GFYA 2J7KA 2JRSA 3BYPA 2J8SA 2WONB 4USTA 5A6WA 4P72A 2HW3A 4KSEB 1BUXA 3DRYA 1T95A 2BJ8A 3I31A 5AXKA 4FS1A 2QLBB 2AJ2A 4L75A 1GQEA 2OPPB 4NYPA 4NA3A 3PEJA 4O3SA 3K59A 2OSQA 2ZKUA 3I0SB 2OGUA 3LAMA 3R5GA 3KJFB 4IFYB 4GRSA 5SUHA 1PYOB 2EKYA 2OD6A 3SSQA 3KK1A 3RB0A 3R7BB 2RU3A 2HLUA 2PA3A 3HSZA 4I64A 3AD9C 1DJ0A 4DV3J 1UVIA 1FKOA 2VA3A 2LKZA 2XSJB 2V4JA 2HZAA 3T3FA 1X5PA 2AU0A 1AW0A 1KHWA 3G2XA 2MQMA 1W2BR 3FQKA 4TNOA 4H54A 5B09A 4B3OA 4B3MF 2W9BB 3ITHA 2F9JA 5D6GA 4CIOA 4OHYA 1KR4A 2EWHA 4HTIA 4KFBB 4MKAA 1FKOB 1RWWB 2DNGA 1XR6A 3KUEA 3Q8VA 3OJSA 2F7VA 3S7RA 2YNFA 1I1GA 3LWLA 2ZVSA 1S6PA 3R7NB 2E9ZA 1TL1B 4ES2A 2GJFA 4EEYA 3N01A 2WW4A 3FSYA 4IR9A 3SEOA 2DEJA 4QYZK 5DQHA 4FYVB 2AX1A 2X1BA 3CCTA 3KG4A 3MMCB 4JYAF 1NB7A 3KUHA 1H6KX 4ETZA 3DOLA 3CCLS 1RT2A 3CDBA 2LCWA 4W98A 1NJYA 2EXUA 2J5AA 2ROPA 1RKJA 4WPAA 1RTHA 1D09B 1S1VA 2C1EB 3J7YI 2ZUGA 4FBUA 4LVNP 1MLAA 4WE1A 2RQ4A 4NLDA 1MWYA 3W5YA 3PX0A 2GMJA 1ZM2A 2IRYA 2YTCA 2JEJA 2VOPA 1RISA 4NWBA 4DL2A 3ILLA 3MR2A 2F9DA 1K1QA 1I6JA 1GK8A 5J2QB 1SQFA 4LF9J 3QRPA 4DR6F 4OJ3A 4QCLA 1G1XA 2EVZA 2CA9A 3OUYA 3G9CA 1U6FA 1Y5IB 2BYCA 3QJJA 3ONQA 4ECUA 2N7CA 1RT3B 1YJTA 1VQOS 4LRFA 4ANCA 2AQ4A 1N34J 3BKTA 2EC2A 4DSFA 2AJ1A 1YJ7A 1VK3A 1X4AA 1NSPA 3GSDA 1S12A 3QFHA 4ELTA 2DHHA 2R7WA 2N7YA 1UVNA 1YZ6A 5HMWA 1LWFA 1U1NA 4ED3A 5F8IA 3G86A 3IXQA 5AE2A 1D1UA 4MYUA 5ETOA 1GXUA 4JI6F 4DI6A 4LMZA 4Y2AA 3ZTSA 2ZBIA 1WI8A 2VB6A 2HBRB 1S4EA 3LP2A 1MMDA 4FP9A 3KK2B 1WG4A 2FVRA 2UUCJ 4LFBJ 3MMBB 4HDGA 5LT5A 3OR2B 4LT6A 5D0HA 1R0CB 1RABB 1T9XA 3JSYA 3M2UA 4LR9A 4X4TA 3R9LA 1HMVA 2Z57B 3QIPB 1FVQA 2XMKA 3JTPA 1CULA 2NCKL 2UZAA 2YH1A 3W60A 1UJ6A 3NOCA 2ROGA 2G9OA 5CABA 3Q8RB 5F8JA 1APSA 3S1TA 2HQCA 3MI7X 4OX6A 1T11A 4YEAA 3ZZTA 5D0GA 4NYZA 4DV2F 1WELA 5MLCV 5KFFA 3KUGA 5D0EA 3EGVA 4I4BA 3TARA 1FJEB 3WDOA 4KC5A 4ZVPB 2NXEA 2RILA 3H4DA 4B3SJ 1Q8IA 2KRBA 4QR0A 2EFPA 3DRSA 4RNHA 3L09A 4DSJA 1WKJA 3HX9A 1QD1A 3FGVA 4FN5A 2CNKB 2CYYA 2DNZA 3MZIA 4PZVA 5CHCB 4ZMMA 4F2RA 4ILLA 2KB2A 1N5VA 1YIJS 1XMQF 2QSFA 4DFPA 2AYBA 3VF0B 4IG3B 3W65A 2EG2A 3H98A 1FE0A 8ATCB 5L1LA 2DTJA 3OFHA 3U27A 3R5AA 1R8PA 3Q8UA 1T9UA 4ECXA 3DLGA 3FJ2A 1WTBA 4FVMA 1XTZA 9RUBA 4WCEQ 3Q8PB 3MPVA 1X0FA 2XYPB 1GX5A 3ADAC 3EZUA 2WVFA 2QMXA 2DCLA 5E3PA 4ES3A 3J7YU 5HQMA 1S97A 2P9EA 2XMJA 3GFXA 4FKXA 4ZOSA 1BE4A 2EFQA 2F63A 2VL1A 4C3LA 4ICLA 1LW2A 1S57A 4USVA 1Y10A 2AEFA 2ROEA 4ZP6A 1DTQA 2LU2A 3H25A 3MOJB 1QM9A 1GEHA 4X64J 4ERDA 1X31C 4CI0B 1REVA 4OV6A 1AZSB 2FPHX 2BJDA 3O44A 3L7PA 2RSQA 5EHHA 5F3TA 5CAAA 1WTFA 2MKSA 1GAOA 2ZOGA 4H4MA 1OY8A 1SV5A 3M6WA 3QSIA 3ZO7A 3FZBA 3L4BC 2AP6A 4U95A 3EZ5A 2RQCA 4DL3A 2HRYA 4RBVA 3S6EA 4ED2A 3CE8A 6FDRA 2A6MA 2WBMA 4HH1A 3GIJA 1RT5A 2KG1A 5HP1A 1T3NA 1FKAF 4TY8A 1FCAA 2NUHA 2N3LA 3MPDA 3Q2SC 4JV1A 3HMJG 1NRKA 3MUTP 1B4SA 1Q53A 2Z2LA 3AA8A 2XBPA 2APOA 1IKXA 1N5YB 1O8BA 4NLXA 3OFEA 4LF9F 3ETMA 4EO6A 1L3UA 1VBXA 4DUZF 1JXLA 4G1QA 1P9QC 4F4AA 5ETPA 2RDIA 2GS8A 1HBOB 2MLXA 1TUWA 1HBUA 2CZ4A 4OYBA 5KFOA 3LWMA 4OI4A 5EUHA 3GFZA 3KNAA 3V5RA 2JFDA 6AT1B 3DLEA 5IT0A 3HHNB 1WI6A 5I4MA 4CYUB 1UP1A 3EXYA 2XSFA 3HFKA 1Q16B 1C0UA 1FT8A 2EBEA 3D6HB 4O3PA 1PYSB 3U7JA 3QWPA 4C6AA 5JJBA 4PG7A 2CPFA 3MMJA 4ZP8A 1U1MA 1KC8T 2HHHJ 4LF5J 2XNQA 3HF5A 5KFHA 3NAIA 3A8EA 2ZJQQ 1IR2A 1OS5A 1U25A 3DOKA 2E5IA 1MG7A 3CCJS 3I0RA 2NPFA 3KJNB 3W8GA 5D77A 2YKPA 2A6OA 2RVJA 1JNZB 2KRRA 2PN6A 2E5GA 5HVFA 3AAWB 1VOMA 3RGIA 3N79A 3RTVA 4LR7A 2B56A 3G82B 5BYRA 4DR5F 1U02A 3RRHA 3RRKA 3IRWP 1C4CA 2LDIA 5B0AA 4B3MJ 2DHXA 3OSPA 4DR7J 5HATA 4DV2J 1URNA 1N6QB 1NO8A 3DXBA 2O1PA 2JSXA 1BHNA 3PCOB 1Z2ZA 4JBCA 2ZH9A 1SC3B 4Q43A 1KBRA 1S0NA 2OJ3A 3M6UA 1KKHA 1P8GA 2UVRA 1M5VC 5KFAA 3HXMA 1JIHA 2GCFA 4ANEA 2KZMA 2G13A 3A3OB 1YSJA 2GV1A 2YKMA 2MZQA 4MKYA 3PVXA 4DZ6A 2OTJS 1WC6A 2YNGA 1XMQJ 3MPUB 2ZH8A 1CJUB 2KM8B 1MMLA 1HNZF 3OR1B 1S49A 1KEKA 3PW0A 2QLJB 2QC3A 3D68A 5M2RA 3GV5B 3R5CA 4GKJJ 3MM6B 1F5AA 1N34F 4P75A 5CQGA 5L9XA 3IR6B 4PWWA 2KYXA 2Y1LB 5KT4A 3KHLA 1VQMS 1HYSA 3IR7B 1RTHB 2C2KB 2NPIA 3M32B 1VC0A 2BOAA 4IG0A 2CJ9A 2DNMA 4O3RA 4DPTA 4PQUA 2VBYA 3NS7B 1FWPA 3OV7A 4KR0B 4KHPF 2MZRA 4Y2IA 2MQPA 3D67A 4DUYF 2X3GA 2PSZA 2DIVA 2UUTA 4N47A 5IC6B 5E2QA 2L08A 5JUMA 2IM1A 5A8WB 5BXIA 5A6PA 2HIQA 4LUBA 3CCRS 5FIIA 2YQ0A 5FDLB 1NK0A 2JWNA 2V68A 3N28A 3GLJA 1JLAA 3N6LA 4MIAA 3WIVA 1OWXA 1X4BA 2CQHA 2FZCB 4LR8A 3GV7B 4DU7A 1RADB 1UZDA 1NB2A 2RU9A 1T7PA 4AL5A 1S9FA 2BQ3A 1W2IA 2M2BA 2AX0A 2L3MA 3GJRB 3G4SS 2BR0A 1WOOA 4UF4A 4R8UA 4CLWA 3KFWX 5K8NA 1IR1A 1HQUA 4RUBA 1TKZB 3PZPA 1LWXA 1XIQA 3TI0A 2BRKA 2RKIA 1VQKS 1RT3A 1ULRA 2CQ4A 3CD7A 3PIPQ 5ETKA 3OJUA 3B54A 3Q0AA 2CVIA 2C42A 3MEDA 4DQQA 1TFYA 2RRAA 2CNLB 2B7BB 4J9LA 2LQ8A 2J6TA 1K47A 4KQZA 3RB6A 1R0AB 3CTRA 5CZVA 4LF4F 2CQ2A 3ZZPA 5M2UA 4I2QB 3GJQB 1QTNB 4AD6A 2ZZNA 5K8PA 4IOCQ 3AXMA 4EBCA 2OPRA 5DZ6A 4URSA 1HW8A 1JB0C 2OPPA 4D3GA 5IWAF 2J6UA 3MXHP 4ED7A 1LWEA 2IJFA 2KL8A 1PJ7A 2V2ZA 3ZNUA 1P9YA 3EMTA 3QT7A 4ZVHA 1T9VA 1HL6A 1QUVA 1UW9A 3D3BJ 3ISZA 2HHHF 4IH7A 1M1HA 4MFBB 3CMES 4K0KF 3NCQA 4XTTA 4LBPA 1TMMA 4URQU 1N5QA 2WSFC 5C25B 4DL5A 1FRKA 1PILA 2V5HG 2YX4A 5HK4A 3GSIA 4FNHA 3KLVA 4OI6A 3OFGA 1PG5B 3IM8A 2PC6A 1X5SA 3AHPA 3M8RA 2ZOMA 4IQMA 3GIMA 1NU4A 2R2RA 1MSWD 1T05B 2MQOA 1Q79A 2HG4A 1SKRA 2UVUA 4WKRA 2GJ2A 4MMOA 4QIVA 5H1SV 4G1QB 3AXKA 1CLFA 2FLPA 2PE8A 2AJ4A 1F0XA 3D0GE 1RB0A 4A4JA 3JAMY 4B3RF 1TTHB 1UWBB 2IYIA 5D4NA 5KOWA 4FYYB 2ASYA 1XMOF 4NCGA 3MUVP 1YJWS 1WF2A 4LRAA 4OYIA 3I32A 4C48A 3KG0A 3JB9k 4FYDA 2WCXA 1IKWB 3IFEA 4ZN1A 2KFNA 3W3SA 2MLZA 4WTYA 4X2BA 2HZCA 3HVWA 3DRPA 5CCLA 1PO6A 2BE2A 3KOAA 5ETVA 3OHAA 2Y0BB 2ZUAA 3TZWA 4UOGA 1V5IB 3LP1B 1X60A 2V34A 2IHR1 2XMTA 4K2XA 3TW0A 3HKZD 2RH3A 1JLQB 2CPYA 2NYHA 2IRXA 2KXHA 3DLKA 3GTYX 2DR6A 3I5AA 4HACA 4Y3CA 1EETB 2VG7B 3EICA 1NSQA 2RIJA 2ZZTA 4PABA 2MXYA 2IMOA 3BO3A 4G1PA 1HIYA 4DV1J 4DV6F 2QV6A 2E7XA 3B6BA 4KO0A 4NZ6A 4WYWA 3ZNJ1 5ITHA 5KT2A 3PIOQ 1JLEA 4K59A 5CYJA 4F8RA 4KH1B 4TY8B 2OMLA 3H5UA 2Y8WA 5DDOC 1LK5A 1OPIA 2BM1A 4J91A 3A4TA 3ETOA 4ZVOB 3LALA 2ZBCA 1WDTA 1YRXA 3OXFA 4ZCKA 5GAEI 4QIGA 2W7OA 3VAHA 3T1HJ 4NXMJ 4M63A 1J5EJ 4FF1A 2Z8QA 3SCIE 5KTQA 4DR1J 3AD7C 1N36J 1FHTA 2GZOA 4CO3A 1WOPA 2EKNA 3MM9B 3QGIA 3OL8A 4IG3A 2DNLA 2LMIA 4RW7B 3W61A 4X66F 4DF8A 1VIOA 1RBAA 1TK8A 1L3TA 2UU9J 4WZQA 1AUSL 3W66A 1ZPWX 1YBUA 4NASA 4WK1A 5F0WA 2C2RA 2Y9HA 2Y1RI 2XM3A 3FSXA 3IWLA 2ZM6J 3QMQA 1OMSA 1WHYA 4J9OA 2CPXA 1UKUA 2QT7A 3JTOA 2XLJA 3GYNA 4C0OC 3MAHA 3OL6A 4A8QA 1JJHA 3FBBA 4P6QA 2ZHOA 2LECA 1FD2A 1M1GA 1HNWJ 2Q43A 2B5JB 1G6BA 1YG0A 2WSEC 4QIEA 2J9EA 2OPQA 3NBPB 3ZXWA 3MR5A 1FF2A 4X62F 2VH7A 4Z7CA 4Q0BA 5K8MA 2WZ1A 2HYIB 1I5OB 2BW2A 3PO5A 4DR7F 3HD1A 4WXOA 1UJ4A 3EZOA 4WJBA 4ETXA 5KFKA 2ZWPA 1P6TA 5BYSA 2E9RX 1BGXT 2K2PA 3SZ2A 4RBUA 3BH6B 2RS2A 4YOEA 4DSEA 2HVEA 3MM7B 4CLTA 4NLRA 2QG9B 2CJYB 4RU2A 1BWEA 2KN4A 3RAQA 3TA2A 4J90A 1HHQA 4NXNF 2BKOA 2CJXB 2B4OA 3MEEA 1Z1ZA 1HI1A 1U49A 3UQSA 1URRA 1FX4A 4CO5A 2J7WA 4G1IA 4PWDB 2U2FA 4DQRA 2IY5B 4CLFA 3I56S 2MJNA 3QAUA 4L76A 4CP5A 5GADU 2AHOB 3PRBA 4IKAA 4RNOA 1RT6A 4J5OA 4XDCA 4OZ3A 4ED1A 4QW9A 2YNIA 3MTKA 3AA9A 3P5TL 2XG8A 3MD1A 2DNRA 5L38A 2HNYB 1XR5A 2AZ3A 2DRBA 1ZYQA 4P2SA 4YDDB 2W9CA 4TQRA 4WF9Q 2QIFA 3AJDA 2UUCF 1Q81T 3DLEB 4DUYJ 1N32J 1Q7LB 3K57A 4ZVQB 1LWCB 3PW4A 1F3FA 4JV5F 3M1VA 3Q22A 3D7SB 2SXLA 4RLEA 4ZCIA 5A2QY 3RR7A 1HBNB 4H4OB 4H4MB 5B0GA 3AOAA 4PYDA 1RTZA 2U1AA 3UVJB 2VOOA 4WKYA 3CNQP 2PFDA 2RQKA 3F73A 1U1RA 1U2FA 4KBIA 1F2HA 3C14B 4USIA 1NUEA 1ZPVA 5I3UB 1QSSA 2CUYA 4NLSA 2K7JA 4FPIA 4QWCA 4JI0J 3JAMU 2RD5C 3WX8A 4HL9A 3M1VB 2XO7A 3UN5A 4CT9A 3EVWA 3MMAA 1J2VA 1SIWB 1EJ7L 4LIWA 1T9YA 2QMUB 4Q8EA 1UA0A 1BLUA 2UXDJ 3PX4A 4UT4A 3IGVA 1JLAB 1RWXB 3CJ2A 4LRBA 5KFRA 3TZZA 3DC2A 2UUBF 2DRAA 3R2DJ 5C5JA 2QX0A 4OYPA 1V3SA 1F5BA 5D15A 2AEJA 4LRDA 5J1EB 3V6KA 1NJWA 3CC2S 1U2RA 3IBCB 5KFTA 1SH2A 3VQSA 2FY1A 4ZIWA 3DCAA 2FVQA 5B08A 3EYZA 1HQUB 2GMLA 2LYVA 4ID8A 1VQNS 3D4JA 2DKOB 3HI9A 1T05A 1FWLA 3D1OA 3BGRA 4TLQA 1IBMJ 2H51B 4NL5A 3OLAA 1MNEA 2ALZA 2DH7A 1R31A 2XMUA 3P5BP 3CC7S 3BV8A 5LJ5Y 3H20A 3KLIA 2J0WA 1CQNA 2A18A 2NSCA 2O01C 1RWMB 1TKXA 2VIHA 2BV3A 4MFBA 2G1HA 3RU0A 3US5A 3VV2B 4DU8A 4RUAA 1NZAA 2R7QA 1IBCB 3EM1A 3CCQS 4DL7A 3R1HA 1NDCA 5B7WA 5F9NA 2KFZA 2YWGA 1KDNA 3H59A 3NOGA 4USJC 4W4MA 4M5KA 5D8HB 4BWMA 4LJMA 4M5IA 2FJXA 1AROP 5SZTA 3S01A 4K5SA 5IT9U 3LOUA 4GKJF 1YJRA 2F1FA 2QSWA 4OI3A 2V4QA 1NCLA 4GKKF 3IAM9 4CDIA 3FNNA 5J2NA 1HQ2A 1X4DA 2W7AA 1TV6A 2POKA 3SQOP 4QWAA 1S77D 2KU7A 1F60B 3BGOP 2IVYA 4RL1A 4K4UA 3FQLA 5GAGU 2X1FA 2HVDA 2H4WB 3A8KA 4MJKA 4PXCA 2J7UA 1LW0A 1NPRA 4KY3A 5MAOA 2AGOA 2YNGB 1SC6A 1X4HA 4MIWA 1JLFB 3CWJA 3BSNA 4WXWA 4KPYA 2VDIA 2XCPA 2DGXA 2FB0A 2MY8A 4O3QA 3W9HA 1P27B 5B0FA 2PMZD 5ETNA 3TOQA 2FGOA 2HFZA 3W2VB 3C2PA 2GNKA 2WSCC 1LV5A 1OPZA 3FUYA 4IO1A 4ZPAA 3OQ2A 1JWWA 5BYQA 3G6XA 3VGSA 2QYGA 5GAEU 2BE2B 1U2CA 2HGLA 3IBWA 4GO7X 3CEDA 4P9SA 3SDEA 5EWEA 1R6VA 2HNDA 4FF4A 4DWIA 1K1SA 1C1BA 1DQAA 1RAIB 3UNGC 2E29A 1OY6A 1M5PC 4I56A 2C3YA 4WIQA 2LEBA 2JH3A 1U45A 3NGSA 4OJGA 2MB0B 1FWKA 3UE2A 3DMJA 1VLYA 2AV5A 3JTNA 3DGPA 3M8PA 4IFVA 5T7LA 2MGZB 4K50A 5THWA 2DIUA 3CCMS 3DOKB 3QIPA 2DITA 2D1CA 1U6ZA 1IKXB 4Y2CA 3KMQA 2K3KA 3K0JA 1C1CA 2DEIA 2XYGB 4ZCMA 3DYAB 3MURP 1J27A 3A8IA 2E1RA 2CPDA 1JLGA 1V6HA 4M5GA 2Y1JA 4JI7F 4O3OA 3P8BB 1H7WA 3LP2B 4ZVSB 3MEEB 5KFMA 2X1AA 1B3TA 3Q2TC 3D6MB 5T14A 2VJUA 3IBFB 3N4WA 4JI0F 4NLWA 2FHJD 3W63A 2QLFB 1D0EA 2MQLA 4F2SA 4ED5A 2IBOA 4RW9A 1C1CB 3J81U 3THVA 1FK9B 3W2WA 2NS1B 4LSZB 4DSLA 2FHOB 4PXBA 5HJYA 4KPCA 3M9NB 2K1RA 4ITSA 1KRPA 1MMNA 3VCDA 1HNWF 1IKYA 2V2KA 1UPPA 3NS5A 2B9EA 1PAEX 3M05A 1LOUA 4O23A 1VJWA 3QSYB 1Q86T 1UFLA 2DNQA 3I82A 4KIAA 2H3EB 2PEBA 1G2EA 5C24A 4QJVA 4DOZA 1VS3A 2FC8A 2GQ2A 5DLGA 3QO9B 2UUAF 4AXIA 3RBXA 4ZPCA 2QA4G 2B9WA 1XEZA 4WP8A 2WVDA 2HHQA 5FLXU 4F04B 2RUSA 2L9NA 4C9DA 2ASLA 1NMEB 3AQOA 4PG6A 4JI5J 2XLKA 2HWTA 1RHMB 3HPOA 2ZITA 4HDHA 5KFZA 3HHLC 4X4RA 1FFGB 1F5CA 3UN3A 4ZHRB 1RDRA 1EZZB 3Q24A 4A8MP 2A2DA 1IKVA 1RT4A 2H4YB 2L48A 5B0DA 4YB1P 2ILZA 1S76D 2VU5A 1CEZA 4F0MA 4ZVRB 3KDOA 3OXLA 3NGUA 4QBUA 1XNRJ 1HBOA 3HFVA 2DR9A 4Q2LA 3MM8B 4J9UE 4KHMA 4P2FA 3EJMA 5EX0A 1K0VA 1NHKL 2BJ3A 2IA0A 2KH9A 2VPWB 3GIRA 2IDEA 5KAKA 1CC7A 3E3XA 1FDDA 4C8ZA 4YY3F 2VV5A 3UR0A 2B0GA 3MD3A 4OZ1A 5KFYA 3QJLA 2AJ0A 2Q66A 1WC0A 2GHPA 3J7ZT 4J9QA 2D74B 2GGPA 2R4FA 5KFXA 2XQCA 1WHWA 2LP4A 3IGNA 2WB4A 3GU0A 3O5TB 1UWAA 5A8RB 1UW4A 1X4FA 3AB4B 5IWAJ 5LSRA 2G2ZA 2JVOA 4X84A 1CJUA 5CYQA 1WF1A 2DT9A 3QYYA 2QO3A 4NCBA 3MAAA 1OJ4A 4KO0B 2ZWOA 3K8WA 3V6DA 3PKYA 4LSLA 3PX6A 3PW5A 3HZGA 1SUQB 2ATCB
chains in the Genus database with same CATH topology
4O4GB 5LSOA 2ZM6F 1FDNA 2EW9A 2VUGA 2ZDOA 2RMLA 5KFDA 3BSOA 2AYGA 2ZKTA 1S48A 1TKXB 1DZ5A 2XNRA 1X4GA 4J9RA 3V4IA 4JV0A 5HROB 3TA1A 2VA2A 4Z2XA 1H3DA 2RS8A 2UXBF 3OFFA 2W4CA 4QIFA 2ZZMA 4MKBA 4IOAQ 4OIXA 1DURA 3CD6S 1M90T 2AW0A 2W25A 2FJDB 4NZ0A 1GX6A 2BUNA 3UCUP 6FD1A 5H9EJ 3X3UA 1NHUA 3UCGA 3GV8B 2J9CA 3VAFA 4F3QA 1HYSB 2ZOFA 2HHVA 3C66A 3KLIB 3IS9A 3NRBA 2EFGA 2RNEA 4KHRA 1ROFA 1DFDA 3NMRA 3KLGB 3BO2A 4RW4B 2D9PA 3AQPA 3KHGA 1B64A 2UVVA 2YKMB 2F8HA 3I6PA 3HO1A 3OTCA 1NK9A 2R7SA 2VFTA 2R7TA 2VPXB 1DRZA 4K4YA 2QRRA 5EDWA 1C4AA 3CCWA 4PG4A 3IRXB 2YKOA 3MCSA 2DHGA 1X9WA 2LEPA 1FD8A 2RQMA 2EI5A 4DL6A 4ECQA 2QE5A 1TV6B 3RBEA 2WOMB 4KKOB 2JX2A 2CG4A 1S0VA 3VAJA 1HHSA 2MHNA 1ELOA 5BR8F 5IT4A 5G4DA 3TANA 1S99A 4QZVB 2ZD1B 2B4PA 4CQ1A 4KJIA 3LPYA 2EG1A 3NGDA 2HWHA 4F3OA 5KFEA 1UEUA 3PW7A 4JUZA 3DFEA 2XMVA 3AJ1A 1H7XA 3VZHA 3I55S 4CT8A 4WIIA 3DOMA 2ZH4A 3PV8A 4I2PB 4DJBA 2HQIA 2B51A 2KYZA 1FRJA 2O3DA 2EPIA 3X1LB 2HNDB 4BC9A 2IM2A 2Q3PA 3MR6A 1E6VB 2DH8A 2VZ9A 1MROB 4BBYA 5HLFA 4A8YA 5KG7A 5E41A 3J81Y 2WK4A 4DEZA 1FVSA 2IM3A 5I3PA 3CCUS 4IFVB 2MGZA 4KGMA 4J9LA 2KI2A 4NZ7A 1HPZA 1NEEA 4OI2A 4EU0A 5KFJA 3MUMP 3PJXA 1SJ4P 3PY8A 3B82A 2EC0A 4X4UA 4IOBA 1KN6A 1SBRA 2M3DA 1R3NA 2J0SD 3D0HE 4N8OA 3UFCX 4QYRA 3WBZA 2D9OA 4I7FA 4YR0A 4W90B 2B7CB 1J5OB 3UD4P 3THPA 2UV8A 4JV2A 2AJQA 3ITHB 5E3QA 4V19X 1C2PA 1UVJA 4F02A 3M8QB 1FDBA 4CTAB 1S1UB 2J8AA 2NUUG 3OBIA 4ECYA 1CPZA 2M7SA 2JVRA 1VQPS 5KFPA 1X5OA 3C46A 2GMHA 2KXNB 2WHOA 4Y34A 4JI2F 2C3PA 1VBZA 5KG2A 2E5LF 3D1HA 2MQQA 1FA0A 4WFBQ 3KLHA 2HRUA 2FJVA 1YWXA 2E1MC 1NJXA 4C8KA 3TAQA 1N0VC 5LL6d 2VFUA 5DGBA 4YDXA 4OHXA 5CXTA 1JLEB 5A0YA 1HNIB 2LXFA 1OQ6A 1B0PA 1RGVA 2ASDA 3FFIA 1LFWA 3HVTB 3I0RB 3SQGA 4ED6A 4FF3A 2WONA 3S8SA 4QR2A 1O5JA 2XY5A 2MKJA 4A8SA 4F50A 4C8OA 1E6YA 1EP4A 2HVIA 3WC0A 4A8OA 1HD1A 2HHXA 1R7IA 4ZLPA 1S79A 2UV8G 2JOQA 3OHBA 3PFOA 2DNYA 2XULA 4HT7A 3QZ7A 4ECRA 4ECTA 4PR6A 1S1WA 1L3KA 1BQNA 2OKQA 1U1LA 3CUNA 5J1NA 4NRTA 2XGQA 1QY7A 3ICLA 4YQWA 1GH8A 3CF5Q 3BDPA 3D2WA 4IQXA 2QFJA 4C7QA 3BM7A 2DPJA 4PRFA 3BN7A 1LKZA 4RX6A 1T94A 1R8BA 2GFFA 5AXMA 3U1NA 2MKHA 2RF2A 3ULHA 4HVZA 4QR1A 2R7XA 1Q4RA 1FNMA 2XY6A 2MYFA 2JEGA 2YNFB 3P96A 2B6AB 2W8LA 4ELUA 3LGNA 4XO0A 4O44B 1PSDA 1SI9A 1DTTA 2LXIA 1CG2A 3EGZA 1KQGB 3CPWR 2CQ3A 4OHWA 1LWEB 3JSBA 2PI4A 5CYMB 3K5LA 2OLWA 1LW2B 1S10A 2P9CA 4OV1A 4I6AA 1C0TB 4QWDA 1LXJA 3JSMB 2VBZA 5C25A 5D4LA 1DHMA 3BB5A 2IC3A 1S0OA 2E5HA 2OMOA 2AD9A 2J6SA 3CJ5A 4JI5F 5CYMA 4HTJA 2I0XA 4BS2A 1SL1A 3VZIA 3K5MA 1NAQA 4XPCA 1TKDA 2YKNA 2PI5A 3K5OA 3QPIA 1WHVA 1SJFA 1HWIA 1KOHA 3E01B 3T5HA 2LQ9A 3UI3A 3KLHB 3QIDA 4F4KA 3TP2A 2KFYA 4YB6A 2EFNA 2LQ5A 2DNHA 3OR1A 3GILA 2E1AA 2X51A 1LK7A 2EBGA 4QU7A 1HPZB 3IA0A 2GX8A 1RTIB 2Q79A 2R8IA 4MAKA 4OZ0A 1QAIA 2XB2D 1M1KT 3BO4A 1IXKA 1QE1A 1RT7B 2F8MA 2LQJA 3GG0A 4LF7F 3CO9A 1HQEB 2MSTA 3BZQA 1DQ9A 3R27A 2P6SA 1GXLA 2YWFA 1YVFA 1L3SA 3HDSA 1BY9A 1S4FA 3B4MA 2R2SA 4CZCA 3DRXA 5KG0A 5AXNA 1MU2B 1NK4A 2HNZB 2ZE2B 4RNNA 4WE1B 4B9LA 2CJBA 1IN0A 5GAHU 1A6LA 4ZPWR 2E1CA 2BXJA 3FEYB 4B08A 5ADZA 4C3MA 1ZAWA 4MIBA 1RP5A 1Y00A 1FKPA 4TKTA 3CJKA 5GMKa 2N82B 1T03B 4DR1F 3N0VA 5J2QA 1E6VA 2AWZA 2EK1A 4CNZA 3GWCA 3JYTB 4HYKA 3KWMA 5I42B 4PPDA 1VC5A 2BJEA 4ZP9A 1H0HB 4KAIA 2UXCF 1S6QA 2DISA 3IG1B 5D4PA 1BQMB 2NXUA 5D4OA 3DLHA 4AFFA 3I96A 1EETA 2VG7A 3WX4A 1WG1A 4U9RA 3VAGA 3EGWB 3HLUA 4EBDA 2ZJRQ 3DOLB 1RYRA 3C6UA 4R8UB 2XEXA 5A0YB 3TQ1A 4XDDA 3I5BA 2CQIA 2VASA 1I94F 2M8HA 2HVZA 1U26A 3NG8A 4L6V3 1RKIA 4MK7A 4OHVA 2OTLS 4DV7F 4TU7A 4OI0A 2C3OA 4EUVA 2M0GB 2M9KA 2KG0A 1QLNA 3R1LA 2ZHAA 4PUOB 4F67A 1KLNA 4C97A 1RK8A 2PD1A 1R43A 2CIMA 4DN9A 2IAJA 4UUWA 1WWHA 2YKAA 3IC1A 3N9UC 5L1JA 4B3OB 1N52B 4DG1A 1REVB 2HQ3A 4QWBA 3HP6A 4EYHB 2CKWA 4RW6B 1ZZNA 3IWNC 4NLQA 2GIQA 2MZJA 1TVRA 2KVIA 1XR7A 4WU3A 3CCES 1Q7YT 3SCJE 1Q82T 4BDPA 1WEXA 1IKVB 4OI1A 4K4TA 5B0EA 1IJFB 2RB7A 3DYAA 3FCHA 4LF5F 5LMNF 2GJIA 3FMBA 2VG5A 1KONA 1TR0A 5FJ4A 5DG7A 4NA1A 1X9MA 1D3WA 3UR3C 2WRMA 4ES1A 5JVGQ 4B3TF 1KTQA 2K3IA 1DTQB 1BQXA 3CC4S 3G71S 4Q8FA 1HBMA 5FD1A 4NLYA 3MFIA 5KT7A 1T8EA 3O2IA 3I0SA 4MYTA 2FJAB 2GW8A 3DLGB 2R9LA 3RB4A 5M2PA 2B3TB 4ED0A 2HVHA 1S9GB 1S9EB 3M8QA 2UXDF 5K14A 2L9DA 2QMWA 1FNOA 4OZ5A 3OTOF 2B4UA 2YH1A 3GB0A 2J9DE 1KLMB 5J1EA 4N5SA 1VMBA 2EFVA 4AXJA 1J5OA 4DQPA 1NKCA 4ICLB 5E33A 4O44A 2A3JA 2GIRA 2FC9A 5HLFB 3BF4A 2RE1A 5I3QA 3V4MA 4ECWA 4URGA 1U1QA 4Q5VA 4TQSA 3UCZP 1RI7A 4ZK7M 1U1KA 2A1BA 2YKNB 5K9FA 4OX9F 2D3UA 3NP5A 1NJIT 2VONA 5JVHQ 2H9ZA 1FERA 1TL5A 1AXQA 3NCPA 4G6VB 4TYBA 5F9LA 3HHLA 4DN0A 5D3GA 3O8WA 3CD0A 3LQVA 4UW2A 5EN1A 2B4VA 3THTA 1IQZA 3DRPB 5DM6Q 3PR5B 1HHTP 1N33F 1KHVA 1FO1A 4O4RA 3HHLD 4PCQA 2V4RA 2E66A 2YH0A 5AJ3F 3DN9A 5AXLA 1Q78A 2JZ5A 5E7OB 2DO0A 4OL8A 3RW7A