4Z3GA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with 4-methoxyphenyl beta-d-galabiose in space group p212121
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
198
structure length
198
Chain Sequence
MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PapG, lectin domain
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 45
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3gA00
4Z3HA 4Z3GA 4Z3IA 1J8SA 4Z3EA 4Z3FA 4Z3JA 1J8RA
chains in the Genus database with same CATH superfamily
1X5KA 4HAKA 4BV1A 3ZYOA 3EFOA 4EF3A 5FUZL 1XF3B 2YSSB 1LMKA 1RUAL 3CFDB 5MI0C 1R46A 2WXIA 4YDVA 1JN6B 1I8KA 1KJMA 1S7WB 4F7KA 1FG2A 4IJTA 5BW7A 5DI8B 2K0RA 2XTLA 4OCYH 3RHWF 3TA3B 4X7SH 4DN3L 4D94A 5FM5O 4N9GA 2WWNA 4XCCL 1HHJB 1KV7A 3T9WA 2NW3A 5CWSB 3GLAA 5SWZD 4HKXB 3S7GA 3D3VA 1K72A 4B9FA 4ORGB 4YHNA 5FLVA 1T89C 1DQML 2X87A 5EF2A 4OV5B 2E8YA 2QVMA 5J11C 3ILPB 5K9OB 1JF1B 4NCC1 5DVMA 4GO8A 3T6WA 2HFEB 3DETD 3BRFA 5EIVA 1NCGA 2FO4B 3BSZA 2V5TA 4GRLB 3MROA 3MKGA 5D1XA 1DJHA 3JV4B 1U3YA 1ZPUA 3NCXA 4WHYG 2NY4D 2Z6FA 3TURA 1IJ9A 4L29B 3SKJH 4OQ1A 2CQVA 1XGPB 2GB2A 2H5UA 2X5PA 1QEXA 3UTSB 3WS6C 4ZOBA 3RWDB 1MI5B 5CZVH 3LVEA 2RALA 4J28A 4FTVE 2VERA 5GRZA 1PY0A 2BRRH 1E3XA 1L7TH 4FFWD 5KANG 4LLQA 5GGRA 1ES0A 5HI4D 5D93B 2XZCH 4X5RA 3QP3A 3GTNA 4FCAA 4Y8DC 3KPNB 4NUPA 1EHXA 1KT2A 4XVTH 1W6LA 2FB4L 2G9HA 2DW5A 1DL7H 2AGJH 1HIML 1KTLB 3ZIYA 4NNPH 4KAQL 3ZTCC 5FM8A 1KWKA 5C07B 1O9VA 1CL7L 1AQDA 1QSED 25C8H 3SE8L 2UXFA 2EH8L 2J8UF 5CMAB 1MCLA 1QFUH 4JG5A 3MOAL 2L7JA 4BH7B 4N86A 4F8NA 2MPVA 4BHUI 4C4KO 3UGEA 4ZMTA 2F1AA 3ZRSA 1GTFA 4WO0A 4PJIB 1FLRH 5DD0L 3DSNA 1CMOA 1ZHNA 2GQHA 5IFAH 4K7PX 1P7KA 5FUCC 2YGQA 3BD4A 3OX8A 5F88B 3R8BB 4OM1H 3NCCB 4PGEB 5KS9B 3MCLH 4JFQB 3RRQA 1CO1A 4N8VA 3DDFA 4JFTA 3QFDA 2H0JA 1S8DA 1S9WB 1Z32X 3F64A 2X4PB 2O5NA 5DUJA 1FO0L 3KGSA 3CC5A 5EBLA 2AZAA 3BLBA 4MQTB 1KNOA 2VLMD 2J72A 5FOBB 2AJ3B 2XWRA 3MV8D 3FRUB 1NEZG 3GK8L 1ETA1 3G6DL 3DHUA 4JFFE 2EIZA 3IDMA 4GQRA 4WU5B 3RJDA 4QRPA 4ZTEA 1ZA6B 1D6VH 4HV8B 3I6GA 3FT1A 5FECB 1MHPH 2YEQA 2EC9T 1JPSH 4HIHB 3ZYIA 3H9HA 3NTCH 1JRHI 4HIEB 4JK0D 4P2OA 1BAWA 1WYJA 3BVVA 5C08B 1WDAA 3WTYA 4XP5L 3VXUD 4DVBB 2OL3B 3OR7B 2GAZB 3CBKB 2YARA 2BH0A 3G04B 1LEIA 2CKBA 2V33A 3D48R 4JKLA 1R5IA 3QUKA 3MR9B 5GJSH 4KHXL 4N8CL 3V0HA 3X1GA 4B41A 4Z3GA 4Z7NE 1XIWD 5EC2B 3ISYA 4KOCA 5DHYB 1A9EB 1EJFA 1JDAA 3SDXE 5ECJE 3SN6N 1A7RH 5FPIA 2V3DA 3IDIB 3H54A 4G1MB 4KQ4H 4Y9FA 3MREB 2VWEE 4FTVB 4RGNE 4PMEA 2VXUH 3L81A 1M7IA 4NQDA 3OQRA 4WW1A 3N1MC 1I8MB 3AWFA 4X7DC 5I1IL 4YSTA 1OE3A 3OAYH 2K7QA 1A47A 3WFEH 1KEGL 4XBPA 3PDOA 1FVEB 4PJFF 4APQB 2XJLA 4NQCE 5I6OA 3TA4D 4FQHA 2B7DT 3FBQA 1JXDA 2X05A 2EYRA 3TX4A 2V2WA 3HC3L 4LOVA 5MEND 1RURH 4OCWL 3BRDA 1I4FA 3B2PA 5I1GL 4XGZB 5D7LD 3VXQA 4BWTA 5ADOH 1NEUA 3LRKA 2CO7A 3NEEA 1JYVA 2VISB 3FH7A 1I85C 4A6YA 4AYID 1U8JA 2V37A 4A7UA 4WI3A 1CFMA 3CFEA 5BO1L 4UM9B 3N91A 5BRZA 1J8HD 1L9QA 2PTTB 3OL2A 4TVSa 5IT2L 1EANA 2EUVA 1TQBB 5HDOA 2P5EE 3ARVA 5DJCB 3S48A 1M1XA 1KG0B 4JFPA 5IMKB 3ZMRA 3S0PA 3QORD 5DHMC 4NJ9H 5CILL 1DVUA 1CYWA 3CLEH 4LLWA 4M02A 1IFGA 5AW8B 3RWCA 3MOBL 3OAZH 4JFDD 2C4FT 1A6WL 2JIXB 4JFFB 2ZSVA 1SMOA 5FYKL 1L0YA 3MPCA 1URZA 1AS6A 4LHUB 4F1ZA 1PCSA 5IW1A 5E1GA 4K2UH 1O0VA 4UUJA 2FEEL 2GITA 3GYRA 3LN4B 4N0FA 5EA0L 1KEML 4L8SC 1RZPA 4FOMA 4TNGA 3AS1A 4HLJA 2BCKB 3BAEL 3BP7A 4K5OA 1ML0A 3IFNH 4KDTA 4NUJA 4R0LA 3T6QC 2AJZA 4LF3A 1KCVL 3SGJC 4KZDH 1UZ6E 2NY2B 3T09A 3D05A 4Z7OF 2QELA 3QNFA 1BX2B 4Z7NB 4V11A 1G9NH 1H8OA 5HTSA 5LCVA 2R56L 3RYMA 3SDXB 1OP9A 4HKJA 4BH8B 1WC7A 1F58H 2B2XH 2JJWA 1EA9C 3Q01A 4TL5A 4Z3EA 3I3BA 1DUZA 1ET8A 2BSEA 3LS5L 4GG6A 3DO4A 4KGJA 4PJAF 1X9RA 5CS7A 4FQQA 1JWSB 1TSHA 4RGNB 3U79A 4OLVH 1MW2A 5KVEL 3QR1A 5F7EH 3EDDA 4JB9L 3SYCA 4Y4KA 2ZKYA 3PXJA 1K3ZA 3ILQD 4TSAL 5INCB 4AQ8A 3OB0K 1G6VK 1WZ1H 4GUCA 1Z3GL 2DQDH 2HTKD 4AITA 2PXYB 2IQAB 4NQCB 5EU3B 1E4HA 1MRCH 2DLEA 4PWKA 5F1SA 4HHAA 3LV3B 4XNXL 1HNGA 4TNWK 1GA2A 3WNJA 2Z92B 1OGTB 1A5FH 2VXTH 1NBYA 1UT2A 1T2QH 2Y2WA 4O02A 2YD1A 5JOFB 4XTRC 1F3JA 3HVDA 1MF2H 4O2FB 1EIBA 1UYWL 1UXLA 2VQ4A 3CK0H 4F7CA 2Q86B 1B6DA 5I1CL 3L3GA 3NCYP 1CLZL 5KSBE 1TZGH 1XCXA 4WGVB 3MA9H 2CA4A 5EEYA 1N0LA 4W9JC 5CNHA 5DVPA 1DE4B 2X42A 3KWVA 3SPHA 1JTOA 3SGKC 3UJIH 1EDHA 1NCNA 4LDLB 2P5EB 5D1ZB 5EPMA 5AVZB 1Q9WA 3RGVB 4O5LH 3FQUA 2UZYA 2DBLL 4Q9CA 1XEDA 3LQAL 1G9NC 1M6OB 3LXCA 3PJLA 4RMVA 1H3GA 1TJHH 4X9HA 2VE6B 4L5FE 4JFUA 3JWNG 1DBAH 1H5BA 1MCOH 2Z4TA 1T7XA 3ECBB 1M57B 4L9LB 5DDHA 4QLWA 1RHHB 5BUAA 4A04A 2HVKB 1DQKA 1J0YA 2A9NH 1SF3A 2XWTB 4JDVB 1I7ZB 1MIMH 3ABZA 4YBQC 3MMEB 1HE7A 2A6JA 1UACH 3DHPA 1IGIH 1Q9LB 2X3CA 4JO3H 4P5SA 2F8XC 2A7BA 3CU1A 4WEBL 4YE4L 1J87A 1Y18B 4KVNL 2VDKB 1AIZA 1TR7A 5HD8C 5JR1H 5TE4H 2NNAA 5I0VA 1ZS2A 4UZGA 4O02H 4AVIA 2K1MA 5CEZH 2CO2A 2D03L 4N25A 3F7YB 3RVXD 3IJHA 5C2BL 4WW2A 4AW4A 1X3DA 3BZDA 2DH3A 4F37K 2DYPA 3IB4A 4R2GB 1JXFA 1MZZA 4LAQH 3VQ2C 4OJDH 1M9SA 5I1KL 1FBIH 2OX5B 3MODL 1MAML 5CGBA 3HZYB 5KSUA 5AZ2L 5D2NC 1RPUA 3L7FA 5E00A 2CJUH 3AREA 3ARFA 1ZPLA 3RTQA 4P57B 1ED3A 5C6PB 4Y5VA 1MCCA 4K07A 4UTCA 3RVUC 3RX8A 3V5KB 3FTUA 4FEIA 3CDFA 4I18B 4DPCX 3UEZA 5FYJU 1EEQA 3DX9A 4JFYA 3HVNA 2VLLA 2V9RA 1LDSA 2LT9A 1NEZB 4YN3A 5DMYA 1P5VA 1MVUB 4B9GA 4OGXH 1XCQB 4RBPK 4LASL 1GZQA 2BNRA 4P2CG 3TGXA 2V2TA 2J73A 2J71A 1LNUB 2ICES 5KSBB 4AQ8C 3ALWA 1B2YA 3NACH 12E8H 2UUDH 1XTMA 3V6BR 3WENA 4WJ5B 2AQ2A 1EBAA 3H3KA 4M48H 4ZMOA 1BXXA 2F1BA 4I77L 4JQVC 3KWUA 5H8DA 1XH3B 4WTZA 1EFXA 3WKML 4IIQC 2CXKA 2P80A 1NWPA 3BH9A 2GY5A 4QF1A 4ZMVA 2QPDB 5CP3A 2FX8L 3HAEG 1B0GA 1WBXA 3EH1A 1BGXH 1XDTT 4U3SA 1TTUA 1ACXA 2FJHB 2VLJA 1KDJA 1WFJA 4U1GB 4K9EL 3VDAA 4ZQKA 2ATAA 3GHBL 4YDJA 3O2DL 3UAAA 3LPOA 4DK3A 5E2TH 4JL1A 4N2IA 4R7NB 5DVOA 3IAGC 4HXBL 3VM7A 4XZUA 5J7CC 4F7PB 3D85A 3NIFE 5CZXD 1UD5A 4WZ9A 4X9GA 2QR0B 3SKNB 5KSAB 1MNUH 4G72B 3SDCA 3V6ZA 3PP4L 3HPJA 2WQWA 1PX8A 3O6FB 5FGBC 4J2QA 1CXEA 2WVUA 1O5PA 3MGOA 1KY6A 1F4WL 4FNUA 4A67A 2AJUH 1DQDH 4YFLI 1U95B 2ZWKA 4LPWA 4FXGC 4KTDH 2MKWA 3VH8A 2DI9A 5I15H 3N43B 2Y0SA 5GHWH 4OCRH 1SNRA 1R9FA 4NXSA 4PI2A 4M6OL 3RNQA 2X10A 4HYTB 3KPLA 3WBDA 1PW3A 4N0CC 1JGDB 4NNXB 2R23A 5D7IA 1O6VA 3T0EC 4OI8A 4P2RE 4DKAA 1N64H 2DLGA 2V6HA 4CGUB 4GS7C 3LKQA 1BQSA 1TCRB 3IETB 5JXEA 3JWNE 4W93A 3GBDA 5BRQA 2JKJA 2W65B 3KL3A 5K33A 2FT7A 4YO0A 1MJ7L 2ZUXA 3QCUL 2DB8A 2Z1KA 5TGBB 4ZFZB 4JAMB 4ALAH 1OF2B 1XSJA 1DHKA 2ZNXA 3WGUB 3I6SA 2YD0A 3UOAB 5T8IA 2XKNA 2GI0A 3RIFF 4NZFA 4U1HA 2UY7B 3VXRE 3P3RA 4UZUA 4Y2OA 5D6CA 1U8CA 2OPCA 1TYEB 2VXVH 2EJ1A 2P7TA 5PAZA 4XTRD 1CD1A 3SBPA 5KSVB 3SDXF 3UBXA 3L3IB 1U9KA 3J8F7 3R0MA 4XPGH 3W39A 3WFHA 4F5CE 3OZ9H 2I07A 2XQYK 1QUPA 4IBZA 2WM0A 4LIQE 1JF6A 3BGMA 2Y7SA 2YJLA 4G9FE 4CMMB 4DF9A 3THML 1FZKB 1XL6A 2ZJSL 5JO5B 3QPXL 3WKNA 1MHCB 5LGHL 1P53A 1YEEH 1T1XA 2Z64C 4OM0H 2F68X 1CIUA 1JV5B 1YNTF 4ZUVA 1ZHBB 5SV3A 2HPTA 2Y1AA 4WUUD 1J48A 1TITA 1YMMD 3DBXA 2TSAA 1SDYA 1T4WA 3OWRA 5K39A 3NIFB 3V4VB 3DIFB 4MNGE 2Z35A 5ETUA 4RLDA 1TLKA 5ECGA 3RVTD 5C0FA 4NO0D 4UILL 4AMKH 3AGVA 1XF5A 3NZ8B 3Q0HA 3FTXA 3ZE1E 2D2CC 3CFIC 3OC8A 3ULSB 4XCFL 4ZS7H 4ZT1A 3QDMD 4IMKA 3TYFA 3FO0L 4AEIL 2Z4QB 4N1HB 2BC4A 4PJ9C 2Y23A 4M93B 4L9DA 3EJYC 1E27A 1TQTA 4XWGL 4OKVB 2FL5B 1DJSA 5D7KE 2XQBL 2DZEA 4ALAC 1W6WA 2X3BA 3AMKA 2HT2D 2BP3A 5FLUA 2HFFB 1J8KA 4GKLA 1RULL 3LXUX 1GJWA 2MOGA 1QFWM 1UASA 4D0DA 1KF9B 4R4ND 4PJDA 1PG7H 4OLYL 4GXFA 1LK3L 2O4EA 5FUZH 5JW3L 3TO4D 5HVFB 1XBRA 2RFXA 4MAYB 1Q94A 1I1CA 1AZVA 2IAND 2JJSC 4B50A 2NXYB 1DQJA 3NCJL 4P2RB 4XNAA 3VFUA 3IFLH 4NFBA 4QYOA 4JFOB 4W6WB 4WV1A 2VQ1B 1KTJA 2XXCB 4XCCH 1NGXA 4YFDB 5AWNL 1T1WB 3RVUD 5JPMA 1N7ML 2WZPA 3PG2A 4WSGA 1DQMH 5C09A 3GMQA 4DUWA 3HS0B 3GRBA 4HKZB 1U91A 5AZUA 3NEOA 1JPGB 1E4XL 2AXGA 1BFSA 1EEYA 5K9QI 2FWOA 2YR3A 3VXRB 1UZ6F 4UIMB 4PG2A 3L5WB 4UTAL 1DANU 3LMJH 3MNVA 5IBLC 1SDDA 4HJSA 4KROB 3T77B 4G43A 4N85A 4CVWA 3KLHD 4BA0A 4XBGA 3UTTE 1AQKL 2F9BT 3IRZA 1GR7A 3U0PA 1B9ZA 4OLXL 1F3RB 5JXEC 4NKIH 1TG8A 5HYIA 2WKLA 5IFHL 1A7NH 2VW4A 3FCTA 3GEWB 2PWEA 3KGTA 3MRLB 3E38A 4G9FB 5DHVH 4BGDA 4WFFE 2X2HA 3AW5A 5BS0A 2WQRA 3U2SB 5DQ9A 1S7XA 4PWJA 1NBVL 1ZSDB 3V4PB 1WFTA 2Q0ZX 3NFPA 3VSTA 3HOGA 4MA1B 4M7LH 4XNZC 2IIJA 4XVUC 3M46A 5DC4B 5FGSA 4IJ3C 5IB2A 2AXFB 1PL3A 5AVSB 2YFOA 3I2CL 1IL1B 1UB6A 4GOSA 2J6WA 1YEGL 2CBPA 4MNGB 4YIQA 2PCFB 4LSVL 2IAMA 2WTOA 4JJOA 3BN3B 1JZ7A 2WY3B 4OZGE 5F9JA 4ZW3A 1JNHA 1FN4B 1JF5A 4IBYA 4JO1L 3MV9D 3ZE1B 3WJJA 2AQTA 5I1HH 3BPNC 3LD8B 4ODUA 4KAQH 3S98A 1WA1X 3GXMA 4XPTL 5IB5B 2FO1A 4PBVC 2VDNL 3O3DB 3GSQB 5ISZA 1FL5A 4JO5A 5AG8A 3SE8H 3PY9A 5DYFA 1C5DA 1PZ5B 1TJXA 2RACA 3MOAH 3X12B 1SYSA 1Q4NX 3VB8A 4KJQD 4QHMB 5FIEA 1A22B 1A7BA 3BH4A 4Q9QH 1NPJA 1GGYA 1NFIB 2YAHA 4ZAKC 4C4KT 1YYMH 4FZ8L 1NWOA 2F19H 1EXUB 3EOBB 3IK2A 4MVBD 3TVMD 4HWEH 5JIIA 5E8DL 3Q3GA 1OQXA 1DVTA 1Q8MA 4Z7VE 1A1OB 1YHPA 4FG6D 5I66A 1EDYA 1HVXA 3QHZL 1FO0H 4IMKC 3VFMA 1BJ1J 2ZOKA 3B9KB 3LNFA 5D6DA 3UPCA 1IBYA 1N5YH 3D69A 1IVLA 2IFGA 3GK8H 4PJGE 5FWRA 1XMEB 2FJGB 2IDCA 4ZYKA 4Y4HD 3A6BL 4I3RL 2WAQA 5FS5A 43C9A 1T2JA 4WFHE 2CBQA 1G7MB 1USZA 1A9BA 3BWUC 2O6PA 3QWOA 1JHKL 1NEPA 2CU9A 2YPLE 4F7EA 4PD4K 1KXTA 4RNRA 3EH5B 3ES6B 2AAVA 3U0WL 1S7UA 1W2KT 2VJ0A 3DX2A 3KYKH 4GKZA 2BS9A 2OCFD 4RWYH 1TU2B 5PCYA 3O2WH 4I2XA 5CKAA 3UTTB 1AZRA 4FQ1H 1QUNA 2OMYA 4L4VA 3QULB 3G9AB 4KHXH 4N6QA 1DR9A 1PEWA 4H26B 1YEWA 5IM7B 1R0AL 3HG4A 4MSWB 4Z7WE 4BCZA 2G60H 1XGTA 1NC4B 2WLKA 1M2VB 4R26L 3MRKA 1AZUA 1Z6JT 2OMZB 3N43F 3RBSA 4XMUA 1B2WH 1Z1WA 3QHFH 3QRBA 4B9ZA 3D1MC 1KCLA 4KNSA 4DT2A 2ZOUA 3APCA 2KZKA 1GYAA 4IK7A 4AE1A 1LL1A 3HUJA 1KTDA 3B2MA 1S4IA 1EVUA 5CU9A 1ZXKA 4RIRA 5K9JH 2UV3A 4FJ6A 4IS6B 5I1IH 1MWAB 4W81A 1EBPA 1G7IB 5H4ZA 2D3JA 2ZT9C 3BUDA 5EG6C 1X44A 2Z8RA 3KPSA 5A2AA 3ZZQA 3GZKA 3FO2B 3ORJA 1XAUA 3QRGL 1YJDL 1N8OE 3PIQA 1ORQB 4J3OG 4MA7H 3S5YA 2UZXB 4OCWH 3EDJA 5BQDA 5I1GH 5EOCL 5ESQB 1F3DH 4MJ5B 5G4OA 3LEYL 4LP4A 1M71B 1NL0H 3GMPB 2XNAB 4YSPA 5K1VA 4WCYH 2A0LD 4MDRA 3O0RL 4KNUA 3GINA 2R1XA 1S9XA 4NNYA 4G11A 5BO1H 4BFIB 5DRZB 1QBML 4FQJL 4G71B 3SE3C 3RG1C 5BVJB 1G0XA 1K4DB 3MNDA 3K72A 2PYFA 2XWZA 4G6MH 4Z7VB 4DKFL 3ZSTA 4UT7H 2HJFA 3B8YA 2XPGB 3TT3H 3QAZB 1A8JH 5J12B 5L0QB 1U8PA 1IM9D 5DURB 5CILH 3OHMB 2A6KB 1JWUB 1H6TA 2OM5A 5SWSA 5JW4R 5KYNA 5JDSB 4PJGB 1G94A 1A6WH 4PUBH 1IC7H 4CADA 5L2KE 1VADB 3L5IA 1RAMA 4JPQA 4P4RA 1W72L 2ENYA 3MLZL 1T0NB 2ZWZA 3WLWD 4TLTA 1IGTB 1T1YA 2WMPA 4HWZB 5BV7L 5EA0H 3FO9A 1XFPA 1KEMH 2OFQA 3NIFF 3JV6B 5IMMA 1QLFA 3LH2H 3BAEH 1GGIL 2YPLB 4U7SA 3W38A 1TZIA 2OTUB 4MCZA 5E08L 3EO0A 2IDUA 1GIGL 3LKRA 4PJ8B 1IBZA 3CIAA 4UAOB 2FR4B 1KULA 2CR6A 3X1BA 4LCYA 2F18A 3L1EA 4QXVA 2L7UA 1TTFA 1VHPA 1L6ZA 1PQZB 3TP4A 2IMNA 4JM2A 4N0UE 2R56H 1ZLSL 1XSKA 4OJYA 4N2GA 1I1AD 4HBCL 4NZUL 2J5LB 3ZQXA 4Z7WB 1Z2KA 1DQTA 4MS8C 1JK9B 1X5YA 3K6NA 3NGBB 3QUMB 1K85A 4X4ZA 4AQAA 5I6LA 1JUFA 1E3ZA 1IILE 5B1CA 1IAOB 3GMNA 3EF4A 5E1AA 4Z0BH 4MQXC 1J9SA 1NCWL 3NABH 5CSGA 1LO3L 4JDTL 5IJKA 1G7QA 4TSAH 4OUUA 1Z3GH 2JSFA 4OJFL 4CDHA 4UNIA 1C5BL 5BVPH 2LAGB 1RP9A 3OHXB 3TEUA 4HPYH 1QWUA 3OLGA 3DA0A 4Z3IA 3K5SA 5GQBA 3VMNA 4XVUD 4XNXH 3F8UB 2YGVA 4PJHE 2YUWA 3LPPA 3UPRA 2WJ7A 3IGAA 4LCWA 2P4AB 3ESOA 3JTTA 1LO4L 4Y5YA 5F7AA 1IQWL 2AVFA 4TQPA 1JNLL 5IB4B 1N0XH 2RQEA 4QTIL 5F21B 1J5IA 1FIGL 2EH7L 4MCMA 4X5QA 4WWKD 1UYWH 1U36A 4NB7A 1CLZH 1AC6A 3D30A 2GSGB 5J0BA 2XFXB 4HOWA 2R29H 3SJVE 2GK0A 2FIKB 1T5WB 4P23C 3K81A 3U46A 4PY8I 3V6OC 1M1SA 2BP8A 1Z9SA 1GMEA 2XI9A 4H40A 5G4NA 2WBJC 1KZQA 2IH1A 3H85A 5BZDB 4J3WA 2J8HA 1N10A 2OTWB 4EDWL 5CM1A 2EC9U 1E7VA 1TZ8A 1U6AL 1ZV9A 5CSZB 2ZCKL 3D8MA 4WHDA 2WK2A 3O4OB 4RMSA 5L2KB 2R0LL 3WMPA 1S3KL 3D0LB 4L8BB 1PZ2A 4OGZA 3SD5A 5EIIA 3Q6FA 5SWZA 4TV3A 3K6OA 5JZ7D 4LCVA 1JZHA 4IDLA 5FYJE 3IE9A 1P7BA 4WNJA 1HE8A 3IXAB 1OAQH 2NW2A 5J6SA 2HTLC 2DS4A 3OVUB 2VMDA 1A6VL 3QA3B 3ZE1F 4LVHC 4D0CB 3IWUA 4PTUA 2VN6A 4YE4H 4KVNH 1HHKB 2QDWA 3OMAB 4GI9A 1PZSA 1R5WA 4UT6L 4N0UB 4PW4A 3RFZA 3EYQD 4YSAA 3GJEB 4TYUA 5F3BB 4CGTA 2APSA 3T8XA 2DH2A 2HAZA 4W1TA 3DLQR 2F8IA 2NCMA 3MYJA 4KK8D 5ACMA 3UDWA 3JWDH 3WIFB 4UU9A 2X9WA 3WKQA 2CDGB 1J86A 4D9LL 3MODH 3EDKA 4KI1A 3MUUA 5AZ2H 2YD2A 2OJZH 5A2IH 1RIUL 3VFTA 4WTQA 3II1A 2NXZC 3GSRA 1JHTA 1TLMA 2MPAL 3F83A 1L7IL 2Q76B 4OZIF 4NYLA 5IF0B 1OAYH 3ECWA 4KQ3H 1JD9A 2ZOTA 3TC9A 5H37G 4QGTA 4PJHB 4EO5A 3UABA 5CAYB 2DJSA 3W56A 3DPBB 3U2IA 2NY0C 1VGEL 4JE4B 1QSEA 5EBMB 1OP5H 1KB9J 4XP9H 1RUML 4OD2B 2SEBB 1K5WA 4HA1A 4V1DD 4J4PD 2XKSA 1WQVT 3SPCA 4PRDA 2FBOJ 3VI3F 1SEQL 1ZGLP 3OSVA 4OU3A 2BRQA 1U3ZA 3EHBB 3NIDF 4U6VH 3SJVB 2W9EL 3ML8A 3N1FC 5DD6B 4I77H 2C4FU 5IMOB 2I9LB 2Z31B 5DC2A 1JYXA 3WKMH 4IRJB 1B90A 1QP1A 4GNKB 5DUBB 4RA3A 4OCXL 4ZI8A 1AIFB 2DQJH 1ZT4B 4ZMLA 4ZTPL 4NRZB 4PS4L 3BO8A 3AADB 4HC1H 1RJZA 1JFQL 3TO2B 3PAVA 1I8IA 3B7RL 2K9FB 3JWDC 4WNQA 1GCFA 3PNWA 2CDFA 4U1KA 5CIPA 2R9HC 2WTRB 3O2DH 5GRUH 3GTTA 1MKFA 3H3BC 5TK4A 4E68A 3BEVB 4HUKB 3SBWA 3GSOA 5JXAH 3D50A 3WSQL 4PG9A 3UZVA 3FFCB 4HK3J 5E8EA 5EU4A 4KQ0A 3UP1A 4HXBH 3SEPA 1G4MA 4OZGF 5JHBA 5D7JC 3X3FH 1C7SA 1MHEA 2XQYA 2IG2L 1IJNA 1ZIBA 3BKJL 3E9TA 2COVD 4KO6A 4QRSA 1IKOP 2Q7YB 2A9CA 4RGOH 1E8XA 5DRXB 3VXUA 3MUZ1 4YAQB 3U4EB 3F7VB 4FABL 3FOLA 3I6KB 1MY5A 1XIWA 3FYEB 4PRID 1F4WH 1I7UA 3AU1A 3KPQA 5C7XL 5B8CA 3L16A 3O41B 1FA4A 5IESH 1C16A 2IPTL 4WO4D 4M1CC 1IE5A 2WZ6A 4U49A 1HZHL 2Y22A 3N9GL 4JUTA 1V7MH 1UOLA 1Z9NA 3K2UL 1ORSB 2E3VA 3BQUB 2YLHA 3R19A 3VQMA 1JWMB 5EU6D 4FZEL 1BVKA 5ICZA 4JO8A 1N4XL 2JK5B 4C56D 2CGYA 4I0KA 3MBED 4PJGF 1QAWA 4X7EC 1N6UA 1FJ1A 3G5ZA 5E24E 4MB4A 2Z65C 1YC7A 2PO6D 3AQZA 1YPZF 5MENA 3R4DA 3I02B 3SY0B 1I3RB 1KGIA 2CLZA 1MJ7H 3QCUH 4IGBD 1RUPL 1EZLA 1BMGA 3MRPB 3KPOA 2H8PB 3T4AC 2ZKHH 2IALB 1RV6X 3DYMA 1I3VA 4KDWA 3DV4A 1QATA 4YNYA 1KIUB 4JY4A 1K5NA 2UUDK 1N5AA 3QYCA 3HRZC 3KCPA 2ZKWA 4I0PD 1OGAE 3VFRB 4ZFGL 3EJZC 4NUMA 4O2CA 3LSOB 5TE7L 4Z7WF 4G42A 3HFMH 2ARJA 2VC2L 4QCIA 3PHQA 4DEPB 3QORA 4M4RA 5C0GA 4N2NA 2XWCA 5IK3B 1WJ3A 1CDCA 3TBTB 2WCSA 3V6FA 4JFDA 5F7MC 4P23D 5EOTB 5DK2A 2VABA 1R6VA 5DZLA 4PTTA 1UFGA 1J9QA 4LBEA 3V0FA 2W07A 3MRCB 3OMZA 1BDYA 1F00I 1BEYL 1H19A 2GJZB 5HJ3B 2HVBA 3ARBB 4ELKA 1K4CA 2AI0L 4UWQB 3PHOA 4UILH 4FFZH 5EEWA 4N90E 1RU9L 1MJUL 4RMRA 4KKNA 4XCFH 2H26A 4P46B 5E8OB 3QI9D 3U2JA 5B3NA 3AGWA 3A3YB 1BM7A 2X53A 4OD1L 4AEIH 4WUKH 4AV0A 4GQ9H 2DQFB 1XWVA 3Q5YA 4XWGH 4HH9B 4GKOA 2CMRH 4G80A 4E5XA 3V95A 4UTBA 2XQBH 4PJAA 2ITDA 3C5ZC 2W95A 3D25B 3QJUB 4EMZA 3HC4L 4NZRL 1O6SB 4GIAA 3WFBL 3ZHLA 3HMXH 5AG9A 4C59B 5HYJE 2JKWA 3EGSA 5B1BB 4ZFFA 3HMWL 4OLYH 5ESVB 1LK3H 5JW3H 1CTOA 1KCBA 1ODAA 3TH2T 4YSQA 4XO4A 1P4UA 4HFUL 1ZKAA 3ZDXE 4AQ1B 4KKAC 4TVPL 3O4LD 4GYBA 5AVWB 1A9VA 2G9KA 3QJOA 3G7TA 3TPUA 1D9KD 3J7HA 3AG2B 4DWHA 1U8OA 1HZKA 4P3DB 1IBBA 3IU4H 3LYRA 5MHSD 1HEHC 3OJDA 4ZXBB 3CDGB 4Y1AA 1E28A 3QIBA 2A1WL 4FS0A 5F7FA 3CFNA 1ZV2A 1HQRB 4DW2L 4FMVA 1DLFL 4Y4FB 1SFDA 4HD5A 4UTAH 2A83A 4G8GB 1ZMYA 1QBLL 4GMSL 4H1LH 5FW8A 4OIIH 2VR3A 3ETBJ 5HHPA 2APXA 1U8HB 1AQKH 1HINL 2H6UA 1NGPH 1PAMA 3GGWA 4U6HB 5DF0A 4YSUA 2VMJA 3IGKA 2NUPA 3WHXA 4S1SL 4G8AC 3CXHK 4TOYH 1CBJA 2F53D 3G5VA 4MYPA 4JR9L 4MAUL 4FQLH 2JKRM 2JXMB 2DRUA 3C60C 2ZAGA 3GKWH 3O9WD 3S3PA 1D7BA 2XJKA 4P2QE 3WL9B 1S7TA 1ND0A 2XBDA 3BVXA 4NERA 5IHUH 4LPCA 4RMQA 2UZIH 4DGWC 2KZWA 4GKSA 3TNMA 2MQ0A 1D5MA 3C6EA 2J4WL 3KNBB 1YEGH 5IIEA 2DD8H 2CO6A 4XPBH 3Q06A 3DURB 1MCFA 3KJ6L 4PJHF 2G2RA 3US9A 4ZNEE 4JO1H 2APBA 1GL4B 5I74C 5C0RH 1SHXA 3BAIA 1IGMH 4XO8A 2TRHA 5C3TA 3HE7D 3GXUB 4KRMB 2I5YL 1K2DA 4OTXL 2VL4A 1WICA 4JRYE 4NGHH 5TDPB 3DGGB 5CCHE 4WEEA 5IVOA 4IBTA 4CBZA 1QQDB 4JN1L 3QJXA 5E03A 1OP4A 4M5TA 4HUXA 5GRVL 2XA3A 2ZYRA 2QGBA 5HYJB 5GZOC 2CIIA 1XF2B 5BXFA 5C0JB 4PQXA 3TJHD 4HEME 2O6EA 5D5MA 5DUMH 3ZDXB 1U3HB 1JGVH 1ZDQA 1U58A 4X7CC 2ITEA 3CSYA 3CZFA 4GIPD 4ICXA 3KM1A 4N0RA 2MTAA 4G8IB 4NLHA 4QLRA 3OKEB 2FUTA 4BDVA 5GRVK 4YHZH 4NBYB 3BKCL 4X8JA 1DQIA 1UZ8B 2XG5A 1PZAA 2Z8VC 1Z5LB 1MXGA 3PWNA 3TU6A 1YAZA 5DZAA 3CG8A 4G59C 1T83C 5GSVB 1ZOXA 4J27A 4B97A 3GHPA 4PSPA 1ZTMA 2J7LA 1XV8A 4H2CA 4MD0B 4WU7B 2RIKA 3IMVA 3ZKXC 1DBJH 1BIHA 4PSRA 1HCFX 4XPAL 1N59A 3TA3C 4KVPA 1G9MH 5FA4A 1TIUA 1KC5L 4EEEA 3P4NB 5FO7B 4BRVA 1G1KA 1FCCA 5GIRA 5G4MA 1NMBL 2VNCA 3L3HB 1T03H 4YK4B 1R3HA 3HRPA 3M1BA 1T22A 4XNYH 1JP5A 2DQEL 2NZ1A 2Z3FA 3VXPB 3UC2A 2CM6A 1IAKA 3QB7C 1KUMA 3AACA 3QDGE 4P2QB 5TDOB 4ZSOA 3K4AA 6PAZA 2ZOWA 1HJBC 3GSXA 3CSFA 4GRLC 1W72A 4LLDA 4BFRA 2FJFB 4A2GA 5GGVY 3P40A 5ITFA 1KIPB 1ZEAL 1HH6B 1PDKA 5I0XA 1DVYA 2FBJH 2JJTA 4FADA 4PV9A 2QFPA 3ESMA 4CVZB 3NSCA 1HXMB 1MCIA 3CZSA 1D7DA 1U8KA 4HJGA 2PP8A 2EXWD 2J21A 1S7QB 4G8FA 1Z5HA 2FWUA 2X9XA 5IHLB 5EOCH 4JRYB 1MN4A 1NMCB 5CZRA 3BVTA 1LEKA 3GM8A 3B9VA 3NCMA 4LRIC 4XVJL 3FKUS 1KBGL 1U8LB 1U2HA 1R19A 3O0RH 2EO1A 3WEOA 3G5XA 2VO8A 2C1PB 5D1QE 1AMXA 3LAFA 4FMKA 3D9AH 2ZXAA 1ACYL 4ETYA 4N2LA 1WAEA 2J8OA 3PL6B 5BQ7A 4JANA 3DVGB 3LJ3A 4QRBA 5HHVH 1G9MC 5DK0A 4WKZB 2UVFA 3L7EB 4LEEA 4HOXA 5F9WC 5ALCL 3QJQB 8FABB 2ODIA 2B0SL 1FRGH 1B0IA 3OKLA 1Q0XH 6TAAA 1QBBA 2IOIA 5KYXA 3BCFA 1MLBB 3MLZH 4NENA 1HCVA 4JVPA 3STZA 3P3SA 1YY9D 4GAJH 4NZJA 4CU8A 2R69L 4IM8A 4UAHA 3MGAA 5I17B 3HHMA 3MBWB 4KXZI 1FPTH 4R4FH 5C0NC 4GP8B 3E6FB 1P6FA 1Z9OA 4K7FA 4BFNA 5IFJA 2FLBT 1R3JB 2Z1PA 2V4LA 3PV7A 4WFED 3EJPA 4FNPA 4AH2A 2EE0A 1T7YA 2ZCZA 1X7SA 2ICWA 2HUEA 2B1HL 2WANA 4DEUA 3BN9D 1QA9A 1QI5A 1UOWA 4BSVA 3L9RA 4ES8A 2X70B 4M9PA 1KSRA 2M8XA 1EMTH 4YHML 3S34L 2OKMA 4KUCF 4ODHH 1MLCB 3KLAB 4DZBA 5FF6A 1NFDE 2PPCA 3TF4A 1NBCA 1TZOA 1YNTA 4IOIA 1BPLB 4M3JA 3SHSA 4JDTH 4KY1H 3ROLA 4UQ3A 1AXSA 4OFDA 3QXWA 5DQJA 3UTQA 4AGQA 3C60D 1W15A 2DKSA 3FZUC 1QG3A 3GB7B 5E2WH 1HKFA 4NO0A 1A6AB 1NUDA 4OI9A 5AD0B 4QHPA 3VWJD 2KL6A 3QXAA 4BZ2A 2JB6B 4OGQC 4WI9A 2H47C 4LLUA 4UT6A 2VQTA 1LO4H 5CHNB 1NGYB 3VXMA 4F15B 2GYSA 3QDMA 1CTMA 1HU8A 3DV6B 3W9DB 3V0DA 5I8OL 4AVKA 3BFWA 4CILA 1BG9A 1JNLH 1S9VA 5B7MA 1I1YA 2VLKD 4QT5A 1XCTA 4XO3A 3MX0A 4QTIH 1FIGH 2C34A 2EH7H 3QJVB 4H0HB 1AFVL 2NR6C 1TZHA 1P4BH 3TT1H 5I24A 5D1QB 4O51B 1SYVB 4APQC 5IG7A 4M62L 4ZFOB 1JK8A 5C9JB 3X11B 1QR4A 1EWHA 3PAYA 3SKMA 3A4DA 1Z3RA 3HZVA 4FHJA 5AOIA 5I6NA 1E9QB 1FZJB 3BAKA 1SBSL 1ETJA 3NZHH 3TO4A 1OE2A 1CGTA 2IANA 1SOQA 3DIDA 1CZ8H 4PRPD 4JHAL 3QUXD 4U1IA 2PYED 4UIKL 4DVRH 5BRPA 2Y7MA 1MFCL 1HHGB 1RZFL 2EACA 2IEPA 3KR3L 1B0RA 3NIGE 1U6AH 1ZLVH 5HDQH 3GZOA 1BW8A 4MKTA 1S7SA 2C5DC 1NC2A 2DWTA 3MJ7B 3FXIC 3V5DB 2DY2A 1O7DE 1TQBC 4BQ8A 4MLSA 3LIZH 5E4AA 1UD4A 3NH7L 1JD7A 2P48B 4Z0XA 5I23A 5FFGA 3WEXB 1J9TA 3D18A 1VFBA 3AU0A 4XPFL 3CPUA 2ITCA 2PCYA 1B9KA 3SBRA 5GGQL 3IAQA 2B08A 3OKNB 4M03A 2I85A 4XBMA 4B9JA 1HH9A 5T1JA 2D2OA 2YKLL 4BK5A 4P48A 2DLFL 4YS4A 5LQBH 3CU7A 1WGVA 2RAMA 2W0FB 3ZN6A 2JF1A 1KLUB 4E42B 1BF8A 3B1UA 1KPRA 1NFDB 2X4UB 4TQEL 4D9LH 1YEHH 1QSFE 2JE8A 3MFGB 3T0AA 5GS1B 2B39A 4F91B 4V2CB 2AABH 2NY2C 2NYKA 4L05A 1PF3A 2H3NB 4XNQA 4QXWA 3ZDXF 2MCG1 2A6IB 3AAZA 1IVTA 2MPAH 4ZDHB 2YRZA 2WUCH 4MA8H 5CJBA 2O6CA 2NZ9D 3QFJD 4MCYA 2CGRL 1CFSB 2DJMA 1TVHB 2WLNA 5DSCB 3MV9A 1YNKH 2VIRB 3PCYA 4IBWA 1XVSA 3K6FA 2VWEC 4ZUTA 1ETZA 2NQ3A 3DJZA 3Q9QA 4RGNC 4U1SB 3UO1H 2YD3A 1C12B 4CAGA 1U93A 1HESA 2VDRL 3OG4B 1A2YA 1EHLL 5DT1L 1WEJL 1RP8A 2UY6B 2XKUA 3IGUA 2H1XA 2XN9E 4XBEL 4LDCA 4U0RB 3KYNA 1AD0B 4Z77A 4ZS6C 3DHMA 2GT9A 3NCEB 3FB5B 3QISA 4M1GL 1ZHLA 1BOYA 4HGMA 2PXYC 4P04A 5FW6A 3M17A 5IQNA 2VDKH 3ECQA 3QIUD 2OYLA 3FUHA 2FHBA 3TVMA 2OR8A 2W9EH 1Y1UA 3Q8BA 1ZGLA 2V7NB 2Y06L 4HUVA 5KYUA 3ZKSD 4NKMA 5CP7A 3L4CA 4XB3A 3MLWH 1HOCB 1GHFH 1TKWB 2YK1H 4M5ZL 1YEDA 1DVFD 3NIGB 4IW4C 5DJXA 2OYPA 5C0AD 3HC0A 2VZOA 4XNBA 3LEXA 4AYFB 3K46A 3UO8B 2AITA 3FSZA 1YDPA 5GGSY 4Y4HA 1MCHA 2P8PB 1RZQA 2GEEA 3WSQH 5D1ZC 4AZUA 5KVDL 3NQIA 3V7MA 3ULUD 5TPWH 3B56A 3RGVC 1JVKA 5I8EA 4QRTA 4GW1A 2AQ1A 3L9EA 4RAHA 5CLTA 1ZCRA 1MCKA 1LD9B 1QVOB 2C7FA 4XNUL 1CXLA 3C6LD 2A5UA 3KVQA 1N18A 5GPRA 5IV2A 1QRND 3RDJA 4L9LC 2IFFH 1AAJA 4G8EB 4WGKA 3IVKA 3DXAD 2CIKA 3F84A 5T3ZD 1NGWB 3VGEA 4POUB 2IPTH 1BP3B 3HBQA 5BOZG 1HTYA 5MEPA 4C54A 4QAWA 1QSFB 1RK7A 3J07A 4EI5B 3INUL 1UUNA 4D7BA 1X9UA 3K2UH 3VXOB 4BCXA 5DJ6A 2IAAC 2MNUA 2VSMB 1CFQB 3EBAA 4G7YL 4JPKL 3ZO0A 4L5FH 1NGZA 4K3JL 4LSTL 3CLFL 3FW6A 5ALBH 4A68A 5C08D 1OAKH 4R2GC 5L6YH 4EVNA 1SN5A 1II4E 3B37A 3Q1SL 3L3OB 5FYJL 2VAAB 3FHQA 4KJWC 4HWBL 1OP5K 2XN9B 3TN0B 5LN4A 1XF1A 2R2CA 1RUPH 1XGUA 3H7LA 4L3FA 5GGUB 2AMUA 3P0VH 5HI3D 4ZW6A 4CN1A 1ID2A 1FHGA 3OPUA 4HDIA 3VD7A 3WXWH 5JHAA 1F4YL 5B39B 1T5XB 4ZFGH 1QFWH 1TF4A 3FRPA 5TE7H 4DFHA 5F2FA 5GGSA 1U3JA 3DGDA 3AXLB 1IM9A 5D96B 3S97C 3V4LA 4AZ8B 4TF4A 1CJYA 1H9VA 3QUHA 2OAAA 4LCCA 1IC4L 4BQBA 2ZWLT 4UQ2B 1CI5A 1F4HA 4XMXA 2ZUUA 5J57B 1OK8A 4QHUB 1XEUA 3QCVL 1EVTC 4TRPH 2OMVA 2ZWSA 3VRIB 3DX8A 2YMXH 3ABMB 3MNWB 5FYLD 4P5KB 4NSKA 3KM2A 4NN5B 3TBVA 3SDAD 3VXSD 4YFEA 2DJUA 3EJRA 4X6CA 1RU9H 1CQKA 4WWNA 5DHXB 4ZJ9A 1KCWA 3L3KA 4U1GC 2BXZA 2KZ1B 2MCAA 3ZTNL 3ZPDA 1TEFA 3Q48A 1I1AA 4EUPA 4K3DH 5I1DB 3S8FB 3WLBB 1S46A 1ZY9A 3HN3A 3KS0H 1A66A 3WEAA 4GP4B 5JUEL 2PR9A 4HFWA 4WTWA 5D2LF 5EU5A 2Z0UA 4Y2DC 4X7TA 2P8MB 3QNXB 4KNTA 2NY5H 2K3TA 3HG1A 3SOBH 5I19H 5IJVA 2O61B 3EJCA 1GC1H 4NZRH 2C3HA 4DUXA 4PLKD 4AWJC 1MG2C 3WFBH 5KSAC 2UYLB 1DQLH 2BJML 3L1GA 5TTRA 1TQCC 3BXNA 3RX5A 1F11A 3O6FC 4HZLB 3RY6C 2MOVA 5B38G 5EEVA 1GZPB 1JXJA 4KMTL 3ERXA 3QZPA 4QHNB 3U6XA 3FB6A 4TVPH 4ZUUB 1YZZA 4U6XA 4EOWL 5E23A 5IEHB 3FT9A 3P9WB 3C9NB 2Z7ZA 2DIEA 3KXFD 3ESNA 1VZGA 4IU2A 2IXQA 5T1LB 3ATFA 5DJDB 1AZBA 2A1WH 3K4ZA 4MNHB 1SBBA 1UWEL 5IBTL 4WWKA 1DLFH 3KPRE 1Z9LA 2DWXA 4Q2ZB 5B7FA 5CINL 3RIAF 5I8KH 3BP5B 1E6JL 2BNQD 4LNVA 2NY6D 4WI0A 1HINH 4Y1SA 2CALA 2PWGA 2XZQL 4EUPH 4X2UA 1KTRL 1WZAA 2H7WA 3GM0A 4RRPA 3GJFH 4S1SH 4UT9H 4H7VA 4TLUA 1G43A 3HHSB 3L5JA 1NFDF 3MGTA 1M6UA 3CNKA 2WBWB 4J6RL 4ZOEA 2VMFA 4TUJB 5JOEA 1W0VB 2NY5C 4FQ2H 1GC1C 1WSST 1O9ZA 5KBDA 5F7DB 1E5ZA 3VWKD 2J4WH 4FXLA 2WJ5A 1UENA 3IJ8A 3PP3K 3KJ6H 4PJBA 1B88A 2DMHA 3QYMA 4H8UA 3ZOAA 4OJCA 3IM1A 3JWNH 1BQKA 1HS6A 4FLOA 3CCHA 4Y16B 5AYUH 3FQWB 4NHCL 2CLRB 1E65A 4DHLA 1TTRA 1CN4A 4OTXH 3LRSB 3ALPA 2BIQA 4GXVL 3VD2A 2L8AA 1KMGA 4HK3N 4LKCA 4PJCE 5JQ6L 4N8VG 1WVZA 4FQXD 1BQHA 4UI2A 1XB6A 3AXIA 3FUDA 2DOCA 1CB4A 3O3BA 1IGJA 5SV4A 2A6DA 1SJVA 4LIQH 2QEJA 1ZTXE 2X4RB 1REIA 4NQEE 3BYTA 5DJYB 4OZIA 1V7NH 3NIGF 1OK0A 2JMRA 4M93C 4N1CA 4EIUA 3V4PH 3D2UD 2VLRE 2BSSA 5EMYA 1PZBA 2Y25A 2W0LA 3RVVC 3SPIA 3BKCH 1AGCB 1PPIA 3C08L 4P5MA 3ASOB 4QHLB 3LKSA 3QQDB 4XOBA 4HJ0D 5LJYH 4Y19D 3PJSA 3MRIA 1PFOA 3OKDA 4K5LA 3OKKB 5IVZA 3IJEA 2Y2YA 3LNDA 1ONQB 3ARRA 4V1DA 3P69A 3KPRB 4J4PA 1HWHB 4WY7L 1RZKL 2Z91B 2ZPKL 3KWWB 4GAGL 4MAYC 1ET7A 3VI3A 3PGFH 3AVEA 4FGMA 4NXKA 5T1MB 4U1LA 3W0WA 4I3SH 4LSDA 4YDKH 3CFBB 4P4KA 3V9CA 3BAJA 3WIHH 4K23L 2K9UA 3ARSA 1CICD 3JWNC 1KC5H 4UV4L 3P0YL 4N2FA 1MUJA 5LGJB 3ETTA 3QDJE 4OLUL 3QUZB 1G7PB 3FN0L 3GDBA 5LXVA 3WG7B 1T3FB 2DQEH 3M86A 4NUQA 3EBIA 4X4YA 1RIVH 1PX3A 2QLYA 3HBZA 1RZ8B 3TBYB 2W0KA 3QH3A 5KG9A 4PHZA 1KPVB 2FX7H 4KROC 2R7EA 1TDQA 4KC3B 5E6IB 2WXNA 5KYWB 5I75B 3QE5A 2AQ3A 3H6JA 4LSQH 2R69A 4OZGA 3ATAA 5C0DB 3TYGH 4A1RA 4O58L 3L3JB 4BINA 2FVNA 1EAQA 1R3KB 3CZUB 3CUPA 4BFGA 4HLZG 3O6ML 2EKSA 2WIIA 1I7RB 3D3VE 1A6ZA 4MA1C 4OUOA 2BSCA 4PRIA 5BUPA 1GGUA 3EDEA 3SDYL 3EFDL 3STLA 1KBGH 2ADGA 4PJCB 4H5SB 4X5XA 1L9SA 4ZX4A 4KX7A 4WO4A 32C2A 1A7PL 2KS0A 2I7SA 3BFOA 2ICWI 4DEWA 5D1XE 3CVHB 3GSVA 4DP4X 2YXWA 3QDHA 4OGAC 1HHHA 2CLVA 4PWFA 1NFKA 3LD8C 4G83A 5EU6A 1NDMB 4UQ9A 4AXWB 4NQEB 3FU9A 1N12A 2E75C 4C56A 1QEWB 2WLLA 3HN8A 5ALCH 3MBEA 4AI7A 4HT1H 2VDLB 2DQGH 2QADD 1J0IA 2VLRB 4PD4J 3BYYA 6PCYA 3JTSA 5DWUL 2PO6A 2YAEA 1IM3B 4MJ6B 1YPZA 3HBGA 4XXDA 4N1EA 3LVTA 2BFVL 1MWAH 3S35H 3BISA 4CW1B 5HYQA 2XVLA 4IGBA 3ZQWA 2EDLA 1HKLL 2BVOA 5EZIL 3T3PB 3MCKA 4NZTL 3K0WA 2CR3A 3LZLA 4N6RB 5BZWB 3CZEA 3B9KC 2NY3D 3US1A 3FQNB 4JPSA 4OF6A 4GSDL 4I0PA 3A4AA 5J9PB 3BHBB 2A4CA 1MJJB 1JMXA 4YHOL 1KJ2L 3EO9L 4KK5D 3K6SB 5F89A 1MNNA 1AGEB 4F33B 5CJQH 1NIEA 4JZJB 1PZCA 1BZ9B 5I1LA 4DFIA 5HHOB 2X9YA 3I75B 1PCXA 1VSCA 3FPYA 1TQSA 4L23A 5KN5A 5T5NG 1L0PA 3EFOB 1FGVL 3IFOA 4ADGA 1XGYH 4HX1A 4NIYE 2QQNL 1F45A 4YDVB 1THCA 1I8KB 1KJMB 3C2SA 4PP1D 1BFOA 2Q7NA 4U05A 1FG2B 1URLA 4QEGA 5D8JL 1EFQA 4HJEA 4N9GB 1SY6L 1V3KA 5A2CA 5DMKA 2HG0A 2CUMA 1O7SA 4TNVF 1IAMA 1S78C 3D3VB 4QRPE 1RJYA 4YHNB 2WGNB 3II3A 3N5AA 2ZUWA 3VYPA 1AHMA 5EBWA 4ESKA 4Q58C 4YR6B 5E99L 4DP0X 2HRPL 3BPLB 1KYFA 1IKFL 5HVHB 5IHHA 4HXAH 3CFMA 1HAWA 3GLEA 5E1HB 3MROB 5D1XB 4PCKA 1O7VA 1WWCA 1K6QL 1OCRB 3L45A 4L2LA 1HILA 1QTSA 4QRRD 4LVEA 2DQHH 4MB1A 4BUQA 5TH2A 1U2CA 2K8MA 2ILLA 5D9SA 2KHAA 3VDCA 4UIKH 3O4LA 1MFCH 5KZCB 2ZTBA 3KR3H 4NKDA 1D9KA 3EJSA 5E1QA 2PR4H 5HP5A 4NQDE 2IH9A 3NCYS 4PJEF 3N3EA 4LLQB 5GGRB 1ES0B 5E6SB 2UXVA 2WQUA 2WSPA 1IFHL 4GW5A 3K0YA 1CT8A 5CGYC 1XO8A 1Z7JA 4NAQA 1KT2B 1Y0LA 2NYYC 3EYSH 3SOTA 2G9HB 3D0VA 3QAZC 5L0QC 4W9ZA 4LEXH 4OR1A 2F15A 2DM4A 3J27A 5AB9A 1AQDB 1T5KA 3E8VA 1HXYA 4QRFA 2QVIA 1CE1L 1NCBL 4TUKH 4AK1A 4PMFA 3AS3A 3KLKA 5IB3A 4MA3A 4KJYA 2WXPA 3O3EA 3ARUA 3DSNB 4NWUL 1ZHNB 3ZYZA 1P7KB 2YKLH 3OX8B 1F5WA 2F53A 3ZL4L 2NXYD 1OARL 5KVFE 4NPKA 3NFSL 5BRZE 3CAFA 5T5FL 5E9NA 4PP2A 1ZD6A 2EZ0D 4N8VB 5J3HC 4MBRA 4PJ8C 3O9WA 4UAOC 4EQ2A 2D3NA 3QFDB 2VKXA 1S8DB 3DVNA 4JGMA 4I48A 3CX2A 1HT6A 3T0XA 1RFDL 1Y6KR 2A4ZA 1KJ3L 4UV7L 2ZIDA 3CC5B 2WCGA 4L4TE 5EBLB 4LOEA 1M3JA 4ZUWB 5MEQA 1KNOB 4KRPB 4ENEC 2J5LC 3MUJA 3NGBC 1QI4A 2BW4A 4A37A 4GXUM 2EIZB 3IDMB 3APDA 4JFED 5H2BA 1AG0A 4D9RD 4QRPB 5C0BD 2XY1A 1O75A 4FG2A 4HETA 5FM5M 3I6GB 5FGCE 1FORH 2CD0A 2VSDA 3UBHA 4KH2A 1WEJH 2W9DL 3RI5F 1FZOA 3H9HB 1D5IL 2E27L 4P2OB 2OMXA 3U1QA 5IJDC 4HHGA 4EZLA 4A55A 4M1GH 4WTZG 3WIIL 4JEGB 1LEIB 2CKBB 3LQZA 1NCHA 1RVFH 2VL5A 3QUKB 3OHXC 4UYPA 1LTXA 4BQ6A 1AH1A 4F9LC 2QKSA 2G5UA 1SHWA 1J5HA 3SQOH 5I1AA 4M6AA 3CPLB 3QIWD 7FABL 2KMWA 5CD5D 4J1UA 1SQMA 1Y6NR 4G7QB 4YDMA 4GG6E 1E5CA 4R7LA 3U4BH 4BWUA 2E46A 3OAUL 5I76A 1UKTA 4M8VA 1M7IB 4NQDB 4WW1B 1L4IA 3WE1A 1VFAA 2Q3ZA 2BZ7A 3Q2LA 3FTYA 1MDTA 1FFNA 1OANA 4HU2A 2CGZA 1MCJA 2YN3A 3NJFA 4GW4B 2GHWB 1V27A 1QTYT 4XBPB 3PDOB 3U9PL 4HWBA 1J10A 1IC1A 2HMIC 3QEHA 1OW0C 5B4MD 5KVDH 3V9EA 1KXVA 4QJ4B 4FQHB 3NJNA 2R2HA 4KV5E 2EYRB 3BLPX 4LARH 4WF7A 4B9CA 4WK0B 5DUPL 4R4BA 3LZRA 1I4FB 2NY1D 1P4IH 3DYPA 5FK9A 3OJMB 1T6WA 3VTTA 3O4OC 3VXQB 4B9YA 2CO7B 3VCLA 5I1JH 3VH8G 4ANXA 1U8JB 1S2EA 4HQQL 4QYAA 2BNUA 1AHWA 4YFLF 3QEGL 3CFEB 3QWQB 2KQNA 4GG8A 4PLJD 1OV8A 3IF1A 5BRZB 3QQ9D 2X1XR 3IKCB 5J6HA 5CLWA 1TETH 1UM4L 5E4EB 2G4EA 2R0ZH 5F7WC 1M1XB 3L5HA 4JFPB 5CN2A 1U33A 4UCFA 1IBGL 2VMCA 2W81C 2QJDA 2MWCA 4LLWB 5DYOA 4C47A 3ZHFA 5B3JF 5JTWA 4G7YH 3RWCB 4LMQI 2E86A 3AS2A 3CLFH 2ZSVB 3HZ3A 2D7PA 4L3ED 1DBMH 4JKKA 3VD3A 1CDGA 1J8SA 5IW1B 1BM3L 3ARDD 4UUJB 4N0FB 2AK1H 5FGCB 4XI5D 1VA9A 2JKLA 4N0YL 5FYJH 5KTEL 2OSLA 3BP7B 4LSUH 4R0LB 5FB8A 4QD2E 2AJZB 4LF3B 4E36A 1W9XA 4IIZA 3TV8A 2LW3A 2YWYA 2VDPB 4IHOA 3UBXG 3RX7A 4TTGA 4LEOA 4CSZA 4BSJA 3F6JA 3UP6A 3MLTA 5JOPE 2NNCA 4HZ1A 4HKJB 1GSKA 4J3OH 1DP0A 3ARXA 2QHLA 1WC7B 2EADA 5LB1A 2EE2A 3H9SD 3HE6C 1DUZB 1OGSA 5H35A 1PEZA 4C57C 4GG6B 2DLIA 1IC4H 4FQQB 4MKMA 4GT7A 1OT4A 1WD9A 2NPLX 4NQTA 4Y4KB 1GOFA 3IXTA 4H8VA 3EHBC 1USQA 3FT2A 3D87B 3QCVH 4ZD3L 1WZLA 3T8MA 4NOFA 5I30L 5JIQA 4OFPA 1QYGL 3MZGB 2Z31C 1QFPA 4IRJC 4O4YH 3PWPD 1AR2A 2Y3NA 3CXDL 2WWMC 4PJ7A 4HHAB 5EZLA 3VQ1C 5F93C 1J5CA 2QVFB 2GK2A 5EWIL 2EDOA 4HS8L 1LDPH 1NBYB 1WBYA 4XCYA 4PHXA 2GSIA 4O02B 2FX9L 1F3JB 2H41A 2C9UA 3ZTNH 2NYYD 2BNRE 3ZDZE 2BWQA 3I3DA 3WE6A 2CE6A 1KN4L 4F7CB 4HISA 2O30A 1WLHA 2Y1YA 1WGOA 3L3GB 2HFGH 2XSKA 1M7UA 1KCUH 3WTUA 2QMJA 1MVFA 1N0LB 1R3IL 1AS7A 2VRQA 1PMYA 1S7RA 3IT8D 4NT6A 4Q56A 1CGYA 5EPMB 3TEWA 4ZNCD 2AQNA 1U3NA 1U2YA 2DQ6A 3D0AA 3FQUB 2UZYB 3SDDD 3M45A 2BJMH 1J7VR 5LNGA 3MRMA 1R17A 2V7HA 2AV1A 4EN3D 4OCMC 4J3OC 4KMTH 4DTGH 5BMFL 2AZUA 5EORL 3BI9X 1H5BB 2VLJE 3GSNL 2YD9A 2VOTA 5DDHB 3VWJA 1XD0A 3JVGA 2OA9A 4YSDA 2AEPL 1WT5A 3IMSA 4H20L 2H6OA 2IOMA 2QQKH 3E2HC 2IF7A 1ZIAA 3IS0X 4OAWA 4PWGA 2A6JB 4LL9A 4Y88A 2VLKA 3DO3A 1NCDH 4IRZL 4TPRH 1UWEH 3S37L 5SWQA 1ITCA 5IBTH 2X28A 4OZHE 3WJLC 1AE6L 5ICYA 1OGAA 4YUEL 2NNAB 1T0MA 4PGCA 3RWFA 1P69B 3OLDA 4WTXA 2C1OA 5CINH 2VDMB 3U7WL 4BFBD 3BUIA 3IJHB 4WW2B 2ZD0A 4XWOD 2DYPB 3AS0A 4PRPA 3QUXA 1M2OA 1OAZL 2PYEA 3FO1A 2EIJB 3UAJD 5AW6B 2YC1B 3CFJB 5KSUB 5CKGA 1GYCA 3MRJA 3Q2WA 1WWAX 3FSOA 3L7FB 4JPVL 5E00B 5F7KC 1A25A 3ARFB 3AREB 1MIEL 2JKNA 2KI6A 1MY7A 4FXKA 3RTQB 1V55B 3GRWH 1ED3B 4A2FA 4BFKA 4Y5VB 2DJ4A 1PBYA 4X6EA 4X9YA 3H42L 3B2VL 3B9EA 2GSMB 3NK4A 5D7IE 3LZQA 1MFNA 3DX9B 4JFYB 1I9IL 2VLLB 1JHLH 3F00A 4UINH 4DEPC 4Z7AA 1X4XA 5K1NA 2OMTA 5K9KA 5A3ID 3PDGA 2CR0A 3CE1A 3MJ9L 5GS0D 3R7RA 1P5VB 4AW7A 2VITA 1H3PH 4F57L 1MFEL 5TDNA 2DBJA 1GZQB 1OZUA 1ZDSA 2BNRB 2ZXWB 5CEYA 3ZDZB 3TONA 2V2TB 1WPCA 2CXGA 5KW9L 5IWLC 1XF3A 4OZFA 1EX0A 3GUTA 1UA6H 2NZIA 2WGXA 3QR2A 1EO8L 3PXHA 4K73A 2DDQH 2JKXA 3VA2C 1QZ1A 3KZ8A 1UA3A 3WFDL 3ARBC 3I50H 3ARZA 1EFXB 4N68A 4CNIA 5T3XL 3BH9B 4M7LT 4QF1B 3KW7A 4S0SD 4ZMPA 1QPPA 4JKWA 5CWSA 3MNMA 4YDNA 3LZPA 1PLBA 4P46C 2BS71 1B0GB 3VGHA 5EULV 1WBXB 3QFJA 4U3SB 1CLYH 2VLJB 3BVUA 3V0WL 4ZQKB 3MLXH 4K4KA 4PY7A 2P47B 4YDJB 4PJ9B 2JQMA 2VR7A 3AY2A 3B8SA 4K3EL 5AOZA 3FONA 3C08H 4XZUB 2N4IA 3D85B 4MQSB 4BFEA 3U83A 3U7AA 4OV6F 4KKZA 1RZKH 3DX7A 1IZKA 4GAGH 5F8QC 5F97E 4HGWA 5FUOH 3RWDA 3SDCB 3HPJB 3V6ZB 4AQ1C 1RPQA 3QIUA 2X6BA 4HP5A 4PS3A 4YL9A 3D51A 1OTUC 5H37H 5I0YA 4WFGD 1GGBL 3WXVL 1KACB 3MGOB 3VNZA 4BYHA 1NCIA 1UWFA 3ZE0B 3OGCA 2EVFA 1ASOA 1L9OA 4G7VH 4NM4L 5IOPA 2B9AA 2CM5A 5HHME 3NJIA 2XG4B 3VH8B 4OZFH 1DVFA 1MPAL 1UGNA 2HH0L 5CR1A 5KEZA 5EV7A 5C0AA 1BD2D 2X09A 3QNYA 4AGOA 4RFNB 3RNQB 4Y4FC 2AEWA 3N1PC 3Q7JA 2OMWA 2WXFA 1WZKA 1J1OL 3KPLB 4PJDE 1F4XL 2R23B 5D7IB 4N3UA 2RCSL 1A4BA 4G7RB 2E74C 1I9RL 2BSDA 1RQ5A 4M6ML 1BYOA 3LKQB 4DP2X 3KBEA 4UBDD 3NCWA 4AJWA 3A47A 3OB8A 1AJ7H 2FD6L 1KBVA 4Y5XC 4YO0B 4C4UA 2H0PA 3C6LA 1NUFA 4YXLL 3L1OL 4ORZC 4JM4H 1KJ2A 1QRNA 2FH8A 2P43B 5C09E 2XWBA 4IRJD 1L5GA 1FGNH 4JJHA 3EFDH 3DXAA 3FUMA 4IRSD 4U1HB 2G75A 1I1RA 3APNA 3HFFA 3PREA 4XNZB 4OFIA 4JN2A 4AUYA 5GJTL 1PSKH 3HI6H 1W0WA 3PDDA 5D6CB 1U8CB 1A7PH 1X5AA 4EIBA 2P7TB 1CD1B 1RZKC 3UBXB 3L9BA 5I73B 3W39B 2D0GA 4URTB 1CF1A 1AGBA 3MCG1 4JQIH 3WFHB 2I07B 3H7BA 1MRFL 2HRLA 4NPYA 4GG6F 3BGMB 3FFCD 2Q8AH 1QKZH 3CFUA 3WY4A 5BS0E 3VFWA 1PIGA 3FTZA 5ANHA 4BKLB 1T1XB 3TJEL 1SY6A 1R24A 1T66C 2PW1A 4QWWD 5C08A 5DWUH 4ZUVB 3KBPA 5HGAA 4OSUH 4N2HA 3H9YA 4O9HL 3DBXB 2BFVH 5AB2A 2LE9A 3OR6A 5K39B 1ACZA 1AGDA 1FYHB 2NSMA 2Z35B 5ETUB 1HKLH 5EZIH 4NZTH 4KV5F 3RA7H 5C0FB 2J57A 2ADFH 2EEFA 1U3HC 1JYNA 1HCYA 2CDEA 1XF5B 3S4SA 4G1MA 4D9QD 1T4KA 1C08B 1CPUA 4GSDH 3IRPX 4DGIL 3TYFB 5ISZE 5DO2D 1NTDA 4JE0A 4QHKJ 2BC4B 3P11H 1KJ2H 4I5BA 2H45A 4YHOH 3BQUD 4Z78A 3EO9H 1ANUA 4ONOA 5HHMB 4FA7B 1E27B 1LJMA 4OIBA 3NN8A 1FFOB 15C8L 1Q9OA 3VUAA 1BF2A 4AYGA 3RL2B 4HIJA 5IB1A 1SEBA 3ULVD 1B0WA 1A1MA 1VCAA 3IDGA 1OTSC 4IK6A 3EYFA 4A7VA 1T7VA 3FTVA 2PCXA 4D0DB 3VD4A 4XP4H 3QUYD 4PJDB 1T21A 4PJ5D 4NHUA 2RFXB 2WXOA 4CSSA 1Q94B 4G70B 2WC7A 2ZWYA 4U1JA 1DQJB 2GCYA 1JDDA 3VFUB 2OXHA 3X2QB 3EH4B 2QSQA 4QYOB 3T4YA 2ZXDA 4L1SA 2DQMA 4WV1B 3SDAA 3SKUD 3VXSA 2GUOA 1ZVNA 2PN5A 4PREA 3OMNB 4YK4C 1S9YA 1NGXB 2GBAA 3MUHL 4A2HA 5GZNC 3C8HA 4OF3A 5EO9A 4RZKA 5JW5A 4DQOL 4RGMB 1HK6A 4OH2A 5C0CA 3P3UA 5C09B 3GMQB 5A40E 2H2SC 1U91B 3ROOA 5C3LD 2AXGB 1EEYB 1KB3A 4Q6IA 4BUHA 2F7RA 3MNVB 3QZLA 4ZUSA 1SDDB 5D2LA 4G43B 5KJ7E 3Q5TA 5T5FA 4MDIA 4XPHL 4XBGB 2RH0A 3WD5H 3P4LA 4Q97A 3X3GL 1DDTA 3IDJA 2J6EL 3U0PB 2ZX6A 3VW3L 1P4LA 1VERA 4WW2F 1AG6A 5IW3A 1FL6B 3FCTB 3AT9A 4XH2B 1QW9A 1VZHA 3FTWA 5BS0B 1UQSA 3FUIA 5DQ9B 1S7XB 3LHPL 5EIIG 3NFPB 1W16A 1YAIA 2ATKA 2N7AA 2WP3O 5FYKE 1AC0A 3OV6A 2IQ9H 4KTYA 3UTZA 5IB2B 3HUJE 3KXFA 2UZPA 3RUGA 1UB6B 3VFNA 1J0JA 1IFHH 4GJTB 5FA3A 1A0QH 4YIQB 2R1WA 2GVYA 2IAMB 3OG6B 5F9JB 3ML9A 1JNHB 2X4OA 3PL6C 1YQVH 2WWOA 2PW2A 2O26U 3KPSE 1A8ZA 4ODUB 5JW4M 4TMPA 4AEFA 2ZF9A 2OYMA 4OIAA 1QSZA 1E5YA 4IKLA 5ACZA 1FL5B 2KT6A 2UXTA 2XPZA 5AL0A 2BNQA 3EBHA 1C8QA 1ZLDA 4KI5E 3REVA 2PNDA 1MCQA 1E4KA 1JPFA 3BSZL 4M1DL 4CJ0A 4PGJA 4XP6L 3CMOL 4FD0A 2GJ6D 1OARH 2IQAA 1PTZA 5JQIB 1YEKL 1EHAA 1T0OA 2HT4D 2EDBA 5KVEE 5DJ2A 4TUOA 4NIKB 5KVMC 5I66B 4ODWA 1KJ3H 4ZXBD 3WHE0 3BLKA 1KCRL 2PWFA 1CR9H 2ZOKB 3VFMB 6FABL 1F3DJ 1NUNB 1TJIH 1G1YA 5EZJB 3MLVH 3D69B 3VWKA 2YPKA 2X4QA 5C1MB 1HYSC 4DKEL 5KYYA 5SWSE 2Z93A 3UZQA 4HULB 2J1XA 1UOKA 4YXKL 3NJVA 1PGRB 2WTPA 3FOMA 3LS4H 4ZYKB 4MHHI 4HBQA 3GXPA 4G8GD 43C9B 5DZOA 4F9PA 5L4IA 4BSWA 3RB7A 4HMEA 3UGXA 1A9BB 1IGCL 2ZAHA 1JPEA 1INDH 3QWOB 3UYRH 4AIZA 2HKFL 1IV8A 2BIOA 4GAYA 2W9DH 2L3BA 4F7EB 1TFHA 1D5IH 2E27H 4UOZA 1KXTB 1YNLL 4RNRB 1G4RA 4OZHF 4GKZB 1EQWA 1XXFC 2X1OA 3SCMD 3IMWA 4I2XB 4FQXA 2BZCA 1QUNB 2OMYB 1DJXA 4L4VB 3HKZA 5EDXA 1ECYA 3CGTA 4ES9A 3O6KL 3OKOA 3DRTA 1XGTB 3W2DL 3WOVA 4M6NH 5E9DD 1T80A 2XWTA 1OSZA 3MRKB 1BBJA 3CDYA 3PAUA 4JDVA 5AYTA 3W11D 2VN7A 3MMEA 2ZUVA 2WWKO 4ZOCA 1W8OA 3D2UA 4YJZL 4BRJA 5JPNA 3CJJA 2C9VA 3UXFA 3HUJB 1KTDB 5J1TC 5D1QC 4RIRB 1X5FA 5HI5C 2WNWA 5KJRL 1BAFH 4LO9A 3VMPA 4JY5L 4Y19A 1OOAA 3DUUA 3MRHA 5BUGA 1OPOA 3U9UA 4LSPL 4D3CL 3R18A 1ADQA 4RFEA 3KPSB 2DWDA 2IADA 2ZONA 5GS0L 4CN6A 2FJSA 2YLKA 1G7LA 4HKBA 4U6YA 3MRDA 4LCWE 1RIHH 5FO2A 3VG0H 4KO9A 4XN1A 3KPPA 3DJSA 5BOJA 1CICA 2A3TA 4NDMA 2ZUQB 4TSBH 1GZHC 3QJTB 2R1XB 2WVVB 4NNYB 3TCXA 3IS1X 4NQXA 3DMMD 3LPGA 4I18A 5EEZA 3BZEA 3DROA 3BT0A 3K72B 1WIPA 2PYFB 2I60L 2HJFB 3HB3D 3BVNA 3NAAL 4M29A 1U8PB 3W9EB 1IBGH 3T1FA 4HEPG 4LVHB 4MAZA 4BZ1L 1YRKA 3IMRA 4GXUN 4Z18A 4YDIH 1RUQL 2A74A 1T20A 5SWSB 2NT1A 3HS8A 5L8KB 4CADB 4KUZH 3VFVA 2KLTA 4P4RB 4RX4D 3F7QA 2WQ8A 1AMYA 2AP2A 1R1CA 3AROA 1T1YB 2WMPB 4HGKC 5ICXA 5SWZE 3MRNA 3FO9B 1XH3A 5IMMB 1JDCA 2WLZA 5GS1C 1QLFB 5AB1A 1I9JL 5KTEH 1TZIB 4MCZB 2IDQA 2H2PD 1OHZA 1JRHH 3AQXA 1J18A 4KKCC 4FXTA 3ARGA 3GI8L 4HD9A 5E94A 4MMZA 3EOTL 1H3TA 2W88A 3IN0A 3EBGA 5FFLA 5EF3A 4JM2B 2DI7A 3VXTA 4P2QD 5E6RB 4A6YL 3BJ91 4LLYB 4M8QA 3RZCD 4AQAB 1KTKE 1BLIA 2P24A 1JUFB 5KVFL 2AJXH 3DX4A 2NY0B 4XCEA 5F9OL 3P2BA 4F7PA 3GMNB 4U0RC 3SGDH 5E1AB 1NJ9A 2DQIL 1BXUA 1OSPL 2MRYA 3BUYA 3GSNA 3RU8H 3QZWA 4EZJA 1MFMA 3B3IA 3HR6A 4PJDF 3SKNA 3RWGA 4A7QA 1G7QB 3QG6A 5IUCA 3D2TA 3MV7D 4OUUB 1LE5A 4YHKH 4XAKD 3U30B 4E9QA 1VLXA 3LKPA 2VERN 4Q0XH 1EV2E 4LB8A 5EZOL 3GRGA 1PLGL 2DM7A 5J1AA 3JYCA 2GC7C 4H1LG 3CXDH 4F7MA 1JZFA 4HSCX 4X0KA 1FL3A 3UPRB 2BIIA 4PV1C 1GS6X 3IGAB 3FU3A 4LCWB 3JTTB 2EXSA 4MRBA 4Y5YB 3S35X 5JHLA 3GT6A 4CSTA 1A3RL 1QSEE 3BE1H 2HWZL 4TVUA 4ETQA 2OI9B 1ZLWH 2ED9A 1CD9B 3QPQD 4UMSA 3PJNA 3DNKA 4JHBA 1O7DC 4S1RL 3AM8C 3RPKA 3MJGX 1R3IH 2GK0B 3U46B 3KPTA 2BP8B 1KB9K 1Z9SB 2BP0A 2VB5A 1SF5A 2D0HA 2ZX7A 4H8PA 3C2AL 4FYTA 1NAML 4GUPA 3VRLE 2IH1B 2XYBA 4M00A 2ED6A 4PRHB 1Z9PA 3RPBA 4Z95H 1WUZA 3SYAA 5BMFH 5I0DA 2VLME 3LN9A 2ALWA 3MV8E 1RZJL 1GW0A 5EIIB 3MJ9A 3KPMA 3Q6FB 5SWZB 5HGHA 1F2XK 3FH5A 2AEPH 4H20H 3RDTD 4EI5C 1E2VA 3L48A 2NW2B 1A65A 2YGNA 4IRZH 4PLOB 2GPZA 3M7FB 1FNLA 3KLLA 2OMUB 4PTUB 4RFOH 4J6IA 3VXUE 1N67A 3UFIA 3V4UL 1R5WB 3CXFA 3ZKNC 3RFZB 2NY4B 2XN2A 1JV5A 1QR1A 3T8XB 2QSCH 2AEQH 4QRRA 2KLRA 3MYJB 3L3OC 4FQIH 5IQMA 1INEL 1M9WA 3CSBA 1MCPL 5JIDA 2FEDC 5AOLA 1DJYA 3POHA 1OAZH 3TN0C 5LWYH 4I89A 2O5ZL 2E9BA 3O3AA 4AM0Q 4B3EA 4PV8A 3VFTB 1MXDA 4JPWL 1MFBH 3ARGC 3T6XA 1LMIA 1MIEH 4PJEA 3T4AB 3GSRB 1JHTB 2OP4H 4G5ZL 4KK6D 3H42H 4NYLB 2ESVD 2Z4QA 4B53A 3GS7A 4ATTA 4TUUA 5D96C 1OAXL 2WYTA 3UJJH 4I1NB 1UD3A 1JGEA 3BT2H 3MQIA 3TZVD 3U82B 5MENE 4PJ6A 5E8PB 3GF8A 5CCKL 4PWIA 1JNNH 2QSVA 4H88L 3NK3A 5D7LE 4WI2A 2R4RH 1BQ5A 1HSAA 1F41A 4AX3A 4ZZKA 5CXPA 2E7CA 1AQHA 4PRDB 5CJ8A 3LZFL 4PGDA 4NUGH 4XC3H 4QOKD 2X6AA 1EO8H 1J8HE 2CBTA 4NBZB 4NN5C 4KXCA 3WFDH 4GMTL 4D8OA 2VDML 3MBXL 5T3XH 3LB6D 4RESB 2IO5A 1E2WA 1U0QA 1EK3A 3G9VA 2KBGA 4MMYA 4AK2A 5HGGS 5CR8A 2ZCHL 3HS0A 4LVNB 1RJZB 3L4XA 3PABA 4JZNA 3GIZL 4JFDE 5JDJA 1LO2H 1I8IB 3V0WH 3NRFA 2QMKA 3PNWB 4FE9A 2CDFB 4U1KB 1GY1A 5CIPB 1UXWA 4JFEA 4L8CB 4IDJL 4OCSL 3GSOB 5C0BA 4W68A 4BE5A 1IKNA 1PKQA 2R59A 4PG9B 5E8EB 1CFVL 1LEGA 1MJ8H 1NICA 4OKDA 5EU4B 3KBHE 1IEHA 5DFVD 1H3VA 1E67A 4MD5A 4KITB 4QRSB 3FB7B 2P45B 3RBGA 2FGWL 1OM3L 2DL9A 2NSXA 3VXUB 2WLYA 1OF0A 1FH5L 5FW7A 2XACC 3BIKA 4LPVA 1WWWX 2E9JA 3FOLB 1XIWB 1GGBH 1I7UB 2ZUSA 4NI6A 5CF3A 4RDBA 3AU1B 2V3EA 3KPQB 5B8CB 5LXGL 4NX0A 4NM4H 3QIWA 2WUBL 3F12A 1XBDA 1SM3H 4W9HC 3QC6X 5SX5K 4GSQA 5BNXD 3QDAA 1NIBA 4PVMA 4PJAE 4LPUA 4XVOA 1WCQA 4JGJA 1EO7A 4TNWF 3M6DA 5A16A 1DJZA 1HZLA 1JZGA 3SO3B 4UDUA 1AZCA 1J1OH 4GRWE 4KXAA 5ICZB 3JZYA 3O3DA 3P2DA 4KK9D 3GLZA 1TTBA 3P3TA 4V2BA 2F58H 1X9LA 3NT0A 4LHJB 4IBLT 1SXZA 1AZZC 1I9RH 1FJ1B 1AD9A 3G5ZB 1I7TA 4Z76A 1NLBH 3EG9A 4LCIL 4M6MH 3P1VA 5E2UL 4LOFA 3WO4B 4HCRH 1YYCA 1GJUA 1VFUA 1OP3K 2EIEA 3C09B 3HPLB 2Q8BL 2CLZB 2LQRA 2XIDA 4ATWA 5KAQF 4YXLH 4Y1AE 4UNVA 2BVYA 2EDJA 4XN2A 4GO6B 5F9DC 4HWUA 1CLCA 1A1OA 3SSGA 4JO2L 4MGXA 1NGQL 3DV4B 2LTQC 1VPOL 1MRDL 4YNYB 4JY4B 1K5NB 2JKTM 1N5AB 4N28A 4UZSA 5I16B 4JREB 4AEHL 3KCPB 1BCIA 3HAEA 4R90H 4JM2F 4O2CB 4FMFA 5HY9A 4L3CA 1A6TA 4G42B 5G2NA 4UM8A 2ARJB 4QCIB 2BY1A 3PHQB 3QORB 4M4RB 5G5DA 1IIKA 3BKMH 5C0GB 1NQBA 4LSSL 4Y16C 4YVNA 1G7MA 4YGAB 4FAAB 1UJ3A 1ZS8A 3V6FB 4JFDB 5FDWA 2HKHL 5GXBB 3BCDA 4IKJA 2HT3D 2NX5D 2VABB 4MXQD 4L3EA 5DK2B 3DO7A 3RKDD 3TJEH 5CUSL 2BS8A 1AR1D 1A4KA 4BIKA 3AT0A 3DK0A 4PTTB 3ARDA 4GAAA 4Y9BA 2VXQL 2PPAA 4ODXA 4LBEB 2AMGA 2W07B 1SXNA 1HX0A 2X40A 4O9HH 4OLEA 5DMGC 4F37F 3W3BA 1Q72H 4ELKB 4GH7B 4MSWA 1K4CB 1OM9A 3PHOB 3ZUNC 3O0LA 2VW7A 1B3IA 5D70H 1FE8L 2E4FA 3AWGA 3VU1A 1A6UL 1L6PA 3VSUA 2H26B 4DGIH 5I5IA 2J88L 3S88H 1Q9KA 2HLEB 3ILEA 3ZBMA 3QDJA 2BINA 5E5LA 4W6YB 3PWUA 3H9SA 4E5XB 4G80B 1UXMA 5IR1A 4PJAB 1KLGA 5DD5H 3PPSA 2ITDB 3DBSA 4EZMA 4JDEB 2KPWA 4LESA 3MRFB 3M8OH 4PJXE 3CVHH 3EGSB 4W9KC 4GRWB 4XOCA 4MCNA 4ZFFB 5DJAA 4QRUA 1ORQA 2M83A 5D5ME 4ONHA 1ZTXH 3ZKXB 2FSEA 2L0DA 4CUCA 2WINA 3TN0D 4P07A 1MCNA 3TPUB 3PWPA 4QJ5B 4X5WA 3CTTA 1SMDA 2VDLH 2ZG3A 3BH8A 3OC5A 1U8OB 4JHUA 4M43L 5F6HJ 4AQZA 3QUZC 4F7TA 1CD0A 4FJYA 3AY4A 3OJDB 2VDNB 3S2CA 4S1DD 4Y1AB 1E28B 3QIBB 2GTWA 4FYQA 1P6WA 1ZHKA 1OD7A 2FATL 2VXSH 2VDOL 1ZA3A 2DQUL 3V0VA 3VRJA 5E6IC 2AHIA 3SE4C 2A77L 5IQ9A 1ZANH 5AVYB 1PD0A 4HLEA 2A83B 5I75C 1YEJH 3BJLA 1R75A 3AB0C 4IOFD 1EHKB 5HHPB 5JDSA 4JG1L 4YC2C 1F8TL 2R2EA 4KJPC 1D5XA 1L0QA 2J6EH 2IBZX 3OKMB 3GGWB 3SDDA 5EBGA 2NUPB 1ACCA 3WHXB 2J2ZA 3G5VB 4EN3A 5GS2H 4UQBA 5IUSA 3PGCA 4JS7A 1QNIA 3LHPH 2OTUA 3CHXA 4BELD 5D4IA 4R7XA 4Q6KA 4R7VA 2E6JA 2FR4A 4YQXH 3BQVA 4WQOA 1RXLA 2P46B 1S7TB 1ND0B 4IOSD 3FSAA 4ONGH 4ZSOE 3IEAA 3LN5A 3B2UD 4MJID 4E9VA 4J8QA 2Q2LA 4FRWA 1PQZA 4GKSB 3TNMB 1D5MB 4OB5L 3WJMA 1J5OH 5IIEB 2WP3T 4JFVA 4L1HA 2CO6B 4QRQA 3A4FA 2AJVL 3UEQA 1FYTD 2B1AL 4LU5H 2G2RB 5ADPL 3WEMA 3C12A 4JY6B 3O6LH 2W8CA 1XGQA 2CBMA 2V5RA 5FXCH 2Y24A 3U4KA 1YECH 5JLZA 4RSVA 2WSKA 5DLML 1IAOA 3EW3B 3QARA 4DAGL 5CJOH 5F9WB 2H1PL 1K2DB 4KZCA 3TASA 4YX2H 2XTJD 2ZXCA 1FVDA 2VJ8A 4ONFL 3PGDA 4LE8A 5D71L 3BSZH 3PQYD 3UAJA 4XP6H 2A73A 4ANUA 4TTDD 4HUXB 4CVXA 1BSIA 5C97A 4L8DA 2CIIB 5BXFB 3A0OA 3VRLF 1CFBA 1E6OL 3FT4A 3AITA 1U58B 5KANI 1KCRH 3CZFB 3CSYB 5EOCJ 6FABH 4K55A 2EXYD 4JKMA 3QNZA 1OKEA 2Y1VA 4DKEH 4BDVB 4ACPA 4Z6AT 1OLZA 4JZJC 2DV6A 5L88L 5IROA 4NN6B 3MACH 4DPRA 1DDHA 2ORBH 1INQA 5AW3B 2XG5B 3PWNB 3WDJA 2F5AL 2FIKA 3IPEA 3S3BB 4P3CL 4OT1L 1YMHA 3P30L 1M7XA 2HKFH 3AG3B 3RPIB 2Y5EA 4KFMA 3W82A 2GTZA 1UFUA 4P5TD 2GTQA 2P42B 5TQ0H 5BZDA 4PRAA 3I6LE 2VM3A 1CDUA 3HNVL 4WEMB 5BW7C 1N59B 4XR8C 4UANA 5FA4B 1PJ9A 2DTMH 3PU7A 1Q0YL 4XXCA 2DPKA 4F1SA 4K3HA 1A4AA 4L8BA 5EEXA 3BUPA 5GIRB 5CD3A 4U3CA 4PEEA 3KGUA 1IARB 1R3HB 4TQIA 5FX3A 4BZ1A 1BBDH 3M1BB 1T22B 1RJCA 2FQDA 3FQRA 5F1OB 1U41A 1AP2A 3MXWL 1RZ7L 3IWVA 1IAKB 1OTTC 4K5PA 4BUGA 3BPLC 4ZSOB 1JGIA 5HVHC 1NPNA 3GSXB 3HA0A 3ZKMD 4LLDB 1W72B 3ATBA 1HHKA 4G6KL 5D1XC 4WUUE 5BV7B 1YMME 5ITFB 3SPVA 4GBXA 1B4LA 1W91A 4EI6A 1S7VA 1J0KA 4PV9B 2Y6SC 3Q6GL 3QR0A 5T1KD 1ERNA 2EEAA 4HIQA 5CBEA 5L2JA 1IGFH 2NY7L 1FFPB 4KTGA 1XT5A 4G8FB 5I5MA 1QLEL 3RJQB 3VXME 4ZG1A 1YN6A 3P73A 1G1OA 3QDME 3KL5A 1LEKB 4NN7B 1KENH 2NLJA 4KKBC 1EXGA 3DUHA 4KXBA 1SXCA 3G5XB 3QXVA 5IF0A 1YUHA 1BD2A 2CKBH 4Z23A 3DJRA 2YAMA 3HLAA 3TFKD 4WI5A 3EJQA 1WITA 1A3LH 1ZJAA 2FH6A 2K6WA 4DOHE 4WIQA 5BQ7B 3NAAH 4JANB 2X1QA 3CFCL 3FUJA 5DVLA 3ZL2A 5DK0B 4L4TA 1MFAL 3MRGA 4YPJA 2IANE 3ABGA 4E9YA 2HP4A 2HG5A 3MFFA 5DD3L 2MCPL 3MRBA 3P9MA 2TRYA 1DSFH 1ZLUH 3OKLB 2CNZA 1A02N 5KYXB 4PWEA 3VFGH 4NENB 2E7LA 4KVCH 2HKAA 5F44A 1CFNA 1KXHA 3STZB 3V8CA 2BXYA 2QV2A 4LSRL 2Q7AA 1BQLH 3EGXA 3WCYA 1MEXL 2WXJA 2JLPA 1I9JH 1SFHA 1OEZW 1AIFA 3AG4B 4IRSA 3S36L 2C7UA 4HJ1A 1ZSHA 2DYSB 2D