4Z3DA

Human carbonyl reductase 1 with glutathione in a protective configuration
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
276
structure length
276
Chain Sequence
SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase [NADPH] 1
publication title Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 276
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z3dA00
2AQIA 4XQ9A 4ROSA 1I36A 3GGPA 4R1TA 3EVTA 2OXIA 4CLRB 3WSWA 1VJTA 3HZZA 1PTJA 4DQVA 4CQMA 4PRKA 5JMPA 3K73O 4BNKA 5ITVA 3S2EA 5KVQA 1KEPA 1P44A 4FFPA 5F5LA 1D4FA 4Z0PA 3AU8A 3E9QA 4O1MA 4AJPA 2DVMA 2AMFA 3OJ0A 3MWEB 2W4QA 2DFVA 4R54A 3EY4A 4XQEA 4J49A 4TRJA 3V1UA 3Q3CA 4OAQA 1ISIA 4MVJH 2JKVA 3JQFA 5I9NA 1GYRA 3WX0A 3VOSA 4BO5A 3GY0A 1ULUA 3FNEA 3T7CA 4J4HA 3ROKA 3U9LA 1I01A 2BGMA 3CTMA 3I1JA 1F8FA 1KC1A 3VPSA 4GMFA 2AHRA 1YOVA 4XGKA 2C07A 3E5RA 4JCOA 3HN2A 1NFFA 5F3RA 3ZZNA 2O3SA 2P9CA 1PIWA 1WDLA 1I0ZA 2C2XA 1XHLA 5JDCA 3TL2A 4YRBA 5A5FA 3GN1A 3DZKA 4GPD1 4J16A 1TT5B 4L76A 4A7PA 1C1XB 2BI8A 3V1YA 1PR3A 1WDKA 4GWKA 1LQTA 1EMDA 3VH2A 1WNTA 1ZZEA 4OYRA 3VPFA 4DC1A 4BO8A 2V6MA 1VL0A 1DAOA 3G49A 3S55A 1E3WB 4DPMA 4GL4A 1HZJA 4L4XA 2HQ1A 4LN1A 4X54A 2ET6A 4XYEA 5TNXA 4J91A 3F3SA 4WCFA 3F47A 4MVJG 4AJHA 4KMSA 4DIOA 3GDGA 4DBZA 3TZQA 1NHWA 2NTVA 5IJZA 4PLPA 4UUMA 1U8FO 4MKRA 1Y1PA 3ASUA 3HG7A 1XCBA 4BS9A 3RUCA 3ZN2A 3LU1A 3UICA 2ZYGA 1DIBA 3SX2A 4DUPA 1IOLA 4YCAA 2GGSA 3TZ6A 5J23A 2FMUA 1YO6A 3HDJA 2SCUA 1PEDA 2Y1CA 5L7WA 1XG5A 3JD0A 3O26A 1LDYA 1U4OA 4IINA 5FI3A 3X2FA 4JBGA 3HN7A 1QV6A 1V6AA 3GVIA 2DPGA 4EDFA 4J2HA 3BMOB 2EERA 4BVAA 3MJVA 4IY1A 2VYNA 5GZ3A 3RUDA 3OH8A 4DPKA 1NWCA 4FW8A 4UEJA 3B70A 3NTOA 1ZKMA 3OHSX 4P38A 1RM4A 3NT4A 3GVPA 1ZJYA 4TQGA 3M6IA 2CDAA 1EBUA 1D7OA 1NQAO 1PR9A 1DO8A 1WXDA 4FSHA 3WGYA 4I8XA 2WTBA 4W9NC 2EP7A 4PFJA 3ONFA 2O2SA 1NAHA 2BFAA 3RC2A 1PGNA 3W1VA 4CM8A 3ZHYA 3G1UA 5L95A 4FDAA 1I3NA 4Z6KA 4D0RA 3BHMA 4RPLA 4INAA 2PH5A 2WD7B 4OSPA 1QRRA 1TLTA 3TN7A 5HTOA 1T2CA 1ZEMA 2AE1A 2FSVA 3D3WB 2E37A 4KUGA 2VWHA 4ZQEA 1R66A 1E3IA 1G1AA 4KWIA 5JYEA 3ST7A 5L45A 1B8PA 4B4OA 5COQA 3U3XA 1O94A 3I9KA 3HB4X 3VH3A 2JFGA 3PHLA 3JYQA 5EESA 2HMWA 1S6YA 1QV7A 4M87A 3G17A 2V6BA 1LDBA 1Q0LA 3IKVA 1ENOA 4RDHA 1CRWG 4OQZA 1FDTA 2J3KA 2POQX 4MDHA 1UJMA 2AXQA 2WYWA 1R12A 2UAGA 1GUFA 5BT9A 1A27A 4UREA 1HKUA 4E5NA 1DDOA 2ZTLA 5HM8A 5KVCA 1DLIA 2B35A 1YBAA 3DHNA 4QFDA 1X14A 4BO0A 1AXEA 5H82A 2X9NA 1H0KA 3DBHA 4RF5A 1MX3A 4CM6A 3CIFA 5GZ6A 2B4QA 2VOEA 4I5DA 4ZICA 3GHHA 4NFSA 1TT7A 2YUTA 4CM9D 1LSOA 4UUOA 1SB8A 1RM0A 4M49A 1UXHA 2DC1A 3G79A 4L8VA 1B16A 1A9ZA 4LW8A 4ZQBA 4IGFA 5CDTA 1ZNQO 4GI2A 5KOIA 2RH8A 3BHIA 3OSUA 4S3MA 4QECA 4ND2A 4W7IA 4XYBA 3WR5A 2HKIA 5TQVA 3WFJA 1XIVA 2D4AA 1YQDA 2J8ZA 2Q2QA 5CEJA 1E1MA 4EBFA 2Q4BA 3JQAA 3KEOA 3H5RA 4LCEA 1PQPA 5A3VA 3B20A 4E0BA 4BGEA 3RUEA 3BAZA 4E31A 4K6FA 1E7WA 3BZUA 4HFJA 4GVXA 4BUCA 1F06A 1QG6A 3C8MA 2DLDA 7MDHA 4J1SA 2A35A 4B79A 3D7LA 2Y99A 1GAEO 4JK3A 1QORA 1XEAA 3OICA 3KYDB 4OL9A 4B7XA 1YB5A 4DGSA 3N74A 3GK3A 3WJ7A 3ZWCA 1B15A 2O3JA 2GCGA 4R9SA 2JHGA 2Y0EA 4P4NA 1HDRA 1QYVA 2ZYAA 3HDYA 3QVWA 1A7KA 3QA9A 2V65A 2D0IA 2HRZA 3C7AA 2PA3A 2YDYA 1UUFA 3DBLB 4L74A 2Z1MA 3WICA 2I3GA 2Y1FA 1M2WA 2VHXA 4JROA 3OEYA 4NIMA 5FYDA 1HLPA 1GEGA 4DLBA 1A71A 3U09A 3T4XA 4YAGA 2NLOA 1ZJZA 4QUKA 4W4TA 4C4OA 4R4JA 3JQGB 4CPDA 1PGQA 5TX7A 2FPIA 3DBRB 2J5QA 1DIGA 5L40A 4EEZA 1GEEA 4P22A 4MVJM 3GGOA 1Z82A 1I32A 1R16A 3SBOA 2FN7A 1Q1NA 2X5OA 3C3XA 2PKQO 1Y5MA 1NVGA 1C0IA 1UP7A 4RVSA 1DLJA 1O9BA 2Z1NA 2UYYA 3FCOA 2LDXA 3ICPA 5ES3A 4Z0HO 1LI4A 1DC3A 2IXAA 5JLAA 2EF1A 4NFYA 4DWVA 2YDXA 1HDZA 3PQDA 2AE2A 2RH4A 3UFXA 4GX0A 1BGVA 3GFGA 1BRMA 1YONA 1QP8A 3HDHA 5C5IA 4FQ8A 2ZTUA 2VQ3A 2Q1SA 2VHYA 4CM4B 3EYWA 2PFGA 2YV3A 3H65A 1HRDA 4DIBA 1M76A 1FMCA 5C7LO 6ADHA 2HMTA 4YA6A 4RPJA 2JCXA 1LQUA 1ISFA 3DMTC 4JBIA 1P1HA 4RZHA 4BQPA 1ZUD1 4MVJD 4D3DA 1H5QA 3FNGA 1P1IA 2VWQA 4DTIA 1BXGA 1T2FA 3AFMA 3NJ4A 3V2HA 2J3HA 3VPGA 1YDWA 1T25A 3ZWNA 1GQQA 1BXZA 2DKNA 2EG9A 2F1KA 4CLXA 4YT5A 2W2KB 2NVWA 3GGGA 1ONPA 3OETA 2BGLA 4Z9YA 4ZRNA 3ZU5A 1GD1O 1IE3A 3SC6A 5C3MA 3Q2KA 5G4KB 3PK0A 3IJPA 1VRWA 2IYPA 3QVXA 2GN8A 5JCJD 3D4OA 4JLWA 1LSUA 2ZYDA 3DO5A 4N5NA 3VVBA 1A7AA 3PJEA 3DONA 1HF3A 5G4LA 1UXIA 1U3UA 3MCVA 4QO8A 5GY7A 4XYGA 1K6IA 3PXXA 1I10A 3ANNA 3BMCB 3EW7A 3KTDA 3ZWVA 3LYLA 2YY7A 1LRJA 2VZ9A 4UUNA 4RLSA 3JCZA 1EQ2A 2QZ9A 3GAFA 4FGWA 4CMJA 1UH5A 3DFUA 4YJHB 1DHTA 3WDSA 4CM1A 5JW6A 1N9GB 1X15A 2D8AA 4NJOA 1MUUA 1NPTO 1R4NB 5F21A 4YJGA 1D8AA 1E7MA 1P3DA 3TJRA 3DZIA 3ITKA 4EYEA 2X22A 1Y9EA 4QT0A 5ILOA 1IHXA 2CVZA 3ZNQA 1CEQA 1YDEA 2VWGA 3ANLA 3MOGA 3ZWWA 5FEUA 3AY7A 4WJZA 5AOVA 4CM9A 1WP4A 3LC2O 4E2XA 3P19A 4QXMA 1DPGA 1DRVA 2DTEA 1YB4A 3H5NA 4OHUA 2NU8A 3VTZA 1YRLA 2R6JA 1DFGA 4WE3A 5G0WA 1JWAB 3KYBA 4P4GA 3RKUA 1LLQA 2GERA 5TC4A 4CLEA 5K6AA 1E7RA 1DEHA 4B7CA 4B4VA 5TSDA 4TKMA 2NACA 3GMDA 5IDQA 4E6PA 4CM5A 3ANMA 1KS9A 3MJSA 3JQFC 2JL1A 4U8GA 4NH4A 1O95A 3JD2A 3AI1A 2X8LA 3A28A 1YXMA 1ZCJA 2PLAA 2HK7A 2Q50A 2EW2A 2XXBA 1IHYA 1ZMTA 3CXRA 3TFOA 4BHTA 2C20A 3U4DA 1O89A 2UDPA 1B3RA 3QW2A 4UVHA 3WGQA 1EFKA 1SNYA 4JX8A 4B3IA 2CNBA 3SJUA 2V7PA 4FN4A 3DDNA 2RAFA 3KBOA 1ML3A 1XR3A 1T4DA 2HJRA 4OGWA 1TA4A 2P2SA 4XYMA 5JDCC 2PR2A 2PWZA 5JXWA 3ZWPA 3OFSA 1U1IA 3MTJA 3GOHA 3I4CA 4D0SA 3JQ6A 3L77A 4IDEA 4JJIA 4OH1A 3OIFA 3ICCA 3NV9A 3OQ1A 5EL0A 1DBVO 2JFHA 2FP4A 4PLYA 3JYPA 2NNLD 1EFLA 4YQZA 2D5CA 4RVDA 2JD2A 4JJFA 4Q39A 3HHPA 4B3HA 3BMNB 1YL7A 3UF0A 5IZCA 5I7SA 4MP8A 5DP1A 3K2BA 3V1TC 4WCFC 2Y67A 2FR8A 1UP6A 3QIVA 4RVGA 2C7VA 1U9JA 1NAIA 5TGDA 2AG8A 3AI3A 4R1UA 3JV7A 4K28A 4ND3A 3V2GA 5G0SA 5A5EA 3NUGA 3GG2A 3NGXA 4M55A 4E13A 1OC2A 1VL8A 4JBHA 1Z7BA 3PLRA 5EN4A 4AICA 4BO2A 4QTZA 3GNQA 1DFIA 2C59A 4TZKA 4IS3A 4R5MA 3P2YA 1ZIDA 1Y9AA 4XJSA 3D4PA 3GVCA 4FB5A 1LDNA 1T2EA 2C5AA 1E7SA 5EQFA 4TRRA 1EUDA 5L7TA 1NNUA 2BGKA 4XRGA 1H2HA 2J3IA 5BSGA 2P9EA 4G2NA 2I3AA 1YKFA 1H6BA 4RGBA 3M2PA 4NNJA 3QRWA 1MGOA 4ALIA 3JQ8A 1M6HA 5JS6A 3U4HA 4UEOA 1E5LA 2ZK7A 3VH4A 3TZHA 1P74A 4AL4A 4A10A 1EVYA 1QLJA 1Z7EA 5GZ1A 4E5YA 2VTDA 1E6EA 1ENZA 3GVHA 3DB2A 3O4RA 4R51A 1ZSVA 2BD0A 2O3QA 1KYQA 3F5SA 4MIOA 1AXGA 4ND4A 4NK5A 2I5PO 4GX2A 4BMVA 4LVUA 4U6SA 3TWOA 3VPHA 3C1TA 3IOYA 4BKUA 2Q3EA 4N7RA 4BKQA 4MOWA 2FR0A 4XRRA 2G82A 3T7EA 3TNLA 2PKQP 3IUPA 4KUHA 4YEDA 4UVIA 3NDRA 4OJNA 3IDSA 3C7DB 4MKXA 3O8QB 2QRKA 1JDJA 2TMGA 1PZHA 1M67A 2GDZA 3FRJA 1BWSA 5A02A 1HE2A 4Q3EA 1VPDA 1QYXA 3K92A 4BKRA 1I3LA 3JQ9A 3KM0A 3LLVA 1IYZA 2X23A 1H9BA 3VZSA 4A27A 5L4LA 1PJ4A 1X7GA 3TQHA 4D3SA 3WNQA 3ROMA 2X5JO 1MLDA 1UAYA 2EKLA 3KLPX 3PWSA 5EJ2A 5DF1A 4DA9A 4NZ9A 1NTOA 1L1FA 5BNFA 4E2WA 1E1LA 2X0JA 3OQ6A 2HMSA 1YQGA 1PSDA 1ZXLA 1KETA 5CPBA 2CFCA 1XU7A 3EHEA 3U0BA 5DN9A 5TJHA 4M8SA 2YJZA 1SCUA 4EEXA 2NVUB 3WLFA 1SZJG 3ZW8A 4YXFA 3AUTA 4IXTA 2CVQA 1V3VA 2BI7A 3I6QA 4IS2A 3VH1A 2JD1A 3JQ7B 3ONDA 4TMFA 1DC5A 4CQLB 4OO3A 1NFQA 2C0CA 3KRTA 3F6YA 3O03A 1LEHA 4OIMA 4QSMA 4FJ2A 3WWYA 3PDJA 9LDTA 4CLOA 4YJFB 4DLAA 2JCYA 1J0XO 3TFQA 1E3SA 3KXDA 1PGPA 3ZH2A 2FRDA 5IDWA 2J3JA 3GHYA 1ZVMA 4R1NA 3HE3A 4NMHA 3RSHA 4BQRA 4A26A 2GR9A 1TT5A 3R6DA 3NGLA 3TOZA 4KDFA 3ZHZA 1I8TA 1K6JA 2XPCA 4JN6B 1ID1A 3ETEA 4DLLA 4QEDA 1NQ5A 4LVCA 2Q4EA 2G1UA 3PQFA 1BDMA 1Y7TA 3WYEA 4WLVA 1N2SA 3LF1A 1ENYA 3EZLA 1E3WA 3OIDA 5G0VA 4FJ0A 4R16A 3L4BA 5JSFA 4YPOA 2PNFA 3TZCA 4OXYA 4B7UA 2OL4A 2YFQA 5G0TA 2VT2A 5F1OA 3PGXA 1HDYA 5L4NA 4XJTA 1X0VA 1JTVA 3K5PA 4BKPA 1GUZA 5ICSA 1JW9B 2EJVA 2AG5A 2QYTA 4ZQGA 3KETA 5T5QA 1Z45A 4BNYA 4A03A 3PYXA 3LVFO 4N18A 1F8GA 1Q0QA 4IGEA 3BTUA 4G5HA 4JP2A 4KTTE 3RC7A 2Y93A 4OMUA 1ADFA 1KY5A 2D2IA 1TVEA 3ETGA 4LISA 3BMOA 4JXKA 3P2OA 5EINA 1NVMB 3KVOA 3M2TA 4BO7A 3PJFA 2AQKA 1VJ1A 1JU9A 3E6AA 2W90A 4PVDA 1DOHA 3LQFA 4IDGA 3K9QO 4TRMA 3GT0A 4AJOA 4LK3A 1C0KA 1U7TA 3PDUA 1JLLA 5A9SA 3WLEA 1KVQA 1ISJA 3TDKA 3ULKA 5CDGA 4ZHSA 2WD8A 2AQHA 4KQXA 1ISMA 1P1RA 1GUYA 4R3WA 3RBXA 2VOJA 4XKJA 2A9FA 2I6TA 3WGTA 2GN6A 3MWDB 1AN9A 1V8BA 3H9UA 3JSAA 1E3LA 4TROA 1GV1A 4MP6A 2DT5A 4PG7A 1CERA 4MVJI 2RHRA 4LCJA 4PLVA 1GV0A 3D3WA 1P9LA 2DTDA 2BELA 3DOOA 3DTYA 1MC5A 2HJSA 2FY8A 4R3NA 2JHFA 3WTCA 3ZU4A 3RD5A 4EW6A 2HK8A 1DIAA 1IPFA 4J9UE 2OO5A 5FF9A 4FGSA 1PU2A 1U5CA 4KDEA 3I52A 4I9HA 3CMCO 2OBYA 1BMDA 2X6TA 4J1QA 2X5KO 4NU5A 1F12A 1CDOA 3FSRA 2ZQZA 3MTGA 4DMMA 2CZCA 3E9NA 1VM6A 4MVJE 5JC1A 1I5RA 1R0SA 2OHXA 4DQUA 3KO8A 2ILTA 3AJRA 3DHEA 3GZNA 4FD3A 1W4ZA 4WPGA 4IDDA 3U5TA 4OOEA 3WMWA 1TI7A 3BMQB 2BKAA 2Z5LA 1Q7CA 2HMUA 3I23A 1NYTA 2ZKLA 3TRIA 3ORFA 3TPCA 1V35A 2IEDA 4Y8VA 1DHRA 1OOEA 2IRWA 4E32A 2NQ8A 3WWZA 1BDBA 1YWGO 1RWBA 2E82A 5K9ZA 3VC7A 3WMXA 4HV4A 1X0XA 1LLCA 3ZU3A 7ADHA 5EIOA 4HWKA 4ALJA 1QYCA 3ZU2A 4YAKA 1R4MA 2X58A 2HUNA 3KSUA 3KLMX 4E2ZA 1KBZA 3RBZA 4IBOA 2QQ5A 2P4HX 3E18A 2C2YA 4RF4A 4RJTA 5JY6A 2FOIA 3CMMA 2DUUA 4UVEA 5U1PA 1CQJA 2EP5A 2Q2VA 4L73A 2CUKA 2PK3A 4RPHA 3DWFA 1ISHA 4R68A 5TT1A 3SEFA 3A14A 4TVOA 3W8FA 4JIGA 4B4WA 1K6XA 1SO8A 5B37A 2Y0CA 1CIVA 4DVJA 3MOIA 5AXCA 1LJ8A 3VDQA 2W2LA 2BFMA 4I9NA 2AA3A 1PJSA 1EUZA 1GQ2A 1I2ZA 1ONOA 3FNHA 1XQ1A 3NYWA 3AUUA 3PEFA 4KZPA 2X0RA 4M54A 3WGGA 4NQZA 1HE5A 1Z74A 5K6AC 4AG3A 1VKNA 2PD3A 3PPIA 5KCZA 1UZLA 3TF5A 3QWHA 3GAZA 1R6DA 3ZGYA 1RYEA 3DBLA 4GGPA 3X2EA 4NDNE 4BMNA 1FF9A 2GRAA 4NR0A 3MZ0A 4PG8A 1VSVA 1SMKA 3SLGA 1BSVA 3HQ4O 4RVFA 3JQGA 5DOVA 5I8ZA 4ZQFA 3W6ZA 2NU9A 4WK6A 3DBRA 4JQCA 3JD4A 1U28A 1YJQA 5HS4A 2JFFA 2BRUA 3QVSA 2X86A 5IZ4A 3VTFA 4RZIA 5F5NA 5CFZA 4AJLA 2PZKA 3M1AA 3U4IA 3GZ4A 2GZ1A 4HADA 3EZYA 2BHLA 4CLDA 3D5QA 3PZRA 3W4KA 2YZ7A 3E82A 4W7HA 5A9TA 4BNGA 4XDYA 1U8XX 4WOKA 3PGJA 3H3FA 1LRLA 2JD0A 3H9QA 4OOFA 3OM9A 2QW8A 3I9OA 4RVUA 1A72A 2P91A 1DJQA 1BXKA 4K1LA 4XGNA 1ZK4A 4Y9DA 2YHIB 3A4VA 4CM4A 4DMLA 1NQOA 4PLZA 5IZCC 3FN4A 1H6CA 4KTVE 4KQWA 3CINA 3PRJA 3PFWO 1ZBQA 5L53A 3WGZA 3JYLA 1R37A 4EITA 5AQ1A 4YQYA 1HSOA 3WG9A 1Y8QA 1U4SA 3AFNA 3C1OA 3H5AA 3MJTA 3K2EA 2GASA 1X13A 3W8EA 2EHDA 3PYLA 5A03A 1OAAA 4EJMA 2W2KA 3RUFA 3H7AA 1N5DA 1MB4A 4B8WA 1SB9A 4PCVA 1PZGA 2HCTA 2DM6A 2H63A 3JYNA 4BO9A 4XX0A 5G4KA 4NU6A 1TB4A 1NM5A 4AFNA 2YFHA 2UUOA 3PYMA 4AJ4A 3PI7A 1A4IA 3WQRA 4NBUA 2C54A 1FXSA 1D1SA 4HXYA 1DC4A 4CM8B 2YV1A 4NHEA 1PWZA 1KEWA 2GN9A 2G76A 2J6IA 3RUIA 5ICMA 4CMEA 1PJ3A 5JC8A 3FR7A 3RFVA 4CM7A 3UXYA 3K8ZA 3AUAA 5BNIA 1I30A 4PVCA 4NG5A 3ADPA 3BA1A 2NU7A 4YJDA 2FPGA 4Y67A 4YJHA 5IFLA 3COSA 3PQEA 1MA0A 1E92A 4NBRA 5H83A 4II2A 4BGUA 4D79A 5IG2A 5JAIA 3QWBA 1MC4A 1GADO 2O7SA 2W98A 3F4LA 2G5CA 3G3EA 3QSGA 2VTEA 4PLCA 4FFLA 4LGVA 4DXHA 5KJ6A 2UVDA 5DCYA 1HTBA 3ENKA 1JVBA 4TSKA 4P4LA 3GF4A 5I7VA 2QYSA 3GUCA 5AVOA 2ZJ1A 3PHJA 4BNLA 4XWYA 2X4GA 4O6VA 3JQ9C 1BW9A 3HADA 4LRTB 4ALMA 5JMWA 4HNHA 1D3AA 5DBGA 2O3UA 3DHYA 3L9XA 3NT5A 4JJGA 4YBZA 3TOXA 4CV1A 1HT0A 3HWRA 4RPKA 3C24A 3GDOA 2HLPA 3RQSA 1NQTA 3WIEA 1U3WA 5AXBA 4BO3A 1QXSA 3EDMA 3TL3A 4RQUA 2YQ5A 5DZSA 2GD1O 5TT0A 2GPTA 3A9WA 2DUWA 3VVCA 3RBVA 3WQQA 1NX6A 2Q46A 2YYYA 1V3UA 5CAEA 3H3JA 5ILGA 2EGGA 4JP3A 1HE4A 1GQYA 4R5HA 3Q1LA 2OFPA 1HDGO 3CZRA 3JQAB 5KJ1A 1PJQA 1M75A 1ADCA 2P5YA 1OI7A 3I4FA 4QQRA 1E1NA 2NSDA 5F1KA 4NPCA 2GZ3A 1HSZA 3CUKA 5DBFA 3QY9A 2ZCVA 4MKZA 4TVBA 1UP4A 3U62A 1WMAA 3IP3A 1K89A 3R1IA 1Q2XA 2CVOA 4DYDA 4YT8A 1GYQA 1PZEA 1Q0HA 4IDCA 1C1DB 2EXXA 2E49A 5I7FA 3BTVA 3BTOA 4E5PA 1GZ6A 3WYBA 3RI3A 4KWHA 1JKJA 5CHEA 4PZCA 3RAJA 1O0SA 1IB6A 2NWQA 4CV2A 2FSSA 5DCUA 4GX1A 3IMFA 4E4YA 3BHJA 1T1RA 3F1KA 2B5WA 1J6UA 2IZZA 1H6DA 4HNGA 4MP3A 1P1JA 3BMNA 3BXXA 3M1LA 4MO2A 5DNAA 3VPXA 1E7QA 3L4BC 5MDHA 5ITWA 1L7DA 3LF2A 4I08A 1KY4A 4J4BA 1VSUA 3LDHA 4TZTA 2UV8A 4FCCA 2NVBA 3WOHA 4HY3A 4FFRA 3E48A 2B83A 4ZD6A 1ZK2A 4AJJA 4CODB 3DAGA 1DRWA 3AU9A 3GQVA 2DPHA 3R3JA 5DULA 5ER6A 4XR9A 1UDAA 1KVRA 3PJDA 4Y98A 1IZ9A 3K30A 3EGOA 2P68A 1LLUA 1PS9A 2DBQA 2YW9A 4DYVA 2Q2WA 3G0OA 4XIYA 1X1EA 3I9LA 3QQPA 1EVIA 4UUPA 2Y1GA 4XIJA 2PV7A 4EUFA 1SEPA 1TXGA 5TF4A 3WXBA 5CEFA 5DDIP 4IJVA 2O3RA 2RCYA 1R0LA 4W82A 5BSFA 5JDIA 1XGKA 2P4QA 5DCWA 1PJ2A 4BL5A 3GNTA 1ADBA 1VL6A 2FR1A 4P8RA 1PJLA 1HE3A 3H9GA 3F46A 1QSGA 3RUAA 4IIVA 1XLTA 2CF6A 4OXNA 1YBVA 4GLLA 4CR6A 1ZMOA 3CEAA 3TSCA 4M86A 3CPSA 1K3TA 4YAEA 4YAIA 3KEQA 5T67A 3HUDA 2QRJA 4Q9NA 4Y6RA 1E1KA 4IJKA 4IQ0A 3MJEA 4Z3KA 3DZBA 3V5NA 4M89A 3RWBA 5C7IO 3PIDA 3WGIA 4WLUA 1GL3A 1W6UA 1JA9A 1W73A 2EKPA 3WIDA 1DSSG 2O3TA 4I1IA 4ALLA 1N1GA 3O8QA 1N8KA 1SEVA 2DBVO 2PD6A 4WECA 3RASA 3UCXA 4LSWA 1GZ4A 1WW8A 1ORRA 4Q3NA 3JD3A 3Q11A 1QKIA 1BVRA 1NWHA 3D5TA 4IDBA 5T8KA 3L07A 2NTJA 1IZ0A 1JN0A 2B37A 1ONNA 1NR7A 3NT2A 1QMGA 4LRSB 4E12A 1LDEA 3O38A 1I2BA 2VRCD 5IN5A 2DQ4A 2GYYA 1BHSA 4MVJP 5KKAA 3FBGA 4NBWA 2OGUA 4DREA 4BNHA 4EUHA 3FPCA 3DEYX 2ZTVA 2NVUA 5JAQA 3RCBA 3UCEA 2H6EA 2E48A 1OFGA 1V3TA 4UEKA 5IDYA 3Q9UA 3JTMA 3VHRA 4BOYA 3W4IA 4Q3BA 1HDOA 3JQ7A 5C7OO 1UXGA 4Z0TA 4BGIA 5KJCA 4CQLA 2IDZA 5KTKA 2WE7A 4YJGB 1GZ3A 1U7HA 3IJRA 4BNJA 4PLWA 3UOGA 5A04A 3ZWYA 4J3FA 3C85A 3D4NA 4YJFA 4AJ1A 2BLLA 3JQCA 1UZNA 3KUXA 4H16A 1E6WA 1Z73A 1AHHA 3JQEA 2ZCUA 4NJMB 1IUKA 1S7CA 1EZ4A 1G6KA 4WLEA 1JAYA 4FFNA 3KSDO 1IPEA 4MVJA 1MXFA 1GCUA 4FFOA 2I9PA 1WMBA 1E5QA 3R0IA 4KP7A 5MGBA 3LT2A 2GLXA 4FOSA 1B2LA 1E3JA 1T4BA 2Z95A 3KB6A 4BNFA 4D46A 2HO5A 2R2GA 2C5EA 5DOZA 4J1TA 2O23A 3RC9A 2OZPA 4G65A 1YGYA 3PHHA 3GPDG 4CUKA 4E5MA 4HX5A 2R00A 1WWKA 5ER9A 3DZJA 3ZI0A 3INRA 3AY6A 1T26A 5JCJA 1O8CA 4I5EA 2GF2A 3AM4A 4U0KA 4B8ZA 3AM5A 3PWZA 5T57A 2CD9A 4II3A 1XSEA 2E4AA 3ABIA 1EQUA 3WSVA 5A06A 4CLRA 1PGOA 3ZWBA 2I66A 3NJ8A 3KHUA 4XB1A 1U5AA 4DBVO 5B4UA 3ZV3A 1P1KA 5EERA 4H7PA 4TWRA 1XDWA 2EJWA 2I76A 4F45A 2EWMA 5COBA 1B7GO 3QHAA 3PIIA 1JQBA 5A05A 1RKXA 3DXFA 4IZHA 1Y81A 1GY8A 1N7HA 4XYLA 3H6KA 1J5PA 4IXWA 4CL8A 1X7HA 4ZN6A 3ZWOA 2DU8A 2WWRA 4HUJA 1W8DA 3OA2A 5B1YA 4J43A 4D45A 3RFTA 2RBEA 1B0AA 4IDAA 2EGHA 5L51A 3FR8A 3DL2A 3JD1A 2O48X 2QZZA 4N54A 1P0FA 3VKUA 2IE0A 5TS3A 3NAQA 4YVFA 2VYVD 3AI2A 4JNKA 4RQTA 3PTZA 4CMGA 1B26A 1PS8A 2I65A 2ZATA 4J2OA 4FFMA 1YQXA 3ZV6A 5U4QA 2TMDA 1C1XA 4YT2A 4ZJUA 1XQ6A 2NM0A 3INGA 3K6JA 3S2FA 2D1YA 4PIVA 3GDFA 3GH3A 2NV6A 1NFRA 4EJ0A 1K2WA 1PX0A 4CL3A 4WLFA 2CF5A 3RROA 3B1KA 4FJ1A 4BNUA 2JCVA 1LSJA 1MG0A 1KVUA 4IZIA 3GEMA 3WFIA 3KYCB 3UGKA 4PLGA 1OMOA 1VE9A 1VKOA 4C7KA 5EPOA 1HYEA 4GH5A 2JAPA 4PRLA 1LTHR 3HJAA 3S1LA 1G0NA 4WASA 1PL6A 3ONEA 3GA0A 1PQWA 3PHGA 4MINA 3IC5A 4CMIB 3GG9A 1C0LA 3E5MA 4E3ZA 1SC6A 3RFXA 5B12A 3OJOA 4L4RA 4LMPA 2DAPA 3GPIA 1HYHA 2X0NA 3H9JA 4BB5A 1H6AA 1IY8A 2QIOA 1C14A 3ETDA 1UXJA 4CJXA 2ZB8A 1PL8A 2G17A 2PH3A 4CM3A 4CMEC 3UUWA 3L4SO 1C3VA 1UZMA 3W4JA 4JGBA 4FC6A 1VC2A 1H93A 5TIIA 4RV9A 3AOEA 8ADHA 5LDHA 1ZK0A 4AJEA 5BQFA 2YV2A 2VRCA 4Q3CA 3KOUA 4RORA 3ZV4A 3B1JA 1ZSYA 4GSLA 1N1EA 2NTNA 1BG6A 1NXQA 1Y8RB 3N7UA 3MJ4A 3NEPX 3KZVA 4R1SA 1GCOA 1F14A 1JVSA 4GKVA 1OBFO 1RPNA 2EEZA 1HETA 5KKCA 2Y1EA 1KIFA 1PZFA 3GEGA 3JQAD 4Q3DA 2P5UA 3HDQA 3FNFA 3CSDA 4U6QA 4KOAA 4BV8A 4ONEA 1ZW1A 2X7HA 2BFPA 1P1FA 1FK8A 1RM3A 1WVGA 2Q1WA 2WD7A 4PLHA 4BGVA 4CUZA 4XA8A 2FPPA 3F9IA 3GR6A 5EQDA 1EE2A 3ZWXA 3E8XA 4N5LA 3RU7A 3ZDFA 2GN4A 2Q1UA 1CYDA 1FJHA 4O0LA 2VHWA 1FDUA 4EJ6A 3WNVA 1LX6A 3I5MA 4BO4A 4H3VA 1PS0A 3ZW9A 4D43A 2HDHA 2AEJA 4CLOB 5IAAA 3RJ9A 4E5KA 3OJLA 3ROPA 4GBJA 4ZRMA 5L7YA 4EZBA 4WEQA 2H1SA 3DAPA 3GNSA 4J7UA 2Q1TA 1EUCA 3C1AA 5L3ZA 3E9MA 1D1TA 4IIUA 3AK4A 2VHZA 4FS3A 4R69A 5T64A 4EI2A 2JJYA 1SOVA 3LC7O 4NBTA 1GFSA 1R15A 4WNIA 4CMBA 1X1TA 4OQYA 2IYOA 4CMAA 4F46A 2E6UX 1ZH8A 1PGJA 3UN1A 3FWNA 2C7GA 4XD2A 4J0EA 4J4TA 3SLKA 1XA0A 4CR8A 1CWUA 2O7QA 4ID9A 4CMKA 4E33A 3IS3A 3EK2A 4G81A 1J4AA 4MPDA 3W8DA 5K0ZA 3NRCA 4I5FA 5AYVA 1I33A 2EIHA 1EK6A 1LBEA 3FWZA 2VUTA 4DIFA 3NDIA 1DRUA 2YHIA 5IXSA 4CV0A 2NUAA 4D42A 3DZFA 4Z3DA 1KERA 1O5IA 1VJ0A 4U5QA 3B6ZA 4CQMB 3DZHA 4IDFA 3RKRA 4NFHA 3A06A 3VZRA 4BO1A 2B36A 1JWBB 2FWMX 3DOCA 4ALKA 1FDWA 3QVOA 2PGJA 2GSDA 2H9IA 1SBYA 1T24A 4R01A 4DL9A 4F6CA 5I9MA 2B69A 4PZEA 2O50A 4XR4A 4AJKA 1T2AA 2PGLA 3LLSA 3KYDA 4ALNA 3MJCA 3ZHXA 1AHIA 1PJBA 2VYVA 4ND1A 3QJ5A 5A9SB 1OC4A 2LDBA 4J7CA 3WTBA 1YOVB 2VHVA 4WLNA 2OP0A 2OMEA 3H4VA 3DC2A 3QE3A 3SJ7A 4AVYA 1EE9A 5JDIC 1AE1A 1EBFA 2VZ8A 1GR0A 5CG2A 1DC6A 5DBIA 4OKIA 2HSDA 2PKRA 2CMDA 4XQCA 4FR5A 4A2CA 3L0DA 5THQA 2I67A 5T6BA 3O9ZA 3UH1A 3HFSA 4PLTA 4BNVA 4F6LA 1LDGA 3DOJA 3PLNA 1WLYA 1HDXA 1YBMA 4HFNA 5GMOA 4D44A 1UXKA 2GO1A 2NQTA 4GVLA 5CPFA 1DXYA 4YYZA 3IIEA 1ZXBA 3OEWA 4GX5A 4DRYA 3L6EA 4PG4A 4BNXA 3FTNA 3UKOA 3AY3A 1Z75A 3EAGA 3A1NA 1P45A 1ENPA 1YE3A 2DTXA 2XOXA 3ITDA 1BTOA 4M1QA 4WCFB 5B4VA 5JYDA 4W99A 5JFOA 3FPLA 2V6GA 5EMHA 4IPTA 1GU7A 1XU9A 2ZTMA 3PP8A 4EUEA 2O4CA 2WM3A 3GZNB 4IQ8A 2GUGA 2OOSA 4J90A 4AJIA 5TLSA 3F4BA 1GDHA 1LU9A 3FHLA 5JE8A 4J9VA 4BNWA 1A5ZA 5T8KC 1EVJA 1W0CA 1LC0A 2QHXA 3WBBA 5IXYA 2IZ0A 3CZMA 4URFA 1GPDG 1VI2A 1PWXA 5JNLA 1N92A 4GMGA 3DZGA 3FTPA 3SVTA 2ZB3A 4F3YA 3LT0A 4L0QA 4YACA 2PY6A 2VNAA 5DT9A 5LCXA 2ZQYA 1HDCA 4J7XA 2VZ0A 4XEHA 3WQSB 1OZAA 1R4MB 2AQ8A 2C82A 4FIZA 3B1FA 1YL5A 2CSUA 1WAMA 4DPLA 1FDSA 4FC7A 3KSZO 4WKGA 2Y1OA 2IODA 2GNAA 4ZGWA 1EDOA 4NI5A 1M6WA 3UCFA 4UULA 4ESOA 2O2YA 1HEUA 2YQ4A 3DR3A 3I9NA 4WUVA 4XB2A 3JQBA 3OBBA 3ENNA 4CV3A 4TKLA 3T4EA 3OA0A 3AM3A 1C1DA 5ENVA 3NKLA 1DB3A 3QLJA 5I9LA 4FPXA 3BMCA 3DMYA 3GUYA 4XZ3A 3ZNOA 1JAXA 5F1PA 1SOWA 1ULSA 5A4DA 3D64A 4Q3AA 1DFHA 1T2DA 2HAEA 1BVUA 1I24A 1YB1A 1ISGA 3D0OA 3OP4A 1N9GA 3UHAA 4GQAA 4ITUA 2D59A 1R4NA 2QG4A 4RDIA 3QWFA 4C7JA 2VWPA 1ADGA 4O63O 1NPDA 2J5RA 1P0CA 2R00C 3QV1A 9LDBA 4D3FA 1H9AA 1GTMA 3EMKA 5AXAA 4UAGA 1LUAA 1NASA 4L75A 4QFCA 3ROQA 3H2SA 3GFBA 5B4TA 4A0SA 2Q49A 3OIGA 3F1LA 4GSKA 2WYUA 3IUSA 1B3BA 1DAPA 1YL6A 1CQIA 3S8MA 5JBIA 3DBHB 4B4UA 8LDHA 1CJCA 1HL3A 2B0JA 4OSOA 4RF3A 5KNLA 1XYGA 2EV9A 2XF8A 3DAFA 5A9RA 2Y68A 3ZWAA 3OJFA 4AJNA 2GZ2A 5IN4A 3DBVO 1C0PA 1P31A 1N7GA 1PJCA 4O5OA 3SC4A 1AUPA 4PGFA 4XQGA 2AEMA 1Y5RA 4XDZA 4GLOA 1MV8A 4CLHA 4L4SA 1X7DA 3K96A 2D5AA 3W6UA 5HWSA 5JY1A 3VAZA 3IAHA 1U2GA 4U0JA 2AW5A 1WZEA 3PVZA 4YT4A 1HLDA 4U7WA 4QX6A 1G0OA 3P7MA 4B3JA 4TRNA 6LDHA 2XXJA 2WYVA 4AJ2A 3PHIA 1XKQA 2VNSA 2ZJ0A 4BNTA 1M66A 4BMSA 3PZBA 1Y8QB 2J5KA 2RHCA 3ADOA 3UW3A 3U49A 3NTRA 3QP9A 5I7EA 1UDBA 3H9EO 3G1TA 4YRDA 2OORA 4R41A 3R3SA 1NP3A 4NK4A 5FI5A 4RF2A 4LMRA 3QWAA 1LDMA 2CDBA 3I6IA 2I99A 3Q2IA 1ZFNA 4RPGA 3QVTA 3L6OO 3P5SA 4BNNA 1LA2A 4BO6A 2CDCA 3V2UA 1MXHA 2V6FA 3I83A 3I3OA 5BSHA 3IKTA 1RM5A 1IL0A 1K5HA 3CE6A 1XELA 4OXKA 1V9LA 5A3JA 1B8UA 1YH3A 4XGIA 2W8ZA 3GVXA 2HK9A 4PN3A 1UDCA 2IEBA 1V0JA 2WEKA 2JAHA 5ADHA 1ZEJA 4OM8A 4WLOA 3RIHA 1QLHA 2WSBA 4K9DA 1U3TA 3WB9A 3INTA 5BSEA 3DFZA 4HP8A 4RL6A 1LSSA 1MFPA 4O59O 4DC0A 5KIAA 4YWJA 3WJAA 3UVEA 1P77A 3AW9A 3RU9A 4Y6PA 5KJFA 1YJ8A 3LK7A 2VUSA 2H5LA 4HFMA 1I3KA 3RJ5A 5JCXA 4MIYA 2IZ1A 2B4TO 3OJEA 1LLDA 2B4RO 5CDUA 1KEUA 3BIOA 4ND5A 4W9NA 5JO9A 5BR7A 1R0KA 3U4CA 1ZK3A 1NPYA 1E77A 4ZVVA 4YRAA 4BB6A 4FBGA 3AOEC 3L9WA 4NJMA 1H94A 4IUYA 2PD4A 3STHA 3FD8A 4Z9XA 4UVDA 2FZWA 2EKQA 1SPXA 2P9GA 5HS6A 1L7EA 4RVHA 1BW9B 2QRLA 2F00A 3JQDA 4IMPA 5COAA 2VUUA 5G0UA 1KC3A 1PJTA 1YS4A 2HU2A 1RJWA 4H15A 4IJUA 4MVJF 2X9GA 4BKOA 2DBZA 2D3TA 1QYDA 1CF2O 4EGFA 3V8BA 5JAMA 3HNPA 2RIRA 5JO0A 3E03A 3NX4A 1B8VA 1TEHA 1BXGB 4OKNA 4K26A 3GEDA 4BNZA 4I5GA 3LT4A 1EK5A 1H2BA 4WNCA 5CDSA 1EEHA 3QWIA 3FF4A 3FBTA 2O4UX 4GGOA 1ZSNA 3VZQA 1YVEI 3IP1A 1PQUA 2XAAA 2OBNA 3TZKA 3PWKA 4S1VA 3KV3O 1ZK1A 4PG5A 4WEOA 1A4UA 1PL7A 5G2OA 1EVZA 4J1NA 3ZNPA 3RC1A 5HBRA 2UUPA 2CY0A 3RUHA 4YAJA 4ZU3A 5CG1A 1F17A 1HYGA 4E2YA 4WOJA 4YTEA 3WYCA 3WGHA 3GLQA 3UAGA 2ZIZA 5DP2A 1MG5A 3E1KA 4CQMD 1DIHA 5THKA 2BF7A 4J6FA 4KUEA 3GMSA 2C29D 2VT3A 4CMHA 4L9RA 4K6CA 2WMDA 2A94A 3I9JA 4FOOA 4HKTA 2X0IA 5L4SA 1MFZA 2Y0DA 1XWFA 4DQXA 3HSKA 4PZDA 2NU6A 3FI9A 2OUIA 5KWEA 4HBGA 1HWYA 2Y1DA 1Y6JA 1JKIA 3D1LA 3ZCXA 1I2CA 1KEVA 4RCVA 1P33A 4LSMA 3GRKA 1IULA 1T1SA 2VN8A 3HB5X 5U9CA 2PZJA 1GPJA 3D3EA 1CETA 5CDYA 3NDJA 3N58A 1JKFA 1A9YA 1E3EA 3Q6IA 2Y66A 1O6ZA 3VDRA 2VCYA 3MEQA 2DBRA 4PLFA 4E21A 2BH9A 4CMCA 3LT1A 4ZQHA 1DIRA 4WGGA 4A73A 3KYCA 3LC1O 5A1TA 1FDVA 2ZB7A 3K31A 3ZHBA 5HA5A 2X1HA 4A5OA 5KVSA 3PFFA 3LSYA 3WGOA 3ON5A 4XCVA 3LZ6A 1UAGA 3HFGA 3RVDA 2B5VA 1ZO8A 4CMIA 3ZWMA 4YB8A 2WE8A 1HZZA 1U2DA 2IXBA 1LNQA 4IM7A 2FZEA 1Z6ZA 4RLHA 4GKBA 3PJGA 5JAZA 1LRKA 3AWDA 3DTTA 3VZPA 1UR5A 1KVSA 3JYOA 2FHSA 1GYPA 1NBOA 2ZB4A 4J0FA 4RO0A 1AGNA 4QO7A 3GRPA 4YDRA 3WBFA 1K0UA 3L6DA 5AXDA 3ASVA 1Q7GA 3SXPA 3EC7A 4I9UA 4MJLA 3CKYA 1QR6A 3EVNA 2DFDA 2YHUA 2PGDA 2X9VA 4BV9A 2BMAA 1LXCA 3Q9NA 5IF3A 5HRUA 2Q99A 3BYZA 4Y6SA 5TRTA 3H8VA 4GAEA 5KVVA 5LDGA 1DJNA 4W6ZA 3WS7A 3OMLA 3OF2A 4IJWA 1LC3A 1VLLA 4NBVA 5TJ9A 4BNMA 1Y8RA 5BNTA 2VYND 1NVTA 2EW8A 3DMTA 1EDZA 5IDXA 4MIEA 5L9AA 4WCDA 2AEFA 2HMVA 2PTGA 3GN2A 3H2ZA 1E0DA 3NTQA 5ENDA 2PZMA 3VKVA 4BIIA 4CR7A 3I9MA 2A92A 1KOLA 1SAYA 3S2GA 3OQBA 4CUJA 3DQPA 4BNIA 1E7YA 2OP1A 2Y05A 4UVGA 5FFFA 1F0YA 3S2IA 2WJPA 4D41A 1WZIA 1KVTA 2W2LD 1NR1A 3OECA 4IMRA 2NADA 4N5MA 4ZA2A 4R9RA 3JQ8B 1ARZA 4HFRA 1E6UA 2G0TA 3ZV5A 4ILKA 5CEEA 4YR9A 3CH6A 3IL2A 1RYDA 1J49A 5I8WA 4GWGA 3C7CB 4IQGA 5CP8A 4Z9FA 1MP0A 5LC1A 5C37A 1QYWA 3BTSA 1Q7BA 2A4KA 3Q0EA 5JPIA 4D7AA 1U3VA 2HRBA 3BMQA 3AUSA 2PZLA 3F5QA 1B14A 3JQBC 2BFOA 1WPQA 3IQDB 3AOGA 3EUWA 3GC6A 1I3MA 1WDMA 5KJEA 4PG6A 5FWNA 2VRBA 4E30A 2QX7A 5H81A 1HXHA 2Q45A 1NHGA 2WDZA 3ZNNA
chains in the Genus database with same CATH superfamily
1KO8A 2AQIA 3EBOA 4CF6A 4IIGA 2XYGA 1GZ7A 3JWPA 4ROSA 1DS6A 3AL3A 4PONA 4WKNA 4LF7B 3A3KA 1J8YF 1SA0A 3DEIA 3HTXA 4R2LA 3AVPA 2BFCA 2CCGA 1FTWA 3GGPA 1D2EA 4XD7D 3GPLA 3R3WA 1O87A 3IO5A 3WSWA 2FEXA 2ZRFA 4V0KA 3D1JA 4ZYYA 2FPOA 2QMEA 1BFKA 3QPBA 2DQZA 1PV2A 4JR0A 1KO7A 1L4MA 2BKXA 1OXSC 1DEAA 3S2EA 4BNKA 2V3CC 1U0BB 1JG1A 1P44A 1XZDA 1XO1A 1ZM9A 2C9BA 1VYVA 1D4FA 4RH0A 3E9QA 1CIJA 2Q6IA 4O1MA 4HI0E 4TMKA 1FFBA 3MWEB 2ODAA 3I28A 4LDZA 2I80A 3LPMA 5IP5A 1XYYA 1D4OA 4TRJA 4EYQA 1GZ5A 2AIRA 2NO7A 1EFDN 1F4PA 1ISIA 2FPUA 3BIWA 3K1TA 4ENQA 4MVJH 1M0TA 3V2IA 5FBWB 4GYJA 3VISA 5JZVA 3CNOA 2F17A 3B2QA 3MCAA 4EBBA 2F8TA 2FNAA 4XARA 4ON9A 5KC9A 5AWFC 3GY0A 1ULUA 2ZSJA 4H9GA 3L1IA 4EQ6B 1JIKA 1I01A 3F3MA 4NABA 2BGMA 3CTMA 4K9SA 1F8FA 1KC1A 4MGHA 4F3RA 1TKAA 3ZTYA 1DJMA 2J45A 3BAFA 4UM5A 5I6DA 2H0AA 3E5RA 2K5UA 2FUCA 4JCOA 5EXXA 5JTUA 3UIEA 1V11A 2GKSA 2F9FA 1EK0A 1HKHA 3LCUA 1NFFA 2ZUVA 3P0JA 3QV2A 2EDAA 3DZCA 3EPPA 4KQHA 4QYXA 1A8IA 5F3RA 1D04A 2QM7A 2RGNA 2O3SA 3SI7A 3ZBPA 1WDLA 1I0ZA 3AWIA 3W3AH 3FSJX 2QJTA 2QLLA 4U7FA 5HCUA 1W93A 3U0VA 5JALA 5JDCA 2EG5A 3FFAA 4RCYA 4YRBA 5KYWA 3DZKA 4IL5A 2H11A 2BI8A 1G21E 5B6IA 1MX9A 1PR3A 1T0BA 4O08A 1LQTA 1EMDA 4UXJA 1R6VA 2ZRMA 3D6UA 3OVMA 3D7SA 4WFKA 1AHPA 1UWKA 2WM2A 5E6SA 4I1UA 3C6BA 5AHKA 3ROTA 1W5SA 1PN3A 1KO4A 1ODTC 4AYTA 3BWCA 1SVWA 4TWBA 1ZZEA 5KNCD 1O1YA 1U5BB 3A6DA 2GTPA 3PITA 1YZNA 5LWHA 5EQTA 3QFHA 1Q6ZA 3H04A 3CXUA 4GL4A 1HZJA 1NN0A 2HQ1A 1VKJA 4X66B 3KB8A 3TIIA 1SKMA 4ECEA 4Z4QA 2I2DA 3DEFA 1C80A 1UCFA 5A6VA 3NATA 3HPQA 4MVJG 2XMQA 1N2BA 4KMSA 2UYHA 4HBZA 5JJLA 4RJ2A 3GDGA 4DIOA 2QI9F 4M0LA 1NHWA 3W0LB 4HMQA 1BEUB 1DQRA 5EFOA 1U8FO 4MKRA 5B30A 5HQTA 3HG7A 2D06A 5DRYA 4JENA 3ZN2A 4BS9A 3SKXA 1PT9A 3FHJA 2IUFA 2CLKB 1U6KA 5ABPA 5BN4B 1IOLA 4ARIA 2F9MA 2QAIA 5K4AA 5JWRA 2J3MA 3B6EA 3RVJA 3VR4A 5J23A 5IVHA 2GM4A 1PEDA 3I0MA 3TTSA 5B7NA 1XG5A 3EEFA 5KYXB 1WA5A 3B9RA 4LV5B 1KI6A 4BJ1A 5ICCA 4C2BA 1RPAA 5G41A 4WKBA 2JCSA 3DSRA 4LFAB 2DUMA 3UWDA 1SURA 3TB6A 2QRGA 4Y2SA 5E6UB 2JEZA 4L3VA 5BSTA 1BXRB 1VLQA 4P80A 4BVAA 1XKXA 3EIOA 3MILA 3KR2A 2NTYC 1F1BA 1FSSA 2ECOA 1G2PA 4GOLD 1NWCA 1CRPA 1Y98A 3B70A 3SYKA 2DG2A 3OHSX 4P38A 4UUAA 3NT4A 5K6RA 2IHYA 1JL3A 3GVPA 4KFCA 1SKQA 3R7WB 2X3UA 1UKBA 2VAXA 2H4JA 3FYCA 2CDAA 3M6IA 1GUAA 1VKHA 2JC3A 4X1IA 2WF9A 3EMVA 3HI6A 3NKFA 1I1OA 1PR9A 1K7FB 1GA1A 1WMEA 4HDOB 2EFYA 3EF0A 4KW7A 2G25A 2WTBA 2IEAA 4UPVA 4EB3A 2OA0A 3RDPA 4QFBA 4L07A 1NAHA 2BFAA 5AW1A 2HU8A 2JJMA 2X4DA 4FS8A 2BCGY 4UBIA 3ENWA 1L7MA 5DU2A 1AV6A 2D1SA 1G1MA 1T5OA 2F62A 2WWIA 3O5AA 2R4UA 3AZOA 1G8PA 3NCHA 4FDAA 4LEIA 2GFHA 1C41A 4EJSA 4Z6KA 2QD1A 3JATB 5FR2A 4LOKA 5EUBA 4KEAA 4INAA 1WSDA 4QYIB 4OSPA 5CYGA 3SC4A 3FLAA 2OWDA 3HDTA 4KRXA 4Q9AA 3UTCA 3UJ8A 4C3UA 2IS4A 5FR1A 3HBFA 3CF4G 1HG0A 4Y6LA 2J0QA 1R66A 3G2KA 1J99A 1E3IA 3B5IA 3IVGA 4NMWA 1L7RA 3BWBA 3VBCA 3FIUA 1SUIA 2OLKA 4B4OA 5A62A 1VA4A 4O29A 3U3XA 3I9KA 5MF6A 3RAGA 1GNSA 4MCHA 4ER5A 3AVVA 3GRCA 5EESA 1OPXA 1QV7A 4M87A 1O9HA 3GLGB 5BUSA 4YLGA 3U1TA 3G17A 1DQSA 4RDHA 1Q0LA 3SIXA 3BT7A 4CCSA 1Y9DA 4K6OA 1VL5A 2J3KA 2POQX 2X8BA 4MLZA 4REQA 4ZP1A 1L5KA 1JXQA 2AXQA 1VSBA 2WYWA 3V1LA 4PBTA 1DCTA 3COPA 3WAGA 1DDOA 3IUMA 4BYMA 3COVA 5KVCA 1DLIA 1DKPA 2B35A 1YBAA 4PRZA 3DHNA 5IVDA 4BO0A 1AXEA 4C4YA 3HY6A 5A0TA 1US8A 1H0KA 3BD9A 1OAOA 3C97A 1MX3A 2F8LA 3CIFA 4G5FA 4H4CA 4YP5A 2B4QA 4I5DA 2BGUA 4IHQA 3F6RA 3LX6A 4Z8YA 1KKLA 3R23A 5T3UA 1XMXA 1T3TA 3W9YA 4EM6A 1OI3A 3ZLJA 3STTA 2G0AA 1FJXA 3UWSA 3RHZA 1UXHA 3FOBA 4O4LB 5KCZA 1DT5A 1Z17A 3PEVA 4CKYA 1E6KA 2WNIA 3ZLTA 1A2OA 4U2GA 5KOIA 1XRQA 4CT5A 2IXGA 1EFVA 2RH8A 3ZE0B 4S3MA 1W96A 3IPAA 4DNOA 4QECA 4ND2A 1W36C 4RWZA 2Z6VA 1MX5A 2ZCJA 3R5HA 4RH3A 4UKDA 4XFJA 3AHJA 3PC3A 3MUOA 3TI7A 3WR5A 4BRWA 5BSWA 1Q3HA 4YGXB 4EBFA 2HXGA 3JQAA 3KEOA 3ZOKA 1VG9B 3WL5A 4RY2A 1GNTA 3A1EA 2QQGA 3DOIA 5FA5A 1XD2B 3C3EA 3SDSA 5UKDA 3IEKA 4E0BA 1YRYE 1PJRA 3FYUC 4M9XA 1BHJA 1YR2A 1NC1A 3A36A 4K6FA 5ITZA 4DNQA 4UPEA 1SQSA 1JDUA 3C45A 5K0GA 4HFJA 4GVXA 2MSLA 2NZWA 2YWJA 1QG6A 3BSWA 3C5CA 5H59A 4ZI3A 3EVAA 1KP3A 2LP4Y 3HNRA 4J1SA 7MDHA 2C94A 2LIVA 4B79A 5IANA 4BLRA 3NOVA 1XJWA 2Y99A 4MKGA 4HZUB 2V0NA 4DGSA 3MAAC 3LPLA 3Q3JB 3N74A 3WJ7A 1M34E 1B15A 2O3JA 1F5SA 3BRWD 3HL4A 4R9SA 5AI4A 2JHGA 5IJ9B 1PJZA 2VF7A 1MX1A 2G7MC 2ZYAA 3LHSA 2BL4A 4LZLA 1OFUA 3I4LA 4RVOA 3REFA 3DMDA 3QA9A 3ZEAA 2HRZA 4BLOA 3GEHA 4UHJA 2F64A 3COWA 4LY3A 5AJUA 1UAAA 5FFMA 4RD2A 2HGZA 3WICA 1SR8A 3HS3A 3Q7IA 4RY8A 1N2GA 1F7VA 1AS2A 1JFFA 2KHZA 2ZRBA 2PYDA 3UHJA 1EYZA 2NLOA 1HT1E 2V7QD 1ORDA 1A97A 1K6MA 2XIQA 1TM4E 3KAPA 3MAGA 3O3MB 4MQMA 3JQGB 1ZONA 2XXAA 2FTKE 1PGQA 1ZNYA 2HNBA 3S40A 5CCDA 1EGVB 3DBRB 3LXXA 2HWXA 2I7TA 2JGNA 4WDQA 1KEKA 1MDFA 4HVCA 4EEZA 4YJ3F 1JJ7A 2GEBA 1GEEA 4W8HA 4MYDA 4MVJM 3IV6A 4QDTA 3L7LA 2ZIFA 2HI0A 2GETA 1Z6GA 2PCLA 2YWCA 4MUEA 5IH7A 1P2TA 3AVOA 3SBOA 2X5OA 3ZIUA 4HRYA 4V3CA 1IQ0A 2Q8QA 4RJJA 4BC0A 1Y5MA 1NVGA 2P35A 5CD9A 1RKBA 2B1QA 4YIKA 1K4YA 1MHTA 4DV1B 3OOSA 4L2IB 1K7CA 4JWKA 3EVCA 4MRVA 5LBIA 2HEGA 3ICPA 3OQJA 4E88A 2PS9A 2XA9A 4GPEA 1LJUA 3L92A 1ESDA 5LXTA 2VDJA 3T1QA 1RI2A 1LZKA 1HDZA 3LKVA 3AILA 3UJ3X 4OMCA 1OA1A 1QS0A 3OPMA 1BGVA 1SCNE 3TPFA 1VP3A 5LKAA 1BRMA 1OYWA 3VJKA 1VMKA 2X8JA 4MTCA 1SJ9A 4A2PA 3A6EA 1HRDA 2AOUB 2VS1A 4DIBA 3W7VA 3B3JA 1RRMA 2HMTA 4TLLB 6ADHA 3B7GA 4COKA 3VR6H 4BEVA 3DMTC 2YXEA 1G5HA 3RVNA 3SQXA 3Q98A 1VJRA 1W76A 2H2GA 3M4ZA 2PXHA 3WP1B 4GOXA 1ZUD1 4D3DA 2A5GA 1L7QA 3ER9A 3MPUA 1P1IA 2ABWA 3DEZA 2VRWA 2UVQA 3AFMA 1ODIA 2C84A 4I7EA 4X84A 1JIXA 5IK2A 3V2HA 3UXMA 1FTNA 1YDWA 3WHIA 3CIOA 3DEHA 1BXZA 2DKNA 3NALA 1E98A 2ZRLA 5A6SA 1T3LA 4RV5A 1F2UA 3N86A 4GPAA 5IS2A 2FLKA 1L5VA 1K4KA 1GQFA 1B43A 4LDNA 1ELOA 3FPGA 3BC1A 3B6KA 4TYMA 2QGNA 3G0CA 4PWZA 1GD1O 2QTTA 3HKCB 4XX0B 4Z9YA 5KYUB 3AQ4A 1HEYA 2J0VA 2FEAA 1VRWA 3IJPA 4YCNA 2PX0A 1MAHA 4P08A 4EABA 2GN8A 2FG5A 2JFBA 4P7FA 4XJXA 2Q6TA 3QE0A 2IVFA 3D4OA 4JLWA 1LSUA 2ZYDA 2FV8A 3DO5A 4N5NA 1C0EA 3TLJA 4GXTA 4HAOA 3PJEA 4LIPD 4DQ0A 5G4LA 2J30A 3V1MA 1PG2A 1Z63A 5T7BA 2XCIA 3FAZA 2IF2A 3TQCA 1NJSA 1I10A 3K53A 3NFYA 4EHHA 2KX7A 4LGMA 3UAXA 3NHKA 1V1MA 3EASA 3P9PA 1KNQA 2YY7A 4IZ6A 4UUNA 2QBYA 4AT1A 4G0VA 1KYXA 3GAFA 1GL9B 3MIZA 3R4VA 2PKWA 3HNOA 3FCYA 5CLHA 3ZVRA 1KPIA 3HBNA 1CUFA 1ULZA 4B2LA 2OD9A 2OVFA 4NJOA 1Z34A 1WUYA 4HOYA 2APJA 4YJGA 1E7MA 1PR0A 2Q6OA 3CZ5A 5KDOA 3DZIA 1JLMA 1DBSA 1N5OX 5BV0A 5KS2A 4QDJA 2P5SA 4FLEA 2CVPA 3ACCA 5ILOA 4BXOB 4XTRA 4N76A 4CIYA 2VZLA 1FVOA 5KO2A 1MQ8B 1GGJA 1QE3A 1WMDA 2VWGA 3ANLA 1AM4D 3GJ3A 4N39A 5AOVA 4KJZA 2YNMD 4AX4A 1WP4A 2YXDA 3GFTA 1EP2B 4LKOA 3RVKA 3LC2O 4LE0A 4AP6A 3OZAA 3E23A 2X19A 1Q92A 3P19A 4O2BF 2YIMA 5JZMA 5K0JA 2DTEA 3EXHA 5TEVA 3R3XA 4BBZA 1E1YA 2A67A 2H1IA 2X8WA 2O8BA 1QVRA 2ACKA 4OHUA 2NU8A 3BD8A 4F21A 2EBUA 2O8DB 1RJDA 1YRLA 1D2MA 1G5RA 4BLQA 2IU3A 4FU0A 1FVXA 1TX4B 2WZCA 5G0WA 3KYBA 1R0ZA 1XDBA 4YQFA 3AFIA 5TC4A 2V9CA 1QM5A 2C5GA 4WZBB 1JJFA 4EARA 4WJLA 4B3FX 4B4VA 4QJ5A 5C9ZA 4X1YB 4YP1A 2VDWA 3SJCA 1QUEA 1TKRA 4CM5A 3FVWA 2GBCA 5HZGA 1TZKA 2HB6A 3JQFC 4U8GA 1I13A 4NH4A 9ABPA 2JGMA 2GFIA 1XZKA 4LJ6A 4UD6A 1VBMA 1O95A 2QN7A 3D8RA 2JGLA 4CIVA 2PQ0A 1CZUA 2GZDA 4GOMD 3A28A 2PLAA 4PEVA 5HF6A 3OKCA 2XXBA 2YRFA 3IAS1 1IHYA 1ZMTA 1JQJC 1RLUA 5SZJA 3U4DA 5BSKA 1B3RA 2QAGB 4G26A 4DUYB 1SXJE 1N6IA 4M46A 3ZCVA 1JR2A 4B3IA 3SJUA 1KQ3A 2V7PA 1LBQA 1UZUA 3DDNA 3CVYA 3KBOA 1MORA 4OGWA 5E6RA 2HJRA 5LMNB 1SUAA 4ENTA 2JZOA 5G1OA 3RE1A 5NULA 2VYCA 2XZTA 1ECPA 4G36A 5LZ9A 3BBLA 5EXEA 2PWZA 3ZWPA 3OFSA 4ILEA 3AHEA 1L8OA 1QV9A 3GOHA 4KWEA 1FNMA 3I4CA 4DRXB 1V7ZA 3SEQA 3MBKA 4LYYA 2H4YA 3GO4A 4ZYLA 4OH1A 4Q9LA 3EEYA 1A82A 5EL0A 1W5BA 1Z12A 4EA6A 1T8RA 1EE1A 4KPFC 2JAWA 4P93A 4TUYF 1ETUA 1HDEA 1N4AA 1EFLA 1VE1A 4R81A 3CVUA 2DLNA 2D5CA 5FPQA 2JD2A 4JJFA 4WBNB 3HHPA 2X5NA 1JPVA 2OAP1 2XVMA 4DDVA 4B4DA 2I7DA 2AOVA 2C3MA 3QHPA 1Q95A 4WVLA 4F3KA 2C2KA 2QTZA 2J48A 3AW8A 3HDVA 3K2BA 4WCFC 3CUYA 2VF2A 3MCWA 3A1FA 3K70B 2Y67A 3QIVA 4RVGA 5JECA 2PO7A 4O2BA 5KNDD 2ZTSA 3AKDA 1U3FA 1KIMA 2AG6A 2MINB 1AOXA 3F78A 3G23A 1WX1A 4WN3A 1P5JA 2ASVA 3BK2A 4QBHA 3NH6A 2I3BA 6AT1A 3NWPA 3EARA 3B53X 3NUGA 4XPZA 2AVDA 3Q72A 1XLWA 2B20A 4M55A 4E13A 2H06A 2C4NA 4CKEA 4G2TA 1CVLA 4AICA 1P4AA 4BO2A 4YYEA 5F33A 1QGED 3VMMA 3IEVA 4FDUA 4TZKA 3HYTA 3KFVA 4R5MA 4U02A 1R0BA 4MQ5A 3C3KA 4JLOA 4XJSA 3ILSA 2IOQA 4B6JA 4EKEA 2BZGA 2C5AA 3RAFC 2XOKD 3TB4A 1E7SA 1M33A 4R6WA 1EUDA 1NNUA 2BGKA 3GWGA 1TM5E 1U3DA 2XE6A 1MO4A 1YS6A 1FP1D 1G8AA 1RAHA 2I3AA 2P9EA 5AOCA 1ZJWA 1MBZA 2HRCA 3M2PA 1WZNA 1MGOA 1CJUC 2DT8A 3JQ8A 4ZV9A 4ALIA 2HX1A 5JS6A 5LLTA 4KG7A 1ZN2A 1VSQA 4UEOA 1DMRA 1EA5A 4O8ZA 3RYCB 4BNDB 1P74A 2IUUA 1ZH4A 1XXHA 1KP9A 5E4FA 5HMLA 3V7YA 3C16C 2IP4A 4EZBA 1T3HA 4GBGA 1VBFA 1FEZA 5ICFA 1A8PA 3BXOA 3R7AA 4JKIA 1KYQA 3IDZA 5IH3A 1AKRA 4HWOA 4Y2QA 3KT8A 1V7QA 3TNDA 4BVGA 4ASUD 2D5BA 4GX2A 5C8YF 2HSEA 3JWJA 1TVCA 3T7SA 3OO0A 2Q5LA 4HXEB 4ZI7A 3ZCQA 4E5UA 4MOWA 2R65A 1CKEA 2ZIXA 5EG5A 3T7EA 4BX8A 4XM1A 3PXUA 3WL3A 1T36B 2CDNA 4RMHA 4BEWA 2PKQP 2FSVC 1LH0A 1CNMA 2O2IA 4UVIA 5AI8A 2RK4A 2JHAA 2NX2A 2DWCA 1ZL0A 3IDSA 3MWJA 4MO9A 1SCAA 1PZHA 3X43A 4P98A 1F8XA 2M6SA 3KXKA 1BWSA 4FUQA 1AURA 1HE2A 1WHTA 3BB4A 3EPRA 2OBBA 3MCTA 4Q3EA 4ZI5A 3TBHA 3K92A 4YUXA 3LSTA 4HDKB 2O8FA 1V9SA 3JQ9A 2W0MA 1EH5A 1KHTA 5FJJA 3TLXA 5IX8A 2NXWA 5L4LA 2UVPB 4P0QB 2P1ZA 1H2XA 5ESXA 3F6SA 4LJ9A 4Y6OA 3ROMA 1D1PA 1V26A 1Q16A 3HSSA 4I1VA 3NU1A 1OWNA 1Y33E 4XLZA 1PRYA 3IE2A 1P7WA 3AEUB 4DA9A 4LXIA 4QPNA 1XP8A 2J0UB 1KYVA 2C2WA 1NATA 2GZRA 1PSDA 4BN5A 3UAZA 2XKJE 4R8VA 4C29A 4UU0A 4CF7A 1XU7A 3ZZTA 3LOPA 5JCOC 3NMUF 2X2OA 5TJHA 3JAKA 3UJ7A 3ZGOA 3JWGA 2NVUB 5BV1A 1CQWA 1CLUA 2DUNA 3AUTA 3COZA 3NBMA 2PRKA 3VH1A 3CEJA 3DLCA 1E64A 2FEMA 3DDHA 3HCAA 1QHGA 5FUVA 4RYLA 3CF4A 4BLPA 3AG5A 4PZAA 4QJIA 3AY0A 5REQA 4FJ2A 1NYQA 1D0SA 4Z4GA 3WWYA 4V0RA 5FUWA 1FUYB 4DCOA 2ACEA 2JIPA 4R7ZA 3TFQA 1Z26A 5GGYA 2CNNA 2EZ8A 2R1UA 1UOEA 4Q3LA 1QIGA 1JFSA 2OYRA 5TR9A 5J2TB 4H7EA 4EHDA 2P2GA 4ZVRA 3TOZA 1UBOS 5JXGA 3CF6R 4TV8F 3SZLA 5KAPA 5A02A 1H4SA 3ETEA 2AYYA 3V46A 3SR0A 1NQ5A 2P8SA 4R8LA 2Q4EA 3PQFA 3JWHA 4DIMA 3VNQA 2OV8A 3P9SA 4ZEOA 1S02A 3M89A 3R9KA 3AO0B 2ISQA 2P27A 3TIXB 4B80A 4DT1A 3WZLA 1BCRB 1E3WA 1YRHA 2IHVA 2VTBB 2YVKA 3AF5A 4O33A 1N5MA 5AQEA 3NO4A 4YPOA 3P96A 3GEPA 3WKAA 9ATCA 2A1IA 2J1LA 5IMBA 1BMQA 2OL4A 3GLVA 2HY7A 4RZUA 1Q0SA 4X1KB 3ZZMA 2P9JA 3H0CA 5L4NA 3DJFA 1PJAA 3CWCA 2KE5A 4YAOA 5E2AA 1JTVA 4LNUB 1ATIA 1QIEA 2ZT7A 4QG3A 3B1WA 1GUZA 1Y1QA 2KW5A 4B85A 3N0WA 5ICSA 2AG5A 4BVBA 3KETA 4KNVA 4S2UA 1TUEA 3EY9A 2VXBA 2BAGA 2HA6A 4FWBA 4LJKA 4MUMA 3PYXA 4G0MA 4ZALA 5JZ9A 4ERXA 4K6KA 1F8GA 4D98A 1KZGB 3NYIA 1RFGE 1S2NA 3BTUA 4HQRA 4G5HA 3DUFB 4HATA 1GRRA 4OMUA 2REOA 2DQSA 2D2IA 2IH2A 3CH5A 4ACBA 1UKCA 3V8PA 3K35A 1XD9A 3BMOA 2DRIA 1QHIA 2ZGVA 5EINA 4Q15A 1ZN7A 4BO7A 1NZJA 3L6UA 1HQCA 3PJFA 1U0HC 2AJBA 1VJ1A 3VSBA 1ZAYA 4QGFA 4IDGA 2G07A 3SHFA 1YVPA 3KU1A 4F5DA 1OXTA 3GT0A 1ZY2A 4J29A 3UTDA 2Q0HA 5FULA 1O0CA 1L5RA 4F0JA 5A9SA 1K5GA 2YYAA 2CD7A 2NMVA 4X92A 3TDKA 3TW8B 3ULKA 4F7DA 2WD8A 2YIJA 3T3MB 4WXYB 4GI5A 5FA8A 4P3XA 3W2FA 3WNDA 1GUYA 3O8RA 3BREA 5T3YA 2WUDA 4BRZA 3WGTA 5HZKA 3EVZA 1JDVA 2QTCA 1AN9A 1V8BA 5D01A 4CF4A 1X9HA 3H9UA 1AB6A 1AT1A 2C1XA 4QYWA 4TROA 1E6LA 1JFLA 3ED5A 5LYJA 2JVIA 3SEZA 3FSEA 3L3BA 5J4VA 4PG7A 1J90A 1P4GA 2RHRA 3F71A 4LCJA 4QODA 1CS0A 3D3WA 2FZCA 1ZNWA 1IAQA 4BWFB 1J5EB 3DHWC 2WHPB 2AD1A 4R40A 3JALB 2Z5FA 4TMVA 4MHTA 1ILWA 1MC5A 3FCUB 4MPJA 1UC4B 5F1YA 3JVIA 1MVNA 1TOAA 4KQEA 5KPJA 3BUSA 3WTCA 5FUMA 4JI3B 1KQGA 1XV5A 1RXSA 5CGZA 5K0BA 2VBGA 4Y30A 1Y6ZA 1G20A 3IDQA 2V7GA 4J9UE 3VHXB 4AKGA 1RAGA 3CFYA 5FF9A 3L0IB 1JG3A 4KDEA 1A9SA 2FF7A 3IOMA 3UWPA 1QGAA 4Q18A 4P33A 4LVOA 4F4JA 2FMIA 3TKAA 4F93B 3FSRA 2ZQZA 4TYPA 1NJ5A 2JIZD 5GTDA 3MBIA 4BFUA 1GNLA 2ORWA 2WJVA 4YUYA 5F7JA 2Q0SA 3S68A 2OHXA 2C4MA 3MF4A 4DQUA 2XCOA 3AJRA 3UJCA 2H5IA 4JI7B 2QLMA 4ARSA 5LJIA 1WZUA 3BGSA 4IDDA 3WLMA 2O59A 3HA3A 2OXEA 2BMJA 5CR9A 5DTEA 4TLCA 4F4UA 3EDCA 2BKAA 1YHZA 2HMUA 3OIYA 3S4YA 2ERXA 5MN5A 3TPCA 3KZ1E 3TE6A 2GM3A 1DHRA 3CH4B 1OOEA 2R9VA 3BN3A 2BSQA 3DXYA 2JH9A 3O82A 3HUFA 2FW0A 4MWEA 3HYNA 1BDBA 2R87A 2ZP1A 3UK6A 4FB5A 5K9ZA 3GU3A 2BLNA 3HCNA 1IWOA 4HV4A 3EEOA 3BEOA 3R3UA 4PF1A 2IH5A 3TDMA 1H2WA 4IEEA 1F7UA 3RM3A 2A5DA 5CLGA 2XCRB 2HUNA 2WM9B 4F85A 4IBOA 2XDYA 3LUCA 4W5HA 2C31A 4RF4A 3FLMA 3JXEA 2FOIA 5ALYA 3WNZA 4W5QA 1XTKA 4EJ2A 3E5HA 2B25A 1ZPDA 1COZA 2IZ7A 4FLMA 4BFZA 3D3NA 1E79D 3AX6A 3NRBA 4RPHA 5E9AA 2GS9A 2PRSA 5TT1A 1XFAA 2PL1A 2Z09A 3B85A 4KH1A 2GKGA 4N9WA 1E4EA 3PXCX 4JIGA 2BE7A 4REMA 4C43A 1PVOA 1CQZA 5B37A 4H3KB 3ZLVA 5BN5A 1LJ8A 2QJOA 1T6ZA 2Z6QA 2W2LA 1NVWQ 4MWTA 5EKDA 3K1AB 4I9NA 1GO2A 3WLKX 1WB9A 2FPPB 1PJSA 4B3XA 3A1SA 4UOEA 1I2ZA 1ONOA 1ZZGA 2GX6A 2I6SA 2OQRA 1U0LA 2G4LA 2OZLA 3DVRX 3GT7A 4KZPA 3PC6A 1WZ2A 4D5GA 1HE5A 4FYXA 3UANA 5K6AC 2PD3A 3M1IA 3NOQA 5KX5A 1R6DA 2WKRA 1W5AA 3CSUA 2JLCA 3NS7A 1W85B 4U8HA 4GGPA 3P9XA 4XUDA 4BMNA 1FF9A 2WJIA 3BCRA 3O93A 2GRAA 3PVCA 1RLMA 4D9MA 3B3AA 1SC1A 3I73A 3S81A 2CLDX 1Q19A 3WLOA 1VSVA 4YUZA 3SLGA 3WDKA 5LNK1 8MHTA 5DBEX 4RU1A 5ALDA 2MSCB 5I8ZA 2PN1A 1ZNXA 2R4TA 4WK6A 3R7DA 3SX4A 1CNFA 1DAGA 5BYJA 3FTQA 1TUGA 2ZYSA 2BRUA 5CFQA 1EBBA 2QVYX 3DE0X 3PDHA 3LY9A 3BJZA 3FWPA 10MHA 4X91A 3R9WA 2ZEJA 2QE6A 4RZIA 5F5NA 3FPKA 3WVNA 1ISPA 1KMHB 3M1AA 4G0UA 1CUUA 5BVHA 2WPNA 1WS6A 3EZYA 2ECFA 4JSTA 1KMNA 2RHGB 1SD2A 5DTIA 2V59A 4Y9RA 4UBLA 1ZC3A 4N12A 5AI5A 4V0OA 1J70A 1GFIA 2IU6A 1LRLA 3H3FA 3OE4A 4OOFA 2VXYA 4F5EA 1E20A 3I9OA 4B6RA 1A72A 1O54A 4ESHA 2PYIA 4F4FA 5KYGA 2P91A 1G4AE 1BXKA 1I7LA 4C1BA 4K1LA 3EODA 4TM7A 3GJYA 4Y9DA 1SHTX 3HKBB 1P6UA 3WRYA 3ZHOA 1L2TA 1T9BA 1UC5B 1M2JA 2IC5A 2QP3A 4W7SA 3VR2D 3WIBA 1EXWA 5IZCC 2LW7A 4YJ2F 1E2NA 1QCYA 1Z4LA 2V3WA 3CINA 4MAMA 3W34A 2O57A 1DAHA 1TM3E 1JG6A 4NRDA 3ZGVA 3KJFA 5L53A 3WGZA 2FR8C 3P0HA 1R37A 2VP3A 3IA7A 3PEEA 4RUKA 3EDOA 1AY0A 5AQ1A 4YQYA 3VKWA 2F3UA 3PEUA 3WG9A 3TGLA 3AKCA 4RKWA 1K8QA 3MJTA 4IFEA 1E69A 5ARDA 3RVOA 2IXTA 1QNLA 3RRBA 1UKVY 4QBGB 2GAFA 2EHDA 3PYLA 3R75A 5A03A 5AVZA 1D5WA 3CCBA 3RUFA 2V74B 3EDYA 3BQNB 1NF2A 5C5CA 4B8WA 5BWOA 2IHNA 3DE3X 4E70A 1HFWA 1OX4B 1VCMA 2QTAA 3JYNA 3L93A 3G8DA 3GYBA 3EFOB 5G4KA 4LRQA 4WTOA 1ID8A 2ONYA 4G9EA 1M6VB 4NU6A 3T1YB 3UV6A 4PYIA 4V1CA 2EJCA 3GUVA 2I4MA 4GLBA 2ANBA 2UUOA 5DYGA 1OT5A 3T5DA 4IUBS 1J0DA 2BZ1A 3CUWA 5JNRA 1FYVA 3D6MA 4HXYA 4LRYA 1DC4A 1V71A 2OAEA 1ECJA 1VCOA 2CLIB 4NHEA 1N7JA 5EWJB 1JALA 5KNCA 1KEWA 4I4CA 1UANA 2X9LA 5F3DA 4CMEA 2GZHA 4MQEA 3FR7A 4RGVA 4D25A 2JVKA 1NV9A 2WFMA 3GBVA 4EG1A 1Q5PA 4NG5A 3V4FA 1OTHA 4BFLA 2FN4A 2ES4A 2ZBEA 4GI3A 2OTCA 3HB1A 4YJDA 1QLWA 4YJHA 5EKXA 1KSGA 4YGYA 2R1ZA 4F3NA 3COSA 3PQEA 4NBRA 1E92A 5KHOC 4LBWA 5H83A 4II2A 4BGUA 5F2NA 3M6FA 3CNHA 5IG2A 5JAIA 2ZRJA 1RW4A 1XROA 3INNA 4JQYA 4OQQA 3KT0A 5A7HA 2WMOB 1Q44A 5GM1A 2YOGA 2O7SA 4Y2JA 3F4LA 2G5CA 3L0CA 2VTEA 2ZRDA 4LGVA 4B33A 1V5EA 5EWMB 1QH8A 4LY9A 4CIWA 1W36D 1IN1A 3O3NB 1HTBA 3WBJA 4WH0A 6PFKA 4PS0A 4B6OA 4DEVA 4HLUA 4JMPA 5C2JB 3AP3A 4JB2A 5ELMA 2YJTD 3GF4A 3OZXA 4I46A 4Z3DA 5M3BA 3PJRA 4RFVA 4YJ2A 1B2RA 4RANA 4E5SA 4O4IA 2RGDA 4RTQA 2PS1A 1BWPA 2X4GA 2OFWA 2H3EA 4QNRA 1EFAA 5B53A 1JMVA 3DMHA 5EZQA 2PT5A 3DWGA 4LRTB 3WWEA 3SZOA 3TO5A 1R8QA 2FEOA 2O3UA 3DHYA 1L3BA 1J9EA 2OHVA 3KELA 3QU9A 4C0QC 4CV1A 4EL5A 3ZV3A 1EVEA 1JHVA 1HT0A 1TKBA 4R9VA 4M0FA 4X8HA 4RPKA 1WCYA 2HLPA 4GPBA 2GD0A 3V1NA 4IDPA 5ALZA 1VFNA 3WIEA 4DRZA 2IPOA 1Q14A 3ANXA 5ARCA 5TQJA 3QM1A 2O1EA 4RQUA 1JG7A 1F4VA 1SUWA 1ZM4A 2II6A 2GD1O 3QVJA 4L57A 1UFRA 3D6NB 4KXFB 4RHFA 4Y1EA 1BU8A 2GPTA 1ZUNA 1NJ2A 2AOTA 4EG7A 4WGFA 5IT5A 3RBVA 3H84A 1CK4A 5LR6A 3EFHA 4MV9A 3H3JA 2QR2A 1KOGA 5IJWA 1UDRA 2EGGA 4JP3A 3P9CA 4P54A 3Q1LA 3PXDA 3DE7X 1XVUA 5KJ1A 1M75A 1IZ7A 3PSHA 3S8YA 1WVMA 3I53A 4OHMA 4QOIA 3S70A 3ZQ4A 1V47A 1MJGA 4I1OA 1W88A 5F1KA 1Z0DA 5AFSA 4F2DA 3CUKA 4X7MA 4N0QA 2ZCVA 1E2JA 4TVBA 3U62A 1RJFA 1WMAA 3HCRA 1OT3A 4KFUA 1FL9A 2XR1A 3EWNA 3BM5A 1IN4A 3K94A 1WP9A 3C8ZA 1W2GA 4I50B 5FP0A 1KDZA 4BVLA 1GYQA 2M2IA 4EG4A 2ZWAA 1Y1RA 5FT9A 1MZPA 2AEEA 5I7FA 3BTVA 2ZYVX 2W93A 4H2DA 5L3QB 3WYBA 1E2GA 3C6XA 3FMFA 1XTIA 5CHEA 1RRPA 2YMPA 3OTQA 4YQEA 2GPYA 2OV3A 2BM1A 4B83A 2Y4NA 3VBEA 4G0XA 5DCUA 1MR3F 3IMFA 2ZYTX 3R0XA 4KK3A 5DI3A 1I7DA 2CXQA 1T1RA 4HNGA 2IZZA 1H6DA 2QY6A 4I4TF 1TUIA 1DKLA 2MT9A 2PTHA 4LAFA 3L4BC 4UEQA 5ITWA 4TS3A 3FSGD 3WJ2A 3K6SA 1H1DA 1KY4A 4UOQA 4C03A 1KBOA 1CHNA 3LDHA 3OFVA 4PAQA 5SZIA 2DJ5A 4OXRA 3BWDD 3CUEF 4ZD6A 1ZK2A 4IVNA 3AU9A 3GQVA 3R3JA 2UUBB 2RAUA 5DULA 1MPTA 4NEHB 4NCJA 1UDAA 4ZRDA 3UC9A 4E03A 1GGEA 1FFSA 2FPKA 2Q6LA 1GAQA 2RHHA 4Y98A 3NIGB 4QOHA 1Z3CA 1LLUA 1PS9A 5AK0A 4RADA 1CQIB 3NC1C 5ALVA 4MRRA 1U6JA 4GW3A 2V7WA 5HE9A 2WVGA 2CW5A 4O1HA 3I9LA 1F9AA 5DHPA 3N8KA 1IY0A 2FMKA 5CEFA 3WXBA 1M10A 5DDIP 2J7PA 3RS0A 5H5JA 4EATA 2O3RA 3CH7A 4D6YA 3PA6A 1KZ7B 1JHQA 3BJRA 3UWKA 4ENRA 4QARA 1HT2E 3GNTA 4B5KA 1PJLA 4RY9A 4W1PA 1CUBA 2WILA 4MRAA 3F46A 4C0XA 3B6IA 1QSGA 4RDXA 3QMVA 5T4FA 1NC3A 1NW5A 1YBVA 4GLLA 1XPRA 4NONA 3LWBA 2A78A 2XYRA 4QXRA 1UPFA 2PZFA 3QMWA 4B46A 4BATA 1C4OA 2QXYA 1M8KA 5GQSA 2I78A 4QNNA 3FDZA 1ILEA 3A1WA 4M86A 1C30A 1Z4OA 3CPSA 1K3TA 3IAS6 3KDAA 4HYTA 4Q66C 2VJLA 2YR0A 3O6VA 3HUDA 3R44A 4YAEA 2BYTA 1CVIA 4LPKA 1E1KA 1Q12A 4IJKA 1QQ7A 2P2CA 4RA6B 1OX5A 2GEVA 3A2MA 5FBQB 5C7IO 5D84A 1K68A 3PIDA 3V6MA 1JYFA 4DLWA 1AZWA 4WY8A 1W73A 2IXFA 2RB4A 2VJCA 1Y7PA 2XTAA 3CB4A 3VFDA 4PAMA 5FUYA 3UUFA 1AD2A 3EAFA 4ALLA 1N1GA 3OJWA 1FXWA 3O8QA 4J0QA 1SEVA 1EX1A 4LYEA 4C88A 3ETHA 1NW8A 3ND8A 4YRTA 3W5DA 3IHLA 3KPWA 1J21A 4N7MA 2ZAGA 1MRNA 2FZ5A 2PT6A 3FG9A 2QYOA 1UOQA 3RS5A 1FLDA 3FWKA 1PT5A 4C0HA 5BVGA 2PUEA 5LB4A 3Q11A 4IG9A 2O8CA 3BPSA 4RZXA 4NOJA 3E4DA 1XRRA 1CJVC 4YO7A 5H70A 3QI7A 1CDZA 5T8KA 3E81A 2OO5C 3L07A 1QYIA 4A3SA 2ICAA 1S3GA 2B37A 2XV1A 4HDNA 1DNPA 2MYPA 4B71A 1NR7A 1GPNA 1QMGA 1N2CA 3A1UA 4TTQA 3LP6A 1VPTA 2NO5A 1LDEA 4OP1A 3OY7A 3FYHA 5AVRA 4MVJP 2HM7A 4D8XA 2YBDA 2O07A 4DREA 3QYPA 4F04A 1GUBA 1W52X 4KQMA 4V0QA 4Z9AA 3RCBA 5IC6A 5LQKA 4GNRA 3VHRA 4BOYA 2AG1A 3KK0A 3RARA 1F4LA 4U7GA 3W4IA 4URVR 5C7OO 3JQ7A 5KTKA 5FOWA 1Y7LA 2GOYA 3GLSA 1PFUA 5CIWA 2R6CA 3VO2A 5KDDA 3B3GA 5CT4A 3VOBA 5A04A 2CNKA 2XUKA 2VF5X 4YDSA 2OSBA 2WB4A 2CJXA 2IA5A 3I04A 2NSHA 2H2DA 2G9RA 3FY4A 3UT5B 4AJ1A 4C5CA 5KWJA 4RX1A 4V24A 1CCWA 5IM5A 3KUXA 1BDJA 5FTJA 1AHHA 3EH1A 1VHWA 2R6R1 3EFEA 3MTAA 3T6KA 2B8NA 4OHZA 4EMBA 1DT3A 4A16A 4EECA 5EHNA 4CIBA 4X7BA 2IHZA 3OPYI 1JAYA 5CCBA 3FGZA 3KSDO 4C6RA 5JSUA 1MXFA 1GCUA 4US1R 2R7NA 3D7KA 4Q7LA 1EFRD 4UDOA 3T5MA 2ZUCA 1RAIA 5GIOE 2I9PA 4UFPA 4PXSA 3P71T 3T9BA 5MGBA 3YASA 2Q3CA 2X2PA 3SR3A 4OBXA 2PKEA 2PGXA 1JJAA 1U2QA 3UNXA 2F59A 2ZG6A 1B2LA 1T4BA 1X74A 3M5WA 3ZLBA 4BNFA 4OH7A 4D46A 3VC3A 3IHKA 2B92A 4JT9A 4WZBE 1JPJA 3CGGA 5DOZA 2O23A 1YGYA 2IYTA 2JI6A 3ZK7A 3GPDG 4CUKA 4D3ZA 3EMBA 1CUEA 4E5MA 3SC3A 5JRJA 2FKNA 2Y0PA 1T10A 2SHKA 3E3MA 1S8AA 2IQIA 5FO1A 2QG9A 3KL4A 2RGEA 2C42A 4I5EA 1IQRA 4P81A 3WK8A 2Y1WA 4U0KA 4FX5A 3IOEA 3W04A 5T41A 5T57A 2CD9A 3G68A 3IMCA 3ABIA 2BKLA 1YE8A 1ZJ6A 2WV7A 4DPMA 2EBHX 1BFDA 1N6PA 3SHQA 3BVPA 4ZO7A 3WE7A 1GNVA 2QJFA 3KHUA 3NJ8A 3Q0TA 4R8MA 5I3CA 3CT6A 4FXPA 5EE0A <