4Z2XA

Crystal structure of a rna binding domain of a u2 small nuclear ribonucleoprotein auxiliary factor 2 (u2af) from mouse at 2.15 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a RNA binding domain of a U2 small nuclear ribonucleoprotein auxiliary factor 2 (U2AF) from mouse at 2.15 A resolution
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 29
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4z2xA00
3RW6A 1X5SA 1VQLS 3IWNC 3CCLS 3PIOQ 4Y0FA 2L41A 2RNEA 2DGXA 2PEHA 3U1MA 2DHGA 3UCUP 2FY1A 1L3KA 1X4DA 3MUMP 3I56S 3G8SA 2DGSA 2LKZA 1WG5A 2KM8C 4QPTA 2EK6A 1URNA 2MJUA 1VQNS 4CIOA 1WG4A 4WCEQ 1HA1A 2J8AA 3V4MA 2MQOA 2CPIA 1U1KA 2F3JA 4TLQA 1U2FA 2CPJA 3G4SS 2JVRA 1WG1A 2XS2A 1Q7YT 4LIRA 3MURP 5GAHU 4PR6A 3H2VE 3CC4S 3UE2A 1N54B 3THTA 4QU7A 1K8AT 4ERDA 1YI2S 1PGZA 2WBRA 1U1NA 5GAGU 1KC8T 2YKAA 1U1LA 3P3DA 2D9OA 1H2UX 1UFWA 2DNLA 2HGMA 4YUDA 1SJ3P 5HO4A 3PIPQ 2M70A 2RRBA 1WI8A 2DO4A 4Z2XA 1VQ6S 2KH9A 3DLLQ 1FHTA 1Q81T 3SDEA 5LJ3Y 1UP1A 3CCQS 2FC8A 2MQLA 5EN1A 2PE8A 2MPUA 2FPHX 3CPWR 2OTLS 3CULA 5GADU 3UWTA 5DDPC 2DISA 3SDEB 2KVIA 2M8DB 2N3LA 2CPFA 2RT3A 3CCSS 2G0CA 1S72S 5DM6Q 2DO0A 2HGNA 2M8HA 2DNYA 2LCWA 4ED5A 2J76E 1NO8A 1W2BR 1X4EA 2ZJQQ 4J5OA 1VQ4S 2QA4S 4IO9Q 1XN9A 3CF5Q 2UP1A 5LXYA 3P5TL 3SXLA 1D9AA 2MZRA 3TO8A 1VBXA 2OSRA 2DNRA 2X1BA 2DITA 5LSLA 1FNXH 1U6BA 3FEXB 5CXTA 1M5PC 2M52A 3SMZA 5JVGQ 2RS8A 1P27B 2CPYA 1JJ2R 2KI2A 4F02A 2DNQA 1Q82T 3MDFA 1U1MA 4IUFA 2KM8B 1VQ9S 2LQ5A 4WFNQ 3HHNB 2FHOB 2NLWA 3S7RA 3I55S 3BO3A 5BJRA 1HD1A 1FJ7A 4UY8T 2LYVA 1DHMA 2CQGA 3OW2R 3TP2A 1CVJA 1DZ5A 2DHSA 3UCGA 3BEGB 1M5VC 1WHXA 2MZJA 3MUTP 2OSQA 3VAIA 2VODA 1YTYA 3VALA 4CH0S 1QVFR 4TU7A 2QFJA 2ADBA 2G1DA 2M0GB 1X4GA 3CC7S 1U6FA 2I38A 2DH7A 3N9UC 2Q79A 2HGLA 2DNKA 2MGZA 1KQSR 5LXRA 2DGTA 2D3OR 2M2BA 2N7CA 1X5PA 5DDRC 2CQBA 1U1QA 1OIAA 4P6QA 1WI6A 2MQMA 2HYIB 5IQQA 2VONA 2NZ4A 1FT8A 4WFBQ 5IFMA 1K73T 2FC9A 2DHXA 2GHPA 3Q2TC 1H2VZ 2BZ2A 1H2TZ 3BS9A 2V94A 1WWHA 4FXWA 1YJWS 3EGZA 1F9FA 1PO6A 2DNGA 3BO2A 2MZTA 3JB9k 1JJ4A 2DGUA 5H1SV 2DNNA 3LPYA 4PRFA 2CQ4A 2EK1A 1U1PA 1OWXA 2F9DA 2CQCA 3L3CA 2RS2A 1YIJS 2MY8A 2KG0A 2JX2A 3BO4A 4TU9A 3CTRA 2CQ1A 1WEXA 2MB0B 3CC2S 1FJCA 1SXLA 2YH0A 3NS5A 1P1TA 1WEZA 1A7GE 1DBDA 2E5HA 2DK2A 3CCVS 2VOOA 3VF0B 3MUVP 3ULHA 2JVOA 2B0GA 2DH9A 3IRWP 2MMYA 2KXHA 5FJ4A 2CPZA 2VOPA 1KOOA 1IQTA 2HVZA 5LSOA 3S6EA 2XS7A 4UQTA 2KRRA 1OO0B 2RUGA 1WHVA 1SJQA 3Q2SC 2MKJA 4F25A 2MXYA 1H6KX 2F9JA 3EGNA 2LA6A 4CH1A 3J7YU 2CPEA 3TYTA 5LJ5Y 1JJHA 2X1FA 1OPIA 3CXCR 2J0SD 1KOHA 4TU8A 3NNHA 4OZ1A 2KRBA 2XS5A 5GMKa 3G96A 1HD0A 3R27A 1SJRA 1VQKS 2MYFA 2CPDA 3VAHA 4OZ0A 2KG1A 2DGWA 2MKIA 4ZKAA 3MOJB 4QQBA 3CCES 1SJ4P 1X4FA 1VBYA 2DHAA 2JWNA 2G4BA 3MXHP 4V19X 3US5A 2ZJPQ 3UCZP 1VQ7S 3LQVA 2MZQA 3P6YC 2E5JA 5JVHQ 3ZZZA 2RU3A 2DGVA 4W90B 3DXBA 1QVGR 3S8SA 2EVZA 1VQ5S 3VAGA 2M88A 1X0FA 4C7QA 5DM7Q 1YJ9S 1U1OA 2X1AA 1X4AA 4M5DB 1KD1T 1FXLA 1ZH5A 5CYJA 4IOAQ 5GVQA 2KXFA 1YHQS 1WF0A 2E44A 2CJKA 4YB1P 3VAMA 3ZZYA 2N82B 2KYXA 5ITHA 3MD3A 3H2UB 2CPXA 3G9CA 1VC6A 3FEYB 3CMAS 1X4CA 2DNMA 2DIVA 2LA4A 2L9WA 2OJ3A 1WELA 4WKRA 3UD4P 2DB1A 2U2FA 1WF2A 4WF9Q 2DGOA 5GAEU 3B4DA 2MKKA 1HL6A 1WF1A 2MHNA 2HZCA 1NU4A 2LEBA 4LJMA 1N8RT 1Q86T 2JRSA 1X4BA 1RKJA 2DNOA 1QM9A 2RRAA 2CQIA 2E5GA 2K8GA 2M7SA 5IM0B 2O3DA 2MKSA 3CCUS 1K9MT 1G2EA 2LEAA 1SJFA 3K0JA 4U67Q 4RU2A 1BY9A 4YOEA 1WHWA 3G6ES 2CQ0A 3MI7X 1VQPS 3S01A 3G8TA 2MKHA 2MZ1A 3CCMS 1U1RA 1X5OA 2M4MA 1YITS 1M1KT 1VC0A 2LMIA 3CD6S 2CQPA 2MQPA 1M5KC 4QU6A 2CQ3A 5D77A 1M90T 1FO1A 1WHYA 1AUDA 2DNZA 4PKDB 2DH8A 1VBZA 2AYMA 2DNPA 2KXNB 1B7FA 2DGQA 4FXVA 3D2WA 2YWKA 2LXIA 2MQQA 5DDOC 2OIHA 2X1GA 1JMTA 1O0PA 2N3OA 3NNCA 2E5IA 2M9KA 3CCJS 2I2YA 2LECA 4C4WA 2DNHA 1S79A 2CQDA 1WTBA 3MD1A 3CUNA 3THPA 2AD9A 2BOPA 2LXUA 1N52B 3NNAA 2MY7A 2MKCA 2XSFA 1NJIT 2L08A 2ERRA 1X5TA 2K3KA 1VC5A 2KHCA 3R1LA 1UAWA 4WFAQ 4IOCQ 3UD3P 2MSTA 2CPHA 4Y00A 3VAJA 1VQMS 4C0OC 4CQ1A 2KFYA 1WEYA 2ZJRQ 1FJEB 4EGLA 5HL7Q 5MLCV 2KU7A 3CCRS 5D78A 2CQHA 2MQNA 2MSSA 2XNQA 2SXLA 2YTCA 4LMZA 1A9NB 1YWXA 2AYGA 5CA5A 3U1LA 3HI9A 1YJNS 4F26A 3VAKA 2XB2D 2D9PA 2MJNA 2RQ4A 2A3JA 2DIUA 4A8XA 2AYEA 3CMES 2QEXS 1X4HA 2OTJS 3B4MA 1M5OC 3P49B 2YH1A 2ADCA 1R8HA 4W92B 2MGZB 2XNRA 1VQ8S 4BS2A 5DETA 3NS6A 3NMRA 1ZZNA 1UW4A 1DRZA 3EX7B 3VAFA 3R1HA 1VQOS 3G71S 2RQCA 2GO9A 3J7ZT 1RK8A 2CQ2A 4WIIA 1N88A 1ZZFA 2KT5A 5DDQC 1R8PA 2KN4A 2MZSA 2J0QD 3RW7A 2AYBA 5IM0A 2RVJA 2U1AA 1D8ZA
chains in the Genus database with same CATH superfamily
1RBOB 2D3UA 4A48A 4B3MJ 1H7WA 3HHLC 4OYMA 5DG7A 4KV8B 3KK1B 4QYZJ 2GCFA 3PIOQ 4LF2A 2HK3A 4PUOA 2EG2A 1CC7A 2V8PA 3RJMB 4Y0FA 5HQMA 3EWGA 2RNEA 2DGXA 2L41A 1EZZB 5CCLA 1EJ7L 1RAIB 1L3TA 1CPZA 5JXSA 3PW7A 2APOA 4Q8EA 4M5HA 3R5JB 2IM1A 4LSLB 3MM7B 5BR8J 3QT5A 1FK9A 1CULA 2EFGA 2EK6A 2ZWOA 5J1NA 1MMDA 2JOQA 4XK8C 3MMCA 5ETMA 4YQWA 1URNA 2FLNA 2XWXA 2OHDA 4P2FA 3GFYA 1LWEB 1BWEA 1R6YA 1HQUB 1TQLA 3I87A 1YDLA 4CIOA 4MFBB 3ZZPA 2BE7D 4WCEQ 4KIAA 1Q5VA 3H4BA 2FJXA 3I31A 2HVDA 5DQHA 2GMLA 3HCXA 1U2FA 1DTTA 2HS4A 3SQGA 2BKOA 3G4SS 4I6WA 3TUIC 1R27B 4B08A 3QGPA 4X4PA 1UL3A 3F44A 4LIRA 2HNYB 5GAHU 1NJXA 1UVKA 3L7PA 1VOMA 4ZVUB 3UE2A 2RE1A 2XSJB 1TL1A 1T9TA 3H5UA 4RW4A 2AJ0A 4JI6F 4ERDA 1OY8A 2WBRA 3P8BB 4G65A 1U1NA 2UUAF 1XTZA 1LFPA 1U25A 5GAGU 3TAMB 1F5CA 1U1LA 2C3OA 2HQGA 2FLLA 3P3DA 3PX0A 2D9OA 2V8HA 2I9SA 2QIFA 2ZKUA 3R5DA 2HGMA 3MEKA 4KAIA 5DRKA 4ALZA 1Y5LB 2OO4A 3FRYA 4QWDA 4Z2XA 1VQ6S 1EKRA 4YHHF 4D3HA 3R97A 4DZDA 3WHIA 1FHTA 3IBFB 1YK9A 2AJ2A 2XYPB 3IR5B 1TAUA 3KG4A 3JSRA 4RPFA 5LJ3Y 1IBKJ 1UP1A 4NX9A 1O6XA 5DQIA 4RZRA 3IBCB 3KG1A 3OL8A 4I56A 3KK2B 2AX0A 2XYHB 1Y5NB 2UUTA 2FPHX 1MWQA 1IKWA 2PA3A 3JAMY 3UWTA 1MLAA 3DOMA 3OV7A 4DSJA 3KNGA 3HSGA 5DDPC 1BQMA 2DISA 3NAHA 4QIEA 4ZPTR 5HAOA 6FDRA 2M8DB 2N3LA 4KRWA 2QMUB 4QIVA 4CLUA 4P2SA 2NXJA 2NZCA 5B0AA 3EXCX 4RW7A 5KG4A 1KSPA 1YRTA 5DM6Q 2DO0A 2RU9A 2W7OA 2AX1A 2B9WA 1JXVA 2M8HA 4ECSA 4B3SF 3LAMA 1NK0A 4M5NA 1FA0A 2F65A 5BYRA 4R8UB 4QWEA 2VQFF 3UFCX 2JEFA 4QR0A 4PWDB 1VISA 3C6TA 3D66A 3S1TA 3IN5A 3R2DJ 2XWYA 1X4EA 4QJVA 3V6JA 4NLSA 2BKPA 1NAQA 1S7HA 1N36J 1HIYA 1CQNA 4HR2A 3W8GA 5CD4H 1RTJB 5JMNA 2YWHA 3MPDA 2GIQA 3OVSA 3FBEA 3CF5Q 1LWFB 5HATA 5L1KA 4P7TA 5H9EJ 4S0MA 4G3IA 4UTGA 3LGHA 2XZTB 1RABB 3H59A 4V1Ak 2JLEA 5L9XA 1RTDA 4RNMA 2V8VA 2VL1A 3IXQA 3H5SA 1DTTB 3SQGB 3UO0A 1S9FA 1S1VB 3MM6A 5IS2A 4K4ZA 2HQCA 3DMJA 1XR5A 2HBQB 3HKWA 5E3CA 1FXRA 4GO7X 1AUSL 2V4JB 1YX2A 3AOAA 3R5GA 5A8KB 4DSIA 3VZHA 4I2PB 3SMZA 1EX8A 3AB2B 3HVTA 4CT8A 2RS8A 3TQ1A 3QJLA 2CPYA 1RHKB 2UVUA 4IFYA 1GX6A 1OQ3A 4MIBA 4Q7AA 1VK3A 2DNQA 3FBBA 3WX8A 3KHLA 1XQIA 1Q82T 1HBMA 1OY9A 2DXEA 1OS5A 4NOHA 3H90A 4LF5F 4WFNQ 4OHZA 2F7VA 4A8QA 1RWUA 3FZBA 3W65A 3RBEA 3NY0A 4FYYB 3NOGA 1CG2A 1HFEL 3PFEA 4NLQA 4QWBA 1BQMB 4BWMA 4QPXA 3I55S 2HHHJ 1FJ7A 1KVKA 3SCKE 2UXCF 1IXKA 1DHMA 4IQMA 4ZCLA 2DRBA 3HHKA 2NQPA 5JUMA 3QGHA 3FC9A 5C24A 3OR2A 3N5BA 5KT2A 1DZ5A 3MR7A 3M8ZA 2VDIA 3UN5A 4FF1A 2FJAB 2ZBIA 3BN4A 3CE8A 2F8MA 3BEGB 1Q16B 3KLGA 3UNGC 4CCHA 1M5VC 4DZ6A 2MZJA 4NLYA 3MUTP 2OSQA 3VAIA 2AEMA 2RJZA 5KTQA 1YTYA 4ELVA 5I42A 2COLA 3DOLA 4XDDA 5J1PA 5J2MB 2BQ3A 2L9NA 5HQLA 4TU7A 2QFJA 4DR4J 2G1DA 3I9V9 4XDCA 1M5HA 2HWIA 2EBGA 3A3PB 1HBOB 4RNNA 3CJ3A 2HFVA 4DR3F 4K4VA 2XM3A 5D4LA 3IG1B 3DDIA 3N9UC 4MK9A 4ED0A 2BANB 3NMAA 3M2UB 1H73A 4DQRA 3KHGA 1KQSR 4OZ2A 4OFZA 3D6MB 4F4YA 2ACMA 4QWAA 5K8OA 4NYOA 2M2BA 1TL1B 1LV5A 1ZA2B 4OJ1A 5AXLA 1FRHA 2GIRA 3K8WA 4WP3A 4ID8A 5GAGI 1KNZA 2W4PA 3CJSA 3GFZA 4ZPCA 5I4MA 1OJ4A 5J2NB 4ZCIA 1GMUA 2QGFB 2QG9B 4HTIA 1EHWA 1JNRB 1HW9A 4CO0A 2YBVA 2HFOA 2ZE2A 4GRSA 4X84A 2JL9A 2V5HG 3GG1A 1K73T 1PYSB 3A8JA 2B4PA 3ILIA 3NEKA 4ANEA 1K1QA 2D74B 3FRZA 4Y34A 5FDLA 4KY3A 2C2DA 1HWKA 3JTOA 4J37A 4OI3A 2RB7A 2R2SA 1AFIA 1M1HA 4NMLA 1LW2A 1H2TZ 3FVYA 2V94A 3I96A 3QFWA 1WWHA 1FRJA 3BBCA 2NPFA 4C8YA 2J9DE 4G6VB 2MDAA 2MLZA 1KONA 1FVQA 3M6XA 3MM7A 3OL9A 1RLCL 5IOLA 4I4BA 4DLEA 2HRUA 3JB9k 1PKUA 3DDKA 3QGIA 3DGPA 3IS9A 4GVLA 4LRAA 3KHRA 2KT2A 4ZVHA 6FD1A 2GVZA 4ECVA 1LNQA 3I82A 1S1WA 3WIVA 2R7WA 4PRFA 1TV6B 2EK1A 5J1EB 3TUZC 5G0RB 1X8DA 4NLWA 1FKPB 2CQCA 2PN6A 4LF7F 3TANA 2A0FB 3KUHA 2VG6B 4O4GB 1WD6A 1N34F 2GMHA 3DLEB 3TJ9A 3WDOA 5KT4A 2K2PA 3P5BP 2KG0A 3GQCA 3JSMA 3BQ2A 3L7OA 4BWJA 4PCQA 3HD1A 1DTQB 5HANA 5A0YB 3TUJC 3NS5A 1WEZA 1SBRA 1A7GE 4PQUA 1S0NA 4NPOA 2DK2A 3K5OA 4NA2A 1UFKA 1ZTWA 2VOOA 2P5VA 2E1CA 3HJVA 1CJTA 2B0GA 2QFIA 2ZC4A 3NOCA 5IZHA 3GYXB 2GGPA 3IR6B 2R8HA 4DQIA 1XMBA 2AMCB 3JYTB 2OP5A 1XMQF 3VVUA 3UVJB 1AB8A 1N0VC 3PKYA 2H1YA 4O3QA 3DN9A 4ICLA 4TVAB 5LSOA 3HD2A 4IFVA 4NLPA 2AWZA 2Q1LA 4I7FB 4UQTA 3Q8SB 1C0UA 1OO0B 3TA0A 1NK5A 7FD1A 3T41A 2GIFA 4UOHA 5HJXA 5K8NA 3H5YA 4OZ3A 3MMJA 2HVIA 1HWJA 4O44A 4IG3A 4DR7F 2C42A 2H54B 4TN2A 4CLWA 4F25A 4B3OB 4JV0A 1ITPA 2YX1A 4B17A 2IDEA 3EGNA 5A2QU 5CD4A 5J2PA 2F4VJ 3J7YU 4ES3A 3TYTA 4USUA 2XCPA 4JOUA 3V6KA 5D8HB 3GYNA 1FDDA 4N77A 1J5OB 3OTOJ 2HIYA 3IAM9 2VQEJ 1UVIA 3D7SB 4TU8A 3VCDA 4J9LA 3NNHA 4K0KF 3FCWA 3G87A 3LA0A 3W5YA 4PPZA 2XS5A 5GMKa 5I3QA 1WOSA 2UVVA 2C22A 3AXKA 3W66A 1IBMF 2EFQA 3T9NA 1E6VB 2NCKL 1S1UB 1K47A 3R27A 1NK6A 1WSVA 2E1AA 4DR1J 2ZOGA 3R7NB 4Y2MA 4KV8A 2Z0GA 4DPTA 4ZHRA 3P4UB 3D3CJ 3CDBA 2DGWA 2MKIA 3KK3A 1D0EA 3MOZA 2QV6A 2XQCA 2EKNA 4EZ6A 3DLEA 1RTHA 4Y28C 3ADAC 4ZS6A 4YDDB 3CCES 2RF2B 2OD6A 4C3LA 3V6DA 4ZVPB 1FDBA 4A4JA 1WC4A 1TKZA 4OI2A 1L3UA 3HXMA 2G4BA 4ES1A 4DR6J 1OY6A 3MMBB 3HDSA 4V19X 4CH7A 3UCZP 4NCAA 3DRXA 1GXUA 2MZQA 1VQ7S 4NZ0A 4U7UD 3M8SA 3ISNC 3OJUA 2W9AA 2GVZB 2WHOA 1WSRA 4YB6A 4UT4A 4DUZF 3RAXA 2WVBA 2DGVA 3QWUA 1CBKA 3M1VA 4ZPBA 4KGKA 3SI8A 1FWLA 2DY1A 1YRXA 2JJ4D 1YG0A 4IOBA 1QAIA 3W9IA 3T1YF 4LF9J 4M95A 2Z8QA 7AT1B 3ILLA 1VQ5S 1U8SA 1YJTA 2M88A 3FMWA 4L76A 1S1TA 1UA1A 4WYWA 2OEMA 1X0FA 4FBUA 5KG1A 3AQOA 3I0SB 1H0HB 4K4TA 2AF6A 2WBMA 1X4AA 1TL3A 1GT8A 3PDNA 5DS7A 3UN2A 2X1AA 2VJUA 1J5OA 3NLCA 4FYWB 3O5TB 3PJXA 1RHUB 4PZVA 1WF0A 1T9WA 2BA9A 3SBMA 1N33F 2DRDA 2FB0A 1X7VA 1QTNB 4ED2A 5IC4B 2ZUGA 3EPGA 3T1HJ 2KYXA 2Y9HA 1TKXB 1Z2LA 2WVFA 4FPRA 2XGQA 3EPIA 1OSCA 1VRQC 3G9CA 3MAAB 2R42A 2XLKA 1X4CA 2FZKB 1C0UB 3F73A 5E0OA 4OLPA 5EN1A 2CZVC 3O44A 1QDUB 1WELA 1FCAA 3CDUA 4KGVB 2V63A 1B70B 4DPXA 2NREA 4B9LA 2OPQA 3OT9A 1RT1A 1MG7A 3UD4P 4MH8A 3NGKA 3BKFA 5E3AA 3WQPA 3IR7B 2DB1A 3H8YA 4WPAA 1WF2A 2B8QA 2VDHA 4IH6A 5IWAF 2LU1A 3I0SA 3J7YI 4DFMA 1HL6A 1WF1A 2MHNA 3CMQA 2CJXB 2RHSB 5RUBA 5DG8A 1Q0NA 3I6PA 1N8RT 1H7XA 1RWKB 1Q86T 2JRSA 4PG7A 5LM7E 2EXUA 3TNVA 2VQFJ 2VICA 2DNOA 3NCRA 5A76A 4B3SJ 2VJVA 1JWWA 4F3OA 2DJWA 4LSZB 2FJVA 1FJGF 4U7UK 5LMNF 3TUPA 4Y65A 3BREA 1HBNA 3R5AA 1SJ1A 4FVMA 2R4FA 1PAEX 4ZVQB 3OL7A 2Q66A 1Y7PA 2GJIA 2DHHA 1XNRF 5E3PA 1UFLA 2BACA 2FJEB 3ET6A 3JQKA 4AQYF 4OLOA 1GNKA 3EVOA 1WHWA 4YB7A 3MI7X 1VQPS 2RAQA 3BKUA 2MZ1A 3Q89A 3CCMS 5AE2A 4EYIB 3GP9A 1RAOA 4CM0A 5KT5A 3E2EA 1M5KC 4MK8A 1T05A 1UVMA 3FBCA 1EB0A 2DXFA 4PXBA 4YHHJ 2B7BB 3MEGA 3OLAA 1RT3B 1TP7A 4KHRA 1M90T 1UWBA 3DDNA 4DR2J 3A13A 3GU0A 2ZOFA 3GSIA 2ASDA 1CJVA 3ENQA 1VRTB 1KQGB 4A47A 2KTQA 2KXNB 3G6YA 3HVTB 3D2WA 4DSFA 2YWKA 1RKIA 3HK2A 4L74A 2MQQA 3MR2A 1M5SA 5DDOC 3GCXP 3BPSP 3QBCA 1H3DA 4M94A 3NNCA 3D67A 1Y5IB 3FFIB 4RW9A 3CCJS 1K44A 1MW7A 1RT4A 3MMAB 1TAQA 2KYZA 3M8PB 2I1RA 2IVYA 2N4CA 2PMHA 2D3ZA 1LWEA 3AA8A 3DLGA 4PXDA 8RUCA 5CYMB 1V3RA 2CQDA 2PC6A 2IJFA 5B0DA 1TFYA 4IH7A 4OQJA 3OTCA 3Q8RB 4B3OA 4QWCA 2KL8A 3U02A 2HS3A 4DUTA 2AD9A 5CH7B 2ZVSA 2P8IA 4PEOA 2FGCA 4DX6A 2BOPA 4J9VA 3CDEA 3K7RA 1HNWJ 2FVPA 4LSLA 2VZ9A 3L7UA 4WXOA 5SUHA 3CJKB 2NXUA 4DCJB 1WTFA 1X5TA 1VC5A 1JLBB 5T14A 2AU0A 2XMMA 4HT5A 4DEZA 3GV7B 3Q23A 3EZUA 3UD3P 2MSTA 1FRKA 3QIPA 1RU2A 1RWWB 3SSQA 1FFGB 3FSYA 3QO9A 4C0OC 4ECRA 1XC9A 2HRTA 5IXUA 3V6DB 3LP2A 1N56A 2CJYB 2YNFA 5HVGA 1A9NB 3VZIA 3V4IB 5L8RC 4M1KA 4DR6F 4BBYA 3B78A 1NDCA 2V68A 3AHPA 2ILZA 2WOMB 3BGOP 1IKYA 1RAEB 4C98A 1I94F 2VBZA 1Y00A 1KEKA 2HLUA 4NI2A 3OUYA 1SH0A 2MJNA 3SFUA 4CNZA 5CHCB 3PKMA 1NSQA 2DVIA 5H9EK 1RT3A 3TAMA 1U45A 5AXMA 1KKHA 5KFMA 1KS2A 1NRKA 3ZXWA 1RT6B 1VHFA 2QEXS 1S4FA 1X4HA 2FHJA 4ENOA 1BD6A 2QZ8A 4NLRA 1VQYA 2BRLA 2YH1A 2BQRA 1QSYA 4DI6A 2EG1A 4W92B 2CWKA 4BS2A 4ZP9A 1EP4B 1XEZA 5GMEA 3QSIA 5DETA 4JI4J 2PMWA 5C42B 3NMRA 2Q6CA 1GMWA 1WC6A 3W63A 5IV4A 3J81U 2V9WA 1TU0B 2RQCA 4IKAA 2VC1A 1RK8A 3KK2A 1ZZFA 3BGRA 2B9EA 3UPFA 2PFFB 1J5EJ 3M8QA 2L48A 2RVJA 3NBPA 2VIHA 2GO8A 3EDRB 1KRPA 2WK4A 1Q7LB 4ZPAA 5B0BA 5EHHA 4ER8A 2PGCA 3OFHA 5DG9A 3RW6A 1Q8BA 2YQ0A 2ZHAA 1EKSA 1FESA 3IWNC 5G0RA 3BGFA 2WAQD 2V69A 2BDPA 4ILMA 3IM9A 2OD4A 1AZSB 2H65B 2PEHA 1JIHA 1PILA 2AEFA 3UCUP 4HLBA 4OV1A 1KQFB 2DGSA 2O5DA 2LKZA 5E3RA 2FZCB 2XY7A 5C25A 3MM9B 3CD0A 2D7SA 4CI0B 4KPCA 4AL6A 1FE4A 1RWVB 1S9GA 2Z57B 1U48A 5IV3A 2IAJA 3PCOB 1ZBTA 4WFZA 5K14B 1VQNS 4OHWA 5B0GA 4NE9C 2NSCA 3KOAA 5I3PA 5KFTA 3NBPB 3SSRA 1WDTA 4DV2F 3RU0A 4DMZA 1VBKA 2MQOA 2CPIA 4KO0A 3EGVA 5D0EA 3EDQB 4JB8B 3K5PA 4TLQA 5LT5A 3LUYA 4DSLA 4DJBA 1WG1A 1HHSA 1XR7A 2PT0A 4LFCF 1VMBA 5KT7A 3W5ZA 5LMUJ 2BJEA 4UOCA 4MJKA 3FZ2A 3ETMA 3HVAA 5C2GA 2HFSA 4B9UA 3CC4S 2ZHOA 1MROA 3CWJA 1APSA 3CJTA 1N54B 2LQ8A 3ZTPA 4ID5A 1QUPA 3THTA 4ZITA 2VBXA 1K8AT 1TVRB 2EFOA 4YR3A 1YI2S 1IBMJ 1PGZA 2CJQA 2OPPB 1NKBA 2UXDJ 1B0TA 1VCTA 1JJCB 1KC8T 4TQSA 4JI5F 5KFGA 3T9ZA 4G1QA 4K0KJ 2UUCJ 2M70A 2RRBA 1WI8A 1ZTTA 3IG1A 2GA7A 4NYPA 5EWFA 2KH9A 2ZH1A 4AFFA 4Z7YA 4DX8H 1C1CB 2CYYA 1U24A 1Q81T 1N6QA 2IYGA 3MEDA 3A8IA 4MYTA 1B99A 1S6UA 1RT2A 2RRNA 3BBBA 1TL7B 2ZE2B 4L3KA 3SCIE 3KLFB 1FFWB 4I64A 3L9ZA 2OEKA 5KG2A 1WOPA 3EZOA 5CQGA 3CPWR 2R7RA 2BW2A 2E1RA 2NSBA 1XNRJ 4L73A 1N0UA 2YWFA 1NJWA 3CDAA 2BJ8A 2GVDB 3GB0A 4GO5X 3SDEB 2KVIA 1EP4A 1UPPA 2C2EA 1G2EA 3AD7C 2CPFA 2RT3A 3CCSS 4IQXA 3QYYA 2B51A 2ILYA 1S72S 1RB0A 5GAHI 4FF2A 2HGNA 1ZM4A 1Y3KA 5D4OA 2N4DA 1REGX 2UXDF 3K58A 2VUGA 2GQQA 2J76E 3HVWA 5T7LA 2ZJQQ 2GGPB 5HVHA 3NL0A 4X4VA 5B7WA 1AT1B 4DFPA 3PM9A 2R7VA 1DJ0A 3W9HA 2QA4S 1C0TA 3CVKA 3AD9C 2G2ZA 4QYRA 4ZLPA 2GJFA 1HNWF 1FRIA 4R25A 4DR4F 2OPRB 3VQTA 1A0OB 1ZM3A 4C8NA 3BSCA 1VBXA 1PYOB 2RIJA 4YR0A 2EFNA 3GJSB 3H7HB 1S7IA 3D1OA 3G8QA 4RJVA 4B02A 5LSLA 1P9YA 5J1EA 3J80U 1FNXH 3BH7B 2DR6A 4CRJA 1TUGB 3FUYA 4Q45A 3BSOA 5CXTA 4M5LA 1Y11A 4O23A 2J6SA 1A6LA 2EEYA 4DL6A 2M52A 2QA2A 4H4OA 4LBHA 3GCWP 2WSEC 1N33J 1Y10A 1P27B 3C15B 1JJ2R 4DG1A 3ZFVA 2H9ZA 5KOWA 3N5FA 1NHVA 1RJJA 3MMCB 3GV8B 4IUFA 3K57A 3RYLA 1S9EA 4LFBJ 4DL2A 1JLEB 3KXDA 4OI0A 3D28A 4JI7J 2FJDB 1V9OA 3NS7B 4DV3J 2W8LA 3KLHB 4LF5J 4K4YA 1LQ9A 2CIMA 3LP0B 5BJRA 2CNNB 3A12A 2OPQB 2CQGA 2BBEA 3JQMA 1XK8A 3OFEA 3OW2R 4ZLJA 3TP2A 4F04B 2QC3A 2V2ZA 5B08A 3SIPB 2DHSA 1Y9OA 4M5KA 4OZJA 1M0SA 3LF0A 2YNFB 4ZPVR 5A6PA 2Z2LA 2W2NP 1JNZB 3QRPA 3CIMA 3AB4B 1JLFB 3C8YA 5D4NA 1P8GA 3POTB 1LKZA 2YNHB 4AYBD 2AHOB 2HHVA 1HNIA 1N5YB 3SEOA 3VALA 1IR0A 1F3VA 1IBCB 5A8WA 4CLTA 4ZP8A 4C9DA 2LEPA 3R7SB 1RWXB 2ADBA 4ZK7M 1UZDA 2OKQA 4MYUA 3CO0P 5IT4A 5DO2A 3QATA 4LQ9A 4QIWD 1X4GA 2ZC3A 3NRBA 1UZHA 5KFUA 3ZZTA 3CC7S 2I38A 4DSKA 1ULRA 4ZVOB 4KHPF 2DH7A 3MEEB 2QRRA 1TK0A 2K7JA 3KLHA 3BGLA 4CP5A 2DNKA 5HP1B 3BDPA 1S76D 2KZZA 5LXRA 3Q8VA 3C6TB 2R3VA 1MWZA 2DGTA 4C11B 2N7CA 2CQBA 1RI7A 2I0XA 4OZLA 1Q79A 1RT1B 4F02A 1U1QA 2YKNB 1OIAA 3MMAA 4HI2A 3UW1A 4ILLA 2YWWA 3C15A 4NLTA 3LTOA 3DRRB 5AXKA 1SL1A 1WI6A 3R2CJ 2HNYA 4FKYA 1U7LA 2Z2ZA 2R7SA 2YNHA 2K7KA 2HK2A 2MQMA 4OX6A 4LRCA 4E2FB 1PIEA 2IYIA 4X2BA 2HWHA 5HLFA 4G1PA 2NZ4A 3HVRA 1X9SA 1LWXA 3QMQA 3N79A 4P72A 2E9ZA 3FQKA 2ASYA 4FYVB 4Q2LA 1PC4A 2IC3B 3BPDA 2DHXA 2GHPA 4WBFA 4ANDA 3QZ7A 3V6HA 2FVRA 4B9NA 4RWXA 1S97A 2BZ2A 3VHQA 1TL4A 1Z1ZA 3QRQA 3BS9A 1CJKB 3ZTQA 1F9FA 1HKAA 1PO6A 2DNGA 1P1LA 4D3GA 4J9UE 5KFHA 3TZYA 3M2RA 1JJ4A 2OFHX 4JV2A 2DNNA 1PJ7A 3OHAA 4NYZA 1F9EB 5EDWA 2QL7B 1BQNB 3DC2A 4ZIVA 4LREA 1B0VA 1FKOA 2MKYA 1RP5A 1OWXA 3D1HA 1LW0B 2ZWPA 2EFVA 3MM5B 2NS1B 3N6LA 4XO0A 1YIJS 1NSKL 1NZAA 5KG5A 2JX2A 4N8NA 3R9LA 5C24B 2W2OP 3D3BJ 1RE1B 3HSZA 1WEXA 1T3NA 2LVWA 1QAJA 2MB0B 1SXLA 4CTAB 4PWWA 1P1TA 4O0IA 4DL5A 1DBDA 1KLMB 1BHNA 3VF0B 3MUVP 3DGVA 3MEDB 5H9FJ 3HSDA 3TJ8A 2MMYA 3M9OB 5DJBA 2CPZA 5FJ4A 4N56A 2VOPA 3O6QA 1ELOA 5I3UA 2CADA 1OMSA 2B9YA 3NWGA 3OQ2A 4J9MA 1UJ6A 2YKQA 3BM7A 4TYBA 2G1HA 3AAWB 5CZVA 4IR9A 4DV6J 4K5RA 1QSLA 2XS7A 2XI3A 2W25A 4ZVRB 4E0DA 4NLXA 4DL3A 4LR7A 3T6JA 2HRYA 1Q8LA 4NZ7A 2CWXA 4C48A 3Q22A 1AROP 2BYCA 2Q43A 1KVIA 5ETOA 1TKXA 2VKRA 3IRXA 3CCWA 1RLDA 3AJ2A 3MAHA 2YX4A 1H6KX 4PYDA 1RT2B 3TRGA 2F9JA 4O3PA 3KJVA 2DRAA 1HBUB 1E6YB 3GLJA 3GFHA 2FVSA 4B9VA 2A10A 4KJIA 1EETB 1JJHA 1LFWA 1RZMA 4B3TF 2X1FA 3CXCR 3WIUA 4LR9A 3HZEA 4LSNA 4DF8A 2IIHA 1EQ0A 4EI2A 4K7QA 4DV3F 2DT9A 3HSJA 3LOUA 3B82A 1U6ZA 3MZIA 4HVZA 1PCAA 2P6TA 4NXNJ 4RBVA 2KDOA 2HFNA 4CLKA 2DKOB 1HD0A 5K8PA 2KB2A 2D1CA 1V3SA 4H4KC 1N4LA 4URSA 4DDFA 5LSRA 2XSJA 3RB0A 5H9FK 5AT1B 1SJRA 1D09B 3CIZA 5KFNA 2VB6A 1GX5A 5L39A 2DYAA 2B6AB 2GMJA 3IMQJ 3RRKA 4Q0BB 4URGA 2YX7A 2KG1A 2QLFB 1L3VA 3IGNA 4USMA 1RWOB 2UUBJ 1SV5A 5E3QA 2LP4A 3BJYA 1GXLA 1DQ9A 1SJ4P 4C8OA 1BUXA 1X4FA 3FCHA 3JSBA 3O8WA 4KBIA 1ZAVA 3OL6A 2R7UA 1NB7A 4DU7A 4F7VA 4ZJOA 1HW8A 3MXHP 2I8EA 2CFXA 1VK8A 4U7CA 4LRDA 3DOKB 4OI4A 3D0GE 1WJ9A 4C3KA 3ZNJ1 3P6YC 1IM6A 2E5JA 2JFDA 2ZDOA 3ZZZA 4PPDA 3MM8B 4NRTA 2RU3A 1T03A 4EO8A 4W4MA 1UVJA 3IP0A 1ZOTA 2LQ9A 9ATCB 5IT0A 5F9NA 2B5JA 1TK5A 2CG8A 1LK7A 2EVZA 3W3SA 3NGRA 2RMLA 3MPYA 2OPSA 4IO1A 5L1LA 1UKUA 2B4UA 3I0RA 2V8GA 3K89A 4LF9F 2D3O1 2GFFA 4R0JA 3HHLD 3NAIA 1RACB 2O01C 1KQKA 5HROA 1HI1A 3Q8YA 4K2JA 4ELUA 1YJ9S 1U1OA 2J9CA 2QLXA 3MPVA 4M5DB 5KFLA 3CJKA 1ZM2A 4PG4A 1ZH5A 2CNOB 1JQGA 4U96A 5CYJA 3GG0A 3EXYA 3D68A 1RDRA 2HBYB 2W4DA 5GVQA 2JEGA 1BE4A 5F8GA 3VAMA 1J5EF 3GFXA 4HACB 1FRMA 5ITHA 3DFEA 3H2UB 2OFGX 4I6YA 5CYMA 1WKLA 3M7VA 4EU0A 5A6WA 1IWGA 2HBZB 3FDSA 2NUHA 1S9GB 1S57A 1B0PA 1HMVB 2DIVA 2VFVA 3A8KA 3ELHA 2B9XA 4P2XA 2HFZA 3D1QA 5BXIA 3SZ2A 1FK9B 3MM5A 4ETZA 2A6OA 1X9WA 4Q43A 4ZJLA 3OXLA 3KTQA 4I7FA 1R0CB 2CJ9A 4DS4A 1JLQB 5G4DA 4U6PA 1UJ5A 2YKPA 1NH8A 3PVXA 2FD2A 1CS4B 4CLFA 4JI4F 2AJ4A 2C2ZB 4WF9Q 2HQDA 3AFGA 2ALYB 3HFVA 3H5XA 1N36F 2PDAA 2ZNZA 2MKKA 3JYTA 3ZTOA 5GADI 4WZMA 2W9BB 1NU4A 2LEBA 4LJMA 4QW8A 2IVFB 3MPUB 1S6PB 3LP1A 3X3UA 2L3MA 1RQ0A 4RW6B 4OYIA 2EWHA 4DPOA 5I3UB 4ITSA 2RRAA 4ED8A 3EE3A 4WU2A 2K8GA 5A0YA 1GXTA 3M8QB 5LOQA 2O3DA 2IRUA 2MKSA 2QJ3A 2VKZG 1NZ8A 4MTPA 4AXIA 1ZYQA 1SJFA 5KFAA 3X1LB 2C1EB 2IM0A 3BSAA 5K8MA 1MN7A 4X4OA 3OR2B 3SV3A 4RU2A 4JV5J 1QY7A 1WKJA 3LANA 2CQ0A 2W7PA 3G6ES 4ZPWR 2XMKA 2AZ1A 2E7XA 2FDNA 1G4CA 4M5DA 4J7CA 2OMLA 2B6AA 4ZVSB 4JI2F 5KFSA 5LMNJ 4J9RA 2M4MA 3I5AA 3Q86A 4ECXA 3T5LA 2BJ1A 2LMIA 3D0HE 4IFVB 3CD6S 2V8DA 1RCXB 2CQPA 2Y1LB 2ABYA 3FJ2A 3B6BA 4USHA 5DLFA 5KFRA 2YQ3A 5KT6A 2FYXA 1XMQJ 1NXIA 1WHYA 2GQ2A 4ED7A 1NB2A 2XO7A 1AUDA 2JC1A 2GW8A 2Z30B 2RHQB 3H42A 2XBPA 2DH8A 4RU9A 3HMJG 3PX6A 2DNPA 2J9EA 4UW2A 5FLXU 3M8RA 3KYLA 5AE3A 3GIJA 2H3EB 4WFXA 2AGOA 5DGAA 4KE5A 3DLGB 2XCAA 2X1GA 1O0PA 4OX9F 1FXDA 4ZJQA 5M2PA 4PABA 4CLSA 4K4SA 1RAJA 2M9KA 3E01B 1J2VA 2LECA 4M63A 4C4WA 1SL0A 5JJBA 4FZVA 1D8YA 4DF4A 1KFSA 2XTJP 1S79A 2B8PA 3CJRA 3MAQA 2ZZNA 2H51B 5HBMB 3BYPA 3MD1A 3ZTRA 3CUNA 3FFIA 3JTNA 1RWNB 3DGPB 3IS9B 4RW9B 3ITHA 3VWSA 3IA0A 5KOXA 2A18A 4WKYA 3C14B 2LXUA 1UJ4A 3I5BA 3Q24A 1N52B 3NNAA 4LF8J 4H4MA 2MY7A 2XSFA 4URQU 2NXNA 1T8EA 2L08A 3PG9A 1NJIT 3OTDA 4MAKA 3K5MA 3MFIA 4PWDA 3SQOP 2K3KA 4MK7A 2IMOA 1L5UA 5IT9Y 4JI1F 2K1RA 1V3ZA 4P71A 1PBUA 1F2HA 1Q1KA 1SUQA 1RCOB 3VAJA 1S6QA 2F40A 2O66A 3AD8C 3T1YJ 2C28A 3W60A 3NCQA 1SIWB 4CQ1A 3OSNA 4IR1A 2W9CA 1FJEB 2CKWA 2HG4A 4I2PA 1XR6A 5MLCV 2ZBQA 3W2VB 3W7BA 2GNKA 2VFSA 2YPYA 5D78A 2MQNA 3VTIA 4AL7A 3RBXA 7FDRA 1XNQF 4JV5F 1S0OA 4RNFA 3PTWA 4X4TA 2AYGA 3U1LA 5KFPA 1YJNS 5ETRA 4F26A 3G82A 4J9KA 2XB2D 2CZ9A 2YVSA 3I5CA 1X31C 2H4YB 2D9PA 3D4JA 4UY85 3VR1A 1QE1B 5HQ8A 3C6UB 3JXOA 1MWYA 4MKBA 2DIUA 3FGVA 4PG5A 3KLVA 1C1BB 2M3DA 4E98A 4YR2A 2QLJB 3CMES 1F1BB 2ZH2A 4F2RA 1YJVA 2K1RB 4JUZA 3A4TA 2XZWA 4DR1F 2ZH8A 1R8HA 2MGZB 4USVA 4OX8A 5ADZA 4EFAC 3ISZA 1VJWA 3G6VA 1JLQA 2XO6A 5D0RA 1ZZNA 3VAFA 1VQOS 5T41A 1YZ7A 3G71S 2GO9A 3J7ZT 3WC2A 2QX0A 4JI0J 2KN4A 5DDQC 4TNOA 1MMLA 2HQIA 1IKVA 3RW7A 4YS2A 4MT1A 2KJWA 2LXFA 2BOAA 1R7IA 4M5GA 1Q4RA 4F4ZA 4OX9J 2MLYA 1YBTA 4TLRA 2H48B 4Y2CA 4A8OA 3E51A 1YJ7A 2X7IA 1WOOA 1X5SA 4PXCA 4RL1A 3FK4A 5EX3A 3I4HX 1G7CB 2D69A 3CD7A 4WK3A 2C2MB 3CCLS 2E66A 3IFEA 4I1TA 4JI7F 3GMGA 1R43A 3U1MA 2DHGA 3HJFA 1IR2A 1KR4A 5EWEA 3I56S 3SSSA 5AJ3F 3G8SA 4HEA9 1HPZA 3ZZRA 5HSPA 2G9OA 1VRUB 1QAYA 3VGSA 4EK2A 3MR5A 1WG5A 2QL5B 1F9HA 1OPZA 1K0TA 1GK8A 3EJMA 4UOFA 3PYDA 4ZOSA 4ZPDA 2AT1B 4MKAA 2HHQA 4QYZK 2MJUA 3RG6A 3M8PA 3L4BC 4R0EA 1WNEA 2FVCA 2GAGC 1KHWA 1IKVB 2Z2MA 1QLNA 4F3QA 1IJFB 1URRA 1N32F 1H74A 1WG4A 3M4XA 5KG0A 1HA1A 3CJ8A 3V4MA 2O67A 5FLXY 1U1KA 4KB7A 4BLGA 3DLKB 1RSCA 3EZ5A 4J9SA 4ED1A 2VC0A 3ISND 1IKXB 4RUBA 2CPJA 2NYHA 4N5SA 1Z4UA 4P74A 2AZ3A 2RF2A 1F3FA 2OGUA 1RTJA 2PFDA 4NLDA 1NK7A 1Q7YT 2XS2A 1SUQB 3AY0A 3TX0A 1IUJA 2UUBF 4PR6A 3TQEA 3IRXB 4FN5A 3KHHA 3QIDA 2Y8YA 3GONA 4YFUA 3DLBA 4QU7A 4CM2A 1FKAF 2QYGA 3LAKA 2ZHBA 2YKAA 2R8IA 4RNHA 3E3XA 4DV7F 1H2UX 2RQKA 2DNLA 4YUDA 2Z4PA 1S1XB 2D41A 3OTOF 2VU5A 3P45B 1TVRA 4IYQA 5KG7A 2QO3A 1JLCB 2V2QA 4W98A 3HT3A 1T9UA 3DLLQ 4NXNF 1Z2ZA 4ZVEA 4PUOB 3G6XA 2BX6A 4HH1A 4EWTA 4YY3J 2VPZB 3AH6A 2BM1A 3MF5A 4YEAA 3SDEA 4X4SA 1HI8A 1NPRA 3CEDA 3K5NA 3T3FA 2FJBB 1TR0A 1SKUB 1U8WA 2ZD1A 3CCZA 3PHEA 1I5OB 4WXWA 1SCJB 3UQSA 2ZH6A 1SKRA 1YGYA 1QVFR 2MQLA 3J7AN 3M8YA 4ZP7A 2OTLS 2ROPA 1DTQA 2J9DA 3MWBA 3JAMU 1I51B 2JHEA 4WP8A 3PNIA 3IC1A 2HMIA 4KKOA 2EC0A 3K2YA 3VGVA 2R8JA 4UQGA 2G0CA 2ZH5A 2DNYA 3KWMA 3W2WA 2Y1RI 3TVYA 2CJBA 4XAKA 3TW0A 4GC7A 4LF4J 3UVJA 3M2VA 4EBEA 1R0BG 3M2RB 1NO8A 1W2BR 3JQJA 4DL4A 2PEBA 3NG8A 4ICLB 2BANA 5D15A 3DM2B 1RT6A 3MCOA 1RHJB 3CMAS 3B8HA 5LMUF 4DUZJ 3QJJA 4EYHB 2OH2A 2VH7A 1LWCB 1XN9A 4CLYA 2QN6B 4NA1A 1G6BA 2R2TA 4CT9A 2EC2A 2KFZA 2AJFE 1WORA 2PA8D 3P5TL 1W25A 1NLKL 2MZRA 5K9FA 1IKYB 1F5AA 2KZMA 2OSRA 4M5JA 4X4QA 1N5QA 2W7AA 4HDGA 4YMEA 2RUSA 2Q6BA 2WB4A 1GTHA 4LF7J 2E1PA 2WONB 3PEHA 4BC9A 4M8LA 4KO0B 3FEXB 2V0NA 2FTRA 2LDYA 2J7UA 3MCMA 1JXLA 2AIRB 2A1BA 1N5TA 2BABA 2FY8A 1MN9A 5JVGQ 1VR6A 3MM9A 4UUWA 1RAHB 2KI2A 2PSZA 2XMVA 3HHDA 1HQEB 3QNWB 4OV6A 4X66J 5B09A 3M2VB 1VYAA 3MDFA 2QT7A 3PW5A 1U1MA 5E5NA 4U95A 2KM8B 4DV5F 4RKUC 1VQ9S 1T7PA 1GMVA 4NA3A 1S5ZA 1WC5A 2W24A 3VV2B 4OHXA 2FHOB 4FF3A 1YLXA 3V5RA 3M2UA 3OJSA 2JLGA 2R7QA 2ZH9A 2V9KA 1FD2A 4GKJJ 2X3DA 1HD1A 1C4CA 3KDNA 4DN9A 1C1BA 2R9LA 4UY8T 2AEJA 5C5JA 1JLAB 1UEUA 4U8VA 2AKWB 5DZ6A 1KWMA 4MIWA 4B3TJ 2F1FA 2UU9F 2IVMA 1CVJA 1V5VA 4CO4A 2XC9A 4LF1A 3UCGA 2YWEA 4DV1F 2F4VF 3NGTA 1B7YB 4P73A 2NXCA 1RWMB 1WACA 1MNEA 3A3NB 1WHXA 3DMJB 4DR7J 4ECQA 3R5CA 5KFQA 1U4BA 4RW6A 4CLPA 2WZ1A 4F0MA 2MLXA 2Y3YA 5KFZA 3DKDA 1LWCA 3U27A 1FERA 4OYZA 1HHQA 4ZVTB 3KLIB 3RRHA 1DLOB 1U02A 2DR7A 4JI5J 1F6TA 4DQQA 4OI1A 4X64J 3O1LA 2JEIA 1U6FA 2HHWA 4C0BA 4L72B 4F4WA 2FLPA 2MTLA 2XLIA 4FPIA 1K0VA 2DR5A 2MGZA 2B7CB 3M9NB 2XI2A 3QAEA 1O51A 1ZA1B 1YZ6A 2IDLA 3QPIA 4CZCA 1LEOA 4KH0B 1X5PA 2WOMA 2D3OR 4GKKF 2BE2B 4C3MA 2FUG9 4EBCA 3PZPA 1PG5B 2IBKA 4DPWA 1NK4A 3U1NA 4KFBB 3FEZA 3NKYA 2JC0A 4P6QA 2UXBJ 5F8JA 3DHWC 4BCAA 1SC6A 2HHHF 4ECUA 4KT0C 4EEYA 5C7PA 2E9TA 1IKXA 4CO1A 1SQFA 1RT7B 4F4XA 3Q8QB 1OQ6A 1HNVB 3W64A 2F63A 3Q8PB 3LP2B 3IO1A 3UDVA 4DCPB 5IFMA 1T94A 3T1HF 2MQ8A 2FC9A 2VG5B 2ZM6F 4NRUA 4J9OA 3EVWA 5AJ3J 2VBWA 1RXOB 2ACYA 2WB1D 3N28A 1TUVA 3FCVA 3MEGB 3QLHA 3QT7A 4FXWA 3H0PA 4IDKB 2HEKA 4WE1B 5KFKA 1YJWS 4F4KA 4K4UA 3C46A 3BO2A 4OJ3A 2NUUG 2IC3A 2MZTA 2KJVA 2WW4A 3OR1A 2R7TA 5I42B 1FD8A 3T5HA 3MR6A 3LPYA 4ZN3A 2AQ4A 1DFDA 2GX8A 1U1PA 4HYKA 4GVBB 3IRWP 4NLGA 3HO1A 2AJ1A 2FHJD 3ONQA 2RD5C 3EICA 1CJUB 3TEGA 2AJQA 4WZQA 1HBNB 4JI0F 4TU9A 1RUSA 2CQ1A 3BQ1A 4FS1A 5KFFA 1VIXA 2YH0A 4I69A 1TKZB 1JLCA 1FKOB 2JH3A 2FQQB 1GEHA 2IHR1 2BVZA 2QL9B 3GILA 3CCVS 2P9GA 4AUKA 5IQ6A 3DRYA 3LW5C 3QGGA 4HHHA 2JVOA 1SC4B 2J5AA 2HNDA 3AA9A 2KXHA 2E29A 5CZXA 5F0WA 2QSWA 3TOQA 4AXJA 1IWAA 2BW7A 2XMTA 1M1GA 1IQTA 2HVZA 2KO1A 3LP0A 2R2UA 3F41A 4DR3J 3I4PA 1X0PA 4OZNA 4DPUA 2IRYA 1HWIA 3DRPB 3KLGB 1CSJA 2VG7B 3H98A 1NJYA 2KRRA 1L3SA 1PBAA 1JB0C 2POKA 3MEEA 5F41A 5F9LA 2RUGA 1CS4A 3W1YC 1MU2A 1WHVA 2VF3A 2R7XA 3M1VB 2C3MA 4RBUA 1SJQA 3PJWA 3CJ5A 3Q2SC 4A8SA 3M6VA 1W2IA 4IH5A 1JK9B 3SCJE 2MXYA 2VQEF 4C8MA 2B4OA 3AT1B 1QD1A 4FP9A 4C8KA 2LA6A 2VBYA 2ZDPA 3CCTA 1FJGJ 1HNVA 4DV6F 2CPEA 5LJ5Y 5KFJA 3DRSA 2WSCC 1OPIA 1S6QB 2CZ4A 2XHWA 1KOHA 1T02A 1PJ6A 2V4RA 3H4DA 4DX5A 3D54A 3KJQB 3SYZA 5K5MA 4CWBA 4OZ1A 5HP1A 4JI1J 2KRBA 3FNNA 3MECA 4O3SA 3QFHA 1ZPWX 5L38A 2V6AA 3PW4A 3N0VA 5ETSA 2EI5A 3M05A 3G96A 1FWKA 2UV8G 4H4KA 2FLOA 2UUCF 2W9BA 2CRLA 4NWBA 4RUHA 1TMJA 1TK8A 1UMJA 4XIUA 2G0IA 2MYFA 3R3TA 2CPDA 4XPEA 3C19A 4JI6J 3HHEA 3VAHA 4ZN1A 3GE9A 5C2CA 4Y6IA 3E8OA 4DS5A 3ZO7A 1IR1A 4ZKAA 3N6MA 1SQEA 3POTA 5ETTA 4EO6A 2AV5A 5D6GA 5D3GB 4MIAA 1T3OA 1U2CA 2J8SA 4A8FA 1S6OA 1RTDB 4QQBA 2DPJA 3OVAA 3H40A 1LW0A 1VBYA 2DHAA 2JWNA 4PQUB 2N7YA 1NEEA 1SVDA 4DFJA 2L9DA 2W9CB 1JX4A 3F0NA 1N5VA 3US5A 5FD1A 1JLAA 5KFXA 3E01A 1TL7A 3L09A 5ETPA 4ZVGA 5KFVA 3ZZUA 1NKEA 4W90B 4A8YA 4FYDA 2VD3A 4DBQA 1TV6A 5DQGA 1XERA 4DR2F 1HBMB 1S1UA 1RTZA 4OYOA 3EYZA 3VAGA 1S1XA 4OIXA 1R31A 3H2LA 1DARA 3HULA 5KFOA 3C6UA 1RU1A 1KP6A 2RKIA 2Y0BB 3PR4A 4NASA 4Z7CA 4X62F 5DM7Q 3MPWA 2VG5A 2C2RA 4DR5J 1QTMA 4JI2J 4OX7A 3M32A 4CO3A 2YPZA 4ZA1A 4CO2A 4B3MF 4F2SA 2OPSB 1FDNA 5AXNA 3PYEA 3C3LA 1CJTB 2HBRB 3C66A 4K5SA 5HVFA 1YHQS 1R0AA 2E44A 3LGMA 3OUYB 1LXNA 1AA1B 3ZZYA 2N82B 3PHTA 4F0HA 4F36A 3J81j 3KLEA 3Q0AA 1PSDA 2CPXA 2RDJA 1TKTB 2C3YA 4FVCA 1MSWD 1YRUA 1HBUA 2P9CA 2HLTA 2RQMA 4BC7A 1RA6A 2BRKA 2YQ1A 3CNQP 2L9WA 4B9SA 1VLOA 2HIQA 3IGVA 1RYSA 3A1YG 2VG6A 4O4GA 2OJ3A 4UOGA 1G3OA 5BYQA 5KAKA 1J27A 4QIFA 1DAXA 3HX9A 4UZCA 2U2FA 1FWPA 4N7TA 3BZQA 3D6TB 3GIKA 5GAEU 3B4DA 1TFWA 4DG1B 1NHUA 4YB5A 4DUYF 2XYGB 2E5LF 1RA7A 1RT5A 1S10A 2K3IA 1LOUA 2EPIA 1HNIB 1RKJA 1N5YA 3B54A 1QM9A 3FSXA 1LW2B 3DLJA 1GMWD 3KJNB 2E5GA 2JSXA 2M7SA 3MECB 4CLZA 4LF6J 3KNAA 1CJUA 3CCUS 4QR2A 3JSMB 1KLNA 2LEAA 2G0JA 4DX7A 1FE0A 1TKTA 3CJ2A 3DI6A 4OZ5A 4F3MA 4PQAA 3DU6A 3GJTB 2XLJA 2JZ5A 4IRDA 3T1AA 3JSYA 2AP6A 2UZAA 3KJVB 1HI0P 2J0XA 3BBFA 3MCSA 4TKTA 1E6YA 1TUWA 1SI9A 3O2IA 1TL3B 2O1PA 3AJ1A 3G8TA 4FXDA 2H5IB 1U1RA 1HYSB 4IG0A 4DQSA 4LF6F 1YKWA 2C3UA 2DTJA 1M1KT 1VHIA 1VC0A 2QE5A 1ZAWA 1YBAA 4ZVFA 1R0AB 5KFYA 4O3NA 2MQPA 3RBDA 4WP9A 5D77A 1RHRB 1WUUA 1HNXF 4ZMMA 3H25A 1U2RA 3OBIA 4O3RA 2B5JB 2RKIB 4KQZA 3WX4A 3DLHA 2E9RX 4I67A 1TMMA 1N5SA 2BV3A 3PX4A 1S0MA 5ETKA 3HF5A 2EKYA 3I0RB 4N47A 1WC0A 1F0XA 3MHYA 2HMIB 1FDAA 3PJ9A 2IM2A 4DN0A 2HZAA 3OSPA 4O4RA 2KHDA 4EZ9A 4MKVA 2LXIA 2IM3A 2E1MC 1RBLA 2RH3A 3VQSA 3H20A 2OIHA 1KBRA 1SL2A 3EMTA 2R2RA 4KGXB 4QIGA 2VHGA 4FKXA 4LSNB 2FHKA 2I2YA 5GMDA 3DYAA 4P2MA 5E33A 5HMYA 1OYDA 1TELA 3MGJA 1O5JA 4RUAA 1JLGA 4XTTA 3K17A 2DNHA 1W26A 4WTYA 3V81A 1Q8IA 2F4FA 2G2YA 5D0HA 2XMWA 5C42A 1WTBA 1H38A 4LQ3A 5J2QA 5D3GA 2ROEA 3THPA 3UDEA 4G1QB 4LR8A 5E7OB 5HMXA 1H98A 2JLFA 1U0SA 1SC1B 5HROB 4ANCA 4G1IA 3N01A 1UVLA 3CJQA 4KGMA 9RUBA 1NK8A 4Q0BA 1Q95G 2ERRA 1AZSA 1T9VA 4HL9A 1VS3A 5KG6A 1H72C 1P9QC 4B3RF 2VG7A 1O8BA 1T9XA 3PXGa 3NGUA 4IOCQ 2XY6A 4USTA 5E2QA 5ETLA 4Y00A 4GC6A 2BR0A 1CJKA 1V5IB 2BJ9A 4LIWA 1BMQB 3ILOA 2ZJRQ 1YSJA 2YXLA 1BQXA 1WEYA 2KFYA 5L1IA 4DSEA 2V34A 4A8MP 3ILJA 3DYAB 2LU2A 4EGLA 3NWRA 3IAS9 1T95A 1NH7A 2HQFA 5J2PB 1Y3JA 4WJBA 4LMZA 3CJ0A 3C16B 1NDPA 4LRBA 3GIIA 5BYSA 2MHEA 4DCOB 1QAXA 5CA5A 3BR8A 1BGXT 2DCUB 3HI9A 4OYWA 3VAKA 4WU3A 1IBLJ 3KUGA 1RAGB 4Y2KA 2Q3PA 2YNGA 5DZ7A 1FF2A 2CVEA 6AT1B 1HNZF 1KTVA 1VI7A 1W7WA 4NLUA 2JNJA 2Z56B 5L1JA 1RISA 3J7Z5 2WTFA 1HARA 2AYEA 5A8RB 3HPOA 2BMBA 4AL5A 4NEYA 3P49B 3PW2A 4K59A 3RB3A 1VRTA 3NXZA 4P52A 4C8LA 2HHPA 1EARA 1JLEA 1FRXA 4IFYB 3UNYA 4K8RA 5L46A 5MAOA 5F8IA 3HP6A 1FI4A 5J2MA 1NDKA 4HHUA 3NS6A 3QAUA 3FSIA 1BWVA 2J7WA 2ALZA 1HBOA 1DRZA 3EX7B 1NHKL 4DU8A 4WFYA 1CLFA 3HFZB 2JFKA 4Y3CA 4WIIA 3BB5A 1S1VA 2KT5A 3MM6B 1FTCA 1NSAA 2J0QD 1N34J 2WVDA 2IFXA 5F8LA 2AYBA 1SQGA 5IM0A 1I1GA 1K1SA 1KHVA 2H5EA 1EAYC 3GTYX 3MMBA 2U1AA 1U26A 4RLEA 4GKKJ 2WVCA 2DEJA 3BGUA 4QZVB 5KFWA 3IWLA 1VFJA 4CO5A 4F67A 5HJYA 1VQLS 2HW3A 4UUXA 3PACA 1RADB 2P6SA 1N6QB 4HHJA 4TY8B 3DRPA 3RB4A 4ZDNA 2FY1A 1L3KA 1X4DA 3MUMP 4N41A 3BH6B 1FX4A 4R5PA 3BYRA 4H4MB 2HHXA 2PO4A 3KUEA 2KM8C 3G86A 3PR5B 4ELTA 2DXDA 2H5JB 4NMXA 2CDQA 4QPTA 4IRKA 4LFAJ 4B3RJ 4YOEA 3ZZ0A 1UTAA 1GFWB 1T05B 2OELA 1YBUA 2ZNYA 1FNMA 4PYAA 2UVWA 2OUGA 1NSPA 4AQYJ 3MFHA 2XGPA 4HT7A 3Q8UA 3OVBA 4ED3A 4ED6A 1QJHA 3HKZD 2HHUA 2J8AA 4F0KA 1ZAXA 4J90A 1UCNA 2F3JA 4N76A 2C2NA 3ET6B 3AOBA 2IJNA 2LQJA 1EQMA 3MAAA 3TR5A 3BSNA 4NXMJ 2JVRA 1MU2B 4K4XA 2C3PA 2ZEJA 2GAHC 3GJQB 1HQUA 3MURP 2J0WA 4TXSA 3TJAA 4MFBA 2BUNA 3OPKA 3H2VE 5EX0A 2RDDA 4L75A 3SV4A 2DR8A 4FNIA 1R8CA 5CCMA 4KHPJ 3P96A 3R6LB 5IWAJ 1UWBB 3ENWA 2KT3A 3KG0A 3UDCA 2Y1IA 5HMWA 1ZETA 2GS8A 4ZCKA 3D0IE 5KFIA 5F0UA 5HI7A 5M2UA 1S9EB 4A8WA 1UFWA 3FKBA 1SJ3P 5T7LB 2X3GA 4PWUA 5HO4A 3PIPQ 3QT6A 3QLHB 2DO4A 3UD5A 2QMXA 3NGSA 3CJ4A 4I2QA 5B0CA 3CD5A 3MTKA 4DV0J 3C2PA 4OYPA 2X51A 2FVQA 2BJ7A 1IJEB 3K59A 3MR3A 2W2PP 4KH1B 1RHMB 3GSDA 4ZCMA 4LT6A 3OD2A 3CCQS 1GH8A 1CQMA 3W9JA 2FC8A 1JLGB 1FTRA 1I3OB 1YJUA 3W2VA 1CC8A 2PE8A 2MPUA 4KFBA 4LBIA 3CULA 4RO0A 1DY3A 5GADU 2ASJA 3RGIA 2HS0A 1QSSA 2UXCJ 1HWLA 3D6HB 3M9MB 4DV0F 4NCBA 2YY3A 3WC0A 5KFCA 1JXEA 2ZD1B 3W62A 4H54A 2UXBF 4J91A 4O44B 3T19A 3ZZOA 3CGIA 5K14A 1S1TB 3IM8A 2WW8A 4IDKA 4WE1A 2BM0A 2LCWA 4LBPA 4R5PB 1G1XA 3ZC4A 2I5JB 4ED5A 2PIIA 3N4WA 1UPMB 1RYRA 2ZKTA 2EBEA 2HWTA 2UUWA 1NM2A 3PW0A 1XMOF 4HKQA 2Y8WA 4RW7B 2YNGB 1D9DA 4J5OA 3TAPA 4OI6A 4IO9Q 1VQ4S 2C2OB 5IC6B 2HSEB 3O3LA 2P9EA 3W2WB 4OJHA 2AGQA 3PO4A 4JYAJ 2UP1A 3PRVA 1SIZA 1FEHA 5LXYA 3TWZA 4GMKA 3W61A 2GZOA 3SXLA 1D9AA 3LPEA 3TO8A 2B4VA 5U47A 3KLFA 4MKYA 4FNHA 3RRGA 2DNRA 2X1BA 4RNOA 3RTVA 2DITA 2DEIA 4GVBA 1U6BA 1S49A 3OLBA 1M5PC 4DV1J 1NKCA 1B3TA 3LALA 1NK9A 3BGRB 1SH3A 3GIRA 4OJGA 4ZLNA 2ZH7A 5BR8F 3I9ZA 2IAJB 1C4AA 1C1CA 3AOCA 2GHWA 3TA1A 4AT1B 2OAUA 1FVSA 2A2DA 4HTJA 1R8BA 2VA3A 2XMJA 1ACMB 1RT5B 1X9MA 3M30B 1UEKA 1ZS6A 3HHNB 2LQ5A 2GV1A 4RW4B 3T6BA 4X62J 2HNDB 2HFUA 4KTQA 2NLWA 2AW0A 2CAJA 1U0HA 1HPZB 2HKEA 2YKMA 1QUVA 3S7RA 2GVDA 3BO3A 4ECYA 3R5BA 2OI2A 5HBMA 2LYVA 1Q53A 2V2KA 1RTIA 3QT8A 4CLLA 1U47A 4OHYA 5HN0A 1KTQA 2WVEA 3CO9A 3BN7A 3MM8A 1T03B 2IRXA 2W01A 1IBKF 4I68A 2JEJA 2V4QA 2B43A 3KMQA 1RHQB 3KK3B 1VJQA 4ZP6A 1S0VA 2WCXA 3T5JA 1T9YA 3CB4A 4N8OA 1JKHB 2VODA 4QW9A 1D9FA 1FNOA 3RZAA 1BC6A 4CH0S 2QMWA 1TZ0A 3DU5A 1Q8KA 2CDRB 4OL8A 1Q5YA 2E7WA 2IA6A 1XBWA 2M0GB 5A8RA 5KFDA 4P7VA 4ECWA 2QA1A 4KYZA 3OXFA 2Q79A 2HGLA 3A8EA 3JTPA 2V2VA 4HDHA 3TX8A 1HYSA 4WTOB 2IBOA 2QA4G 5DDRC 4DLGA 1RT7A 2DD8S 2VPWB 2B56A 4PAAA 1KFDA 2XY5A 3HM9A 1QE1A 2QYCA 3OFGA 3LWLA 1UETA 4RUCA 4HI1A 1SB6A 1YQHA 2BE9B 3CW2C 4A8KA 2HYIB 5IQQA 2LDIA 3TVKA 4AD6A 3J81Y 2FJWA 1N48A 3UDLA 1FT8A 4DOZA 4WFBQ 2VONA 1Y4ZB 4DV4F 3A3OB 5THWA 4GKJF 5CABA 1VDHA 2M5YA 2ZBRA 1I6JA 2F8HA 4YY3F 5E41A 3Q2TC 2H4WB 1H2VZ 3SFGA 5KT3A 1RAAB 4JBCA 1DURA 3GJRB 2I6WA 1WDDA 3W8PA 2OPPA 4NL5A 2VA2A 4RR5A 5B0FA 4DR5F 2DY9A 3QRRA 3EGZA 2ZBCA 3NCPA 1Q78A 4KGZB 3VGTA 4WIQA 5FDLB 3V2UC 3GIMA 5LL6d 5B0EA 5J2QB 2ATCB 2DGUA 4IG0B 3PYGA 3UR0A 5H1SV 4DV4J 3BKTA 1SPBP 3QSYB 1TKDA 3LO3A 1S77D 3K5LA 1S59A 2J7KA 2XMUA 4BDPA 2CQ4A 2WRMA 3SCLE 3D9BA 5GAEI 2J6UA 1KVJA 2F9DA 1NBEB 1UWAA 3KLEB 3L3CA 4JP8A 4F4AA 2RS2A 5A8KA 2ZOMA 2MY8A 2OEJA 2BXJA 4M5IA 3GZ7A 3BO4A 4WWSA 1S48A 1B4SA 1RBAA 3CDWA 1NNDA 2ZFHA 3CTRA 2QTWA 4NEZA 1ZPVA 3CC2S 1NJZA 4X4NA 1FJCA 4FDFA 2R8GA 2E5HA 5IT9U 3M6UA 5HK4A 4ED4A 2ZITA 3QIPB 4U8YA 3RAQA 1PAUB 1WKKA 1U0HB 2G2OA 2BJDA 2QLBB 2XULA 2YKMB 3DHXA 3JS9A 4QR1A 3ULHA 4ECTA 2CG4A 2DH9A 4K50A 2YNIA 1XJWB 5HMZA 1KOOA 1ZM9A 2ASLA 2PI5A 3GYGA 2W4CA 1HQEA 3KDOA 3KJFB 5EGYA 3R6GB 1YJRA 1XMOJ 4DFKA 2E7VA 3S6EA 4EMDA 4TYAA 2HHSA 1REVB 4WYLA 4NI2B 4OYBA 1HLWA 4BHQA 2XG8A 3GPAA 1ICEB 1UW9A 4NLVA 3DRSB 4M5MA 4ZLLA 2QSFA 2MKJA 3DI6B 2BEFA 5D0GA 2LQBA 3ITHB 2ZM6J 1YVFA 4JI3J 2VV5A 3DOLB 4Y2AA 2YWGA 3TARA 2IMWP 4JV1A 1XWLA 2JDJA 4CTAA 4PXEA 4CH1A 2J6TA 5HLFB 5SZTA 1BXNA 3BDEA 3M8WA 1RTIB 2F8EX 2Z58B 3PRDA 3QWPA 5CAAA 4TQRA 3RR7A 2J0SD 1SH2A 4P9SA 3QJPA 1P6TA 3EM1A 3MTJA 4LRFA 3HFKA 5KG3A 4C11A 4JI3F 2OPRA 2HNZA 2VPYB 3FBFA 1BQNA 4AE5A 3RAMA 4X4UA 3TVZA 2YKNA 2KVQE 4C2MA 3LWMA 3AQPA 1NUEA 1D1UA 3M30A 2FZGB 4I0WA 3BV8A 4USJC 4A46A 2GHVC 3T5KA 3TI0A 2CXEA 3ENVA 2Z2YB 4USIA 4DXLA 2FGOA 2HURA 2P2CB 1OSDA 2XZDB 1VQKS 1VGYA 2OMOA 3ETOA 1UA0A 2CVIA 5L9NA 1C2PA 2VFTA 5D4PA 4OZ0A 5AE1A 3PV8A 3R8YA 5CYQB 3MCNA 4X64F 1CEZA 3DXSX 2YNIB 2ZBPA 4P75A 2CJAA 4NXMF 1FEEA 1FRLA 3J7A1 3MOJB 2G13A 4FYXB 4ETXA 1IBLF 2XEXA 1TL5A 1VQSA 1FKPA 1SKSA 3V81B 4OYAA 2HAFA 4FBTA 1AXQA 4DPYA 1XNQJ 2V50A 3OTBA 2ZJPQ 4C97A 3LQVA 1PJ5A 2HVEA 3LGNA 4ATNA 8ATCB 4L6V3 3QZ8A 5JVHQ 2UVRA 3UN3A 4X65J 4B9MA 2WSFC 2FIUA 4Q44A 3DXBA 2UU9J 1QVGR 3S8SA 1JLBA 4NZ6A 2DBBA 4CNYA 2ZZMA 3TZWA 1SKWA 2ZUAA 3EGWB 2LFVA 4L3NA 2IPOB 1REVA 4YN3B 1PC5A 2VFRA 4QCLA 4C7QA 2F5GA 4LFBF 4X65F 4OMFG 4DV5J 1KD1T 1FXLA 1R8AA 3GR1A 4DL0C 2LLZA 3TZXA 5KFBA 2EFPA 4DQPA 4LF8F 4C8ZA 4C0HA 2V4JA 4ECZA 1LXJA 4TY8A 4ID5B 3C14A 3M6WA 3N6NA 3VVTA 3W5XA 2IY5B 3KLIA 2A6MA 4IOAQ 2KXFA 3V4IA 4JYAF 3U7JA 2HAIA 2CJKA 4YB1P 2IJRA 2AGPA 2VASA 3HT0A 3F56A 2ROGA 4O0NA 3MD3A 4HH0A 4UZBA 4Q2MA 5A2QY 1JLFA 2DCLA 3DOKA 2BKNA 1NDLA 1NPKA 3QO9B 1VC6A 3WZ0A 3FEYB 2YKOA 1Y0HA 3KKFA 4RBTA 2DNMA 1FFSB 1RAFB 1V6HA 5F8MA 1R3NA 3UR3C 3THVA 4PG8A 1WC3A 2LA4A 3L95X 4QOTA 1OYEA 1AFJA 3HZGA 1AW0A 2W2QP 3NP5A 5CYQA 2ZH3A 4WK1A 1HR0J 4WKRA 1NCLA 3EUNA 1R89A 1T0TV 4I6AA 3IBWA 4ILRA 5EWGA 2B3TB 2UUAJ 4F8RA 1U49A 1C0TB 2DGOA 2NYIA 4Q8FA 1HR0F 2HZCA 3AODA 4EBDA 2HVHA 5EUHA 5DLGA 2DPIA 2RSQA 5DGBA 2PI4A 2HHTA 1X4BA 1HNXJ 1F2GA 4TY9A 4LF4F 3DCAA 2NXEA 3OXGA 4U9RA 2HNZB 2CQIA 2EW9A 5ETNA 2R8KA 5IM0B 1DLOA 3C16A 4P10A 1K9MT 3BR9A 3TEHB 4JI8J 3OFFA 1DQ8A 3R7BB 1RTHB 1VIOA 2HZVA 5M2RA 4B9TA 3K0JA 3AJDA 4U67Q 1EIYB 1BY9A 2C2KB 4I2QB 4KC5A 1HQ2A 2UV8A 3S01A 3BQ0A 2MKHA 2Y1JA 4CDIA 2CNKB 4LFAF 1X5OA 3GR0A 1YITS 1CULB 1CJVB 1NMEB 1NPPA 2R7OA 2ZVIA 3PFOA 3EVMA 2ZZTA 5FIIA 2BE2A 4QU6A 1ROFA 1F5BA 1GQEA 2CQ3A 3D5MA 3RUBL 3ZTSA 4ZHRB 2XMAA 1FO1A 1KDNA 4R8UA 2ZH4A 3RB6A 3RBZA 3RR8A 1UVNA 2E5LJ 1LK5A 2DNZA 4PKDB 1PYTA 3ZNUA 3TZZA 2VFUA 1IVZA 3CSKA 1VBZA 2AYMA 4XPCA 1E6VA 1B7FA 2DGQA 3G82B 3FQLA 4FXVA 2BJ3A 4OYXA 3KMSA 1R6VA 3J80Y 1HHTP 3DOMB 2A2CA 1U09A 4X66F 1KN6A 4CYUA 2CUYA 1JMTA 2ATLA 1MMNA 2N3OA 1VLYA 2VPXB 1TTHB 2E5IA 1BLUA 2W1BA 3D6FB 4O3OA 1JKHA 3PO5A 2QLWA 4LFCJ 2OLWA 3QQCD 4OHVA 4ES2A 1AYEA 4Y2IA 4LVOP 1EETA 5F3TA 3Q83A 2WONA 4LVNP 5KFEA 2Y0SD 4NCGB 3FMBA 4X4RA 2MEWA 1S6PA 3LP1B 5K20B 4YDXA 4DV2J 2K06A 3OR1B 4QBUA 1N32J 4YP3A 2CNLB 1S1WB 4USKA 2NPIA 4MMOA 2GQCA 3LH2S 3G2XA 2CA9A 2MKCA 2XHCA 4LUBA 3M32B 5C25B 4E8UA 4K4WA 4FS2A 2KFNA 3OTEA 4RX6A 4DL7A 1IQZA 2RDIA 1GTEA 4DWIA 2KHCA 3R1LA 1MROB 1UAWA 3BF4A 3KFWX 2HQ3A 3ENAA 1VRUA 4WFAQ 2IA0A 5A8WB 1HNZJ 4IRCA 8AT1B 1S4EA 2CPHA 4H4OB 2PMZD 3PEJA 4DHVA 3TAQA 1HMVA 3KK1A 1VQMS 4FF4A 1IKWB 1X60A 1HWUA 2V67A 3NGDA 4F50A 5F8NA 3WBZA 2W2MP 3HLUA 1RWPB 2DR9A 3I32A 3VGUA 4KKOB 2KU7A 5HL7Q 5F8HA 3CCRS 2CQHA 2MSSA 1UEVA 2SXLA 2XNQA 2YTCA 4RW8A 3HHLB 4NCGA 1FX2A 5ETVA 1DQAA 3IWXA 1D3WA 4KPYA 1YWXA 3DLKA 4NLOA 2RILA 3CT9A 2GC8A 4Z37A 1RGVA 1XIQA 4JI8F 2PD1A 1SV5B 4J9NA 3DM2A 2RQ4A 2A3JA 1T11A 3DRRA 1IN0A 3TA2A 4DUYJ 4J9QA 4CYUB 4A8XA 2BQUA 2HPUA 2NR0A 1LWFA 2W8KA 3K8VA 3PRBA 4EUVA 2OTJS 3B4MA 1M5OC 3PY8A 4V19J 3AXMA 4KR0B 1WC1A 2ADCA 4DV7J 2XNRA 4KHMA 4J9PA 1VQ8S 3GWCA 3ICLA 3UI3A 4USWA 2I5JA 1UW4A 4K2XA 2KKHA 1GAOA 4KSEB 3R1HA 3OHBA 3GV5B 4PG6A 4RWWA 2CQ2A 1F60B 1N88A 4RW8B 5F3ZA 1R8PA 2MZSA 3HHLA 2GJ2A 1S99A 1KLMA 4HACA 5ETQA 5J2NA 1SC3B 1I94J 1B64A 1S12A 4ZIWA 3PYFA 2FHMA 4C6AA 1IM4A 4IG3B 1D8ZA 4UF4A 3DNCA 1RT4B 4Q5VA
chains in the Genus database with same CATH topology
4A48A 2D3UA 1H7WA 3HHLC 5DG7A 4QYZJ 4KV8B 3KK1B 2GCFA 3PIOQ 4PUOA 2EG2A 1CC7A 4Y0FA 2L41A 2RNEA 2DGXA 5CCLA 1L3TA 1CPZA 5JXSA 3PW7A 2APOA 4Q8EA 2IM1A 4LSLB 3MM7B 1FK9A 2EFGA 2EK6A 5J1NA 1MMDA 2JOQA 4XK8C 3MMCA 4YQWA 1URNA 2FLNA 2XWXA 3GFYA 1LWEB 1BWEA 1R6YA 1HQUB 1TQLA 3I87A 4CIOA 4MFBB 3ZZPA 4WCEQ 4KIAA 3H4BA 2FJXA 3I31A 5DQHA 2GMLA 1U2FA 1DTTA 2HS4A 3SQGA 3G4SS 4I6WA 3TUIC 1R27B 4B08A 3QGPA 4X4PA 1UL3A 3F44A 4LIRA 2HNYB 5GAHU 1NJXA 1UVKA 3L7PA 1VOMA 3UE2A 2RE1A 2XSJB 1TL1A 3H5UA 4RW4A 2AJ0A 4JI6F 4ERDA 2WBRA 1U1NA 2UUAF 1XTZA 1LFPA 1U25A 5GAGU 3TAMB 1F5CA 1U1LA 2C3OA 4FXDA 3P3DA 3PX0A 2D9OA 2V8HA 2I9SA 2QIFA 2ZKUA 3R5DA 2HGMA 3MEKA 4KAIA 5DRKA 4ALZA 1Y5LB 2OO4A 3FRYA 4QWDA 4Z2XA 1VQ6S 4YHHF 4D3HA 1FHTA 3IR5B 1TAUA 3KG4A 3JSRA 5LJ3Y 1UP1A 4NX9A 5DQIA 4RZRA 3KG1A 3OL8A 3KK2B 4I56A 2AX0A 1Y5NB 2UUTA 2FPHX 3KLGB 1IKWA 2PA3A 3JAMY 3UWTA 2R8KA 3DOMA 3OV7A 4DSJA 3KNGA 5DDPC 1BQMA 2DISA 3NAHA 4QIEA 4ZPTR 6FDRA 4JV2A 2M8DB 2N3LA 4KRWA 4QIVA 4P2SA 5B0AA 1KSPA 3EXCX 4RW7A 5KG4A 1YRTA 5DM6Q 2DO0A 2RU9A 2W7OA 2AX1A 2B9WA 4ECSA 2M8HA 4B3SF 3LAMA 1NK0A 1FA0A 4R8UB 5BYRA 4QWEA 2JEFA 2VQFF 3UFCX 4PWDB 4QR0A 3C6TA 3S1TA 3IN5A 2XWYA 1X4EA 4QJVA 3V6JA 4NLSA 1NAQA 1S7HA 1CQNA 5CD4H 1RTJB 2YWHA 3OVSA 2GIQA 3CF5Q 5L1KA 1LWFB 4G3IA 4P7TA 3H59A 2JLEA 5L9XA 1RTDA 4RNMA 2V8VA 2VL1A 3IXQA 3H5SA 1DTTB 3SQGB 1S9FA 1S1VB 3MM6A 5IS2A 4K4ZA 3DMJA 1XR5A 3HKWA 5E3CA 1FXRA 4GO7X 2V4JB 5A8KB 4DSIA 3VZHA 4I2PB 3SMZA 3AB2B 3HVTA 4CT8A 2RS8A 3TQ1A 3QJLA 2CPYA 2UVUA 4IFYA 1GX6A 1OQ3A 4MIBA 4Q7AA 1VK3A 2DNQA 4F02A 3KHLA 1Q82T 1HBMA 1OS5A 4NOHA 4LF5F 4WFNQ 4OHZA 2F7VA 4A8QA 1RWUA 3FZBA 3RBEA 1CG2A 1HFEL 3PFEA 4NLQA 4QWBA 1BQMB 4BWMA 4QPXA 3I55S 1FJ7A 3SCKE 2UXCF 1IXKA 1DHMA 4IQMA 4ZCLA 2DRBA 3HHKA 2NQPA 5JUMA 3QGHA 5C24A 3OR2A 3N5BA 5KT2A 1DZ5A 4FF1A 2FJAB 2ZBIA 3BN4A 3CE8A 2F8MA 3BEGB 1Q16B 3KLGA 3UNGC 1M5VC 2MZJA 4NLYA 3MUTP 2OSQA 3VAIA 2RJZA 5KTQA 1YTYA 4ELVA 5I42A 2COLA 3DOLA 4XDDA 5J1PA 5J2MB 2BQ3A 2L9NA 4TU7A 2QFJA 2G1DA 3I9V9 4XDCA 1M5HA 2HWIA 2EBGA 1HBOB 4RNNA 3CJ3A 4DR3F 4K4VA 5D4LA 3IG1B 3N9UC 4MK9A 4ED0A 2BANB 3NMAA 3M2UB 4DQRA 3KHGA 1KQSR 4OFZA 4F4YA 4QWAA 5K8OA 4NYOA 2M2BA 1TL1B 1LV5A 4OJ1A 5AXLA 1FRHA 2GIRA 3K8WA 4ID8A 5GAGI 1KNZA 2W4PA 3GFZA 4ZPCA 5I4MA 5J2NB 4ZCIA 4HTIA 1JNRB 1HW9A 4CO0A 2HFOA 2ZE2A 4X84A 2JL9A 2V5HG 3GG1A 1K73T 2B4PA 2C2DA 1K1QA 2D74B 3FRZA 4Y34A 5FDLA 1HWKA 3JTOA 4J37A 4OI3A 2RB7A 2R2SA 1AFIA 4NMLA 1LW2A 1H2TZ 3FVYA 2V94A 3I96A 1WWHA 1FRJA 2NPFA 4C8YA 2J9DE 4G6VB 2MDAA 3MM7A 1KONA 1FVQA 3M6XA 3OL9A 4DLEA 4I4BA 1NB7A 2HRUA 3JB9k 3DDKA 3QGIA 3DGPA 3IS9A 4ECVA 3KHRA 2KT2A 4ZVHA 6FD1A 3I82A 1S1WA 2R7WA 4PRFA 1TV6B 2EK1A 5J1EB 3TUZC 5G0RB 1X8DA 4NLWA 1FKPB 2CQCA 2PN6A 4LF7F 3TANA 2VG6B 4O4GB 1WD6A 1N34F 2GMHA 3DLEB 3WDOA 5KT4A 2KG0A 2K2PA 3GQCA 3JSMA 3BQ2A 3L7OA 4BWJA 4PCQA 1DTQB 5A0YB 3TUJC 3NS5A 1WEZA 1SBRA 1A7GE 4PQUA 1S0NA 4NPOA 2DK2A 3K5OA 4NA2A 1ZTWA 2VOOA 2P5VA 2E1CA 2B0GA 2ZC4A 5IZHA 3GYXB 2GGPA 3IR6B 2R8HA 4DQIA 1XMBA 3JYTB 2OP5A 1XMQF 1N0VC 3PKYA 4O3QA 3DN9A 4ICLA 5LSOA 4IFVA 4NLPA 2AWZA 2Q1LA 4I7FB 4UQTA 3Q8SB 1C0UA 1OO0B 3TA0A 1NK5A 7FD1A 5K8NA 3H5YA 3MMJA 2HVIA 1HWJA 4O44A 4IG3A 4DR7F 2C42A 4F25A 4TN2A 4B3OB 4JV0A 2YX1A 4B17A 5J2PA 3EGNA 3J7YU 4ES3A 3TYTA 2XCPA 4JOUA 3V6KA 5D8HB 3GYNA 1FDDA 4N77A 1J5OB 3IAM9 1UVIA 4TU8A 3NNHA 3VCDA 4J9LA 4K0KF 2XS5A 4PPZA 5GMKa 5I3QA 2C22A 1IBMF 2EFQA 3T9NA 1E6VB 3R27A 1S1UB 1NK6A 2E1AA 2ZOGA 4Y2MA 4KV8A 2Z0GA 4ZHRA 3CDBA 2DGWA 2MKIA 3KK3A 1D0EA 3MOZA 2QV6A 4EZ6A 3DLEA 1RTHA 4Y28C 4ZS6A 4YDDB 3CCES 2RF2B 2OD6A 4C3LA 3V6DA 1FDBA 4A4JA 1TKZA 4OI2A 1L3UA 3HXMA 2G4BA 4ES1A 3MMBB 3HDSA 4V19X 4CH7A 3UCZP 4NCAA 3DRXA 1GXUA 2MZQA 1VQ7S 4NZ0A 3M8SA 3ISNC 3OJUA 2W9AA 4DUZF 2WHOA 4YB6A 3RAXA 3QWUA 2DGVA 4ZPBA 3M1VA 4KGKA 3SI8A 1YRXA 1YG0A 2JJ4D 4IOBA 1QAIA 3T1YF 4M95A 2Z8QA 1VQ5S 1U8SA 1YJTA 2M88A 3FMWA 1S1TA 4WYWA 1X0FA 4FBUA 5KG1A 3AQOA 3I0SB 1H0HB 4K4TA 2AF6A 2WBMA 1X4AA 1TL3A 1GT8A 3PDNA 5DS7A 2X1AA 1J5OA 3NLCA 3O5TB 3PJXA 1WF0A 2BA9A 1N33F 2FB0A 4ED2A 1X7VA 3EPGA 2ZUGA 2KYXA 1TKXB 1Z2LA 4FPRA 2XGQA 3EPIA 1OSCA 3G9CA 2XLKA 1X4CA 1C0UB 3F73A 5E0OA 4OLPA 2CZVC 3O44A 1WELA 3CDUA 1FCAA 4B9LA 2NREA 2OPQA 3UD4P 1RT1A 4MH8A 3NGKA 5E3AA 3IR7B 2DB1A 3H8YA 5IWAF 1WF2A 4IH6A 2LU1A 3I0SA 3J7YI 4DFMA 1HL6A 1WF1A 2MHNA 5DG8A 3I6PA 1N8RT 1H7XA 1Q86T 2JRSA 4PG7A 3TNVA 2DNOA 3NCRA 1JWWA 4F3OA 2DJWA 1FJGF 2FJVA 4U7UK 5LMNF 4Y65A 3BREA 1HBNA 3R5AA 1SJ1A 4FVMA 2R4FA 3OL7A 2Q66A 1G2EA 1Y7PA 2GJIA 1XNRF 5E3PA 1UFLA 2BACA 2FJEB 4AQYF 4OLOA 1GNKA 1WHWA 4YB7A 3MI7X 1VQPS 2MZ1A 3CCMS 5AE2A 4EYIB 5KT5A 3E2EA 1M5KC 4MK8A 1T05A 1UVMA 4PXBA 3OLAA 2B7BB 3MEGA 1M90T 1RT3B 1TP7A 4KHRA 2IBKA 1UWBA 3DDNA 2ZOFA 2ASDA 3ENQA 1VRTB 1KQGB 4A47A 2KTQA 2KXNB