4Z3DA

Human carbonyl reductase 1 with glutathione in a protective configuration
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
276
structure length
276
Chain Sequence
b'SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase [NADPH] 1
publication title Structural insights on the catalytic site protection of human carbonyl reductase 1 by glutathione.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 276
sequence length 276
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z3dA00
3MTGA 4CQLB 3W4KA 3VHRA 4ZN6A 1PQWA 5L7WA 1GR0A 1B0AA 1PL7A 4N5NA 1E6WA 4CMKA 1RM3A 2YZ7A 3PDUA 5BSEA 4J4TA 4CM4B 3I5MA 5FF9A 1ISFA 2EW2A 3QQPA 1NVGA 3IP3A 4LN1A 1ZXLA 1C14A 3EZLA 5H82A 5CEFA 2QQ5A 4FPXA 1ADFA 4R5HA 1I3NA 2CSUA 3RC2A 2GZ1A 3BZUA 2DPGA 2HMUA 4J1NA 3C8MA 2D4AA 1MFZA 3FWNA 3WYBA 4RVHA 2YW9A 1VSVA 4Q9NA 5TF4A 4BHTA 4B4VA 1RJWA 3RSHA 3GGGA 3PGJA 2VHWA 2FWMX 4I5EA 3FN4A 4F6LA 1HZJA 1MUUA 3O26A 1HL3A 3FNGA 3INRA 2CMDA 5BSGA 3QWFA 1PTJA 4U6QA 3VVBA 3DTYA 4JXKA 2NVBA 1XR3A 1OAAA 2WTBA 2BH9A 3CZRA 3H9JA 4ALKA 4DQVA 5B4VA 3W8DA 4ITUA 3FHLA 2VZ9A 1B8PA 4GSLA 1UR5A 4RF2A 1LTHR 3NAQA 4ZD6A 1HDOA 4BKQA 3E5RA 3NT5A 3LSYA 1ISIA 1U2DA 1XIVA 3WGTA 3GG2A 1NQTA 3HSKA 3OF2A 3NTRA 4AJEA 4IBOA 1UP7A 3BMOA 3IOYA 4IDAA 1BDMA 1KEUA 2BGKA 2G76A 2YQ4A 1Y8QB 1YB4A 2POQX 4OAQA 3WYCA 1DFIA 1XLTA 3G1TA 2UUOA 3RUEA 2WE8A 4RORA 4CMBA 1UZNA 1ZUD1 3MCVA 2HRBA 3O9ZA 3PQEA 3U4DA 1QP8A 1I30A 4PIVA 2HJSA 4A0SA 3Q11A 4E6PA 2Y0DA 3AI2A 3KEQA 2NADA 3JQGB 4RLSA 2J3JA 5A5FA 3JQ8A 1GU7A 3F46A 2HJRA 2Q99A 1CIVA 4XDZA 3LT2A 4AJPA 1GZ6A 3ZGYA 5A1TA 2BF7A 4Q3EA 4R16A 5BNIA 3E8XA 2FPGA 1T24A 4ZRNA 2ZQYA 1H6AA 2X6TA 3DEYX 3RBZA 4DVJA 3X2FA 1V0JA 1PWZA 1JLLA 5KKCA 4CLOA 5ENDA 3BMNB 3JYNA 5EQDA 2W98A 3DL2A 3NT4A 5BR7A 5A9RA 1PJ4A 2EEZA 4A03A 3Q0EA 4YJGB 2J3HA 4RGBA 3ZNPA 1T2CA 5K9ZA 4AJIA 4BUCA 5IFLA 3JD0A 3PHGA 2X5OA 3IDSA 1WNTA 4PCVA 3M1LA 2DTXA 3IQDB 1IPEA 1U28A 4YEDA 2HK9A 1P1JA 2ZCUA 4GLOA 3QRWA 2DKNA 3RASA 2P9EA 3RJ9A 1UDAA 4XYBA 3V1YA 4P22A 3PLNA 3RU9A 1U4OA 1ZCJA 4MIYA 4CL8A 4XRRA 3BMQB 3OQBA 4D7AA 4PG5A 6ADHA 3DZIA 1NP3A 4H15A 1Z7EA 4R9RA 3RUHA 3JQ6A 2O7SA 1LJ8A 4RQTA 1LSSA 2WMDA 2DBQA 1V35A 2RAFA 4WK6A 4MVJP 1A5ZA 3WYEA 5EL0A 4PG8A 1Z7BA 2VUUA 5T6BA 5AYVA 4GH5A 2OGUA 2WD7A 3W4IA 3DB2A 3H2SA 3O03A 4FFLA 3IJRA 3ZNNA 5JC8A 4PLFA 4WEOA 3JV7A 3PHIA 1HDXA 3WQSB 2H9IA 1TB4A 2GNAA 1B14A 3OP4A 4DBVO 3QHAA 2Q1WA 4KWHA 1JA9A 4CV0A 2UV8A 2EW8A 4G5HA 3SEFA 1HWYA 4FC6A 3KRTA 4B7UA 1DHTA 4UVIA 3PWKA 4IPTA 4S1VA 1LLCA 4W9NC 2GYYA 3HDJA 3RCBA 4A27A 4DLAA 1P77A 2X5JO 3L4BC 4N5LA 2AEJA 4FFMA 3OQ6A 3DOOA 2W2KB 2DLDA 1YL5A 2CF6A 1NPYA 5F21A 2C07A 1IOLA 3ZZNA 1R0KA 3TOZA 3PWSA 3OJOA 5HTOA 3ZH2A 1EK6A 1GYRA 2IZ0A 1JKJA 3WGIA 3LVFO 3TFOA 4B4WA 4Q3NA 4BMNA 5T8KA 3H5NA 1KIFA 3ZU5A 1T25A 1ENZA 3A4VA 1PJSA 4KZPA 4MO2A 1BDBA 4HP8A 5CPFA 1UP4A 5T67A 4YXFA 4UVHA 2CNBA 4R1UA 3ZWPA 1DRVA 1O95A 1GQQA 5BSHA 3L6OO 4IGFA 5HS6A 3T7CA 1U3VA 4QFCA 4L4XA 2ILTA 5A06A 1WDLA 4ZQEA 2E82A 2HLPA 4TROA 4WCFB 2P5YA 4LRTB 5DCWA 3TF5A 2ZTUA 4LSMA 2HSDA 1ONNA 2VHVA 3TSCA 2I5PO 1YGYA 3RD5A 2PD3A 1YS4A 3GHYA 1RWBA 5G2OA 2PH5A 2CZCA 4WLOA 2GR9A 2JCVA 3ABIA 2X0RA 4MJLA 4XWYA 3PQDA 4EEZA 4L76A 1HZZA 1DIRA 2ZK7A 2PFGA 4A10A 1G0OA 3AY3A 1QYCA 3I9NA 4E30A 2ZJ1A 1NNUA 5B12A 1WP4A 3MWDB 4CV1A 3NDJA 5THKA 3GDFA 1UXHA 3JQAD 5DBFA 4LW8A 1ULSA 2OORA 3I9MA 1X0XA 3K96A 1KEVA 3H9GA 1BRMA 3UW3A 4K1LA 4O1MA 4B3JA 4ZICA 4MOWA 1DJNA 5BSFA 3ZN2A 4B3IA 3GPDG 4MP3A 1V3UA 2B0JA 1Q0LA 2I6TA 1UJMA 2Q1UA 3OMLA 1GD1O 2JFFA 2C29D 4R1SA 1BXGA 3JQ7B 4RPKA 2DBRA 5I7FA 3FCOA 1I01A 3RUFA 4DGSA 1C1DB 1B3RA 1AHHA 3KSZO 4IXWA 4EJMA 5L45A 3I9JA 2BELA 1D1TA 4NU6A 2J3IA 3T4EA 4J1QA 1JW9B 1N7HA 4UUNA 4CLHA 1HRDA 3OIFA 4B7XA 3IUPA 2HMSA 3AOEC 4DREA 3TZ6A 3A28A 3D5TA 5G0TA 4RCVA 3T7EA 3FD8A 5HRUA 3OJEA 5CG2A 1N1GA 2NV6A 4J43A 4FGSA 4BS9A 2Q2VA 2PY6A 3TOXA 4ALJA 3BA1A 1ISHA 1MX3A 4E31A 1YB1A 5TQVA 3GMDA 4J7UA 1VJ0A 2W2LD 3PXXA 1H2HA 1Y8RA 3DBRB 5C37A 4UEKA 1A72A 5JAZA 2NU9A 5JMPA 4AG3A 2E49A 4J16A 2NSDA 4MIEA 4BNNA 1EFKA 1RM4A 2AQIA 4OXKA 1NX6A 3PJDA 4BNVA 4EUEA 1F06A 2NQTA 4D43A 2VYNA 1EQUA 1E1LA 1P31A 1BHSA 2YV3A 2R2GA 2VZ0A 1DDOA 5L3ZA 5U9CA 1Y9EA 4UEOA 3PZBA 2IEBA 1I8TA 3OJFA 4OOEA 4KUGA 4OSPA 3W6UA 2VYVA 2A94A 5IG2A 2B83A 4Y8VA 5ER6A 2O2YA 5JY1A 1T1SA 4O63O 4NBTA 1Y5RA 3LLSA 1EK5A 1R4MA 4O59O 5ITWA 3IIEA 4MVJM 1P33A 2EKPA 5G0VA 3ANNA 1WDMA 4QXMA 3EYWA 4LCEA 5A04A 4TRJA 3GRPA 3PHLA 4W82A 4Z0HO 1ZK2A 4IINA 3SC6A 4BNFA 4CLEA 4YBZA 4IMRA 3ZHXA 3F3SA 4DLLA 1OC2A 2AQ8A 1SNYA 2WJPA 1DXYA 4R3NA 4Z3DA 1Y6JA 2NNLD 1PJQA 2C2YA 1YBVA 3IMFA 3WB9A 4GVLA 3W8EA 3H3JA 5DP2A 4M54A 5I9LA 2P9CA 2GCGA 4M87A 2RIRA 1N7GA 3PJGA 4II3A 4D3DA 1ZJZA 1X0VA 2AG5A 1MG0A 1I5RA 2PKRA 4FQ8A 4EZBA 4RVUA 3I6QA 1QYXA 1LBEA 1PSDA 1J6UA 3NX4A 4PGFA 1FF9A 1MFPA 4WPGA 3TRIA 5B4TA 3OETA 2PZLA 2PTGA 4XKJA 2X58A 9LDTA 4RV9A 5T5QA 3ETEA 5CDYA 1XU9A 2C2XA 1LC0A 2ET6A 4NR0A 4Z9XA 4D44A 1UP6A 4H3VA 1JN0A 1QMGA 5IZCC 2B69A 1P74A 4IDFA 2DUWA 3IKVA 5JMWA 2TMGA 1Z75A 2G1UA 2IZ1A 5GY7A 1Y1PA 4D45A 3OHSX 3QVTA 1LQTA 1GV1A 1IE3A 4NK5A 4J9VA 3PYXA 4G2NA 4B4OA 5A9SA 1GUFA 1X1TA 2VZ8A 3D4PA 5DOZA 5LDHA 3RUAA 2QRLA 3DAFA 2NVUB 1U5AA 3HNPA 1EFLA 3QSGA 2VTEA 3HB5X 2UDPA 5A4DA 4LCJA 1X15A 3NKLA 4K6CA 3VDQA 4PRLA 3DMTA 4NK4A 3U5TA 5FI5A 4YRBA 3DHEA 3M1AA 3EAGA 4HKTA 1DIAA 4O0LA 3D4OA 2V65A 5A3JA 1T26A 4HFMA 3GMSA 1P1FA 4XA8A 1X13A 1UAGA 1Q7BA 3TFQA 4BO1A 3WFIA 1R4NA 3WLFA 4DL9A 2AA3A 3CEAA 1OI7A 1V8BA 3ONDA 2NLOA 3HN7A 4CM8A 1YOVB 3BMCA 3TZHA 4JN6B 1ORRA 1HSOA 3VZQA 5TC4A 1KVUA 4IJKA 4DA9A 3F6YA 5KJ6A 2PKQP 2X1HA 3ON5A 3UOGA 5IAAA 1YDWA 2Y1DA 4ZU3A 3NJ4A 3S2GA 4H7PA 1DIHA 4FFNA 5G0WA 5L53A 4ZJUA 4WASA 2BGMA 2BRUA 2D0IA 4J6FA 4TVOA 5C7LO 2DC1A 3F4LA 3B1JA 3N74A 1DC4A 3VPSA 1DC3A 1ENPA 2HDHA 3KOUA 4XQ9A 3ZV6A 3GEMA 3W8FA 3O8QA 1O6ZA 2Y99A 3PTZA 1DLJA 3PYLA 4FS3A 1GDHA 1HDZA 1YJ8A 4PLHA 1IUKA 2Q50A 1VJTA 3ITDA 4YR9A 1Q1NA 4GSKA 1B3BA 5HA5A 4K6FA 1DO8A 1IHYA 3HDHA 5TT0A 3C1AA 4B4UA 2W90A 4OYRA 4E32A 4M86A 3BTVA 2X9GA 3OSUA 1KBZA 3HDQA 4NU5A 4A26A 4XYMA 4EJ0A 4J7XA 2XXJA 3FPLA 4F46A 3WWZA 3WGYA 5CDGA 2PWZA 2X9VA 3ZCXA 2DFDA 2W8ZA 3GNSA 1SO8A 2EERA 5DOVA 3RC9A 4CR8A 4E2YA 4JLWA 4TZKA 2G0TA 1VM6A 1SB8A 2PK3A 4OHUA 1K6IA 1RKXA 2DT5A 2IYOA 2VRCA 2DTDA 4LRSB 4OQZA 4CM1A 4W99A 3SBOA 1MG5A 1KVQA 3LDHA 3PJEA 3F1LA 3RKUA 4RVDA 4Y6RA 1DC6A 5TSDA 2X86A 4BO0A 3NGLA 2JFHA 5EESA 1K5HA 2DPHA 4WNCA 3JYQA 4CM6A 4CQLA 1A9YA 4MKXA 3VOSA 3BIOA 3NTQA 3IUSA 3DHYA 1VKNA 3K9QO 4NG5A 4EDFA 1TI7A 5DF1A 1LLUA 4CM4A 4XIYA 5JDIC 3BHMA 4BNWA 1E3WB 2EJVA 3C85A 4WGGA 5DULA 4OO3A 1PWXA 1ADBA 2R00A 4A2CA 2O3RA 1LDBA 3PFFA 4D3SA 3GAFA 4IGEA 4OIMA 4JBGA 4MP6A 1GZ3A 2ZATA 3IS3A 4B8ZA 3SJ7A 3M2TA 3NJ8A 2RH8A 1KVSA 3MJ4A 5JPIA 4KQWA 2RHCA 3C1OA 3UCEA 3VVCA 4KUHA 4WUVA 4S3MA 1SPXA 3TJRA 4QX6A 4R68A 2NVWA 1H9BA 4W7HA 4BIIA 4YAIA 3EDMA 1LA2A 1E3SA 3AI3A 1SB9A 1YDEA 1ZK4A 4RLHA 2CDAA 2IODA 2O4UX 3V8BA 4B7CA 5JS6A 4JX8A 2HCTA 3CUKA 2JAHA 5KWEA 4ZQHA 4U5QA 5IF3A 3RBVA 4ZGWA 4J0EA 2YQ5A 1HDGO 4KDEA 5JC1A 1GY8A 1DC5A 4BQPA 1EE9A 4CMEA 2UAGA 4QFDA 5A5EA 5JDCC 4CL3A 1LRKA 3WNVA 1VRWA 1AGNA 1NPDA 1E3LA 2RH4A 2VHXA 1F12A 1Y8QA 4TQGA 2IYPA 1B7GO 1LSJA 1DHRA 4TMFA 3VZSA 2JHFA 2PH3A 2QHXA 1D3AA 1EUDA 2Z95A 3WQQA 1C3VA 5DN9A 3MZ0A 3P19A 2NACA 2WEKA 1I3LA 2WDZA 2AQHA 3JQGA 4YJFB 2DBZA 1XA0A 1PEDA 1B16A 2VOEA 3VKUA 2HMVA 3E03A 1J4AA 2A92A 5B1YA 2IRWA 4KMSA 4OSOA 1ZH8A 4YYZA 4AJ4A 2SCUA 1CETA 2FZEA 3EHEA 1HF3A 1NQOA 2LDXA 4IXTA 3ZWNA 2H6EA 5ITVA 5IZ4A 4DXHA 5H83A 5H81A 4AICA 4XYLA 4WECA 3BMNA 5HBRA 5TJ9A 2O50A 1IY8A 2JCYA 2OUIA 4YJGA 4YQZA 4AJJA 1OZAA 4EJ6A 5C7OO 3BTUA 2Q4EA 2BGLA 4GKVA 5L7TA 4JJGA 3ZWAA 4E12A 2X8LA 5AOVA 3WDSA 4Z9YA 1LI4A 4IJUA 3TWOA 1LLDA 4A73A 2GPTA 4KP7A 1R37A 1GUYA 3ZWBA 3DC2A 1YBMA 2XPCA 1D7OA 3AW9A 4IJVA 4YJHB 1QSGA 4R4JA 3JCZA 1FMCA 1E7SA 3KYDB 4ND1A 2YV1A 3PK0A 1Z73A 1GTMA 1YKFA 2XOXA 2Y93A 3MEQA 3PZRA 3B20A 4AJOA 2O23A 3U62A 3D1LA 2EGHA 3BMQA 5F1KA 4BMVA 2PGDA 5AQ1A 1A9ZA 4XDYA 2HQ1A 4TRRA 1NAHA 7MDHA 1IB6A 4W7IA 1QYWA 4P4GA 1ADCA 4DPLA 4P4LA 3KLPX 8LDHA 5AXBA 3AJRA 1C1XB 2PZJA 2JAPA 2Y1OA 3R3SA 3ZWCA 1E3EA 2GN9A 5DZSA 3MJSA 1E1MA 1R15A 1GPDG 5CEEA 4J4HA 2YDYA 1I3MA 1WWKA 5ES3A 3P5SA 4XX0A 1GQ2A 5TJHA 3D4NA 3VH4A 3RAJA 1AXEA 4XRGA 3D5QA 1VL0A 3QWIA 1BSVA 1D4FA 4EUHA 3QV1A 2NTVA 2ZYAA 2RBEA 3E1KA 4DQUA 2VHZA 1LQUA 2Y1CA 3ZWYA 4RVFA 1Y81A 4CMGA 1Z45A 2B36A 4HX5A 4UVEA 1BMDA 1NTOA 2H63A 3C24A 2PR2A 1GCUA 1OBFO 3FBTA 3G17A 4ND2A 3WNQA 4DWVA 4EEXA 1SOWA 4Z9FA 5L4LA 5CFZA 1DIGA 4E5NA 1A71A 4CODB 2VWGA 1CRWG 4D46A 1I2CA 1O5IA 2JFGA 1VPDA 3AFMA 4JROA 3TZQA 2GERA 4BO8A 3EMKA 3PQFA 4E21A 3ETGA 1YB5A 4PG6A 5KCZA 1E5QA 1RYDA 1ISMA 2W2KA 3JQAB 4J9UE 3ZV5A 4JQCA 3C3XA 3HQ4O 3BHIA 1LDMA 5CP8A 2IZZA 4BOYA 4BB5A 3GFBA 1N92A 1M67A 1E1NA 4F6CA 1FK8A 1QYDA 2E48A 5KJ1A 5TX7A 3E18A 1KYQA 1UZMA 2EV9A 2YHIB 3K31A 3PWZA 1H5QA 1PIWA 3I23A 3C7DB 4IQGA 5TRTA 3ZWVA 1LDYA 4CQMD 3G79A 2YV2A 1NPTO 3D64A 1EBUA 1EVZA 1YBAA 2I66A 3RC7A 4MPDA 1LX6A 3HDYA 3U49A 3UHAA 1M75A 3SVTA 3MJEA 4CUZA 7ADHA 3L4BA 1K2WA 4NHEA 2GD1O 2B5WA 1MXFA 1LDGA 1TA4A 4WCFA 1NWHA 2VN8A 1O9BA 3M2PA 4JK3A 4MVJD 4WLVA 4BNGA 3DDNA 4XB2A 3VZRA 3AK4A 5JBIA 1MA0A 4BO7A 3GF4A 4DPKA 3L9XA 1CERA 1DPGA 1E7MA 3UCFA 4RQUA 4OXNA 3K73O 1V3VA 4ALIA 3QIVA 1ZBQA 3AU8A 3NV9A 4KWIA 3DAGA 3FTNA 4BNTA 4NFSA 2R6JA 2X0NA 1T1RA 3JD3A 3GZNB 1C0PA 4KOAA 2I9PA 2Q2QA 3Q9UA 1M6HA 3D3WB 3UICA 4ALLA 4EW6A 5A02A 3G3EA 4ONEA 1S7CA 5DT9A 3Q1LA 2J5QA 4XZ3A 1NWCA 4E2ZA 5KVCA 2WE7A 1ULUA 3I4FA 4R69A 2I65A 1CJCA 2PD4A 4Q3CA 1JAYA 5JYDA 1AXGA 3FI9A 5LCXA 1X14A 3HG7A 1AHIA 5IDQA 5AXAA 3IKTA 4FSHA 4BNHA 3OA0A 2YHUA 3LT1A 4JJFA 1P3DA 2EIHA 3RFVA 3PPIA 1SEPA 2YYYA 3AY7A 3JQ7A 4DMMA 5EJ2A 3I52A 1DFGA 1C1DA 3KSDO 2JD1A 4NDNE 5I7SA 4DLBA 4RF5A 4QT0A 3ZU2A 2QRKA 3JQEA 5JAIA 3SXPA 1M6WA 2DU8A 1WXDA 2Q1SA 1GYQA 1DRUA 4CUJA 3WGOA 3U4HA 4E2XA 1PGNA 4K26A 5EQFA 4X54A 2O3JA 3U4IA 2ZCVA 1ZVMA 3NT2A 4BGUA 3GN2A 1UZLA 5KJEA 1I0ZA 4DPMA 3LLVA 3F5SA 2OOSA 4AJNA 2QRJA 2A35A 4RPGA 2I67A 2OZPA 3DBRA 3HHPA 3L4SO 4LISA 4ND3A 2UUPA 3RFTA 1XQ6A 4AJ1A 5F5LA 3WTBA 3ORFA 4ND5A 1E7RA 2HUNA 5AXCA 1Y9AA 1P44A 3ZHYA 2CFCA 3FF4A 4KTVE 1N1EA 2HU2A 4GPD1 4YT2A 3UCXA 3GH3A 3LC1O 4IDDA 3BAZA 3SC4A 4E0BA 1EVJA 4F3YA 2NM0A 1KC1A 2QX7A 2PZMA 3KTDA 3WSWA 2G82A 4BL5A 1GUZA 1P1RA 4R3WA 1UUFA 2QZZA 3A14A 3JQDA 4YWJA 4KUEA 1PL6A 1EEHA 3FTPA 3B1KA 4NH4A 3MTJA 3DZFA 3FR7A 1HYEA 3P2OA 3W1VA 2E4AA 2PA3A 1AE1A 3MJVA 5T8KC 1PQUA 3DAPA 2C5AA 1U2GA 4RL6A 4NIMA 3H9EO 1ID1A 1P0FA 4XB1A 1TVEA 3ENNA 4BO6A 3AUAA 1K89A 3DO5A 2B4TO 4R54A 3WX0A 1PJTA 1NYTA 3HFSA 1JAXA 3RUIA 1O8CA 4YTEA 3G49A 3VH3A 4R41A 3OBBA 3DBHB 3K2BA 2JCXA 1AUPA 1YVEI 3KHUA 3S2EA 3KXDA 4GWKA 4HFJA 1G6KA 3CTMA 4Z3KA 5ICSA 3KBOA 1N9GB 2XF8A 3QVOA 1Y5MA 4ZQFA 3SJUA 4GGOA 3UVEA 4FJ0A 3GUYA 3PP8A 4J1SA 4W6ZA 3PHJA 4L8VA 3KB6A 2IEDA 4YCAA 2C54A 2FOIA 1EE2A 4CM9A 3JQ9C 4NI5A 2X7HA 1V6AA 2OP1A 1T4DA 4BQRA 4WLUA 4U0JA 1EDOA 5FFFA 4PLCA 1U3WA 4CMJA 1EVIA 2NTNA 2OHXA 3VPGA 3ZV3A 1ZNQO 4CV2A 3LF1A 3QY9A 3JSAA 3DZKA 3U3XA 1WMBA 1IPFA 1JVBA 4GLLA 1PJCA 3JQCA 3LYLA 5I9NA 3RC1A 3CIFA 1DBVO 5GZ1A 2NVUA 3D0OA 4U0KA 3KLMX 1OFGA 2P4QA 3QW2A 5TIIA 4GI2A 1IHXA 2O3TA 3N58A 2O3UA 3ZWXA 1TT5B 3VPHA 4IQ8A 4BO5A 2CD9A 4YA6A 1PJLA 1ZEJA 4QO8A 4YT8A 4PLVA 1BVRA 1FJHA 1HSZA 2BFOA 1ZEMA 4IDCA 1PZHA 1ISGA 4CMIB 1Y7TA 3CMMA 3ZDFA 3SLKA 1ZXBA 3QVWA 2PGJA 3F5QA 1NAIA 4J91A 2Q49A 2RHRA 5ENVA 4II2A 2YY7A 4N5MA 3VPXA 4Z0PA 4XGIA 3ROKA 3TDKA 4U7WA 5KJFA 1P0CA 2O3QA 3AUUA 3FPCA 3I6IA 1YJQA 4NZ9A 4MIOA 4WLFA 3RJ5A 2B4RO 1YWGO 1YOVA 3UFXA 1JKIA 5CDUA 5K6AA 2VWQA 4DC1A 1MC4A 1IL0A 1NXQA 2Y1GA 2OBNA 4HXYA 3D3EA 1E6EA 3WSVA 1YL7A 1DSSG 4IIUA 5JW6A 2FP4A 3GGOA 3ICCA 4D0SA 4OKIA 3A1NA 2D5CA 3GT0A 4RJTA 4E2WA 2X0IA 3GA0A 1E1KA 3AFNA 3JD4A 1PS9A 2ZJ0A 4TRMA 3WR5A 5KTKA 4ESOA 1LNQA 4HNGA 3JQBA 5A05A 4W4TA 5F1OA 1E7QA 3QWBA 4OMUA 5CDSA 3E5MA 1H94A 3KYCB 4XGNA 3VTFA 5CAEA 1MLDA 3PJFA 4BV9A 1R6DA 3AM3A 2O7QA 1BTOA 3UXYA 3K30A 1HEUA 1KY4A 2HK8A 2A4KA 4NJMB 3CE6A 1Z82A 2GN8A 3CPSA 4PLWA 4CLRB 4R1NA 3R6DA 1ZJYA 1C0IA 1E92A 1JWBB 1X7HA 2QIOA 3AOGA 3BTSA 1UXKA 2P68A 4IZHA 3GVPA 1BVUA 4OGWA 3WFJA 2ZTMA 3R1IA 3WWYA 1R0LA 1HTBA 1XU7A 3CINA 1UXJA 1T4BA 4BMSA 4E5MA 3WGHA 3I83A 5IXSA 3FNHA 1DB3A 3DZBA 3QJ5A 1I10A 4G65A 5HWSA 1EDZA 4YQYA 3GHHA 3EC7A 2CVZA 2FSSA 4MP8A 2IDZA 1DOHA 2C59A 4J4BA 4UVDA 2BFAA 4QECA 1IZ9A 2BLLA 4DIBA 1E3WA 4L74A 4ALMA 2FHSA 4RVGA 3IJPA 1NFRA 2OFPA 3RROA 2Y67A 4XD2A 1ZFNA 3QA9A 3V1TC 3NGXA 5MDHA 3HB4X 4C7JA 3V5NA 3HJAA 1HYGA 2CUKA 3VH1A 4BNMA 1U7HA 1YQXA 4NFHA 5HS4A 2HMTA 3FNFA 2JHGA 2ZB3A 4GX2A 4J3FA 4UVGA 5MGBA 1H6CA 4LSWA 2CDCA 1JDJA 4FN4A 1ONPA 2J5KA 3DBLB 4NJOA 3KUXA 1CEQA 1XYGA 3JQFA 1TLTA 1N5DA 1C0KA 5JDIA 1A4IA 1FDTA 4OKNA 4TWRA 4PZDA 2D1YA 1N2SA 2GF2A 3MOIA 3IC5A 4GX5A 3HZZA 3ZU4A 1T2DA 5TT1A 5ER9A 3UUWA 1LEHA 1QORA 2H1SA 1I36A 1ZSVA 2WM3A 1EMDA 4CMHA 2XAAA 5F3RA 4CQMA 4FOSA 3GDOA 4I9NA 1BW9B 2Y66A 2BMAA 5COBA 3A06A 3F1KA 1GPJA 2UVDA 3LC2O 1VJ1A 5BQFA 1QLJA 1HKUA 2DBVO 2FSVA 3L07A 3NYWA 1SMKA 5F5NA 5C5IA 3H4VA 4CLDA 1EUZA 4BB6A 4YPOA 3K5PA 3WOHA 4BNJA 4MVJA 5G4KB 4CM5A 4YJFA 1IULA 1CDOA 4BKPA 1PGPA 3GVHA 4MVJH 3U4CA 2PNFA 1SAYA 1NFFA 2Y1FA 1WDKA 2B4QA 4TKMA 4OXYA 1GEEA 4IUYA 3NDIA 2G17A 2X22A 3AUSA 4HUJA 4C7KA 5FWNA 1R66A 3DOCA 4GWGA 4MVJF 5HM8A 1RYEA 4FIZA 2OO5A 2FY8A 3QWAA 4OOFA 1W6UA 4WCDA 2AE2A 5JSFA 4XYGA 1K6XA 2Y1EA 4FJ2A 4XJTA 1T2FA 2C5EA 3AM5A 3AWDA 3LF2A 1P1KA 4BNLA 4IS3A 2W4QA 4I9UA 1PGOA 4YAEA 2O2SA 4EBFA 3DWFA 4J1TA 2GN4A 4YT4A 3V2HA 1H0KA 2VHYA 4YAJA 2FR1A 5THQA 4YJDA 2NQ8A 3GRKA 2OXIA 1PR3A 1PJ3A 3PGXA 1E5LA 4WOJA 2JJYA 5C3MA 4YJHA 4ZVVA 5A3VA 3KYDA 4J7CA 5IN4A 2VYND 1F8FA 1LLQA 4OM8A 1SEVA 3C7CB 3S8MA 4HY3A 1U5CA 2WYVA 3BHJA 4IM7A 2VYVD 3E9QA 4BO9A 5L4SA 4J2HA 1W8DA 1M66A 2EKQA 3OJ0A 2ZYGA 2AW5A 2WYUA 3B70A 1XELA 4K9DA 1C1XA 1PL8A 1K0UA 4CQMB 2GZ3A 2H5LA 3JD1A 4UAGA 2Z1MA 3PLRA 4FCCA 4L75A 1MGOA 4Y98A 4HBGA 3OM9A 4RPLA 3IAHA 5DNAA 3UN1A 5TNXA 1MXHA 1JTVA 3ZWWA 5JO0A 2R00C 1WLYA 3HFGA 1H6DA 1PS0A 1YONA 3I9LA 5BNFA 4CUKA 1DAPA 4ZQGA 4YDRA 5L7YA 3SLGA 3HUDA 5CEJA 1ADGA 3E9MA 3PHHA 2VWHA 2NWQA 3ONFA 4YACA 4CJXA 2F00A 1KY5A 3NRCA 4R5MA 1KVTA 4Z6KA 1PGJA 4YRDA 2DVMA 3LU1A 4G81A 5TGDA 2CY0A 3MJTA 3G0OA 4N18A 4PRKA 3VZPA 4D79A 5CG1A 3ANLA 1XCBA 3ULKA 1B26A 1QXSA 2BHLA 3RI3A 3DFUA 1UXGA 1KEPA 1P1HA 5L51A 3OECA 5DBGA 4M1QA 4FJ1A 1LUAA 3ITKA 4FDAA 3JQAA 1I33A 4IDEA 3GFGA 4U8GA 3OFSA 4DBZA 4I5DA 3L6DA 1PS8A 3GQVA 4R51A 3WIDA 3KETA 2J5RA 2D59A 1PU2A 1WPQA 4E33A 5I9MA 1HT0A 2QG4A 4CMEC 5EMHA 1KS9A 2NU8A 1E6UA 4YAGA 3WG9A 3CH6A 1O0SA 4I1IA 2YHIA 4L4SA 4P38A 4BGEA 4E5PA 4EUFA 4FBGA 4A5OA 4E3ZA 2NUAA 3FRJA 1TXGA 3BTOA 1LDEA 3P2YA 1J5PA 1ZIDA 4QTZA 3UAGA 5CDTA 1CYDA 3GVXA 3WMXA 3DXFA 3NEPX 3EVTA 3S1LA 5JCJD 1JU9A 2FR8A 1Q0QA 2C7VA 2YUTA 1LU9A 4MVJE 1NFQA 4UULA 4Q3BA 1CQJA 3GDGA 3UKOA 4GVXA 5JXWA 1U1IA 4BO4A 1CWUA 4BNYA 1JKFA 3E82A 2I3AA 4JIGA 5IN5A 4DIFA 1ZK1A 2P5UA 5COAA 4WNIA 3VAZA 3LK7A 1LSUA 4GQAA 3RKRA 2CVOA 3KO8A 4UUPA 4MKRA 2W2LA 4M55A 5DDIP 2YFHA 1YL6A 3H2ZA 3C1TA 3LQFA 4U6SA 2IE0A 2GO1A 2E6UX 1ZSNA 4O5OA 1MP0A 2FPIA 5A03A 1VL8A 3LT0A 4Y67A 4QEDA 5ILOA 3OH8A 3GZNA 6LDHA 1UAYA 1GAEO 4L0QA 1FDWA 1XSEA 3V1UA 3D3WA 5G0SA 4L4RA 1ONOA 4KTTE 1FDUA 1QYVA 3WTCA 3MOGA 1BXKA 3FR8A 5IDWA 1FDVA 1MB4A 3IP1A 2Z5LA 4WLEA 4IDGA 4OH1A 4XQGA 5AVOA 4BVAA 3TL3A 1JVSA 2V6MA 3O38A 5G4LA 3VPFA 2Z1NA 5DCYA 1GADO 4J2OA 3EK2A 1VI2A 3OQ1A 1T2EA 4RZHA 2GUGA 3JD2A 3GGPA 4R9SA 2ZB4A 1M76A 3GPIA 3KEOA 3IL2A 2AG8A 2RCYA 1EVYA 3E6AA 3ENKA 4IMPA 1J49A 3RU7A 2ZTVA 4FFRA 2OMEA 1B8VA 2CDBA 2GSDA 1S6YA 2B5VA 1VE9A 1QV7A 3HN2A 1GFSA 1J0XO 1HE4A 3RQSA 3EZYA 3H5AA 1SC6A 4MVJI 1NM5A 4W9NA 5DCUA 4E13A 1OC4A 4LMRA 1V3TA 3ROPA 5FYDA 3V2GA 2WD8A 1P1IA 3EVNA 3NUGA 2BD0A 1YO6A 1GQYA 4PZEA 2LDBA 2HRZA 2Q4BA 5JCXA 1B2LA 3FNEA 5KJCA 4PG7A 3QVXA 2VRCD 3GY0A 2VUTA 3DZGA 1WZEA 3BYZA 4PLYA 1R0SA 3Q2IA 5ADHA 4PVCA 4TKLA 2QYSA 4YVFA 2F1KA 4QUKA 3ZV4A 3GNTA 1KERA 1ISJA 3ONEA 2BI8A 1F0YA 3PIIA 4E5KA 3BMOB 2P9GA 3F47A 2ZIZA 5I8ZA 4AFNA 4ALNA 2O4CA 5I7EA 5IXYA 5B4UA 3H65A 3QWHA 4TZTA 1W0CA 1DAOA 2G5CA 4HNHA 4YB8A 3K2EA 3OICA 2HO5A 3NTOA 5CPBA 5JO9A 1PX0A 4EYEA 3PEFA 5EN4A 3WBFA 3ZHBA 1SZJG 1P45A 2YJZA 3ROMA 2B35A 3AY6A 3JQ8B 4WEQA 2Y0EA 5CHEA 3V2UA 3QLJA 1NHWA 5DBIA 4BV8A 2Y05A 3GEDA 4Y6PA 4NBVA 1I24A 3RIHA 1MC5A 5JAMA 2BFMA 2HAEA 3D7LA 4IDBA 4CLOB 1GV0A 2BFPA 3B6ZA 3L0DA 4WE3A 2EGGA 4YT5A 3QE3A 4B3HA 1XG5A 2PV7A 3GUCA 1W4ZA 4IJWA 1GYPA 2C20A 1HE2A 4ROSA 2IXBA 3B1FA 1YRLA 2P4HX 2DUUA 3E48A 4WCFC 4O6VA 2VT2A 5EIOA 3ZWOA 3JYPA 4R01A 3P7MA 4I5FA 1F14A 2JL1A 2AEFA 3DBHA 4IQ0A 3GC6A 5JLAA 4FB5A 1BWSA 1N8KA 1ZK3A 1JQBA 1ZSYA 1N9GA 3JYOA 5IDXA 4GBJA 1CQIA 1TEHA 4BNIA 1E3IA 3TN7A 2C7GA 1I32A 5TS3A 3Q3CA 4I08A 2ZB7A 3KSUA 5JNLA 3C7AA 4NPCA 4BKRA 4N7RA 4BGVA 9LDBA 1A27A 4NBUA 3K8ZA 1ZO8A 8ADHA 3R3JA 4JP3A 3PIDA 5AXDA 2ZTLA 5KNLA 3WXBA 5JY6A 2VWPA 1ENOA 5BT9A 3ZNQA 3L6EA 5IDYA 3CMCO 5L95A 1B15A 3H3FA 4UUMA 2PLAA 3T4XA 5JAQA 4DYVA 1EZ4A 4CM3A 4ZHSA 1EUCA 4ZRMA 1VLLA 1HLPA 1ZK0A 2OBYA 3S55A 4NFYA 3TNLA 2DFVA 3AOEA 1NHGA 4L9RA 2WD7B 3NDRA 1DRWA 1ARZA 1XEAA 3STHA 3WLEA 3ADPA 4CR6A 3GEGA 1TT5A 4CPDA 5DP1A 1PZGA 4QSMA 3SX2A 1E3JA 1AN9A 2AEMA 5L4NA 1NASA 3FBGA 1Q7CA 2JD2A 4DIOA 2WYWA 3H8VA 3JTMA 4EITA 3I1JA 3G1UA 4CMIA 4HFRA 4H16A 4XIJA 2BKAA 3JQ9A 2BI7A 1HDCA 1X7GA 2VNSA 5U1PA 3Q9NA 4E4YA 4FR5A 1KVRA 5KVQA 1V9LA 5J23A 2HK7A 1VC2A 4NBWA 1BG6A 2PGLA 3E9NA 1NVMB 3ROQA 3RUDA 3WICA 2EP7A 4CLXA 1YXMA 3WJAA 4IZIA 3VH2A 3CXRA 1UH5A 2VTDA 1PR9A 4CM7A 3DBVO 3LT4A 4WJZA 4D41A 3RUCA 3H6KA 3DTTA 5KVSA 3ICPA 4NNJA 4AJLA 3BXXA 1HDYA 3INGA 4GMGA 3U0BA 2VQ3A 4NQZA 3I3OA 2FRDA 5K0ZA 2V6BA 1IYZA 1QRRA 4JJIA 3OEWA 4QQRA 4XR9A 4TSKA 3KYCA 2EHDA 4FC7A 5JYEA 2FZWA 4BGIA 4BO3A 3L9WA 2I99A 4R1TA 2VCYA 4RZIA 2A9FA 1YH3A 4NJMA 3AU9A 1WVGA 1PJ2A 1DIBA 3CZMA 3GAZA 3HADA 3R0IA 2VOJA 3RBXA 1PJBA 5C7IO 3GVCA 1U8FO 4CLRA 2QYTA 1L1FA 3W4JA 2CF5A 1Q2XA 4DTIA 2FN7A 3OA2A 5TLSA 1O89A 2D3TA 3PVZA 4HADA 3TZCA 4WKGA 3AI1A 5I8WA 1WAMA 1ZMTA 4RF3A 5U4QA 1OOEA 5KOIA 4PN3A 5I7VA 3WBBA 4RPJA 5ILGA 4J90A 1NQ5A 4RDIA 2GASA 3I9OA 1NR1A 2O48X 4D3FA 1WMAA 4FGWA 1HETA 4I8XA 2XXBA 3ADOA 1YE3A 5F1PA 4Q3AA 5IZCA 1DLIA 2TMDA 2P2SA 3CSDA 3MWEB 1P9LA 3ST7A 3UF0A 1K6JA 4AVYA 3GZ4A 1W73A 3HE3A 4XEHA 1KOLA 4NBRA 1D1SA 1EBFA 5EERA 1SCUA 3OIGA 3JYLA 1ML3A 1DFHA 1HLDA 3UH1A 1RM0A 1PGQA 2NTJA 4HWKA 4BNKA 1PZEA 1X1EA 2P91A 1B8UA 2VUSA 2X5KO 4J0FA 1NR7A 1XWFA 2X0JA 1GEGA 1E7YA 1O94A 2ZB8A 3GNQA 1LRJA 1X7DA 1D8AA 1BXGB 2J6IA 4IY1A 1DJQA 3I9KA 3M6IA 3WMWA 4YAKA 4AJKA 1GL3A 4B79A 1YQGA 3DZHA 4URFA 2UYYA 1ZKMA 3QVSA 4MDHA 1G0NA 4LGVA 2NU6A 4FD3A 4GGPA 5A9TA 4Q39A 3WJ7A 4FOOA 4JBIA 5FI3A 3PDJA 2PD6A 1F8GA 5KKAA 3DHNA 1ENYA 4HFNA 3TPCA 4A7PA 4I9HA 2Y0CA 2QZ9A 3KZVA 2VNAA 3CKYA 2VT3A 4P4NA 1I3KA 2WSBA 3K6JA 1BXZA 4WOKA 2OP0A 3DBLA 3DOJA 1FDSA 1QV6A 2D8AA 3OIDA 4IIVA 1T2AA 3INTA 2AE1A 3GLQA 1G1AA 1HXHA 3ETDA 1H6BA 3KV3O 2X9NA 4M89A 3OJLA 4CV3A 1L7EA 1Y8RB 4RDHA 4CR7A 2C82A 4TVBA 1WZIA 1H2BA 1ZZEA 4F45A 4ILKA 4EI2A 2X4GA 3VTZA 2EWMA 4BNZA 2C0CA 1HE5A 2PKQO 3DONA 3GG9A 4JNKA 2B37A 3UGKA 5LDGA 3RVDA 3EUWA 4LMPA 5FEUA 2E37A 3AM4A 5K6AC 4I5GA 2HKIA 4MINA 2EP5A 4DC0A 5JFOA 4N54A 3H7AA 3GR6A 1BW9A 3Q2KA 2D5AA 3WGGA 3ZWMA 4AJHA 1HYHA 5EPOA 5JCJA 4BO2A 4PFJA 4FFPA 1R4MB 4Z0TA 3X2EA 1XGKA 2GGSA 2AQKA 2AHRA 3EW7A 3VDRA 5G4KA 4M8SA 1U4SA 1Z6ZA 1NVTA 2DQ4A 1R16A 3I4CA 1U9JA 4L73A 3JQBC 4INAA 3PRJA 4BKOA 2Q45A 1U8XX 5COQA 1I2BA 4YRAA 5L9AA 3EGOA 4UEJA 3F4BA 4QO7A 1Z74A 4BKUA 1U3TA 3U9LA 4GMFA 4DMLA 1EQ2A 4JGBA 3VKVA 3GVIA 2GDZA 3L77A 1E7WA 4DQXA 1QKIA 4DUPA 4GX1A 2V7PA 1HDRA 3O4RA 2DTEA 4CMAA 2ZQZA 4D0RA 1LSOA 2Q3EA 4XJSA 5GMOA 1CF2O 1JWAB 2DAPA 2Y68A 2GZ2A 3LZ6A 2GRAA 3DMTC 1QLHA 4JCOA 3ASUA 4FW8A 2EKLA 1H9AA 4P8RA 2OL4A 2IXAA 4Q3DA 5T64A 1A7AA 4LVUA 3WQRA 2I76A 1NQAO 4DYDA 3WS7A 1E0DA 3WGQA 4GAEA 3Q6IA 2GLXA 4PLGA 3WIEA 1DEHA 2FR0A 2YFQA 2EF1A 3F9IA 5T57A 2Q2WA 1VSUA 2JD0A 4PLPA 1SOVA 4WLNA 2AXQA 2ZKLA 5A9SB 4JP2A 3ZU3A 4IS2A 3QP9A 1QR6A 1U3UA 4XYEA 3VC7A 4K28A 4ZQBA 3DQPA 2I3GA 2JKVA 1XKQA 3GK3A 4BNUA 4XCVA 3H9UA 4OL9A 1QG6A 1LDNA 1U7TA 2AMFA 3KVOA 1XHLA 1GZ4A 4XR4A 1BGVA 1UDCA 3DR3A 1VL6A 1XQ1A 1GCOA 1TT7A 1YQDA 2J3KA 3FSRA 3S2FA 4DRYA 1E77A 2HMWA 4GX0A 4XGKA 3ZW8A 3TQHA 4KQXA 4MVJG 4XQEA 5KVVA 3N7UA 5EINA 2NU7A 3ZW9A 4HV4A 1NBOA 1KC3A 4B8WA 4EGFA 1PQPA 2QW8A 3H5RA 5JE8A 2X23A 1KEWA 1R4NB 1A4UA 4PLTA 1H93A 4CMCA 4E5YA 4J49A 4GKBA 1LRLA 3GOHA 3S2IA 5JDCA 3ANMA 4TRNA 4CM8B 1UDBA 3BMCB 3TL2A 4AJ2A 3TZKA 5GZ3A 2Q46A 1M2WA 3GN1A 4JBHA 1WW8A 3JQFC 4PLZA 1SBYA 3A9WA 1R12A 3H9QA 3RFXA 5L40A 2O3SA 3ASVA 3KYBA 1ZW1A 3WGZA 2VRBA 1FXSA 4OQYA 4OJNA 4CM9D 2FMUA 1RM5A 2PZKA 5BNTA 1PZFA 3LC7O 3O8QB 1LXCA 3HWRA 4MKZA 1OMOA 3OEYA 4BNXA 2D2IA 3RWBA 4RVSA 4UUOA 2WWRA 4Y9DA 5G0UA 4XQCA 1F17A 3U09A 4D42A 4GL4A 3ZI0A 4PZCA 1L7DA 2EG9A 3EY4A 1XDWA 2V6FA 3PYMA 2DM6A 4ND4A 3FWZA 4M49A 4FFOA 3PI7A 1IZ0A 3DZJA 1LC3A 4RPHA 3ZNOA 2V6GA 1ZMOA 1RPNA 5KIAA 4AL4A 5IJZA 2FPPA 1UXIA 4ID9A 1HE3A 4KDFA 5GZ6A 3W6ZA 2EJWA 1Q0HA 1MV8A 3PFWO 2Q1TA 3ZHZA 1VKOA 2CVQA 3COSA 4LK3A 1I2ZA 3DMYA 3MJCA 4LVCA 4NMHA 4ZA2A 3AUTA 3DFZA 4C4OA 5B37A 3K92A 2J8ZA 1A7KA 2YDXA 1K3TA 1C0LA 1Q7GA 2GN6A 2ZYDA 4PVDA 4Y6SA 4RF4A 1KETA 4PG4A 4UREA 3KM0A 5ICMA 2EXXA 4RO0A 5LC1A
chains in the Genus database with same CATH superfamily
4PBRA 2HSZA 4HZGA 3NH9A 4ZN6A 1ZUIA 3EZNA 5ALOA 4DUYB 1E6WA 3C3YA 3OUTA 2YFYA 1HO3A 1JX6A 2WD9A 2YZ7A 2ZVDA 3BHNA 3DOFA 4OAPA 3I5MA 3DE4X 5FF9A 1KI9A 2XT6A 4GPBA 4RKRA 3D8NA 2C5SA 5EJ9A 3QQPA 4GDFA 3PA8A 2GLUA 2XCIA 4LN1A 3VYWA 2W6ZA 5IT9A 4B9AA 5CEFA 4HHEA 4TLCA 2PGAA 2OSVA 1KS2A 2VP6A 3KQQA 1D09A 1I3NA 2CSUA 4I9FA 2GZ1A 4YFVA 3EYAA 1MVOA 3WYBA 5EIXA 1NI4B 1ZDMA 1N6RA 4RVHA 4PHCA 2PJRA 3KZ1E 1A4RA 2OGTA 1N8TA 2Q8NA 2O57A 4B4VA 3H5VA 1JBQA 3GGGA 1KQ3A 3PGJA 4WJLA 2RIPA 4I55F 2QL6A 1U1EA 4JJ7A 1HZJA 2XE4A 3BT7A 1HL3A 3FNGA 3INRA 1UBTS 1ZIXA 3KJZA 4OD0A 3V8MA 4C1NA 5JECA 2ZAIA 4BQOA 5KNCA 3FZNA 1KP2A 3KFVA 3QWFA 4QNMA 3MBKA 3RW9A 5JQWA 2ASVA 3TVYA 4JXKA 4WN9A 2OV4A 2PWBA 1I7NA 3WL5A 1GGHA 3E61A 3P2JA 1XR3A 2L2QA 1OAAA 2BH9A 3H9JA 3Q41A 3BWEA 4ALKA 3ZXIA 2YZNA 4ZYVA 2OMKA 1FFXA 4DA6A 1B8PA 3NHPA 1DQYA 3ND6A 4EK9A 1IRXA 3NAQA 2PTHA 4QPPA 3LBHA 4ZD6A 2XOKD 4BKQA 4YIHA 1YFJA 3O4JA 3KWFA 3C8UA 1JJIA 3E8MA 3R5HA 3RADC 4MJ3A 4DV7B 1U2DA 1HDIA 4ZVTA 5KYYB 1XRQA 2Y4NA 3C39A 2D0OB 4HB2A 4QLOA 1U2PA 3OF2A 5KYXB 4WA8A 4Q48A 4H1VA 3IOYA 2ONYA 1BDMA 1KEUA 2G76A 2P9ZA 3FUTA 1Y8QB 2L18A 3OLVA 3E7WA 4M88A 2P2NA 3JAKB 1S2IA 1XLTA 1U2EA 1VIVA 2O1WA 3QELB 4HB3A 3WA7A 1A97A 4Y6OA 5D2CA 1U90A 1YRBA 2QAGB 2RE8A 2HRBA 1IHPA 3PQEA 4TGLA 1Y3IA 4ZQIA 3W2EA 4WACA 2X1LA 5BQ5A 4M0FA 1J07A 2H7VA 1N57A 2Y0DA 3KEQA 4FDTA 3Q72A 4HDNA 4ON9A 5A5FA 2JAWA 1Z29A 1XZNA 2O2IA 3GH1A 4IMIB 1EHYA 2X77A 1GG2A 2J08A 4HOYA 4KPUA 4AJPA 3LT2A 5L3SA 4C3UA 4Q3EA 3TK1A 3EBLA 3E8XA 2XY4A 4I3FA 3KKPA 2DEUA 2VJCA 1G8FA 2IDJA 4HWPA 2KI5A 1OVMA 4MUHA 2WFLB 2W6ID 3X2FA 1CD5A 3JVDA 3BICA 5D7NA 1U9IA 5KSPA 5CB6A 4CLOA 3W5JA 1GKKA 4OK3A 1QAMA 2ZCJA 2QUJA 3DL2A 5ICGA 1M2KA 2AC4A 4LNHA 5DM70 1U0LA 3ZVRA 2FR8C 4JI4B 2VQSA 4A03A 3PD1A 3Q0EA 4H4EA 4L8GA 2J3HA 2D74A 2EYQA 1JJVA 2IX3A 4Q21A 4MGKR 1ORTA 1T2CA 1XCOA 2ENWA 5K9ZA 4AJIA 2X6QA 3K09A 3RVJA 3IDSA 3VO8A 3PR3A 2ZTHA 1WXQA 3M1LA 1O5TA 1WVMA 3VTAA 2M2IA 5I9SA 3L7AA 4PRYA 3VJKA 4UDNA 2QBYB 4OHBA 4WN9B 3NATA 2HK9A 2ZCUA 3PC8C 5REQB 3QRWA 3RASA 2P9EA 1KAQA 4GNRA 2I22A 3RJ9A 5KYTA 1VRCA 1THGA 5CLQA 3V1YA 2PSEA 2RAVA 3AF5A 2R4QA 3Q7TA 1U4OA 3HU5A 5HDBB 1EWQA 3MGCA 3OQBA 6ADHA 1IDN1 2RCNA 4PG5A 1SY7A 3DZIA 1GAQA 1NP3A 4PM4A 2C5FA 5DTQA 1OU4A 2G0NA 1N6NA 3NR2A 1PSZA 1JHYA 3N8DA 3B3QA 4R9RA 4B71A 1PW5A 1UPFA 5AW0A 2Q4OA 1LJ8A 1BFKA 1E2HA 4RQTA 4ML3A 1ZMXA 1N9ZA 3OE4A 4RXMA 1MBZA 3AR3A 3MRVA 2C99A 2H1WA 4JB3A 4LA4A 1L4YA 5EJIA 5JCOA 4YP0A 5IC5A 1A5ZA 3WYEA 2NV0A 1TJNA 4NG4A 4Q47A 3SEZA 1Z7BA 2WUWE 3DLBA 1WUKS 1YBFA 3FOAA 3QK7A 4H6XA 3LLMA 4U9IS 1RAAA 2IDMA 5DYWA 5MN5A 3K70B 4QULA 4ZAZA 3QG1A 2ZPAA 1YR1A 4JB8A 3ZNNA 2PGOA 2P2CA 3JVVA 4S05A 1FFBA 3FDFA 1KORA 4U2FA 2OPHA 4DUGD 2FF7A 3UNXA 3QHAA 1WU7A 5I5GA 1KP3A 2BZSA 3LUDA 5CXUA 1JA9A 3HKCB 3ZQKA 2BFFA 5CCEA 5LQRA 1FSFA 1XFDA 4G0XA 3T34A 2CLDX 1DHTA 2C1EA 3LY5A 2WWIA 1ZM3A 3PC6A 4IPTA 4PCLA 4S1VA 1NM5C 4UVIA 4D9KA 2I9KA 3RCBA 4A27A 3R5FA 1YR6A 1E18A 4WNAA 3SK0A 2X5JO 4P08A 4RHTA 1FTGA 2JRCA 2OVFA 2QL5A 3L4BC 1Q0PA 3NB0A 1NXVA 2BGUA 3EXEB 3WRYC 3F0TA 1JU3A 3OIWA 5M5BA 4PGGA 3AGQA 3GL9A 4RPCA 2REOA 3NRJA 5AUQA 2BR4A 5HEKA 1GXSB 2EDCA 2XLBA 1YZHA 4OFBA 2CF6A 1NPYA 1OLUB 3GGSA 4S12A 2BJWA 4MCIA 5DHPA 4RV5A 3K9WA 1W7AA 3ORRA 2HIAA 1SR8A 2RGAA 4EVRA 1AQIA 3OJOA 1GPH1 5GONB 3ZH2A 1EK6A 4MITA 2JHCA 1JKJA 3WGIA 2WMNB 2V1UA 4LWQA 3KPJA 2ZUFA 3OC6A 2NN3C 2YXEA 4Q3NA 5AOAA 3H5NA 3W3ZB 4BMNA 5JWOA 4O8ZA 4RXTA 3ZGOA 4JKOA 1Z22A 1J8DA 1T25A 1TTTA 1ENZA 2TS1A 3QFTA 3HCEA 1ESEA 2DH6A 5CPFA 4ZCRA 1VYVA 1HDEA 1LVUA 1JR4A 1PL0A 3GRAA 3O8BA 4GOLD 4JQZA 5EAIA 2FPXA 5JHHB 5G40A 1AM4D 3DV0B 4F4CA 3MOSA 4QFCA 1OH7A 2LKDA 5DGDA 2VPWA 4P7GA 4RETA 2YWCA 4FSDA 3HUEA 5DGIA 1OUMA 5CLLA 4PBSA 1CUJA 4Q18A 3IAM1 5BWLA 5C9ZA 1ZVJA 4UHCA 5JYCA 3TF5A 1X3SA 3TSCA 1RBZA 4AUKA 2PX3A 4MS4A 4KQHA 4QJ5A 2WIJA 5G2OA 3BA6A 3M4NA 1B1CA 5JZSA 4KODA 4G01B 4WBNF 2IW3A 1FP7A 4MMXB 3BXGA 3M6AA 3PUHA 1AUQA 1NTRA 3PQ2A 4L76A 2ERXA 2IUSA 3OZSA 4M2LA 2GETA 3LYUA 2B92A 3LRPA 3W6PA 1NOIA 5IF9A 3AY3A 2GZAA 2ZJFA 3MWGA 5AVRA 3A6LA 1B76A 3RF7A 3PEEA 3CPHA 3V3TA 1HQDA 1I6MA 3R7WB 3E15A 3LUHA 1FFAA 1PYOA 1SCJA 5H3LA 1TZJA 1WP4A 3IP6A 3LYHA 5JFGA 1BVYF 1VB5A 5DBFA 3TBFA 3TBHA 3IDZA 4Z1MD 3ESAA 2ZBRA 4WJKB 4ZC8A 1REQA 3MTEA 2ZBGA 4DA4A 3LO8A 5IKPA 1W88B 3CLSC 4KFCA 3UW3A 3HACA 4K1LA 3ZKWA 3FPKA 4O1MA 4DMHA 4HMOA 1CUIA 4ZICA 2G0AA 3LPDA 4MOWA 3T5GA 1AK2A 4ZIRA 3AKZA 1GRNA 4CKWB 3PTAA 3LDAA 3O7WA 1KKLA 4PZ9A 1QFZA 2GO7A 1YHNA 2JIBA 5EGSA 1QHHA 1AMOA 1UJMA 3BDIA 3NETA 1RW4A 3U4MA 4PWYA 5H4GA 1JSXA 1SHKA 4PEVA 3PPXA 3IR5A 4JASB 3ICOA 3WLAA 4QGAA 3NNDA 5AW7A 2CVFA 1B3RA 4R84A 4EJMA 4NPHA 4X00A 2BELA 1G21A 1PT8A 3MSXA 1PAUA 4PE5B 2XDQB 3A04A 2GILA 4UUNA 3W79A 5IT5A 1FNMA 5JIBA 1ZS9A 2R1TB 2OZKA 4XJXA 1LTKA 2HMSA 3FIJA 3A2LA 3LOUA 1I80A 1SBCA 3TZ6A 3USCS 4DREA 3IEMA 3A28A 5G0TA 3FD8A 2QI9F 5CG2A 1DU4A 1M2HA 1N1GA 4DIUA 5FUBA 2WTNA 1CJBA 4KI7A 1JG1A 3P9RA 5CA1A 5AW4A 2PS0A 4O4HF 1KDTA 1Q11A 2D13A 4ZANA 2AXPA 4EELA 1QHGA 3GLFE 2JFZA 4J7UA 1CY7A 3ISTA 2W2LD 4KC0A 1WZNA 5BV0A 3SWWA 3DBRB 5EMLA 5C37A 4EMTA 2ZJYA 2NU9A 1NVKA 1YJCA 1NJGA 3HCCA 4BNNA 2O1SA 2ZJAA 3ZHSA 5ALRA 1BWPA 1L4HA 3EHDA 1NX6A 3RRNA 4J29A 4BNVA 4EMBA 2H3EA 2EKBA 2P3QA 4L1KA 1SCBA 3ICWA 4M0LA 5LXTB 2OCXA 2YV3A 3R7NA 1N7JA 2JH3A 5U9CA 1PO7A 1R4AA 4FYMA 5PNTA 3LKZA 4GXNA 1E0SA 5ALLA 1I8TA 3V8PA 5FUMA 1T3GA 4KUGA 1FJXA 1ZGAA 3W6UA 1WZ2A 4IDPA 4MLPA 4J94A 4Y8VA 3DTNA 2QT0A 2AX4A 1T1SA 5JZOA 2A8YA 3WC4A 3LLSA 5IAJA 5EUCA 3DWGA 4CL2A 1EK5A 1KA9H 5DEIA 2BN4A 3T1TA 2JASA 2EKPA 3AG6A 4G0QA 4MVJM 3QPDA 4N6GA 5ALHA 1NJ5A 5GWXA 4E07A 3ANNA 4WD3A 4ECEA 3ZZUA 1L5QA 5FPQA 5CNIA 3OP1A 3CVOA 1ZK2A 4NU0A 3SC6A 3LV8A 2EBFX 1A0OA 1N0IA 3I64A 3KKMA 3LD9A 4YBZA 3PRKE 4X1YB 4OGFA 4IMRA 3FLEA 1Q12A 3ZHXA 4X91A 4DLLA 5DNUA 5CURA 1F7VA 1OC2A 2E1PA 2PLFA 3H8WA 3AERB 3QFSA 5DV9A 1U7OA 2G71A 1YZUA 1PJQA 3R20A 1GO2A 2C31A 3WZMA 4MDEA 5ULLA 1U63A 2YZMA 3OFND 3H3JA 2HJWA 3P0FA 3RVPA 5LWQA 5DP2A 3RRJA 4M54A 3B5IA 3BF7A 4FOTA 4PC2A 4JUFA 2RIRA 1N7GA 1JAHA 2FUG1 1P19A 4M1YA 5ALDA 1A76A 1P5RA 3E0XA 4D3DA 4NZZA 4NCHA 1D9XA 2AG5A 4RHXA 2ZJ6A 1I5RA 2PKRA 4FQ8A 2Q7XA 1DQNA 2JVKA 3I6QA 4MIKA 3RTGA 4DEXA 2FPKA 1QYXA 1W85A 4MZXA 4D4GA 1J6UA 5AP9A 1FF9A 3E7FA 1EGVB 3TRIA 1Y80A 1JJ7A 4RA6B 3DAYA 1IM2A 1NW3A 4XOIA 5E8JA 3FMPB 3O5AA 4H35A 5F2NA 1JTFA 2C2XA 4XDGA 2CYAA 3CLVA 4G5SA 1NMSA 5DWVA 2HMAA 3QEBZ 3DMHA 4E5DA 4C7OA 1VHJA 1QMGA 1QZTA 2Y6UA 3AR7A 5BWMA 4BE4A 2PGXA 2M6KA 4DG8A 1MH9A 1NW4A 4GE0A 5DRYA 4N9WA 2DUWA 3O1LA 1D4OA 2IZ1A 1RXIA 4MH0R 1Y1PA 3AESB 3LFHA 5E6RB 4MB2A 2G6BA 2W5UA 2P9HA 2R47A 5HRAA 1QO7A 1TAHA 1IE3A 3BGDA 5A0TA 1YS7A 4J9VA 4B4OA 3L4EA 4HG2A 2M9MA 1EGAA 3RVQA 4PO1A 1WNFA 1L1EA 4MRRA 2ZANA 3D4PA 1T3TA 4B6PA 3REQA 4C4TA 4HVCA 2NVUB 1U5AA 1WD5A 3HNPA 4TXMA 2I87A 4YREA 4YPFA 4XWKA 1OCEA 3I8XA 3L1KA 5AH0A 1YVUA 5GGYA 3KL2A 1RP1A 3O3MB 4LCJA 3CRVA 2N42A 4FBLA 4K6CA 2HNKA 3VDQA 2NXJA 3VKFA 5FI5A 3PE4A 2H07A 4WL0A 5HP4A 4YROA 1KXZA 5HZMA 1DIAA 3N3BC 3PDIA 4MV7A 1BX1A 5FNZA 1L8LA 4EHIA 4HFMA 4JSYA 3GMSA 3H11B 2W2OA 4H6PA 2HQBA 4CTOA 3WIOA 4D5EA 2QAJA 2YHBA 1Y4AE 3R24A 1QX4A 4BIMA 4DL9A 4H1WA 3CEAA 3F8WA 3FPEA 3UOAB 1T6YA 4JL6A 3IV7A 1JF8A 1I1HA 4N6OA 3RS5A 2ZXUA 1TM5E 3KVYA 2QZSA 3KDAA 1HSOA 2DWPA 2XTZA 4X44A 5TC4A 1XEWX 5LQJA 1IBLB 1VPWA 3WVNA 2XJ4A 1T8YA 3CRW1 4ZTZB 4WT7A 2X1HA 2D1RA 2Z5VA 4WZAB 2CE7A 3AY0A 4MA4A 4CF5A 4DY4A 1YCFA 3CSUA 5IWCA 4BVBA 2BZ1A 2PMCA 1FXWF 5EG5A 4RHCA 2C5GA 4DANA 2RFLA 3H5WA 1Y3DE 1WHSA 1LPNA 2GK6A 4LBWA 3S2GA 4BZPA 5L53A 1RRGA 1NOKA 2QN2A 3A4IA 3SR3A 2BRUA 1NXTA 2XCRB 4RIFA 2C2MA 4P5DA 4YUVA 3ZV6A 1DC4A 2HJVA 4BNIA 1PRYA 3Q0TA 1H2FA 3O8QA 4HYTA 2Y99A 3NM5A 3PTZA 2COEA 3PYLA 2X14A 4RBNA 1NE7A 1IUKA 4KXNA 1FZTA 3L6UA 1X87A 1XCPA 4YR9A 4YRMA 1RHUA 1Q1NA 3WSTA 3N0RA 2GPNA 1L5VA 5HA5A 3RJZA 2AI1A 1DO8A 5TT0A 1VHTA 2VRWA 3C1AA 3QYAA 2ZFUA 2QMYA 1N1MA 2D0PB 4FX5A 4KSYA 4BMXA 3BTVA 4KXUA 1KBZA 1MRZA 1XNGA 1IN5A 4F5ZA 3LP8A 4IDHA 2FW6A 3REFA 2I7VA 4EJ0A 1RFGE 2Z83A 4L6AA 3E2PA 5LZ5A 2O2XA 1LPBB 3UMBA 2CLIB 3QYPA 4B9EA 1XTJA 3N8HA 2ZUTA 3P9XA 2X9VA 4BASA 3G0GA 4JLVA 2JPDA 3ZCXA 2IYQA 5FWXA 4C0LA 4YP7A 1CY1A 3OTWA 3RC9A 4QBGB 1ZC3A 4B4DA 4E2YA 2G0TA 4PY2A 5KX5F 1F1BA 3LAWA 1DAMA 1BD4A 3UANA 3HXKA 4M1TA 4OHUA 2WWGA 2XMQA 3CEHA 2DT5A 2IYOA 2VATA 2DTDA 3UMFA 4OQZA 3EW9A 5EXTA 2NO4A 5AHOA 2UXDB 3ZBUA 3FGOA 3G85A 5HW0A 2XODA 5CB4A 3OC0A 1LTQA 2X86A 1I0IA 3NGLA 4CM6A 3LUKA 1K5HA 3VKWA 2B7CA 2QTGA 3DVSX 4CQLA 3T06B 1FLNA 3NS7A 1SIOA 5KHAA 1OVGA 2CZQA 1F6DA 3EEBA 2GEDA 3NTQA 4LY0A 4OM7A 3ZUGA 1XV5A 1T0PA 1TI7A 5DF1A 2PKCA 1RVV1 2OAP1 4IIJA 2FUEA 2GEKA 3C85A 5LYJB 4CQJA 1WHSB 4TMKA 3AQIA 3V32A 4IO0A 1QNFA 1GIAA 1PI3A 3EDOA 3ET4A 1ZAYA 4I1SA 4D9EA 1CNFA 1L4GA 4LWZA 3N7TA 3P8ZA 1A2OA 1WXXA 3PFFA 4JMPA 4JUDX 5HG0A 1DRKA 4ZVNA 2RAUA 3VNAA 4D3SA 2Y27A 3OQJA 4OUDA 4I6GA 2PS1A 3M3PA 2GM5A 4TV8B 1L5HB 1YA4A 3OSZA 3EMBA 3MJ4A 4KQWA 3Q8MA 3N87A 4IDQA 3VVCA 4S3MA 2BFDA 3C98A 4WFJA 3O1IC 1GQRA 4BVJA 3U26A 3OOHA 1LV7A 1J0BA 5K6TA 5D1HA 1IXSB 5I7RA 1T2UA 3HR8A 4TYMA 4IFIA 4X7RA 3ZGZA 5F73A 2J5BA 1E3SA 1WULS 4MLDA 2HCBA 1YDEA 1ZK4A 3OY7A 4RLHA 4I50F 4C0BA 1NONA 2CDAA 3DWEX 4ABYA 3CZCA 1WV1A 1E2KA 1YB6A 3JYHA 5AMXA 3NUZA 1LBIA 2J4FA 1IWPB 4ZQHA 1RCFA 3CKKA 2HXYA 2R84A 2I8AA 5KU7A 3PI6A 1JG2A 1HDGO 5JC1A 5A5GA 4BQPA 1EE9A 4L3OA 1ESZA 3ZEIA 4XIFA 4BEVA 1Z0FA 1UOPA 4QFDA 4V0LA 2F6RA 1G3UA 1NJFA 3EIFA 2Y2UA 1KZ4A 2WJ3A 3I45A 2AZTA 4N4AA 3T5MA 7MHTA 1R0ZA 2I2XB 1U0SY 4TXHA 2IYPA 2ZIVB 4E4TA 4LF8B 1YMUA 3QOYA 4QM6A 3SZOA 5H59A 1LSJA 5CW1A 1DHRA 3GRFA 3VZSA 2ECFA 3L79A 2JHFA 5AW5A 4XVCA 1PQYA 1OB2A 2B1RA 2P27A 5DN9A 5T3YA 2ZE7A 3CZPA 1L6RA 3QOWA 2WT9A 5KOHA 4R1MA 3M7IA 2AQHA 3ZV7A 1Z47A 4JKIA 2VOEA 4MSUA 3IAUA 1JBKA 1PDWA 5E6UA 4AUEA 1UODA 3NVMB 1XEXB 1GUBA 1N2EA 1ILWA 1X70A 2XRMA 2MDTA 4Y2GA 3AP2A 5KCMA 3QXXA 4D4HA 5BY2A 1JG7A 3C5CA 1HI9A 1UFRA 1ZJ5A 2X19A 1LY1A 1GNTA 3EHEA 1M0TA 4IXTA 4PQRA 4XCXA 2H6EA 4XCQA 1YHZA 3ZWNA 4DXHA 4EPWA 5JT1A 2QSJA 2MYTA 3ZCRA 4LYYA 3TTWA 3A37A 3SLRA 1CP2A 4I55A 1BDHA 3RU2A 3OJWA 2C9YA 2VKTA 1VOTA 2ZR8A 1K3UB 3RRBA 2H59A 2O50A 1VECA 2QZJA 1IY8A 5HIMA 4UHJA 1M9NA 1GNSA 4YJGA 5A7HA 4LNUA 4EJ6A 5TPZD 5C7OO 1CZRA 3BTUA 1I7QB 5L7TA 3GWGA 4JJGA 1Y6QA 1M1ZA 1T9ZA 3W5DA 1J0CA 3I12A 1C9YA 3E0QA 5J4HA 2O0HA 3DEIA 4C43A 1M5RA 2WHYA 1P4SA 2H4ZA 4YDQA 1LI4A 1MEJA 2X4LA 4J8PA 1YDHA 4TX1A 1CY0A 3TWOA 3M6WA 2IEAA 4U63A 3EGWA 4MV3A 4N82A 3PGKA 3DC2A 5DT2A 1YBMA 4LSZA 3H18A 4IJVA 1Y63A 4YJHB 5FL7A 3BWVA 4ND1A 1KGSA 3PK0A 4AJOA 1B6RA 2XOXA 4R0VA 2QUAA 3AZQA 3UKJA 3FOEC 3B20A 2C96A 2B1QA 1U81A 2O23A 3H5OA 4DEVA 1L1QA 5EJGA 4M1SA 4BZZA 4KX5A 1G3QA 4TSRA 5AQ1A 2W11A 3C1UA 3ND8A 4XDYA 3NOVA 3ZJTA 5DW3A 3X1DA 2D7CA 5J58A 2GN1A 2PXXA 2PH1A 1YUMA 3S5UA 8LDHA 2V7QA 1ZA1A 3ZPXA 2WSSD 2NTEA 3AJRA 3ILXA 3MTBA 4QA9A 4UU0A 2P6MA 2JAPA 4M0EA 2JLXA 3K7EA 4Z4IA 2ZW9A 2VJDA 1JI3A 4NY1A 1QIHA 3QU5A 4MRPA 2H0QA 4D81A 2XNCA 4GFDA 4U4AA 3ZKAA 5CEEA 3UMRA 3B7PA 5ES3A 3KQHA 3OM0A 1GQ2A 4WY8A 2BMVA 2NW6A 2ZSAA 3S7ZA 2FV8A 2J59A 3K0BA 3HDTA 3SX0A 4E70A 3QEJA 3SZGA 1JILA 4DABA 2FWBA 4PS0A 2EBWA 4EA9A 3RABA 1J56A 4EUHA 3QPVA 3QV1A 1MPXA 3SIXA 4BBZA 4QG3A 1JR3D 2I4LA 1A69A 2GQ0A 2NTVA 4A8TA 4C5AA 2J7PD 1LQUA 3BXEA 4XD7A 4EY3A 3TW0A 3BFKA 4Q1BA 5P21A 4YAWA 5KOJA 1YHYA 4K87A 4BQNA 4JKYA 4WDQA 5DHRA 2VDNB 4JYZA 1NVBA 4Z9FA 1NE2A 1P7PA 1XRJA 2AOWA 5TQ2B 4DJDC 1GNQA 3VISA 1EGMB 2D54A 4CODB 1CRWG 4F38A 1TVCA 4PWZA 3D6VA 1O5IA 3TZQA 5ICCA 4Q1CA 2I6QA 3C3DA 4US0R 3EMKA 3PF8A 4LTMA 3PQFA 3TLBA 3OU7A 1X94A 3LVQE 3ETGA 3RTCA 1LPSA 2H08A 3G88A 1TU3A 2EJCA 3R5JA 4R7GA 4V0ME 3ZZTA 3L46A 3JRNA 3JQAB 5DYNA 4YMLA 1GNLA 1Q0UA 4E5UA 3GIDA 1J09A 3OQNA 3TM5A 4DMCA 2GPYA 3A9VA 1LDMA 5CP8A 2IZZA 5JJKA 1ZCZA 2DWQA 4OHMA 3KT6A 5KU1A 5AW3A 4RM2A 1AQNA 3L02A 1JNXX 1CSEE 1FK8A 2NU8B 2XTAA 5TX7A 3ZI4A 2R2AA 4YX9A 1F1JA 2PZEA 1JXMA 2ZYWX 3WY9A 5KNDD 4OQ4A 1KJYA 1SCIA 2PGIA 2Q7DA 3TIXB 3W8RA 4BFVA 5CGQB 2DQKA 5EIAA 1XLTC 2ABWA 2AOXA 1H5QA 1PIWA 1MIOB 3IVAA 1YZNA 5T6MA 5JH7B 1PD1A 2XH8A 5TRTA 3LUFA 1LDYA 4J76A 2WP0A 4X1OA 3HUUA 4WV3A 3SYKA 4UM9B 4JJKA 3I9V1 3D64A 4LZNA 1EVZA 4NV3A 5DE3A 1LX6A 2GBLA 3HDYA 3K15A 1P4GA 1G5QA 5HKLA 3RYHA 2ZE5A 3UHAA 1XMOB 1R8SA 1IUOA 2PX8A 2VDRB 4MV5A 1SM4A 1XTRA 3SQWA 2Q1YA 1WF6A 5ALZA 3WO0A 2DLCX 1CQJB 2PKWA 2A1IA 2ZRAA 3HMQA 2IE8A 3M2PA 1RKBA 3VX3A 2QTTA 1Q16A 3F8TA 2O2GA 3RAEC 1OJLA 1W5FA 1SRQA 2XNHA 1SRRA 2ATEA 4LDQA 1U9IC 1FNNA 1CERA 1DAFA 2ECOA 3L9XA 3NQ41 4RDCA 2HJGA 4OXNA 3TMKA 3UC9A 1T9KA 3S99A 2PG3A 2C8VA 3QIVA 4ZOLB 3AU8A 3D2AA 3DDSA 3AM1A 1K2VN 1IC6A 4BNTA 5TS2A 3RS9A 1FYWA 4NFSA 4EYOA 1RS0A 2R6JA 3OPYB 3UTDA 1L7BA 4NAHA 3GJYA 2QSYA 2V6IA 3QVVA 1T1RA 3F7OA 3K09C 4EPVA 2R6HA 3QKUA 3U3OA 5C8ZA 5DI3B 4QOEA 3I2IA 4QJ3A 4YCLA 3QUCA 1M6HA 3MWDA 5IU6A 3U9TA 4ALLA 3HJFA 1P75A 2DP4E 4UU7A 3BGOS 4YRLA 5BSTA 1WVIA 4H7DA 4MI6A 3T3HA 1YR2A 3HKEB 5B1HA 2V45A 4ID3A 3X2SA 3AVQA 2HWKA 2WE7A 5KVCA 1AV7A 4KQKA 4DT1B 1VPTA 1YZ3A 3EEIA 4HAXA 5B2ZA 3AV0B 4IJ6A 5JYDA 1AQYA 3PQ5A 3UB3A 3HG7A 1AHIA 3KJFA 1A7UA 2H2GA 2VPPA 4N7BA 4N7MA 4WOPA 5AUNB 3LT1A 4JJFA 1P3DA 4UTPA 4WK2B 1FVFA 2YYYA 3AY7A 3ZE6A 1M6YA 4MX8A 4IOMA 3FMIA 3IR6A 4Q4HB 3KQLA 4UCXA 4Q7QA 3WK8A 1U3DA 2ZEJA 2I1WA 1O2DA 2JD1A 4G5RA 2IYXA 2JW5A 4RF5A 3LCUA 3G2MA 5JCOC 2G63A 2W93A 1DVRA 2QRKA 2YXLA 3JQEA 3DXZA 3K9LA 3QYFA 3S0JA 5JJCA 5JTTA 3PGA1 2X3YA 1GTJ1 3K1JA 3IE1A 3RYHB 4P9NA 4LJ6A 4EYKA 2CB9A 1FQOA 2FWPA 1DRUA 2Q1SA 2IEGA 3EVZA 1FL9A 3U4HA 4E2XA 4JU8A 1PGNA 3I01A 4KXFB 2CFRA 2H92A 1CDZA 2ZCVA 4BMOB 4DLZA 2NIPA 3NT2A 4WBNA 2G4VA 5ERYA 3I5XA 3GN2A 1ZMRA 5FLYA 3RHTA 8AT1A 4JOCA 4JDUA 5LQAA 4HQ0A 3R7AA 1E2DA 1UT8A 2A35A 3L4SO 2WPDA 4RPGA 5AOCA 4AJ1A 1VL5A 4LGMA 4EB6B 1Z07A 1FU7A 5F5LA 6NULA 1KF0A 3PKJA 3QXSA 5E9AA 4DDTA 1F20A 3D4BA 1VLHA 1XLWA 2FSUA 1DTWB 3IUNA 1K7EB 3PV0A 1DE0A 1W5TA 1F2VA 4RTRA 3LC1O 3WK5A 4IDDA 2DR0A 3BAZA 5IYZF 3SC4A 3ANSA 3CRQA 5J2UB 3HCAA 3IIIA 3BK2A 4E0BA 3H9CA 3OOWA 4F3YA 3ZZMA 2NM0A 5AKHA 2PZMA 4QSHA 3N8KA 4DCJA 5CDHA 4OK5A 3KYJB 4YUYA 3I5YA 1J1UA 4L8YA 3ETLA 4RJLA 3KSRA 4IZOA 3GFRA 1UUFA 2JBAB 2J48A 1PE0A 3ORHA 4K9KA 4DBLE 3AVVA 3QVJA 2OECA 1IXRC 4L85A 5KHLB 2NUBA 3QVLA 2M6RA 2A5FA 3B12A 3MTJA 3DZFA 4GKAA 2DYKA 3P2OA 1DOZA 2AJCA 2PA3A 3C4QA 3MJVA 1MB9A 1KSGA 3DAPA 4F85A 4NIMA 5IHXA 3K1ZA 1J7KA 1P0FA 4DQKA 3T7SA 1ONSA 1JHMA 5D84A 1IBCA 5FEMA 1E2JA 2OHGA 3X1WA 4UM9D 4BO6A 4B73A 4F1JA 4DV3B 1EA5A 3AUAA 4MLCA 1Z8FA 4H7JA 1FFDA 4L8LA 4WRRA 4I14A 5I7UA 1WMEA 3NVKI 1CQPA 1NNEA 2XVMA 4QDOA 3TRKA 2ZI6A 4A2QA 4LTDA 2JIMA 1SELA 2IIBA 1M8FA 3DF9A 2GTIA 5C31A 5M3BA 1ZNZA 2AF3C 4HJRA 3UJ3X 3VH3A 4GZ5A 4O4HA 3K2BA 1XNRB 2IELA 2QYOA 3KHUA 4X41A 5HR5A 3K20A 5CM8B 1VJGA 3KPYA 4K0RA 4B0OA 1XDUA 3DG9A 3H2IA 4REQA 3UVEA 2XUAA 4ZVLA 3D2LA 1EI9A 4BVFA 2PT6A 1VCOA 1STOA 5LZ4A 4JUCA 1VXRA 3UK7A 4H7KA 3RHSA 4L8VA 3KB6A 4FYXA 1SK9A 4BVHA 1YASA 1ZQ9A 4NI5A 1GITA 2JGMA 4MYHA 2OP1A 3G89A 1JQKA 3UHOA 2WKPA 1P6QA 2FEWB 1AS0A 4PLCA 4M6WB 3W7VA 5F7JA 1P7ZA 3ZDAA 1SU7A 3HDVA 3LF1A 4IHJB 5IS2A 1NNI1 3DZKA 3GBPA 3LBFA 1WMBA 5J4YA 1KMCA 1TJPB 4PZPA 1JVBA 3IAS6 3JQCA 3P9CA 1YRYE 1WTCA 3FUVA 3NHMA 3FLBA 3RC1A 3I09A 5MF6A 3C6QA 5D87A 1OI2A 2XCUA 5FUQA 5GZ1A 3D0OA 3H0KA 2X8JB 3KLMX 2P4QA 3QW2A 1U8ZA 4YMWA 4BTEA 5TIIA 4C4PA 1SXPA 3N76A 4MYDA 1N5RA 3OQIB 3BRQA 4BO5A 4ER3A 1PJLA 4PLVA 5CITA 2BMDA 2EWVA 1HSZA 4X1KB 3HNOA 1AQUA 4LEIA 1PZHA 2J3MA 1SCDA 4CMIB 2ALJA 2FQQA 3RIMA 1ZXBA 3QVWA 2PGJA 2F48A 2R3SA 2Y76A 1OREA 2Q49A 2RHRA 5ENVA 5AW2A 4QUBA 4A8JA 4HNAB 3ROKA 3TDKA 1FDRA 2R5NA 2C77A 3E70C 4QXRA 4XSVA 5KJFA 3F5DA 4UOQA 3FZGA 4NZ9A 1R6VA 1YJQA 2X2EA 4PFSA 1HORA 4BEWA 3ELYA 4WLFA 4CDMA 1BYIA 2VC2B 3DBOB 4FHFA 3DCIA 1TIBA 1TEVA 2A0WA 2OR3A 2V98A 3OOJA 2HXSA 5EKXA 3TE6A 3TZLA 3ICQB 2OBXA 2C9CA 2W6NA 5FTMA 3ZWAA 5HFAA 5KREA 1KFJB 1KMHB 4J07A 4LJAA 3TMYA 4C0KA 2D5LA 1J06A 3T8YA 1QIJA 3WSVA 1ANKA 1N4AA 1YL7A 1DSSG 4UOEA 3RV4A 3U5ZB 3A1NA 2IYAA 1X7YB 4QLAA 5DN6D 2DSNA 3WLQA 2RI6A 3GOQA 1H69A 3T3OA 3WBJA 1CB7A 3GFTA 2R1VA 2X0IA 5ALPA 1E1KA 4QUEA 2HDWA 1LFDB 2UZ1B 1LNQA 2QGZA 4EVQA 2AWNA 2QV7A 3MXTA 4WNYA 2ZRDA 2Q5HA 3QWBA 3QBDA 1Z0KA 4GUDA 5CDSA 2NPFA 2JLWA 5LQUA 3PT9A 4Q82A 4TKVB 3KYCB 3VI3B 4HGNA 1M2FA 2QD2A 2H65A 2O0LA 3VTFA 5B57C 3FSGA 3PJFA 3DV2A 1R6DA 3AM3A 4XASA 4FZ3A 3RR2A 3DTVA 4C89A 1VZ2A 1TFUA 3JTEA 3QKTA 2WAYA 3ZX5A 5HYVA 1JQDA 1KY4A 1X80B 3GD7A 4TS1A 5F1YA 3NM6B 3ES9A 2C1ZA 1Z82A 2M1ZA 1UADA 2AGVA 1V5GA 2GNOA 2ZIUB 3VPCA 2FMTA 4X8HA 2PL1A 3IB6A 1GLGA 2NNWB 4TPKA 5JASA 5KAPA 2J67A 1ZM9A 3K9CA 2OPBA 4GPZA 1Q6ZA 2A5LA 3M0EA 4Z2YA 1QH9A 3O47A 1FFEA 4LF5B 3I73A 1UC9A 1JWBB 4FONA 2IHNA 1OGIA 3BTSA 4PICA 4LV6A 1Y6FA 3GDWA 2C2GA 5JCPA 1MAHA 4YAUA 1FQKA 1E89A 1W9HA 2LV8A 2ZTMA 5BO5A 1FQJA 4QREA 1ECCA 5EXPA 2QP3A 3HFJA 4JNCA 1INLA 1HTBA 3V4VB 2O5EA 1CUCA 2F7SA 2G9QA 1T4BA 1BFUA 5IJWA 2XWQA 3DWIA 2JI8A 2RBKA 4BMYA 4PHFA 3CPJB 1W96A 1G1MA 1FXWA 4EPTA 1JQEA 3DZ8A 1I9CA 5HKKA 2C94A 2VJQA 3A2KA 5B1DA 3PNPA 2BEVA 3R3XA 2Z6QA 1KYIA 3EC7A 2FSSA 3CF2A 3ESRA 2AFIA 4UVDA 1LBQA 2JIZD 1PEAA 1IZ9A 4O29A 4DIBA 3EC2A 2AR0A 4U3JA 2EAUA 4ALMA 4EKGA 1A9XA 1A4XA 4X95A 5AK5A 1GA1A 1B2RA 1SU8A 2OFPA 8GPBA 1XEWY 3ODGA 2WWYA 1QQAA 2Y67A 2IP2A 1ZFNA 1NJ6A 5IJ0A 2IHZA 5BSKA 2E55A 3FMVA 1QPBA 3V5NA 1QVWA 1Z6XA 1NNLA 1O9HA 2WFAA 2YINC 4BMPB 3O4HA 4N0MA 3LHDA 3QM1A 1XJQA 4Y2SA 4QAQA 3VH1A 4BNMA 5JNRA 1UOQA 3JWGA 1RXEA 5EMNA 4J0IA 5DNYB 1IHDA 1S3IA 2WIBA 2ZB3A 3FY4A 4UVGA 4LC0A 4CKCA 1O97D 3C87A 3NTVA 3WYNA 5EZYB 4TSFA 3KUXA 3ELDA 4ZYZA 1XYGA 2V97A 4U9UA 5KX5A 1N5DA 4LJ5A 4UNIA 3IV9A 4FIDA 1KYTA 5B1EA 4G0YA 4ZDKA 5K7SA 4HX9A 1A4IA 2CVHA 3CUUA 4O3FA 2M32A 1L3BA 4JVNA 4OK6A 3FSEA 3LQRA 2DCMA 2F4NA 5IK2D 3CZAA 4IHAA 3IC5A 4U7JA 2WU0A 2X2PA 3IBGA 4IFTA 3A6EA 3UUGA 1Q7TA 3ZU4A 3EQZA 3KQMA 3TVTA 1T2DA 1WXIA 5TT1A 1TRHA 5A2GA 1LEHA 1PR2A 3EXG1 2I4OA 3H0CA 1I36A 1NSYA 2HM7A 4OGKA 4QYSA 5ELMA 2F9FA 3OMXA 3ZIAD 5DWDA 4XM0A 4CMHA 4E14A 5IBCA 4ZOQI 4D9HA 4YJ2A 1BJTA 2BKXA 1Y8AA 3UJAA 3GDOA 2J9FB 2UYCA 3IEVA 4HEJA 4MR9B 3TTSA 1RXSA 1CVRA 1Z7WA 2ZJZA 4WZAE 3MCTA 3ZLTA 1FYEA 4AU1A 3OPXA 1GPJA 3LC2O 3ND5A 5SZJA 4EHKA 5BQFA 1QLJA 1Q3HA 1DKNA 1Z38A 1HGXA 2FSVA 2OCKA 1B6SA 2WJ6A 4MTCA 4V0NA 3A3PA 1EUZA 2BRUC 1DEOA 2ZZMA 3TRFA 4RD4A 3VR3D 3ZTYA 2QGFA 5G4KB 4YJFA 1IULA 1BU5A 1CDOA 1PGPA 4FM9A 2XMSA 1PR6A 4TL9A 3U4CA 2B78A 4EJSB 4TKMA 2NAPA 1JLRA 1K66A 2B4QA 1QU3A 2WW8A 1GEEA 2OKGA 4OXYA 4IUYA 3E81A 5JEDA 3NDIA 3UIEA 2X22A 5K51A 4HUJA 3TZEA 1V1MA 5IMSA 1ZKDA 1B23P 1RYEA 3WAKA 1I6WA 5T4FA 6YASA 1IUPA 2WHXA 4K3VA 5A71A 4PW0A 3QF7A 2CLCX 4CW7A 1K6XA 3CS3A 3ASZA 2ZJ8A 4MVCA 4QHYA 5A4KA 3PQ3A 4G89A 3AM5A 5FLKA 2QTLA 5CFNA 3L43A 1CJSA 5FNVB 3O31A 2IHJA 4QQ8A 1I51A 2Y77A 4IKEA 4YAEA 2O2SA 4X6YA 3MB5A 4J1TA 3ZGNA 4I50A 3TOVA 3RRZA 4YT4A 3V2HA 1H0KA 1BCSB 2Z4SA 2C4NA 1WETA 2X1VA 2ZROA 1PR3A 5IT0A 1OHHD 3T5CA 3VYUB 1UT5A 2Q5OA 4QAJA 4EOGA 3KZOA 1DCFA 2AR9A 5FBVB 1W0KD 1U94A 5C3MA 1DJLA 1S2NA 1L2TA 3EUFA 4K2AA 1MC8A 3NFYA 2JEYA 4P92A 3IPYA 2OBFA 4ENWA 1F8FA 1S8FA 4TVSA 1KRXA 3C7CB 1CF4A 2HHLA 1QHXA 3S8MA 1VFNA 3CW8X 1U5CA 4HY3A 2QEQA 3V1MA 1XZEA 4ADSG 3WADA 1KJ8A 1P91A 2WYVA 2BMWA 1VKJA 3M70A 4X66B 1DOAA 1DP4A 4FMCB 4BO9A 4J2HA 1W8DA 3F97A 2GNPA 1PJZA