4Z3DA

Human carbonyl reductase 1 with glutathione in a protective configuration
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
276
structure length
276
Chain Sequence
SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 104
structure length 276
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z3dA00
3WQRA 4IMRA 3P2YA 3NDRA 2D4AA 1UAGA 1YOVA 4CM9A 1P77A 1D1TA 4ND4A 5IXSA 2AHRA 2NU8A 4E33A 4IS2A 4U7WA 1EDOA 2VOJA 1DAPA 1SEVA 1HZJA 5F5NA 2DBVO 3DTTA 4L74A 3ZDFA 5L40A 1V3VA 5MGBA 4M86A 2J3JA 5CDTA 2UV8A 3FTPA 4KZPA 1S6YA 5JMPA 2WWRA 3GT0A 5JAMA 3DR3A 4CLRA 1BVRA 3JQ6A 2NWQA 1BMDA 3NGLA 1ID1A 1NPYA 1FDVA 2GNAA 4XIYA 5JDCA 1X15A 3MJTA 5KJEA 5TT0A 3DAFA 3LC7O 4TROA 5JE8A 4XRGA 4TVBA 4KP7A 4XGKA 3GMDA 2A9FA 2UUOA 3BMNB 4IS3A 4E5PA 4EBFA 4LSMA 3SVTA 2IXAA 1JKFA 1LDNA 4AJ1A 1F17A 4QQRA 3JQEA 3OF2A 3H6KA 4YYZA 1BHSA 1HLDA 1EEHA 3I9KA 4BNWA 4NBRA 3GAZA 3ZHXA 3L4BC 3EUWA 5KWEA 4FFLA 3NX4A 4WJZA 4EZBA 3VZQA 2J3IA 1UXGA 4R16A 1T2DA 4PGFA 3C85A 2GR9A 4I5DA 1J0XO 1YJ8A 3WB9A 1IPEA 4JJGA 2C0CA 2FN7A 3DMYA 1WAMA 3BMCA 3ITKA 4D7AA 1ZJYA 3ITDA 1UP7A 3EYWA 3PPIA 4BNIA 3ROQA 3KB6A 2C59A 2Y1EA 3JD3A 1D4FA 2O4CA 4WEOA 4URFA 1BGVA 4RVDA 2OL4A 4HBGA 3LU1A 2P5UA 4CM6A 2BFPA 2DTXA 4MVJI 4ALIA 1NQ5A 5AVOA 1U3TA 5I7VA 1ZCJA 7ADHA 2DT5A 4HFJA 3FD8A 3ZNOA 4WCFA 4B4UA 5BSGA 5A3VA 1PZEA 1X0XA 1P1KA 2VUTA 4NJMA 4J16A 3NKLA 5CG2A 1X14A 1M67A 1SCUA 3L4BA 4PCVA 5H81A 3DMTC 3QRWA 4Q3EA 3OJEA 1EBUA 5IN5A 3WYEA 3JQGA 4R3WA 2AQKA 1W6UA 3MJVA 2HK7A 2VRCA 3FR7A 2VT2A 2B4RO 1NQOA 1J4AA 1GY8A 1D3AA 4UEOA 1Y8QA 3VH2A 1T25A 4Y9DA 1DFIA 4KTTE 4II2A 2BGMA 1GAEO 4S1VA 5IN4A 4RJTA 1EK6A 2YV2A 3OM9A 3WQQA 3ZWYA 3L6DA 3AOGA 2PZLA 2NVWA 1A9ZA 2OOSA 2YV1A 1N5DA 1LDGA 3LT0A 1YONA 4KWHA 3ZV3A 2YJZA 4GPD1 3PHHA 4DVJA 1NFRA 2DTEA 4ZGWA 3E1KA 2H6EA 4KUHA 5CDUA 4DQXA 4UUOA 3R1IA 4WOKA 1GR0A 1O8CA 1AN9A 2G76A 1PGJA 3VTFA 1PJSA 3HFSA 3QVXA 1EE9A 1UXKA 4PG7A 1XELA 2QW8A 3PHIA 4U0KA 3V1YA 4OOEA 1LSJA 2JCXA 4W9NC 5HTOA 1MG5A 3GG9A 4JBIA 4QFCA 4RVUA 1F12A 2DPHA 4FFRA 1BG6A 3AWDA 1V0JA 1DXYA 3RAJA 2VNSA 1EVZA 3KLMX 5BSHA 2W8ZA 3IS3A 2NTJA 1K89A 4JCOA 3TNLA 2Y68A 4EEXA 4J1TA 3RUIA 4CUZA 3IUPA 2J8ZA 2YHIB 3RUCA 2WJPA 5JY6A 3ADOA 5L53A 3W6ZA 4OQYA 4L0QA 2E82A 5U9CA 4W7IA 3OJ0A 3ETDA 4J1SA 1PEDA 4INAA 3LF1A 4FFOA 3OHSX 4JJFA 5CG1A 1QXSA 5IZ4A 5T64A 1GCUA 4OXKA 3BMCB 3P2OA 1Y1PA 1TXGA 3QWAA 4OIMA 1U5CA 1HYGA 1H0KA 3S8MA 1UDBA 3NV9A 3SLKA 3IP3A 5A05A 1U2GA 2QYTA 1AUPA 3NUGA 3FTNA 4J2HA 4BO9A 1B3RA 5BT9A 1TI7A 1QYDA 2FY8A 2GD1O 4TZKA 5K9ZA 3ANLA 3W8EA 1X1EA 3E6AA 4ZD6A 6LDHA 4R5HA 3PQFA 1MB4A 4N18A 4RGBA 3RJ5A 1C1DB 1NPTO 4J4HA 4DPKA 3DBVO 3EC7A 3GVPA 1NFQA 2LDBA 1LSUA 3RJ9A 3KYDA 4FJ0A 1N7GA 2FRDA 4DLAA 1JKJA 1GEEA 1YXMA 2PLAA 2RH4A 2PK3A 4UVHA 4YJFA 1Z45A 2JKVA 1E3WA 5TIIA 3G1TA 2VCYA 4TMFA 1PGPA 3GVIA 5I7FA 4AJIA 2NU7A 2HKIA 1K5HA 3JQGB 4J1QA 2HCTA 3AM4A 1AHHA 3O4RA 2EV9A 3CTMA 2GDZA 4J9VA 5CPFA 3QWBA 3EVNA 4H15A 4HWKA 3K9QO 1W8DA 5A02A 1CDOA 1UJMA 3EY4A 1B15A 5GZ6A 3ZU3A 2ZCUA 2EWMA 4TZTA 3G49A 2ZB7A 2HMTA 5CHEA 4JP3A 1F06A 5CAEA 2IE0A 4A7PA 5CEEA 6ADHA 2Q2QA 4YT8A 3SC4A 1IB6A 4FSHA 1AHIA 1GFSA 1PJTA 2V65A 2VHXA 4IDCA 3D64A 4R54A 3TZ6A 3H3JA 3GN1A 2Y0EA 3SBOA 4B4VA 5T57A 3MJ4A 3MTGA 3ZU4A 4DMMA 4XQEA 4U0JA 1I8TA 4RCVA 3ZWNA 3ZV5A 2C7VA 1SPXA 4DRYA 1PZGA 1R66A 2DUUA 2X5OA 4I1IA 3RASA 4DYVA 1A5ZA 3PWKA 3PLNA 2JAPA 4TSKA 1PS9A 4UAGA 3QY9A 2YQ4A 3WMWA 2CVQA 5GY7A 1GZ3A 4NG5A 3Q11A 2ZIZA 2CDBA 2YQ5A 2YDXA 1J49A 3ULKA 5AXBA 3KLPX 1H2BA 3OETA 3ZH2A 3RBZA 1LSOA 4CLRB 1E3SA 3L77A 4YQZA 2C7GA 1Z6ZA 3ZCXA 4AJHA 1KC3A 2W2KB 3FHLA 4HY3A 2PD4A 3JQAB 4XGIA 3JYOA 5LC1A 2PKRA 2GRAA 3RC2A 1NX6A 4RL6A 3WGGA 1BVUA 1MGOA 2CFCA 2V6GA 4Q9NA 3QWHA 1YQDA 4BO7A 1HSOA 3PWZA 3UGKA 1FK8A 1KC1A 4BB6A 4YRBA 4BVAA 3STHA 1KBZA 3TWOA 1PTJA 4BNJA 4Z3DA 5CFZA 3AW9A 1UP4A 2PNFA 1FJHA 4CMBA 2DBQA 1LNQA 4K28A 3WICA 1U4OA 5HWSA 3GRPA 1ZK3A 4FPXA 3AFMA 4O5OA 4PG5A 2B37A 1YBAA 4J2OA 1E0DA 1EQUA 3KSDO 4EI2A 2Q1TA 1NAIA 1K6JA 2Q3EA 2YW9A 3PZBA 4H3VA 3AM3A 1VRWA 3V5NA 1PZHA 3QLJA 2JFGA 3GNTA 4FGSA 1KOLA 4IQGA 4A5OA 1LUAA 4ALMA 1Q0HA 4KOAA 2X5JO 4RPJA 4ALLA 4U6SA 1H6BA 3VPFA 1CEQA 1I2CA 3DZIA 3GZNA 3Q3CA 4E31A 3TRIA 2WYWA 2JFHA 2B4TO 4PVCA 2J5KA 4UVEA 4CMAA 1BTOA 4R1SA 5TLSA 1VJTA 2X9VA 4LVCA 1PGQA 1P3DA 5JAIA 1V9LA 2IYOA 2UAGA 2NACA 3WBFA 1G0OA 4MINA 2X4GA 3DO5A 2WYUA 5COAA 5JY1A 3QW2A 4KDFA 1EZ4A 4YAKA 1C0IA 4O6VA 2HO5A 3PHJA 1T4BA 2NLOA 5JCJA 4M55A 1E7SA 3HE3A 4MVJH 1JDJA 3G79A 2DUWA 2D5AA 5U1PA 2P2SA 1DEHA 5FFFA 3BHIA 4F6LA 1KETA 1A7AA 1GADO 1ADGA 2IEDA 4J7CA 2DC1A 1JWAB 1V3TA 3IJRA 4YJGB 4CPDA 1DAOA 2AEJA 3H9JA 4BB5A 3JQFA 2YFHA 3MWEB 1ENOA 2O48X 4Y6RA 5TC4A 4WCFC 1ORRA 1H5QA 3C24A 3OJLA 1F0YA 3X2FA 1WVGA 5I7SA 2X8LA 1VI2A 5DZSA 1N9GA 4IJVA 3HJAA 1PJ4A 4FJ2A 3E48A 4IBOA 4N7RA 5IAAA 3ZHZA 4IJUA 4TKMA 3GEMA 3DDNA 4W6ZA 1NVMB 1CIVA 2O7QA 3GDGA 2FHSA 2FZWA 3C7CB 3CPSA 1EFKA 3AOEA 5B4TA 4D79A 1MUUA 3FNFA 1LRKA 5COQA 3FNHA 4J0EA 4LMRA 4CMJA 3S2EA 1HE2A 1P1IA 2Z95A 2OZPA 1O5IA 4KWIA 3UFXA 5I9LA 4R3NA 2PGJA 3VZPA 3F1LA 1PJLA 4LN1A 1K2WA 2I6TA 3JQBA 3PJEA 1G1AA 2ZK7A 3RUEA 3G0OA 2TMGA 2HQ1A 1E5LA 3QV1A 2Z1MA 3CZMA 4JX8A 4H7PA 3F1KA 3AY3A 3CINA 1J5PA 4MIOA 4NR0A 1A4UA 5HBRA 3MOGA 1UZMA 1F8GA 1MC4A 5AXCA 5BNIA 2BF7A 4U6QA 3WWYA 1DFGA 1LU9A 4J9UE 4ZJUA 3DTYA 4A0SA 1MFPA 3HN2A 5G0UA 3OJOA 5JNLA 1FDUA 1N92A 2VYNA 1Z7EA 1BWSA 4Z9YA 3W1VA 2CZCA 2CVOA 4IIVA 2ILTA 3NGXA 3AY7A 1RM5A 2D5CA 2JD2A 2UVDA 2BHLA 2UUPA 2ZQZA 3JCZA 3N7UA 2QHXA 2VWPA 3VVCA 2VZ0A 4GL4A 4GI2A 4R69A 3ZWPA 2DQ4A 1HKUA 1YO6A 4W82A 1PL8A 4C7KA 3HQ4O 1A9YA 3QVTA 1WDKA 2E37A 1L7DA 3NT2A 4J1NA 3ZWXA 4BKRA 1HDRA 4YB8A 5K6AA 4XQGA 4HKTA 3VTZA 2HMWA 4RQTA 1CERA 3QIVA 3WSWA 5A06A 1HL3A 4XR4A 1ZSYA 1E7RA 3LZ6A 4JK3A 1BXKA 4XX0A 4PLTA 2AMFA 1IUKA 4ZICA 3W4KA 4OYRA 4XWYA 3TQHA 4HXYA 4NZ9A 3VDQA 1ZMOA 1QYXA 1QSGA 1R37A 3JQ8A 4R01A 4IJWA 3RC1A 4WGGA 1V8BA 4E5MA 2DTDA 5TT1A 2EGGA 2X1HA 1R16A 3PQEA 3WMXA 3GDFA 4HV4A 2FR0A 1ZXBA 5G0TA 4E0BA 4LCEA 3PGXA 3LK7A 3OQBA 1KY4A 4PLGA 1B8VA 1ZUD1 3JD2A 4BNGA 2LDXA 1E1NA 3BMOB 1T2FA 3KSUA 4E13A 4EDFA 2W2KA 4BMVA 4UVGA 3DBRA 3PLRA 3PHLA 4DPLA 1WWKA 5I8ZA 1LA2A 2JCYA 2W98A 5FF9A 5TGDA 2SCUA 1EVIA 1ZMTA 3DBHA 5KVCA 3KZVA 1R0SA 3BTVA 3R3JA 3VAZA 4BNUA 2UDPA 4XEHA 4JQCA 3U4HA 4E2WA 4CMEC 2QRKA 3WYBA 1IZ9A 3H9GA 4EJ0A 1O95A 4XIJA 2IXBA 2PA3A 2X9GA 3GFGA 3PJGA 4ND5A 4OGWA 2FPGA 1HXHA 3PYLA 4CLHA 1T26A 1MXHA 3O03A 5L45A 4IM7A 1GU7A 1LC0A 1AXEA 1YB4A 2I9PA 3KYDB 2J3HA 4R4JA 1YWGO 2EKPA 2GN9A 2B83A 3O9ZA 3T7EA 4BMNA 3HDQA 2RIRA 5AXAA 1C0PA 1QMGA 3H4VA 3FWNA 3K96A 2BELA 2OFPA 3K2BA 3NAQA 2IRWA 4AJNA 4A26A 1I2ZA 8LDHA 1E7WA 1HDCA 1VSUA 2NU6A 5I8WA 3D5QA 4OJNA 1FXSA 1ADFA 3DAGA 2FMUA 2GPTA 4QTZA 1P44A 2C5AA 4ZQFA 3KXDA 4GGPA 3DXFA 3BXXA 1ARZA 4WECA 3HDJA 3RUFA 4TRJA 4N5NA 3UCEA 4CMIB 3INTA 4I5FA 3I83A 1C3VA 5A5EA 5KJFA 1C1XB 1SO8A 1CYDA 1H6CA 2JHFA 1Y5MA 2B69A 4J6FA 3IDSA 4BIIA 2EW8A 3EZLA 4MVJE 4K6CA 3FCOA 3EMKA 5H83A 2HJRA 4MIYA 4UVDA 3QWFA 1NR7A 5DOVA 4MVJM 1HWYA 1PWZA 1GD1O 4L8VA 3S1LA 1Z82A 2O3TA 1I24A 4ESOA 1EVYA 1SNYA 1WW8A 1I32A 3WFJA 3WYCA 4YACA 3NYWA 2NVUB 3N74A 2QRLA 1P1HA 5ENDA 4M1QA 1GYQA 3GZNB 3PFFA 4CL3A 9LDBA 3Q1LA 3PIIA 1ZO8A 3IIEA 5EJ2A 1YJQA 1L1FA 1XEAA 3QVWA 4CQMD 1W73A 4MVJG 4R9RA 4WLVA 2OHXA 1E1MA 3DEYX 1BW9A 1QV7A 1YKFA 4CMCA 4I8XA 4OQZA 3JQ8B 5IZCA 1EE2A 1A4IA 5JW6A 3WIDA 3H5RA 1OAAA 3VPGA 4BO2A 4XGNA 3A4VA 2RHRA 2UYYA 4Y98A 1AE1A 4DYDA 1NNUA 2FZEA 3HN7A 3VKUA 4AL4A 3NRCA 5L51A 2NQTA 3WG9A 4CMIA 5JFOA 4IDAA 1V3UA 1MA0A 2HMSA 2GERA 3KYBA 3TZQA 3KM0A 3DZFA 3GGPA 4ZQEA 1P74A 3AI3A 5G4KB 2VTEA 3F5SA 1D8AA 3A1NA 3ZW8A 5HS6A 3ZHBA 1B7GO 3F6YA 3V2HA 5BNTA 1NP3A 4PRLA 4QSMA 1U8XX 4NBWA 2ZB3A 2P4QA 3UCFA 3BTUA 4CMGA 5A03A 4YAEA 3GUYA 4HFNA 5C7OO 1HYEA 1E7YA 2EP5A 3B1FA 3ZNQA 4EUEA 1M6WA 4NPCA 4WNCA 3HDYA 4IDBA 3LC2O 3U9LA 2AG8A 4HNHA 4XDYA 1QLJA 5CEFA 1PJ2A 3ICCA 4OKNA 1GUZA 3HDHA 5G0WA 4IINA 2VRCD 4CQMB 1WZEA 1XWFA 3IKVA 4CV0A 2GSDA 1LDYA 3E5RA 4Z0HO 5EESA 4CLDA 1YB1A 5JAZA 2D2IA 4E2XA 5CEJA 3OA0A 3RUDA 4YA6A 2RCYA 1GL3A 1P1JA 3PWSA 4EJ6A 4FC6A 4J90A 3NDJA 4ZHSA 2I65A 3GPIA 3AI2A 2QZ9A 1T24A 3VH4A 5EINA 3U3XA 3GDOA 3M6IA 1HF3A 2QYSA 1FDSA 3OIFA 4YT5A 4UVIA 4NJMB 4IXWA 1EQ2A 3HUDA 4OXYA 4CR6A 3D3EA 1LQUA 5EQDA 2ZATA 3H9QA 2WE7A 1P33A 1YS4A 3CZRA 3GEGA 4CMKA 4RF4A 4NI5A 2R2GA 1ZK2A 4WLOA 5FEUA 2QQ5A 1ZXLA 1WLYA 3LYLA 1E6WA 1SOVA 1EVJA 2NU9A 1UDCA 4CM4A 4WLFA 5IF3A 3VH3A 3U0BA 3INGA 4W4TA 2Q2WA 3LT2A 3S2FA 3WTCA 3I3OA 4YAJA 3Q9UA 1R0KA 3R0IA 3FPCA 4I08A 1BW9B 4CLOB 4RF3A 3U5TA 4RORA 4PZCA 4AG3A 2EIHA 1ZK1A 1NWCA 3D7LA 1NTOA 2EERA 4BNTA 1R15A 3I9LA 3RBXA 1EFLA 1U3WA 1UZLA 5U4QA 5C7IO 4YXFA 5JDIA 3DOCA 4JJIA 3QVSA 3KBOA 2PGLA 4J7UA 3B6ZA 3NEPX 1PJQA 1JQBA 4GBJA 3JYQA 3D4OA 3ASVA 3Q9NA 2HMVA 4FQ8A 3GA0A 4FOSA 2FPPA 1BXGA 2EHDA 1D7OA 2VTDA 3ASUA 3U4IA 4DIOA 4FBGA 1B0AA 3L6OO 1P9LA 3PK0A 4IJKA 2FSVA 1ISMA 3G1UA 2IZ1A 2D0IA 4ZRMA 3ONDA 4Q3AA 1BSVA 1P1RA 3OEWA 4CJXA 3PXXA 4CL8A 3I9OA 3KTDA 2G0TA 3ETEA 4N54A 3HFGA 5AYVA 3EK2A 2Y1OA 1I0ZA 4I5GA 4XYBA 1X0VA 1GUYA 4F45A 3VVBA 2EEZA 3JQBC 3I9MA 1E5QA 2OUIA 3DBHB 4HFRA 4MJLA 4FGWA 3C1AA 2EGHA 1VL8A 5A04A 3U49A 2CDAA 1NM5A 4JROA 1LLDA 1C14A 4M87A 4WEQA 1NYTA 1WDLA 2Y99A 4XA8A 2WD7A 3I1JA 1UAYA 3AUUA 4ONEA 3T4EA 3DOJA 4ZQBA 3FBGA 4UREA 4PFJA 3WQSB 1OC4A 1PGNA 2IZZA 1FF9A 2X22A 1MV8A 4AJJA 1FDWA 3K73O 1IULA 3EW7A 1VPDA 3GUCA 1SAYA 3TPCA 3GFBA 1EMDA 4E12A 3CMMA 2D59A 1DLJA 4BGUA 3IQDB 2VN8A 3OA2A 4M49A 1X1TA 2D3TA 2AE1A 1O0SA 3CEAA 4DTIA 5TX7A 4HADA 4UEJA 1EUCA 3DZBA 1DC3A 3E03A 3E9QA 2G1UA 4CR8A 5JBIA 5KVVA 2Y05A 1F8FA 3F5QA 3EZYA 4R41A 4EYEA 3DBRB 5K6AC 2VZ9A 1JWBB 1PZFA 4L75A 1GQ2A 1YBVA 2AEFA 2QG4A 4RVGA 1EK5A 2POQX 1X13A 5TNXA 1YQGA 1E3IA 5IJZA 3BMOA 3T4XA 5KTKA 1ZFNA 2WDZA 4MVJF 1MG0A 4CM4B 3E5MA 1T1SA 1DIBA 4JP2A 5DBFA 1OBFO 2YZ7A 2BH9A 3MJEA 1Y6JA 4RDHA 3RCBA 1GUFA 2WD7B 3O26A 3FR8A 2Y66A 3A06A 5L7WA 2GGSA 3WJ7A 4DC1A 3QQPA 1S7CA 4YCAA 3CSDA 3BYZA 3HSKA 4B3IA 5T67A 3V2UA 1ULUA 4BGIA 3KYCB 1KEUA 4IMPA 4AJLA 1QRRA 1G6KA 4L4RA 3I4FA 1DLIA 5GZ3A 4DQVA 1AXGA 2D8AA 3E8XA 2ZTMA 4XD2A 4D41A 1YQXA 3S2GA 4AJ2A 1N8KA 2X7HA 2YV3A 4B8ZA 2XF8A 5ITWA 4RO0A 3WXBA 3H5NA 5DCWA 2GO1A 4RV9A 1KYQA 4GMGA 5A9RA 4WLEA 2JD0A 1ZSNA 2Y67A 2VUSA 4GAEA 2OP0A 3ENKA 4KMSA 2JFFA 3PJFA 4NIMA 1HYHA 2BD0A 1WMBA 4D3SA 1N1GA 4DREA 3QHAA 4MVJP 4ZRNA 5DCYA 1A72A 3JD1A 5BNFA 3ZWMA 1O9BA 2VYVA 3PDJA 3WBBA 1Z75A 3BZUA 4E6PA 3RU9A 4GWKA 1BDMA 1U2DA 2YY7A 4RZHA 5KJ1A 3DHNA 3OIGA 4DBZA 5BQFA 1NQTA 1ZK0A 1U9JA 2AW5A 2C54A 1HEUA 3ZV4A 3DONA 2E6UX 3BAZA 4GX0A 2OGUA 3GVCA 4JN6B 4WPGA 5B37A 3F9IA 3UUWA 4DLBA 4W9NA 4AJPA 3D3WA 3INRA 3NJ4A 4WK6A 5KJ6A 2I3GA 1XCBA 3PGJA 4FS3A 4D44A 2V7PA 1H93A 4FFPA 3TZHA 4D42A 3PIDA 1KVTA 2X5KO 3N58A 1VJ0A 4QECA 4RF2A 5L4NA 3WFIA 4D43A 5TQVA 4IZHA 2AQIA 4OSPA 3GHHA 5IXYA 3PJDA 2BGLA 3T7CA 1CETA 4GLLA 1QLHA 4AJKA 4IDGA 2W90A 5FYDA 2ZJ0A 1LDEA 3CE6A 3TFOA 3RROA 4DC0A 4YVFA 3B70A 4Z9XA 4XR9A 3DFUA 3WDSA 1E92A 1GV0A 1K6XA 4FR5A 1ADCA 4QO8A 1QP8A 2ZYDA 3M2PA 5TRTA 3V1UA 3KO8A 1X7HA 1P45A 3LLSA 2IZ0A 1QR6A 2NSDA 3SX2A 3K2EA 3OJFA 3ON5A 4DQUA 5KJCA 4WNIA 3S2IA 3D4NA 1HSZA 2XPCA 3RBVA 4GVLA 2W4QA 1UR5A 4L4XA 4O63O 5IDQA 1XIVA 4J4BA 1B8PA 4ZA2A 1NAHA 1I30A 3L9WA 4ZU3A 3WJAA 4R1UA 1JTVA 5B1YA 3C8MA 4CUJA 5L7TA 5MDHA 1JAXA 3VPHA 4E30A 1H9BA 4Z3KA 3JQCA 5A1TA 1ZKMA 5IDWA 3CXRA 4GSLA 5I9MA 3B1JA 2VWGA 3PRJA 4E5YA 4FC7A 4Q39A 3UCXA 5JXWA 1E3WB 1E7QA 3BMNA 1U7HA 4O0LA 2OXIA 3ZWOA 5CDYA 4FB5A 1GYRA 1HE3A 1VKNA 3AM5A 1DDOA 4IIUA 4BGEA 3R3SA 1PX0A 1QYWA 3ENNA 4D3DA 3W8FA 1U3UA 4NFSA 1UZNA 4B7XA 5I9NA 3TSCA 3OP4A 1U5AA 1WMAA 2ZTUA 3LVFO 1GEGA 2JHGA 3WIEA 3JQAA 4EUFA 4GQAA 2Y93A 4PLCA 4J4TA 3JYNA 3AU8A 5JMWA 3DHEA 3SJ7A 3UOGA 3FWZA 2AE2A 2I3AA 1GQQA 4TRMA 1GZ6A 2DBZA 2GN8A 1OFGA 5CP8A 4Y8VA 3VPXA 4CM3A 5BR7A 1RPNA 4GKBA 4AJEA 3VPSA 3W4IA 4NBTA 4FW8A 2RH8A 3TN7A 4LVUA 3FSRA 1DO8A 2QZZA 1T2EA 1GPJA 2ZB8A 4JNKA 2TMDA 4EJMA 4NBVA 4EW6A 2P91A 3ABIA 3L07A 3OSUA 2V6BA 3ZWAA 4UULA 2FOIA 5F1PA 1HLPA 3L6EA 3JD0A 4CMHA 4CM8B 1KVSA 1P31A 5JAQA 3OIDA 1IL0A 1E3LA 4IUYA 4P4GA 3UH1A 2C5EA 4PN3A 4TRRA 4BNLA 2VNAA 4XRRA 1LRLA 3WGHA 3FPLA 3EVTA 2JCVA 4XCVA 3WWZA 3EHEA 4R51A 3P5SA 2O4UX 4KDEA 5DBGA 3ZNPA 1L7EA 3VHRA 3JYPA 1WNTA 1NASA 1EUDA 4ID9A 1A7KA 1EUZA 5A3JA 2RAFA 4Z0TA 3D3WB 2O50A 3LDHA 1RM4A 1NBOA 3GR6A 4EITA 4YJHA 4NQZA 2Q45A 5AQ1A 4RZIA 5EPOA 1VL6A 3GAFA 1KVQA 1LJ8A 1OMOA 4L4SA 3U09A 2X0RA 2DVMA 2A35A 3ZWWA 1M6HA 5IG2A 2C07A 3CMCO 1KY5A 2IDZA 3ANNA 2J3KA 4IZIA 3WX0A 2PD6A 3ZWCA 3LLVA 3PZRA 4BGVA 4YEDA 1JVBA 4B7UA 3U62A 4RDIA 3MJCA 1XLTA 2P9GA 4RVFA 4W7HA 4B7CA 1DOHA 4WKGA 2DAPA 1IHYA 3ZWVA 1R4MA 4BO1A 1N1EA 3ZU2A 1H6DA 1QV6A 3G3EA 5TJ9A 4B3HA 4A10A 4D46A 1O94A 3LF2A 5THQA 1B26A 2Q2VA 1VM6A 2BRUA 2X9NA 4LSWA 1PU2A 3HG7A 2OO5A 4H16A 1CRWG 1LSSA 2B5VA 2BI8A 1XGKA 4RPGA 2Y1CA 1KVUA 4BS9A 2J5RA 3UVEA 1YH3A 5F21A 1LI4A 1ZEMA 4ZVVA 4U5QA 4NK5A 2HJSA 3V2GA 5BSFA 4LISA 3FNEA 5FI5A 4NMHA 3ETGA 4MIEA 3GN2A 4PLYA 4C7JA 4CM5A 2EG9A 4D0RA 3DHYA 5DULA 4BNYA 1HDZA 4NDNE 1ONOA 2HDHA 4YJFB 4DIBA 5C7LO 4I9UA 1BRMA 4R9SA 4XYGA 4CM9D 1IYZA 4PLFA 5THKA 4DIFA 4R68A 4JBGA 2J5QA 4HP8A 5KNLA 4LMPA 1GDHA 3F4LA 4BHTA 4XZ3A 1DIGA 1I33A 2I99A 2QIOA 5T8KA 5ADHA 4ALNA 3KUXA 3GVHA 3Q2IA 4N5LA 3ZGYA 2YUTA 3DQPA 1HE4A 1SB9A 1I3LA 1YOVB 4G81A 1D1SA 1DC4A 4RVHA 4Y6SA 1H2HA 1X7DA 4F6CA 4R5MA 1SEPA 3QE3A 5JCXA 3DBLB 4BO0A 3ST7A 5ER6A 1ZK4A 3ROMA 3K92A 4QT0A 1I36A 1B8UA 1ML3A 4E4YA 3JQ7B 4ALJA 2VQ3A 1Y8QB 3TZCA 3RQSA 2NVBA 1ENYA 5IDYA 4QFDA 3GPDG 3MJSA 5KOIA 8ADHA 4A27A 4HFMA 2C2XA 1XU7A 1HT0A 2R00A 2XOXA 4HUJA 1I3NA 1ISFA 4MP3A 3TOXA 4BO3A 3KYCA 4Q3DA 1YVEI 4R1NA 3TOZA 4PG8A 2GCGA 1E7MA 4Q3BA 2PZKA 4HNGA 3ONFA 2ZB4A 4EEZA 4N5MA 4E21A 4DLLA 4E5KA 2FSSA 3FN4A 4NH4A 3AFNA 7MDHA 5TS3A 5F1OA 2HU2A 1B14A 2GN4A 2QRJA 3GH3A 1Q7CA 4RPHA 4B3JA 2I76A 3DMTA 5T6BA 4Z9FA 5DBIA 1UXHA 5KCZA 1AGNA 2PKQO 3U4DA 3PI7A 1XU9A 1Z7BA 4J7XA 3RKUA 3GF4A 3SC6A 4FCCA 1M76A 1Q0QA 2X0IA 1ZZEA 4WASA 3OH8A 9LDTA 5L4SA 1MX3A 3X2EA 2X23A 2EJVA 2AXQA 4G5HA 1E6UA 4IY1A 4CM7A 4BNZA 1A27A 5DN9A 3E9MA 1KERA 2DM6A 2GN6A 3JQ7A 4NK4A 3RWBA 3ZWBA 1XSEA 3PFWO 4CMEA 1ZH8A 3KOUA 1ADBA 4ZN6A 1XYGA 4QUKA 4IQ0A 4GMFA 2JD1A 2EXXA 2XXJA 2C2YA 5L7YA 4GVXA 4ALKA 3G17A 4UUMA 3ZNNA 2G5CA 1DJQA 1XKQA 4M8SA 3TZKA 5A9SB 2EF1A 1NXQA 3O8QB 1DRUA 4MVJA 1Q0LA 3OQ6A 5JC1A 4GWGA 1E77A 4PLWA 2X0NA 3TJRA 1ZBQA 2NQ8A 4O1MA 3GG2A 5ENVA 3BMQB 1MC5A 3OEYA 3H2ZA 4OKIA 1SC6A 2PZJA 4IQ8A 1IHXA 3V8BA 4YR9A 1R4NB 4BQPA 2BFAA 1BDBA 3GRKA 3QJ5A 3VZRA 1GV1A 3OMLA 4J43A 1VKOA 4WCFB 4LRTB 3I23A 2JL1A 1Z73A 2ZTLA 1ZIDA 3GNQA 4WE3A 1NWHA 1PL6A 4J91A 5JYEA 4K6FA 4J49A 1YDWA 3KETA 4E2ZA 3HWRA 5GMOA 2O23A 4MKZA 5JO0A 3BHJA 5BSEA 1QG6A 5JYDA 4PIVA 4WOJA 3IAHA 1Q7BA 3PHGA 1ONNA 1CWUA 3H3FA 2GASA 3RSHA 3FRJA 5H82A 4JXKA 4ND3A 2P4HX 2RBEA 4Y67A 4G65A 2JJYA 2WEKA 4BKOA 1F14A 1K3TA 3HB5X 2HMUA 1ISHA 4GX1A 3ROKA 2O3RA 1LEHA 5FI3A 4PZDA 1XG5A 1I10A 5TJHA 3CH6A 2HK9A 4MDHA 1NPDA 4BO8A 3PP8A 5LCXA 4YT4A 1U1IA 3WNVA 3OECA 1RYEA 2HAEA 5B4UA 3VH1A 2WYVA 4K1LA 4XB1A 4RPLA 4BO4A 3PVZA 1LC3A 1KEWA 4ND2A 2H1SA 5EQFA 4P4NA 3DZJA 4CODB 4LW8A 5DF1A 3RFVA 3UF0A 4Z6KA 3K8ZA 4IDFA 1VJ1A 2HSDA 4UUPA 3WGYA 4AJ4A 2YFQA 4D45A 1B2LA 1ENPA 2P9EA 4XB2A 4B4OA 2ZYGA 1X7GA 5C3MA 3DB2A 2B35A 3SLGA 2O2YA 2G82A 3W6UA 4MP8A 1CF2O 3GEDA 3WS7A 1XQ1A 4NU6A 2IODA 1UP6A 3KSZO 3TL3A 4YT2A 2EP7A 4GKVA 1GZ4A 2ZTVA 3ZW9A 4BKUA 4Q3CA 4K9DA 4KQWA 5CPBA 3ZHYA 4PLZA 3MCVA 5AOVA 1VSVA 1I3MA 5ES3A 1KIFA 2W2LD 5G4LA 1TB4A 1ZNQO 4RQUA 4PG4A 3SXPA 4YJDA 1LLUA 1QYCA 2O3UA 3BTOA 1LLQA 4L76A 4MP6A 5TSDA 4A73A 4DPMA 1W0CA 2HLPA 5JSFA 2O7SA 4X54A 1LTHR 1H94A 4MVJD 4TKLA 4EGFA 2WE8A 1VL0A 4W99A 4DUPA 1DHRA 2BFMA 4BKPA 1QKIA 4NJOA 4CQMA 3UHAA 2I66A 3O8QA 4K26A 2WTBA 5JDIC 1ZEJA 5ILGA 3GGOA 2Y0CA 3HB4X 3I5MA 1NVTA 1YL7A 1U4SA 1DIHA 1N2SA 2GUGA 4Z0PA 3U4CA 5CDSA 5HS4A 1DC6A 4JBHA 1GYPA 3SJUA 1TA4A 1IE3A 1ZVMA 3MWDB 3IL2A 3IC5A 3I9NA 3IOYA 1SMKA 5EERA 5ICSA 4KQXA 3D4PA 1MP0A 4FIZA 1JVSA 3FF4A 3GQVA 1DIRA 2ZCVA 3UXYA 1YB5A 1M75A 4NU5A 3B20A 4MKRA 4MOWA 3BHMA 4XYEA 2PKQP 1UXJA 1Y81A 1UUFA 3RUAA 4BO6A 4ZQHA 1U8FO 5EL0A 4CV1A 5EMHA 4YPOA 1I5RA 4FOOA 4JGBA 3WSVA 3RC7A 1DC5A 4YAIA 4RLSA 2JAHA 1OZAA 1KEVA 3HZZA 4DBVO 2O3SA 2O3JA 3NTOA 3PQDA 4AJOA 4IXTA 3RD5A 4CLEA 5DP1A 1VC2A 2Z1NA 4NFYA 4NBUA 2YYYA 3RI3A 3V1TC 3WLFA 4BUCA 1U28A 4CLOA 5FWNA 2HRBA 2B36A 3NDIA 1YRLA 3JQAD 4FFMA 1XA0A 4A2CA 3M2TA 3JQFC 3WGQA 5A4DA 3I6IA 5G4KA 1DJNA 1JW9B 4OSOA 4YTEA 2DFDA 3RUHA 3H2SA 4O59O 2VOEA 2D1YA 4FJ1A 1DRVA 5T5QA 1XDWA 1SBYA 3ZU5A 3NTRA 4DMLA 5B12A 4I9HA 4JLWA 1BXGB 2Q1SA 3DBLA 1DBVO 2VUUA 3Q0EA 2CNBA 1MLDA 2P68A 2E4AA 2CF5A 2Q50A 4OHUA 1TVEA 3HADA 5EN4A 1DPGA 3H5AA 3OFSA 1XHLA 2H9IA 2EKQA 5JLAA 2BKAA 4IDDA 1HDOA 2VRBA 2P5YA 4II3A 4OL9A 4KTVE 1JA9A 5DDIP 1PL7A 2H63A 3C1OA 3QA9A 4OM8A 3R6DA 3RKRA 2VHWA 3QP9A 1E3JA 3E82A 2WMDA 4ZQGA 2X0JA 2CF6A 2Q1UA 4OOFA 4I9NA 4WLUA 1VLLA 2DPGA 3D0OA 2ZQYA 3LT1A 1PSDA 3C1TA 2E48A 4BKQA 3GK3A 3ZV6A 2V6FA 2XXBA 3LQFA 3S55A 4GSKA 2X86A 1NQAO 1T4DA 4GH5A 4M54A 2R00C 4PLHA 5JPIA 4PG6A 3KHUA 1IY8A 3DFZA 1TT7A 2GLXA 1TLTA 1KEPA 2OBNA 2PH5A 2A94A 3P7MA 3O38A 3ROPA 4BNMA 1HTBA 1DHTA 3TL2A 4CLXA 2F00A 1PS0A 3DZKA 4E2YA 3P19A 4WCDA 3OQ1A 1VE9A 3KV3O 3GMSA 4CQLB 4PVDA 2EKLA 2VHYA 1R4NA 4E32A 3CKYA 3DZHA 4XYLA 2FPIA 4BV8A 4PLPA 1V6AA 4AICA 4KUEA 1RM3A 1E6EA 2X58A 5DOZA 3AOEC 3RFXA 3PEFA 4D0SA 3NT4A 5DCUA 3WNQA 4BMSA 2BMAA 2I67A 3F3SA 3GOHA 3MZ0A 1LLCA 3ZZNA 5JCJD 5DP2A 2FR1A 1CQIA 1RKXA 1ULSA 5F5LA 1TT5A 2C82A 1R12A 4CM8A 1BXZA 1WXDA 5I7EA 1PQWA 2A92A 3QVOA 4XDZA 2B4QA 4IGEA 4PRKA 1HZZA 1Y5RA 3E9NA 1JN0A 3EDMA 2PV7A 2NV6A 3QSGA 3DOOA 3UAGA 1FMCA 2WM3A 1Y8RA 5KKAA 4CV2A 1MFZA 1GCOA 2VYND 4LK3A 4P38A 5HM8A 1I2BA 3GZ4A 1LDBA 1G0NA 4CM1A 1EDZA 4F46A 2VYVD 1PJ3A 1OC2A 1NVGA 2ZJ1A 2NNLD 3ZI0A 4OH1A 3TF5A 3H9UA 5DNAA 1C1XA 3KVOA 1M66A 4XYMA 1A71A 4ILKA 3F47A 1P1FA 3VZSA 3KRTA 1U3VA 3EGOA 1ZJZA 3GHYA 4P4LA 3RC9A 1Q2XA 3JD4A 2YHIA 2CUKA 3D5TA 3I52A 4QEDA 2Q46A 1PIWA 4C4OA 3L4SO 1WP4A 2AA3A 2BGKA 2I5PO 5T8KC 4XJSA 3WOHA 2AEMA 3COSA 2ZKLA 4IPTA 2A4KA 3H7AA 5KVSA 1LBEA 1T1RA 1NFFA 1ISIA 2GZ2A 3CIFA 1I3KA 3IUSA 4TRNA 4CUKA 4YBZA 3UW3A 5A9SA 5KKCA 1NHGA 1EBFA 2NTVA 5F3RA 1PS8A 1IOLA 2VWQA 4AFNA 3RIHA 1ZSVA 1T2AA 3FBTA 4IDEA 3DC2A 5LDGA 2DKNA 4D3FA 1I01A 1YBMA 3A28A 2PR2A 3NTQA 1UXIA 2Q4EA 2NM0A 1RWBA 1HRDA 5C37A 2V6MA 1YGYA 4F3YA 3AUAA 4BNHA 2C29D 2OMEA 3TFQA 3PYMA 1PR3A 2WD8A 3ORFA 1DB3A 3AI1A 4M89A 1W4ZA 4BL5A 2AG5A 4LRSB 2OBYA 3IJPA 2PH3A 1JAYA 2PFGA 1Y8RB 3WGTA 1YE3A 3BA1A 1ONPA 4NFHA 3K6JA 1HETA 3I4CA 4J3FA 4XJTA 5JO9A 4BNNA 2W2LA 3SEFA 1LX6A 2RHCA 3WGZA 4LGVA 1SZJG 3BIOA 4GLOA 5JC8A 2BFOA 5ER9A 3TDKA 1T2CA 2VHZA 1U7TA 1M2WA 2IEBA 3KEOA 3HNPA 3Q2KA 3MTJA 4BV9A 2NTNA 3F4BA 3GY0A 2AQHA 5J23A 1JLLA 5ITVA 1HDXA 2AQ8A 5G0VA 4OO3A 2PZMA 2Q4BA 1P0CA 3MOIA 2PGDA 3ONEA 1KVRA 4OAQA 3WR5A 2DLDA 4FFNA 4PLVA 2EW2A 3VC7A 3K5PA 1WDMA 4DXHA 1NHWA 1LXCA 2H5LA 1H9AA 2FP4A 1O89A 3HHPA 3JV7A 3GVXA 3AJRA 1E1LA 2OP1A 1Q1NA 2Y0DA 3C7DB 3GNSA 1QORA 2VZ8A 3KEQA 5L95A 3K30A 5KVQA 2Y1GA 4ROSA 3RFTA 4BOYA 4BNFA 3DL2A 2OORA 3AUSA 3M1AA 3L9XA 1P0FA 4YWJA 3OBBA 4EUHA 3IMFA 1CQJA 4E3ZA 4L73A 1K0UA 4P22A 3JQDA 4L9RA 1Y7TA 4BNVA 2CDCA 3LC1O 5L9AA 3GGGA 1ENZA 3UICA 4ND1A 5C5IA 1PQUA 4B8WA 2B0JA 2EJWA 2P9CA 4S3MA 3LT4A 4OMUA 1YL6A 3F46A 1RJWA 1JU9A 4QO7A 5IZCC 3D1LA 5A9TA 5COBA 1GQYA 1J6UA 4Y6PA 4A03A 3WTBA 1YDEA 3IKTA 1Y9EA 3FNGA 1IPFA 1HE5A 2QX7A 4WLNA 4DA9A 1V35A 3OICA 2HUNA 3NJ8A 2BLLA 1Y9AA 3VOSA 2O3QA 3JYLA 3GC6A 4YAGA 2VWHA 3RU7A 3I6QA 3L0DA 3JQ9C 4CV3A 1E3EA 1FDTA 1N9GB 2HRZA 4FDAA 3WGOA 2Q49A 1C0KA 2X6TA 3I9JA 2XAAA 1Z74A 4TVOA 5TF4A 1ZW1A 3JTMA 1CJCA 3QWIA 4BNXA 2CSUA 3CUKA 5G0SA 1JKIA 1QYVA 3UN1A 3Q6IA 4PZEA 4QX6A 2PWZA 4GX2A 2WSBA 4WUVA 3NT5A 5CDGA 3JSAA 5L3ZA 5IDXA 3GLQA 1GPDG 4BNKA 1R6DA 4MKXA 2PTGA 1LQTA 3A9WA 3PYXA 5DT9A 4XKJA 5K0ZA 3WLEA 2PY6A 1YL5A 1O6ZA 3E18A 2CD9A 1UDAA 4KUGA 4MO2A 5KIAA 1DRWA 2GYYA 4GX5A 1H6AA 2BI7A 3VKVA 3WGIA 1WPQA 4CR7A 5HA5A 2GZ3A 1C0LA 2NUAA 4LCJA 5GZ1A 3PDUA 1OI7A 1HDYA 1UH5A 3C7AA 2VT3A 1SB8A 3ADPA 3K31A 2YHUA 4TQGA 1HDGO 5F1KA 5B4VA 4DWVA 5HRUA 2B5WA 3ANMA 1PWXA 4GGOA 2HK8A 1RYDA 1TT5B 3B1KA 3H9EO 2NVUA 3FI9A 4R1TA 4XQCA 1KS9A 3AU9A 4DGSA 2R6JA 3A14A 3C3XA 2J6IA 1R0LA 1LRJA 3AK4A 1ISGA 3DZGA 4FD3A 4RVSA 4UEKA 4BQRA 2FWMX 2Y1FA 3JQ9A 1LDMA 4Q3NA 1DSSG 3IP1A 4YJGA 3W4JA 1ISJA 4JIGA 5JS6A 1RM0A 4OXNA 1DFHA 2PD3A 3AUTA 2DU8A 1PR9A 3BTSA 4YJHB 2VHVA 1NR1A 2Q99A 2CVZA 3M1LA 2O2SA 4CQLA 4G2NA 2DBRA 1GTMA 2CY0A 3PTZA 4MPDA 3VDRA 3LSYA 5ILOA 1PJCA 1WZIA 5A5FA 2Z5LA 2Q1WA 4P8RA 1SOWA 3BMQA 3AY6A 3ZN2A 4NHEA 4YRAA 4TWRA 4ITUA 1XR3A 4J0FA 1PGOA 3H65A 3ICPA 4BO5A 2GF2A 4U8GA 4AVYA 5L4LA 5EIOA 1PQPA 2NADA 2YDYA 4YDRA 1N7HA 3DAPA 4RF5A 3EAGA 4RPKA 1IZ0A 4NNJA 1Q7GA 2Y1DA 5JDCC 4YQYA 2GZ1A 4B4WA 4DL9A 1MXFA 4E5NA 1R4MB 1OOEA 1TEHA 2ET6A 3DWFA 4RLHA 3W8DA 1K6IA 2E49A 4HX5A 4IGFA 4QXMA 4FN4A 4YRDA 3RVDA 2C20A 3MEQA 1C1DA 2ZYAA 4I5EA 5IFLA 4B79A 1E1KA 5LDHA 1PJBA 2CMDA 3UKOA 1DIAA 4XQ9A 1B16A 2IYPA 2F1KA 4UUNA 5ICMA 1XQ6A 5AXDA 1B3BA 3H8VA 2FR8A 2DFVA 5G2OA 2G17A
chains in the Genus database with same CATH superfamily
3PJRA 3UK1A 1ODFA 3DFKA 2QUAA 1TNDA 4QBTA 4U2FA 3OQVA 3H9CA 5D7BA 2OA0A 4JUDX 2HXGA 1TLLA 3AO0B 5IXSA 4HWSA 4BCCA 4U7WA 5REQB 2VOJA 1CCWA 4AMYA 2FW6A 1T0HB 2EZ8A 4KBYA 4CCYB 4O2AF 3A10A 4L74A 3ANYB 3HKCB 1KJJA 3ZDFA 1NJGA 5L40A 2PUHA 1V3VA 1VCNA 3A26A 5MGBA 1FQKA 4M86A 4LE1A 2IHUA 1CKEA 4PNZA 1X7YA 2YFKA 4G97A 4MITA 3U31A 2HADA 2Z83A 1KJIA 1RYFA 3OX3A 3AP3A 3ZIDA 2V97A 4ZZ3A 1H2AS 2FXIA 3DR3A 1RLIA 3GT0A 4PQYA 1LPAB 3VZCA 1TJ4A 3ILHA 1BVRA 3NGLA 1P4SA 1KAMA 2NWQA 3FCUB 5DB4A 5K0GA 2ZZNA 4PZUA 4EZEA 1TQ2A 3MJTA 4LOLA 1P61B 2OT3B 5KJEA 5EMMA 1QHEA 4JMPA 1U3DA 2ZSFA 3SBXA 4DJEC 3GMDA 3BMNB 1V9SA 3TCKA 5AW7A 1EFRA 1EFPB 3KWJA 1VGVA 2P0EA 3F98A 3BFKA 4E4TA 4YYZA 4B6GA 3I1YA 2MYNA 5B53A 5BPFA 1K8QA 4XI9A 1SHKA 4JLSA 4FDTA 1A77A 3SOPA 5JCPA 1OAOA 1XTQA 2I6QA 1ZGAA 1ZIPA 2FKAA 3EXFB 3G2JA 3LIIA 2CMKA 4RU1A 3K8OE 5B1DA 5H4GA 1S01A 2BSQA 4OGLA 3DKRA 1UXGA 4R16A 2Q5OA 3FCCA 5LZ8A 1CG6A 3AEKA 4PGFA 3C85A 3RV4A 3EC2A 4I5DA 1CF4A 1E59A 4NTZA 5JALA 2I91A 2CL7X 1BCSA 1YJ8A 4YP5A 3FA2A 4OFXA 4XDGA 4MCHA 3UKJA 4JJGA 3U4QA 4YCLA 2GKGA 3MMZA 5CW1A 1RKUA 3S28A 2FN7A 3VNQA 4MWOA 4XLZA 5AMXA 4L0CA 1ZIOA 4UQOA 1M1YE 3G88A 1DV2A 3ITDA 4NZNA 1BS1A 1O3YA 1UP7A 2ZPTX 3BGVA 3G0GA 5DTRA 3KQVA 3PPIA 4GPTA 3B1WA 4TKUA 5AICA 1Y6GA 1NBHA 2PT5A 1Q6YA 2C59A 2UXCB 2GAFA 3ZCPA 2DH5A 1HV8A 4O1IA 1YZFA 2FOXA 2O4CA 3PPXA 4OBWA 4KPFC 3IQZA 4URFA 1QC5B 4EF4A 3BWVA 4MZXA 1F0KA 4RVDA 2P5UA 4E3WA 1W7AA 3FHOA 5AW5A 2DTXA 4M88A 2EU8A 4MVJI 4GKAA 4BVFA 4U2KA 2W0MA 4ALIA 1KO7A 4KQJA 3EDCA 5KTSA 1QONA 4QYIB 2R5WA 4WNYA 2XZLA 7ADHA 1L9KA 2A14A 2PA0A 3OTGA 4ZT5A 4WCFA 4AYTA 3EFHA 3H1PA 5EZ5A 3VOTA 2O5RA 4B3FX 1DADA 4W1PA 4A82A 4PO8A 5KCMA 5AI9A 3WRWA 4NJMA 4AULA 4I1RA 5K1ZA 3DSRA 1X14A 3W8RA 3UJ7A 2HWWA 1QRDA 1SCUA 4KRXA 4ZRDA 1U1EA 1BX1A 3L4BA 4OMCA 5MGNA 2I54A 1NVDA 2WJ4A 3P9XA 3R41A 3LV8A 4RMIA 1AH2A 4RHTA 2DYKA 1EBUA 3JQGA 3V8EA 1TUEA 2AQKA 1W6UA 2AV6A 4FGLA 4IF6A 4E22A 2BV3A 1KK0A 3U61B 2ORWA 2HK7A 1Z06A 2GFQA 4MUFA 4S24A 3FR7A 1Z34A 3CURA 4XAQA 4CEHB 5B36A 4MYUA 4RW0A 3X1KA 1GY8A 4UEOA 1MENA 5IKPA 2QP9X 1DFIA 4ZVUA 1KZ1A 3IBFA 5IF9A 3RYFA 1K7YA 2IW1A 4C01A 4EA6A 3CVWA 4U7PB 4C4TA 3WYFA 2YV2A 4YR7A 3BBPA 3WQQA 1VLJA 1Y89A 3AOGA 3TIVA 2PZLA 2BMJA 2OOSA 5EIAA 1NT4A 2W6JD 1YONA 3KT6A 1JDVA 3ZV3A 2YJZA 3N0WA 4GBMA 2H54A 3PHHA 4RSRA 4B6PA 3ZHTA 1FBTA 5BN3A 3SIRA 1RRGA 4M53A 2DTEA 5LNK6 4RKFA 3S29A 1E64A 4QL3A 4S1WA 3MJHA 4DQXA 3RVRA 4UUOA 4WOKA 2CLDX 1NF2A 3SYNA 3FCSB 1AN9A 1VIYA 3UWMA 3H3XA 1AOXA 1Y1KE 3E9RA 1PGJA 3ILSA 3QVXA 1ZM7A 4I5IA 4D99A 1YUMA 5I45A 4DDKA 2QIPA 3PHIA 5DMHA 1SC3A 3C3PA 4U0KA 1I9GA 5CM2Z 4N12A 1MW9X 3H2KA 4CF6A 1KFCB 2M6RA 3SYLA 1Y3CE 4XVRA 1GN8A 4FFRA 2J87A 2OV1A 2XE8A 1AU9A 4Z7OB 1DXYA 3GLSA 5DNDA 1EGQA 1GFIA 2YYZA 3KLMX 3UGQA 3MCZA 4GG1A 4C0BA 1E1RD 1NV9A 2W8ZA 2YOHA 3D3NA 2BHSA 4OUDA 3BRSA 1U4NA 3TNLA 4YI5A 3NHAA 5JWOA 1S2MA 4EEXA 10MHA 3U4GA 1EX9A 4UM5A 3KJIA 1RADA 3RUCA 3ZTTA 1NL3A 4H7KA 5L53A 4OQYA 2FWJA 3LA6A 3BH7A 4W7IA 3TW8A 3AR8A 3OJ0A 1T36A 3ETDA 4PXSA 3VR5H 1PEDA 3KQMA 2PZAA 1KEZA 2YJTD 3MGAA 4Z51A 3CNQS 4XVQA 3B3GA 5EA2A 1H8HD 1OLXB 3A1EA 5FPKA 4Q4HA 4OF4A 5H02A 4OXKA 3P2OA 1HA3A 5EE0A 3CV3A 1U8EA 1YA8A 2AR0A 3R6GA 4HB4A 2H06A 1T9DA 1QFYA 1TTHA 3MJFA 5JROA 2O0JA 3CUSA 3EE6A 4MYDA 5A05A 3UYKA 1BFUA 1YJCA 4PWZA 4Q00A 4PE5B 5DBOA 3FTNA 3ZHRA 1B3RA 5BT9A 5BUSA 1QYDA 2Q7XA 4LECA 2RAUA 3W8EA 5K9ZA 5JD5A 6LDHA 3N2LA 1BDHA 1VJDA 2EDCA 2CXOA 3K70B 2O8CB 1CZUA 2UXBB 1VKJA 3NVKI 4RGBA 1LV8A 4CRWB 5DGHA 3EEYA 1MOZA 4S2UA 3EC7A 1Q20A 3GVPA 1NFQA 2LDBA 3X1DA 2EFGA 4X6UA 4DR3B 2GZDA 1QFMA 2F48A 5HF6A 4I8IA 2W42A 4P2GA 3E15A 1N7GA 3ODGA 2F3QA 3GELA 2FLVA 1JDBB 1S2GA 2P62A 2PLAA 1V25A 2C8KA 1G2IA 2WJJA 5HPYB 1QKJA 3G1TA 3DJYA 2O07A 4LNUB 2VAMA 1OBHA 4R6XA 2CJWA 4JA0A 2RH9B 1MJNA 1H2FA 1ZA1A 1K5HA 3JQGB 4IVNA 3LHKA 4Q1EA 3V1LA 4EHIA 3D5EA 1DAGA 1AIPA 4ZEMA 3FUCA 3VNVA 5JQWA 4YXWA 1PCXA 1YNSA 1P81A 3EW9A 2UXDB 1U94A 3QWBA 3V1KA 1Z6YA 2X0EA 2J9FB 1O9HA 3K9QO 4D8XA 1P2TA 4Z1MA 2M32A 3K5WA 1ODKA 4I0WB 5A02A 3EY4A 2IU0A 4OGGA 3DEZA 3UMRA 3CJTA 4ZI5A 1ESCA 4DNXA 3T1HB 2YIMA 1WO8A 5K2MA 2JC3A 1QS0A 1F06A 3PFNA 5CAEA 2J85A 1GSIA 1YS2X 3MWDA 4UDYX 4A7PA 1QQAA 3FGPA 3MXOA 6ADHA 2VSYA 1C9MA 4TLDA 4YT8A 3I61A 1IB6A 5CFQA 2BFDA 4FSHA 1GFSA 4IDCA 3AERB 4LJ6A 4KR2A 3D64A 2IPOA 4B83A 2JIQA 2BM1A 2BP7A 2X2EA 3OKCA 4HQ0A 4NMMA 4OQQA 4ACAA 1DWOA 4ZAWA 3MTGA 4YMTA 1BA2A 4QM7A 1BNCA 4XQEA 2ZRKA 3ZWNA 4RCVA 3LTEA 1V16A 1PZGA 1TYZA 1R66A 4NY1A 2DUUA 4I1IA 1R5OA 3B52X 4P7FA 4DYVA 4ZZ0A 1Y7PA 2DHEA 4GUAA 1JG2A 5BOSB 5AVSA 1TJ3A 3PEUA 3SP1A 4CR7A 3L0BA 1QH1A 1V9CA 2Q3LA 3QHQA 2PVPA 4J3JA 2ZRHA 2CDBA 2WKPA 3ULKA 2J1LA 3OLVA 1YA6A 1H2BA 1N5MA 1QE3A 2VT7A 3QYPA 1GKYA 4KLAA 4K03A 4Q18A 4QJBA 4XX1A 3L77A 2FDRA 1Z0ZA 1C8BA 4YQZA 5DTMA 1KC3A 1GTG1 2WTAA 3O3MB 2I4NA 1NKSA 4HY3A 2ZXFA 3JQAB 4FEGA 4XGIA 3JYOA 2JVJA 3EH2A 5K8CA 4DR2B 3BCSA 3PNPA 3O94A 5FWDA 1XD9A 2ZI9A 4K6MA 4PGGA 5JV5A 1ISPA 4DCUA 3IP9A 4LFAB 4L5AA 1P80A 1FK8A 1KC1A 1LBQA 5JVDB 5EE5B 1ZH2A 1G9XA 3QU9A 3TWOA 1USKA 2P6UA 1IK4A 1IHPA 4NULA 2QF7A 2NUBA 1UP4A 2PHZA 1FJHA 4MS3A 2HCJB 4CMBA 3N39C 3TRDA 2VAPA 3TRKA 2R1VB 3PUIA 2PQ6A 3VHQA 3GRPA 2FUNB 3FCXA 1RQNA 2R1ZA 4RAOA 1FVXA 4O5OA 1YBAA 4J2OA 3DKPA 5H8WA 1JFTA 5EUBA 3MMNA 3EC1A 3GPLA 2IV2X 4ND7A 1JDPA 1F8YA 3E9CA 3GFVA 3DE2X 3AM3A 3F74A 5H9WA 1CRPA 1OILA 1PFWA 3GNTA 2YY5A 4QOJA 3TQRA 3IEKA 3HCCA 3STTA 4ZI2A 4XUGB 1VBKA 3EB9A 5DPMA 1UL1X 1Z4IA 3TTVA 1Q19A 3GJYA 1UK6A 5BSUA 4L3VA 3AKCA 1T9GS 4E31A 4BQOA 3VISA 2B4TO 2HPZA 4HWOA 2DUJA 1HH4A 1JSCA 2MJLA 3DLTA 4FVTA 4JXXA 3M6LA 2HA0A 4WXEA 3HNRA 5BRAA 3AR3A 3HCEA 4R0NA 2OCPA 1VJTA 1X8JA 3L41A 2XZPA 3STXA 3NALA 5K05A 2NACA 3ZHUA 5COAA 5JY1A 2ZS7A 1EBBA 1ZR4A 1IVYA 4O08A 4AIRA 4YAKA 2BKEA 4O6VA 5FTJA 3O9VA 1OZ0A 2HA7A 2JK0A 4M55A 4JODA 4R2XA 4HEA6 3RE1A 4B71A 4GBED 5JARA 1EUQA 1W59A 1UBCA 4UD2A 1UIRA 1USUA 3G79A 2D5AA 1MTZA 1J8FA 2P2SA 2Q9AA 4J0GA 1ZS9A 4IIHA 4YCDA 5B1SA 1JQKA 3WGLA 4ARVA 2H0QA 2N3ZA 2QLBA 4F6LA 4Z4GA 3VU0A 2IEDA 4G8DA 1QR2A 1TJ5A 2J3QA 2XNCA 1DAOA 4HNSA 3H9JA 4ENTA 4QUGA 2G71A 1ENOA 1UEJA 1UK7A 1FOEB 4IILA 5FULA 4LOIA 2IPNA 3A25A 4KPYA 1H5QA 3PD1A 4EG6A 1F0YA 2PUCA 4JAVC 5EGNA 1CUJA 1UM8A 1KGSA 3W79A 1QO7A 2HREA 3VYRB 4MPPA 1Z0FA 2I4IA 1X9GA 3CNEA 3NHWA 3HMQA 2Z2XA 3MD9A 4QUAA 4EFNA 4NV3A 4IBOA 2Y4NA 4N7RA 2H2HA 5LU9A 3A4MA 3ZHZA 2YHBA 1U98A 4DMGA 4IJUA 4TKMA 4IVRA 1ECBA 4QD3A 1HQDA 1GGEA 4EUNA 2W2XA 1W4RA 1CIVA 3GDGA 1J22A 2FHSA 4A8JC 2FZWA 2WHQA 3K1ZA 1I14A 1RQPA 4RH0A 4H18A 4D79A 1ULZA 1ULBA 2KPOA 3IHKA 2IIVA 3BXGA 5BSRA 3PICA 5BV7A 2RD2A 1HT2E 2GXUA 4ENVA 3QTBA 2G1KA 4LMRA 5E4FA 1R0XA 5KNDH 3TPZA 1HE2A 3M3DA 2Z95A 2OZPA 4LE0A 1M2FA 5I9LA 3KUDA 1FS6A 3MAGA 2IYVA 1TVKB 1K2WA 3PUYA 2VJCA 2I6TA 1IHDA 2O5CA 1NF8A 1US8A 5ILQA 1DKMA 3WOVA 2C8JA 2HQ1A 4O4HA 5EQTA 1E5LA 2BSAA 2CC2A 2Z1MA 4BC0A 4UM9B 4IL5A 5DX0A 2DR3A 4CZ2A 4MIOA 4TLBA 5HTKA 1BO6A 1E96A 1U1DA 1QX3A 2FH5B 4IIEA 5AXCA 2OYRA 4N0EA 1Y7IA 4DY4A 1BEZA 3HP1A 3UAWA 1H1LB 2WFMA 3IQXA 3RO7A 5IT9A 1SM4A 1YRQA 3STUA 3P96A 3EWNA 3OQIA 4JJ8A 4C76A 5F9FA 1TF2A 1JS1X 1LU9A 1SXJD 4J9UE 3SM3A 1P0IA 4MJ7A 1FP7A 2BCEA 3B89A 3DTYA 1REQB 1ZHHA 2Z3ZA 5K3CA 1MFPA 3HN2A 1O87A 1A95A 1RLTA 3BE5A 4GP6A 3KDPA 3OJOA 3T9DA 1OB5A 1UIMA 3BX1A 1RPZA 3T61A 4D8WA 3CFYA 1F8XA 3HYNA 3ELUA 1I1HA 1MDBA 3AQIA 4BMZA 1FU7A 2CZCA 3K09A 4D9KA 1CZHA 2QSZA 3GRZA 2H7VA 1LY1A 1RM5A 2GHQA 4H4CA 4KBFA 2D5CA 3NTUA 2XE7A 3JCZA 1GAQA 2XKAA 4OI4A 2IYFA 3E84A 4WY5A 3MRXA 3VVCA 1YR3A 1CP2A 4AN1A 4GI2A 2AFVA 3KZMA 3ZWPA 3LS2A 1J8MF 2HCFA 1GZUA 4LQ4A 1A9YA 3ZWXA 5GPBA 3L4KA 4ZEOA 2IYAA 3AGQA 2XOKA 4BMDA 3CKKA 5FYQA 5BQXA 1B6TA 1CE8B 4MWGA 2PSEA 4JKOA 3VTZA 5DO9A 1CERA 1GHTA 5KWVA 4UUNA 2O19A 4LYAA 3MWLA 4QTXA 1BCRB 2IZOA 3E3MA 1BXKA 3H04A 4XD7D 3D9QX 2W7TA 1GQSA 4PLTA 1VHWA 4ZICA 2VJQA 2GUWA 4ZU6X 4ZAVA 3W4KA 5B1HA 3WLRA 1JLKA 4WJLA 4ESEA 3RSFA 4FINA 3AKYA 1RZRA 4NZ9A 4E5DA 4MAMA 1L1QA 4PPFA 1QYXA 4JYMA 5FWYA 2CBZA 3JQ8A 2VDUE 3AEUA 821PA 1K7XB 2HBZA 2XIJA 3ACDA 1A9OA 1XVAA 3EZ2A 2QAIA 4K7JA 4R01A 1V8BA 4HX2A 2AVNA 2DTDA 5IKMA 5A3QA 3Q8KA 2BKXA 2PRIA 1NQUA 2BUBA 3I3SR 1AMUA 3C6BA 1T9ZA 1DT3A 1BXRA 2QD2A 1TZMA 4LRWA 4WBSA 1RYYA 3C5WP 3CSUA 2OD2A 2SCUB 3FUVA 2A9OA 2E5WA 2HF9A 3KLBA 1CNEA 1WPXA 2KX7A 5G0TA 2WSSD 4I4TB 4E0BA 2BEUA 3ZHVA 1KY4A 4EG7A 3A6LA 2CNWD 3W5BA 2GK7A 4HMQA 3A3YA 3JD2A 1K9SA 2LDXA 2E87A 1P4HA 5GP1A 1G18A 4BNGA 4DMFA 3KSUA 4XQ0A 4EDFA 2ATIA 3PLRA 4GW3A 3ANSA 3A58B 4J7AA 2JCYA 2W98A 3QX9A 4G4SO 4L2IA 1VKZA 1XJCA 2SCUA 5FF9A 5GJWC 5LXTA 1ZMTA 3DBHA 1RD4A 2WJ6A 1I4WA 2M1ZA 3KZVA 1Z2PX 4FZVA 4GLFA 4JT9A 4L78A 2QN6A 2ZR9A 4RH1A 4J16C 5G40A 1L5GB 2QRKA 3U4HA 1IZ9A 4E2WA 2NN3C 4EJ0A 1F4VA 4XIJA 1PQ4A 2PA3A 2GZAA 2IY7A 2X9GA 4RFSB 1NSYA 1HNWB 3GFGA 3PJGA 3MRVA 4DIUA 2J9YB 5FQNA 5KNCH 2UU9B 1T35A 3E9YA 3HA3A 3PYLA 2CLLB 3TB4A 1MXHA 2PNJA 1J8VA 2WMNB 1CLEA 1CR4A 1D0IA 2ZI5A 1YB4A 3CN9A 4IM7A 4LNHA 4LRUA 5AQEA 2B8WA 3S40A 5BOSA 2J3HA 2IHYA 4TQUS 2VNJA 1JWLA 3BVPA 3DKKA 2RIRA 3KKLA 3QITA 2CV2A 4E03A 5EJ7A 2GB4A 4V3CA 1Z0IA 1P60A 2EKZA 3LCUA 3AHIA 4BUZA 3GJ7A 5EKUA 1NVFA 3G2PA 1KK2A 3FWNA 3GJQA 3K96A 1VLVA 3K2BA 1J23A 4J2TA 4ODIA 4AJNA 1QRTA 4Y0NA 1ULHA 2LKCA 3MTDA 4JEIA 8LDHA 1E7WA 1HDCA 4MW9A 2NU6A 2H0RA 3HBMA 1QQ6A 2XDWA 5A0TA 1GARA 2H92A 4OP2A 3PUJA 4RMNA 3D5QA 4OJNA 1FZTA 1ADFA 1WXEA 4KXMA 3P0FA 3PNSA 3PUZA 4MGZR 1P44A 2AYZA 2GTPA 5HIAA 4ZQFA 3H4MA 2HLHA 2Z4TA 3DXFA 1O54A 1IATA 4YRSA 4I81A 4P31A 3ZBPA 2CSXA 1E99A 4BMOB 2PL5A 5SY4A 2V0GA 4CGZA 1XPUA 5B6PA 1GJRA 1RXSA 1O1YA 3DCJA 3FJ1A 2VNIA 4OV6B 1C3VA 3TMAA 4UOQA 5DNUA 1FE8A 5KJFA 1XB2A 2GEKA 2NYVA 1ZR2A 1C1XB 5E1MA 1QGUB 4KH1A 4H3SA 5L3SA 1Z33A 1Z8FA 4UHKA 3TD6A 2OGTA 3FX2A 4F5WA 3EEQA 4NOMA 3EZLA 4MVJE 1PUIA 1TFUA 4G1CA 5H83A 2AC7A 1RYBA 2HJRA 4KO2S 1NR7A 2G9ZA 2FETA 4KQMA 2G7MC 2WT4A 1GD1O 3S2ZA 4X8HA 3NYQA 4L8VA 1Z82A 4ESOA 3R0JA 5KNCA 2O1WA 2F55A 2XEDA 5ALKA 2OO3A 1ZN7A 1I32A 1E79A 2SKEA 2FPRA 4M6WB 3WYCA 5AW4A 4YACA 2NVUB 2QRLA 3OVMA 1XN4A 5ENDA 3FPSA 1V43A 1SD5A 1T5OA 1TIPA 1GYQA 3Q10A 3D6JA 1O5TA 4PX2A 4WK2B 4F7DA 3V6MA 3Q1KA 3Q1LA 3T5AA 3DM5A 4IOKA 1Q17A 1ZO8A 3B85A 1ZH4A 4WJKB 1YJQA 1NOIA 4LZZA 4KIFA 3ITNA 4FFSA 4MVJG 4R9RA 4FXPA 1IXYA 4ACBA 4P98A 1OH8A 3Q12A 1YKFA 3EZXA 1Q6ZA 3N5CA 4OQZA 5FFMA 4PHGA 4D02A 3AV0B 1A4IA 2LVBA 1XTUA 1O0CA 5IUKC 2IYLD 2BFFB 3USCS 1CUXA 1L0BA 1OXVA 1QQTA 1R8YA 2ZJ6A 3R3HA 2VLIA 2ZS8A 4YUVA 3K6RA 4A5SA 4X8MA 2H5IA 4DYDA 1M8GA 4EG1A 4TTPA 4I1OA 4OI1A 1ZIXA 3UAXA 1E9AA 1C80A 3ZCTA 4AP9A 1JHYA 4CMIA 4RENA 4H6XA 2ZBGA 2WG1A 3C0KA 3BXZA 1LD3A 1FVFA 1V48A 3WDLA 3IPXA 3R76A 2FRDC 5DK6A 2OKGA 1JZQA 4JFRA 4F5ZA 1XQWA 4O4LB 4ZQEA 5EE3A 3U3MA 4QKQA 2P4SA 1XWIA 2XQKA 3TQIA 3FZNA 3LBIA 4BRZA 4V1CB 1UKCA 3OZIA 1TZJA 1NXVA 3WK7A 3A1NA 2GXSA 3ZW8A 5K0TA 4IHQA 3P4XA 3G7UA 5KOJA 5HS6A 3ZHBA 3NH6A 4FFWA 5BNTA 4KO1S 4CMGA 1U8XX 3EVBA 2FUG1 4LK2A 4NBWA 1XJWA 3TQFA 3EXHA 3VU9B 4NOJA 5ALNA 2VJMA 4B3MB 2XRYA 1E7YA 1HFWA 1NBME 3MTEA 4FOTA 1M6WA 4NPCA 1TO1E 5C8YF 5LMZA 2BEKA 2QLMA 3HDYA 5GIPE 2C5FA 2A0KA 1RRVA 2AG8A 3LNCA 4JC5A 1NC1A 4HNHA 4LQLA 1W0JD 1Y9JA 3N8DA 2FW9A 4UJ3A 4QT4A 2GT1A 4K8OA 1BU5A 1Q0TA 4RKYA 5ELLA 4IRUB 3IEIA 3OO0A 1GUZA 3HDHA 5K3DA 2XB2A 3V8PA 1Q7RA 1OWLA 3HCFA 2WTNA 3CRMA 2PGAA 3LA8A 2XYGA 4N0PA 1CF9A 1UFRA 1RHRA 3LFUA 3DL0A 4XIFA 1S3SA 3IKVA 1X80B 5EFZA 4CV0A 2P6PA 1YFKA 1LDYA 2OESA 4GU5A 1OYOA 4Z0HO 3P9YA 3GT4A 4YLEA 5K01A 1RTKA 1KP2A 1LBHA 2D2IA 2P2DA 4BB9A 3EPPA 3NOOA 1Q1AA 3FH0A 4BE7B 4E2XA 4RTNA 2DXIA 2VXBA 2XB9A 3A9TA 4GQIA 4YC7A 2AX3A 3N8KA 1COZA 2RCYA 3JQQA 1EJ0A 3PWSA 1JR4A 3NIBA 2XZTA 3BFXA 2DKFA 4HDAA 1U1FA 5DRYA 4CIDA 4HDRB 4ERNA 1CDZA 3ZXXA 4ZHSA 3AI2A 2BM8A 3TMYA 4LX8A 4NU0A 2CUZA 2FPOA 1CJMA 2HDNB 2VFAA 3RC1A 2C77A 1YHNA 3RS9A 1DX9A 1LVHA 1FDSA 3FSJX 5EZYF 4C30A 4UVIA 4NJMB 4IXWA 3UT0A 3HUDA 4AROA 4E88A 3FLAA 2IWRA 4Q24A 3F71A 1AZTA 5FO0A 4K1XA 2ZATA 3EGCA 1VPEA 2ONCA 3H9QA 3TLEA 4AMUA 2EZTA 2WE7A 1QB7A 4KE8A 4YRRA 1PNQA 1E79D 3CZRA 2F7SA 3GEGA 3NC4A 4QULA 5CNJA 4DEYA 5JLJA 4G5QA 1HDEA 1ZK2A 4KAJA 4P3YA 4U3JA 4WLOA 1WLYA 1JILA 1U9IA 5HK9A 1TKAA 4G0XA 1EVJA 1BXRB 4CM4A 3QG1A 5HRAA 2FHPA 3ZDDA 2Z5FA 4ZHQB 1MX1A 1OX4B 2BCGY 4IX9A 4PANA 4E51A 2Q2WA 1MZVA 4LOAA 4W9MC 2BTQB 4GLJA 4TMTA 4MXDA 3WTCA 1FFXA 2GM5A 3CO0S 1KMHA 4A2QA 4W5OA 2ZRJA 1VG8A 4CCSA 1SUIA 1X6VA 3MBOA 3QTLA 3ER9A 4I08A 2GESA 3HTXA 1RRMA 4RF3A 2X41A 1OAKA 2CB9A 3IEXA 4EW3A 4AG3A 1G8JA 2UZ4A 1TQ4A 5EIFA 4I50F 4C4RA 1NTOA 1WHSA 2XWPA 2EERA 1RPTA 2WU3A 4DMRA 3GLGA 1QDLB 1WCIA 3FVWA 3LCVB 3FZEA 5U4QA 4YXFA 2HSGA 3HUFA 1RAFA 3CLKA 1WXHA 2AUMA 4WNAB 1OBOA 3QVSA 4Q9IA 1EDDA 4NMWA 1EX7A 1FFDA 2X7JA 5INTA 4LYEA 5H9VA 1CS0B 3ER8A 1P4RA 3NEPX 2VF5X 1JQBA 1ZJ4A 1L7AA 3FKJA 3ND8A 4GC9A 4Y2JA 5EI5A 1XEXB 3D4OA 3CG4A 3EOAI 5FEMA 2EQBA 4U9UA 2HMVA 3RAGA 3DPSA 3ZZUA 2P9QA 1QOQB 4FOSA 4JJEA 3AUFA 2ZQ5A 4M3NA 4MVWA 3WVNA 2ODQA 4ZVPA 3ZZMA 4OJYA 1V11A 1PEAA 1D7OA 3KHTA 5EXSA 3QI7A 3ASUA 2FSGA 4MQBA 3AF1A 4TS4A 5I4KA 3L6OO 1P9LA 3PK0A 1EEXB 5GIOE 2IZ1A 3JY6A 3BORA 2FEPA 4OHFA 2PX6A 3H2HA 1YR9A 4PAMA 4Q3AA 4YJ2B 5EP4A 4A6PA 1K66A 4I3HA 1W5FA 3UT5B 1U2SA 2Q3JA 2DPLA 1UOEA 1NR5A 4G6ZA 1EWQA 1KO5A 1T4CA 3KC2A 4INZA 1R8XA 4MV3A 3ETEA 1LPPA 3CCFA 2WF5A 4V0OA 3M6UA 1WS6A 4JYCA 3RSSA 2G63A 4XYBA 3QPDA 4GPZA 4JGGA 4FM9A 3I9MA 2OUIA 2YYSA 4MLCA 1NN5A 3AFHA 4KEAA 3U39A 3VR4D 4CKWB 2DRIA 4F2PA 2R7NA 2EGHA 3LLUA 1MT0A 4OK3A 1KYYA 1WCYA 2JLQA 2RHBA 3EFOB 4I9FA 4KE6A 4YCJA 5JS2A 3U49A 3H0KA 1A82A 1Z0DA 2CLIB 4JROA 4PYJA 1B0ZA 4FYXA 2AD5A 2HHAA 2W2NA 3WLPA 4BQEA 1Y80A 4RGQA 4BQQA 4HGZA 4MGKR 2CNWA 3AUUA 4RK6A 4LBZA 3G59A 5YASA 3ZK7A 3E7FA 3SE7A 4ZQBA 1WKBA 1QIJA 4XFJA 1B42A 2DHRA 3UPTA 2GO7A 3DGEC 3BMXA 3WQSB 1W36B 5HIKA 2VRWA 1RRCA 2IEGA 3OE5A 2XGMA 2R7MA 4MW4A 2B3DA 4WN9B 1XK6A 4ZCRA 3GUCA 1VPDA 2V5VA 3HCDA 4LXXA 4MGHA 3NQ41 521PA 3TPCA 5B1EA 1DELA 1MEOA 4YDSA 1FUEA 5HMMA 1WUYA 3KZNA 3OOHA 1NNEA 3CBQA 4I55A 1L8AA 3O82A 1NBAA 2Z2ZA 2XECA 4BGUA 5HK8A 4EJFA 3IQDB 1EGVB 4HWRA 1LF0A 2VN8A 1IEWA 1KKLA 3HJFA 1W48A 1O0SA 1EIZA 1O4VA 2IF2A 3CEAA 3NAGA 3COPA 2W43A 4HADA 4NP6A 1Y42X 1AO0A 1XE3A 5I51A 2B1IA 4RQAA 4MZDA 4B3CA 5KVVA 3DVAB 3L79A 2OHVA 3V7WA 1F8FA 5D2CA 3DXXA 1Q74A 2WB4A 4QUHA 3EZYA 3R8FA 3EPRA 3NXKA 1JWBB 4ATNA 4K6KA 4L72A 2W6ID 5A5GA 4EG3A 1YBVA 2XWQA 2BEUB 2WAMA 3CEPB 4LG1A 3TG2A 2POQX 1J42A 3ELYA 3NLLA 2B2XA 3FYUB 1ZFNA 5FPTA 4A0QA 5CRIA 1MG0A 2GCIA 2V7XA 1JEYA 1H9CA 3BD8A 2XYHA 4ZVLA 3TPFA 3L7BA 4FU0A 4MR9B 4OYHA 2YZ7A 2BH9A 2W58A 3DOFA 3IBYA 1WU7A 4MRMB 3TIFA 5JOQA 1DAEA 1T1GA 2W70A 1FJGB 2WKWA 3FVVA 1GUFA 1E4EA 2AWOA 4DA8A 1SRRA 1TCAA 3IPCA 3QMPA 3QX7A 5AJUA 1YZYA 2GGSA 1ULAA 3NTLA 4MYRA 2CCGA 5L7WA 3N2KB 5JJKA 2X8JB 1ORVA 1NULA 1ULUA 4BGIA 5C5DA 3EIWA 1G6KA 4FCWA 2ZWIA 1UWCA 5GZ3A 2B92A 2YV5A 3F0TA 3MS7A 3S1AA 1U0RA 1SXHA 1Q0PA 1Z18A 2ACWA 4B8ZA 1KEEB 3TUJC 3FHTA 1OH6A 1G38A 1WXGA 1FLVA 4OK5A 5ITWA 3WXBA 3RNLA 1B76A 4ZOQI 4S2EA 1R8JA 2EIXA 2JFVA 4GMGA 5KDDA 4WLEA 2RB4A 2P41A 1CR2A 4W5JA 5A7HA 4AURA 2G04A 3AF3A 2JFFA 3AG5A 2WSMA 2BD0A 1WMBA 5C46F 2J33A 4NYJQ 4DREA 5IPFA 1UJ2A 4CEJB 2AKYA 3Q41A 3OCYA 4HAWA 5B3JC 5BNFA 4UCWA 2YWRA 2G72A 1D09A 2VYVA 4UU1A 2FQXA 3F9CA 3PDJA 4PAWA 2Q2OA 1QGUA 4KQFA 3D6NB 3Q7TA 4QU9A 1Z75A 2C03A 2ZRFA 1AS3A 2GEBA 4GOXA 5DLPA 5TMEA 4NCAA 1N5LA 2H5EA 3BEDA 4R6WA 1P5JA 3DHNA 3OIGA 5LU8A 2HA2A 2AW5A 2WPNA 3OE4A 1C1HA 2XUGA 3R3VA 4RGVA 1GPWB 1YC5A 3TTUA 4E5SA 3BAZA 3WQBA 2F1JA 2QTMA 4WPGA 5B37A 3IOCA 3SR3A 2ZZMA 3U3JA 4ZDKA 5C2JB 3MRSA 4KGXA 2C94A 2X9LA 2C2OA 3VKWA 2UVPB 1XAJA 3G85A 2I3GA 3UO8B 2VJMB 3H17A 5LUBA 2HLNA 5DWVA 2V7PA 2H00A 3E27A 3H2IA 5CYFA 1ZL0A 1RP7A 2JKZA 2YZ2A 3O0TA 4IFEA 4LJLA 3T7IA 3SLRA 3U4AA 1N33B 3R20A 2X5KO 3N58A 1C8KA 4QVGA 3R0ZA 3E61A 4V0NA 2FDXA 1UM9A 3K6KA 3HB7A 5T4FA 1WW3A 1ZWLA 3PUWA 4HYYA 5DI9A 4D43A 2XCRB 2E4WA 5AI0A 4IZHA 5F3WB 5A0VA 2V7GA 4DCGA 1QBGA 4OSPA 4TMYA 3KQSA 4KRFA 1Z26A 3PJDA 1FSSA 5KYYA 2KBFA 3EF1A 3H5OA 4BO6A 2F8SA 1CETA 3T4UA 2QW0X 3EF0A 1X7XA 4KVGA 4AJKA 4IDGA 5FYDA 1HTTA 5SYAA 3RROA 5JSQA 4EG4A 3QY0A 4FR0A 4EABA 1T8YA 4RL4A 4YVFA 3B70A 1VZ2A 1B1AA 4XR9A 5CXXA 4ER5A 3M9WA 1VRVA 1HFEL 5JTUA 1E92A 1GV0A 3KR1A 3GJTA 4OHWA 4QO8A 4DG8A 3C3DA 1O6BA 1IN5A 3D6UA 3DOHA 3KO8A 1G5TA 3O8OA 3BN3A 3COWA 4G1UC 4ENPA 2BL4A 2WYHA 1N7IA 4P33A 1QFZA 3OT1B 3PV0A 5LQNA 2JIMA 3A1DA 5B7GA 3KQQA 1S8OA 3CZAA 2DX7A 3OQPA 3OY2A 1JSRA 3NBYC 3Q3HA 4MS4A 3VRHA 1W5BA 3EA5A 1M5RA 2CVFA 4EENA 2XGOA 5EXXA 1YRWA 1WSBA 2OHGA 3R5XA 4G0NA 4L4XA 3KCNA 4PINA 5I5GA 5SZKB 1XIVA 3RRYA 1B8PA 3CX6A 3NWPA 1XD8A 1GDDA 1M10A 3EUFA 4JLMA 1QH9A 2OGZA 2P4UA 3Q3JB 4LXUA 4OLFA 1VE6A 2BKLA 3WJAA 1KNQA 3LM8A 5L7TA 2UYCA 4ZYTA 2AZXA 2VP0A 3VKFA 5AK6A 5BVHB 2G40A 4E30A 1TCBA 1M8KA 8ATCA 1AQ6A 5IM4F 5IDWA 1N1MA 4R9UC 3VPCA 2DT8A 3PCTA 1G41A 4ZALA 5TPZA 1SY7A 1CIJA 3PRJA 4JT4A 3B12A 3MT0A 3P2KA 3FKQA 4HYTA 3W7VA 4MIKA 2JDIA 2BISA 5CB4B 5JXWA 3ZWOA 3VFDA 1HE3A 4PC1A 3AM5A 2XW6A 1DTSA 1XD2A 2FN8A 2HRQA 2IOYA 3W8FA 3B53X 5JQGB 1J9ZA 5KNBD 2BFEB 3C15C 1OYYA 1U5AA 4BLTA 4A2PA 5EUQB 1SCNE 4U2CA 1GEGA 4WN3A 1F4LA 5DHRA 3GXOA 5JBQA 5BN1A 2V4MA 2OD9A 2QJWA 4XFKA 4F4HA 4Z7NB 3KKOA 1M34B 3ZHOA 2CWWA 5JMWA 3SJ7A 3FWZA 3OIYA 4ZCTA 5ALEA 2IWHA 1GQQA 3QU2A 4UU0A 2ZWMA 2GN8A 3VPXA 1OFGA 1IQPA 2PWBA 4X8LA 4CKBA 5AW9A 5SYMA 3HRKA 5E2BA 3VPSA 4I6JA 4FW8A 1NW9B 1ODIA 3B51X 3FSRA 1XEWY 2A0UA 2FFQA 2ZRAA 1JQJC 1EKXA 2HI0A 3VV2A 5HFNA 3L8ZA 1T2EA 421PA 2O54A 3E22B 1P0QA 2TMDA 2AR7A 4C6HA 1J06A 3HACA 3JASB 3PQCA 1QVAA 4MQMA 1G20A 1OI4A 1C4XA 1FP4A 4KBGA 1KQFA 1MHTA 4MHTA 3JAMA 2P91A 3SHFA 2O8FB 1BCRA 1N2ZA 2V6BA 3NPAA 5AW2A 1P8JA 2GCEA 4CMHA 4EQ6B 4U9IS 3DW1X 5A4AA 1KVSA 1P31A 1KU0A 1OLUA 2I2XB 4UM8B 3Q7EA 3UXEA 4ED9A 5K2OA 2ONYA 4P4GA 1E3LA 2P6RA 1Z25A 1RI4A 2BSXA 1AF4A 3EFOA 1LRLA 4HUTA 3L8MA 4H1UA 2E2WA 4XCVA 4ARUA 5CDHA 1W2HA 4R51A 3T35A 1NW8A 2WFLA 4KDEA 1L7EA 1VSQA 2XNJA 4BN4A 3I1IA 5EWJB 1KJYA 2V8OA 4HLNA 1WNTA 3S44A 4KR7A 3E4DA 4YIKA 5BWMA 1AGXA 2FCRA 5J5CA 3FOAA 1DL5A 1A7KA 4DNFA 4YQEA 3MG9A 3MWFA 3WKBA 3A1UA 3D3WB 5H82A 1KJNA 2AIRA 4NDAA 2IPMA 3FNRA 3IDAA 4MI1A 3TO5A 4EITA 1JPVA 1OWNA 5F4BA 1G7SA 5ERGB 1K7CA 1URPA 3BZBA 3GCWA 5AQ1A 1FPQA 1VL6A 3BK1A 2XGSA 2DWOA 1X1AA 2WIDA 4MQ4A 5F35A 4TMKA 1SXJA 1MVLA 3ZWWA 2DVMA 3ZU6A 4R40A 2C07A 1KY5A 2IDZA 1G1MA 2J3KA 3ANNA 3TW4A 1EAYA 2PD6A 3GMIA 2YTZA 3IP6A 3LLVA 3PZRA 4RVNA 3AETA 3S7TA 4BGVA 1QE5A 1PKEA 2O8EB 4D0GA 3AFOA 3LE8A 3E0XA 3MJCA 2P9FA 1XLTA 4N0QA 3IAXA 1CHNA 4RVFA 4RWEA 3IPRA 3KR0A 4N6OA 4ER3A 3H19A 1IHYA 4QQKA 9ATCA 4WACA 5J47A 4C6SA 3ZWVA 4D56A 3KKEA 1FQJA 1MKYA 4ZO6A 3ZU2A 1SK9A 1SCKA 5JS1A 5IWCA 3VUFA 5TJ9A 4D46A 2IH4A 2FWIA 1O94A 4FYVA 2Z09A 2ENWA 1P0MA 3GZJA 4LSWA 2X9NA 1ZH0A 1PU2A 3DA8A 3L49A 3K9WA 3VNBA 3N2EA 2VSNA 4YIHA 2H08A 4XSHA 1FFXB 2B5VA 1ZI6A 5J58A 2D0PB 2EL9A 3AHJA 2Y1CA 4ESVA 2P2YA 3X1ZA 4ZDJA 1KAOA 1PLKA 3N5KA 3E7PA 4ZI7A 2JZOA 4EVQA 1ZEMA 1JI0A 3N2NA 1QV9A 3HCWA 3HU1A 2KQUA 1MO2A 1KI4A 4U9HS 4YP6A 1OGIA 3A2NA 4G26A 4JFAA 4MIEA 3LL7A 3GN2A 1IOZA 4C7JA 2P7HA 1HNNA 1ZZGA 2EG9A 5DNVA 4D0RA 1RJDA 3DHYA 3EYAA 1GTVA 3DKIA 1BJRE 2WVAA 3QE2A 4BNYA 3GPBA 4AU1A 2I4LA 2VJPA 1CEYA 1WUKS 3V1MA 1Y5IA 1F3LA 3JATB 4R9SA 4XYGA 5DGXA 4DIFA 5GJBA 3BIFA 3K9CA 3T15A 3K05A 1TMGE 3M5PA