4Z3IA

Crystal structure of the lectin domain of papg from e. coli bi47 in spacegroup p21212
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
198
structure length
198
Chain Sequence
b'MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PapG, lectin domain
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 44
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3iA00
4Z3HA 1J8RA 1J8SA 4Z3EA 4Z3GA 4Z3IA 4Z3FA 4Z3JA
chains in the Genus database with same CATH superfamily
3B2VH 2YAQA 3PIQA 3QQ4B 1MNNA 1RZIB 3MAWA 4OH2A 3EUUA 3VW3L 2E7MA 3BCFA 3OZ9H 2HRLA 4XBEH 4G9DA 4HT1H 5CKAA 1YHPA 4PJHA 1OZTG 1ETA1 4XO3A 3N2JA 3L3OB 1HHKB 3SE8H 3TYFB 5J9PB 2YEZB 3DX8A 2VLJB 1THCA 4K3EL 4GLRI 4Q58C 2YMOA 5D8JL 4QF1B 5F7UA 3MRPA 3ZR5A 4WU7B 1PD0A 4Z7IA 2X10A 4GSRA 1FHGA 2FGWH 4GKNB 4HOZA 3QWOA 1GOHA 2B4CC 4JQVA 4KMTH 1AHWC 3EOYG 5ISZA 1UJ3B 3GSRA 1FN4B 3MO1B 1RULH 3W3BA 1IC7H 3AC0A 3P9WB 3TN0C 4EDWL 1L9NA 4IK6A 1N68A 2XNAB 4I2XE 2B1AH 5KJ7E 1FORL 4Z3GA 4QGTA 1WFMA 3OG4B 1RERA 1EDYA 1MJ7H 3RIAK 1AQDA 2IOMA 3QCUL 4YLQT 2WXMA 4DWHA 1PKOA 4DT2A 1L0QA 4H88H 4ZMYA 3A6OA 5DMKA 1WQVT 1TTAA 2P24B 5B39A 3D0LB 1CICC 2NT0A 4RMBA 2OTPA 4FEIA 3T0EE 2D0HA 2XV3A 2A77L 2DLHA 4MMYB 2VO5A 5B38B 3HMXA 2PYFB 4LLYA 5DRWB 5F93C 4P57A 4P9HC 2AJYL 4EVNA 1ZGLP 1HH9B 3PGCB 3QFJB 3IDXL 1ONQB 1Q94A 1SYSB 1ETZA 2R2BB 3EUDA 5FYJD 4ABWA 4R4FH 2IPUG 2XN0A 2DYPD 3O41B 4DP9X 3MNVA 4X9IA 3WKQA 2ATAA 1Q0XH 2AANA 2BVYA 1I8MB 4Y9BA 1UD4A 3LEVL 2YGNA 2A9MH 4Z6AT 1XGUA 1II4E 1U95A 3O2VL 4LQ1A 4L5FL 3TTYA 5GRVL 3QR2A 5F1OB 3NP3A 1FFOA 4U6HA 3UTTB 4P46A 4Y4KB 5E2VL 2QQKH 3QGVA 4Y4FA 2ATKA 1ILUA 4JRXB 1NANI 4JKNA 3IYLW 5DC2A 3U83A 4Z7QE 4OCXL 2R1XA 1CFBA 1ZHLA 3O9WB 2HAZA 2Y24A 5I6NA 2NY2C 4GKZB 2B4CL 4O58L 5TF1H 1OHZA 2Z93A 2B2XL 4EUPG 2FIKA 4YGAB 3JWNH 2I60L 5ADPH 3VD4A 3DIFB 5AZ2L 5KYUB 4IRSC 4FCAA 3MOQA 3QJRB 4YPGB 2YR3A 3AQXA 1YEHL 4K8RH 1QR1B 2D7NA 5DJYB 3ILPA 5F8RC 2V7NA 1HILB 2PETA 4IIQB 2YQ2A 4IEFA 1JFQH 1DVFA 2YGOA 1G6VK 3B8YA 2X4OA 3HC4L 5FW8A 3V6ZB 2BOBB 2NTSP 1BD2D 3BWSA 3II3A 1BAWA 4UTCA 5TDOB 3S36H 5IM7A 2FIRT 3LN5A 1JHLH 4AK1A 4BGDA 4KX8A 4RMQA 3U2JA 1W15A 1NGWB 4P9HL 1RJLB 4NUJA 1XCWA 2BFGA 3ZDYE 2D3LA 1JWMA 5IB3A 4QYOA 5FUCE 1PGRB 4BSWB 1AY1H 1F1DA 1TJHH 3D9AH 2ODIA 4X6FB 3V79C 2HTLD 3FO9B 1JYNA 2J1WA 5A6IA 4FNRA 4N6QA 4M02A 5L2KE 2BNRB 3TT3L 2HT3D 3FYEB 4WUUA 1PDKB 1TVHA 4ORZC 2V9TA 2XTJB 1F0LA 5G2NA 5JA9A 1U58B 4DTGH 3RNQB 3FONB 5I1AB 3RNKA 2NXZD 2XJKA 4OLVL 4PR5B 4XCNA 4XPFH 5D5MB 4Z8FH 4FQ1H 4CVWA 1FG2B 2VAJA 2FT6A 1COBA 2LHAA 1INQB 4LSSH 4QWWD 3KCWA 3G6JA 1NCWL 2GK2A 2WVVA 1RZ7L 1PLGL 4M29A 4UAHA 1MCNA 4XPGH 3VMNA 5EOTA 3V5KB 5L8JB 1IGJA 2FBJH 4YHLL 4OTXL 4JJ5B 4GUPA 4BKLB 1AYRA 1BFVH 4NO0B 2OX5B 1JMXA 3JQOB 2WKGA 4PWIA 3HR6A 3FCTB 3NABH 2BHYA 3U6XA 4E9VA 4L05A 2R69H 3CPLA 2XIBA 3QO0A 1LWHA 4LSVL 1R3HB 4N8VG 3WS3A 1RZJH 4MA3A 3FOLA 2O30A 2WTOA 3D06A 4QXWA 1X5MA 2R2CA 4FNLH 3NSFA 3LH2H 2X5PA 4GQ9L 4WWKC 5DK2A 4GW4B 2L7UA 1YJDC 4I2XA 2RGSA 3ATBA 3US9A 5HJDA 4A6YB 4F37F 5DRNB 2AKRA 3NCEB 2BXZA 1LMKA 3BDBA 4ODWB 2E5EA 3QUKA 5ANME 1BBJA 1U36A 1HFUA 1EHLL 1MCJA 5BW7C 1IU1A 3DIVA 4TUJA 1JWSB 2JKNA 4FHJA 3RHWF 2WINA 3FF7A 3LZFH 4AEHH 4DW2H 3N43F 4X4YB 2K9UA 2A4CA 4NUGL 3QORC 4KJYB 3T0EA 1A6ZA 1WE5A 1XR9A 3L3GB 1GC1H 1E4KA 3RU8H 3QRBA 3U0WH 1PSKL 2JNZA 4WFHE 4G7YH 5J11B 4G6AC 3CCHB 3OLEA 5C71A 1KIRB 4JGMA 4URKA 1J5DA 4LLUA 1ASOA 1XF2A 4N5EC 5DUBA 2J5WA 1JNNH 3IJHA 2X28A 5IB1A 1EK3A 2DLFL 2WVUA 2H45A 2ZUWA 5FDWB 5C3LD 2OA9A 2NY1C 2H8PA 3ZKMC 4HALA 3GBEA 5E5MA 3VACA 1XB8A 4A6YH 3FTUA 4KQ3H 5DJDB 4RAUA 3IJYB 4F57L 3E38A 3TFKD 1XR8B 3ARDD 1EJ8A 3FB5B 4M9OA 4H8PA 2P8MA 2IMMA 4FXLA 3ECQA 4ZUSB 2XWTB 3QDME 4JZJB 4HOXA 2IANE 3FUIA 1UA7A 3SDXF 1AS8A 3WEBA 1N3NA 4LKXB 5JQ6H 2B59A 4ENEC 1QFUL 5AG9A 1UTDA 1N6QL 1DBAH 3BVNA 4WI7A 2IPKB 1H6FA 5EU7C 5C8JA 3BKML 1ZY9A 1WZMA 4FFTA 1E6OL 4ANKA 5HD8C 3W0WA 3MACH 3KH3A 3QI9B 4KTDH 3ZE0F 3RVXC 4L0ZA 2GJJA 4GXVH 5CJOL 2C1PA 4PB9H 5EPMA 5HY9A 3QJFB 1NCJA 4X4XB 3C09B 5F71A 1YJDL 4MAYB 3SODB 3R1GL 4J3OH 2FNWA 1F11A 2V7HB 1DQJB 1T4KA 4RIRA 1S7RA 4LBAA 2DI8A 1RD6A 2LE9A 3P77B 4JBSA 4X9HA 5AW9B 5JHDD 1QRND 3DPBA 4WGVB 2NSMA 3I2CL 1N10A 1FHNA 4V1DE 4B6ZA 5GGSY 5C0IA 1ZXKA 5I66A 5FKAA 2G5RA 4F33B 2ZNXA 4FG6C 4PRHD 1JF6A 2YBRB 3K4DA 2W9DL 3O2DL 4X6EB 1MY7A 1U6AL 3LKSA 5E6IC 4K7PL 2X1QA 4L0PB 1YEKL 3V4PA 2AVGA 4RFOL 2X53A 5HYQB 1B4RA 2VLRD 4BSVA 4Q8BA 1CGSL 4F8QA 2YJLA 1IIIA 1YZZA 1OM3H 4DZBB 5L2KA 4HJUA 2UY6B 2R0LL 3V0FA 2QKIA 1WBZA 1WVZA 3U4AA 5K69A 4QRFA 3CU1A 3CIQA 3VXSB 4LEXH 2GUYA 3BT2H 2UWEF 3FAXA 5LBGA 3RYMA 3FHAA 4XP6H 5DUPL 5J6SA 3HZYB 4LVHC 3I02A 3QNXA 4HK3J 1QKZH 4KZCA 2Z0UA 3IDGA 1GGIL 2WBJD 4LMQI 4OJCA 4CN6A 4Q97A 4FA6A 3S5ZA 1NCIA 3F04A 3OKOB 3BXNB 5F7AA 2CDEB 3SCMD 2Q2LA 4Q56A 4FQXD 4UZGA 1DEEA 3FH5A 4KROC 1KLFB 4EO5A 3QA3A 1ODAA 3FQNA 4BQCA 1QPPA 4ZUTA 4U7SA 1S7SA 4MMZA 4G8IA 4M3HA 2DYRB 2FSEB 1HHJB 2DIBA 5KS9A 1XZWA 1Q4NX 3TN0A 4LLQA 1YNKH 4I0PC 2H26B 4PJ7A 1RY7B 1YMME 4EDXA 3P40A 2J72A 5DJXB 1A65A 2F58H 2VKWA 1JV2A 2GJ6B 1W0YT 2CRYA 5GPRA 4PJAE 1E30A 1CFQA 5F9OL 4K5PA 3VWKB 1OSZA 1U8JA 4IJ3B 4QHLB 3HB3D 4WNQA 3P0VL 1DN2A 4N22A 5FWQA 5ANMA 1IGIL 3O4LE 1CICA 5CLTA 4J3UA 3MLYH 5I1CH 1A4KA 4AX3A 2F8VA 3U36B 2CWRA 2H2SD 1T66D 3WTVA 1BEYL 4WWPA 4AVJA 3EH4B 3PV6B 4HG4K 2E6QA 3LVTA 4XI5D 2B5IB 5A2KH 3T3PE 5B1JC 4NHCL 1MG2C 1A7PH 3ARUA 1BLNA 3NSDA 4M62L 1SJXA 1DZBA 1JGEB 2QR0A 1DN0B 5E08L 1ZS8B 4J39A 1BZ8A 3VG0H 4GMSL 3ZRCC 1TEGA 4BFIB 1QSEB 2PW1B 2J5LC 2QPFA 2AP2A 1E7VA 1QLEL 3ZL4L 3U48A 5C6TL 3D2UB 5F7WC 3MRJA 2P26A 5CP7B 4IGBD 4YHIB 2WW8A 1U93B 4FNTA 3DX1A 1A25A 1ZHKB 3Q01A 3TNNB 4HKBA 4NKDB 2XXCB 4N8PA 5BQ7B 2C7UA 2BIMA 1ORQA 3TYGH 2ZJSH 4D8OA 4LCUA 4A37A 3ALXA 1G1YA 1T6BX 3QDMA 1L9PA 3BPLC 3MJ9H 2YWZA 2IANA 2F7RA 4U1KA 4M7ZB 4XBMA 3RPKA 5L0QB 2FQFA 1ZSDA 2Q5BA 5LDUA 3MTXA 4H8VA 5IBTL 2FR4B 4JFOA 2CHWA 3Q9QA 3NRQA 3WHE1 5IBUG 1MW1A 4NQED 4DPAX 1ERNA 1AKJB 2WKOA 4UILL 3MCLH 2I9LA 3WE6B 2PCXA 4QRSA 1WUNT 4ZD3H 3HN5A 1X7TA 4HUKB 4P4RA 4TTGA 2GI7A 4ZUWB 4AKOA 4OD1H 4GP5B 2J8UE 4HIXH 3WN5B 2HPOA 1SXAA 2F1AA 3C2AH 4BZ1L 1IRAY 2X2UA 2L8AA 3T6VA 2ZTBA 3HPJB 4L3CA 3W2DL 2XWDA 3EYQC 4L8BA 4DGIL 4YDMA 3ULVC 3QK0A 2C26A 1EO8L 1AGDB 3TA3D 4OZFA 2BNQB 5IQLA 3ROLB 4XNZB 1YAZA 3DOIA 2HVJB 5B7MA 2BOLA 3GJFB 5DQDL 1JWUA 5CGMA 1ZCRA 2HRGA 3PL6A 1M1SA 5IR1A 2XPYA 1JDAA 4GUCA 3H9SD 1G0YR 4FE9A 4FQPA 2XT1B 1BQ5A 4G8GB 4K3JL 4Q6IC 2GTWB 1S7WB 3HRZA 3GM0A 2IAAC 2CBOA 4G8EA 4XVOA 2WIMA 5T1LD 3P9LB 4MTMA 1IM3D 5FLVA 5FYLL 1DHKA 1UQSB 3W57A 2VWEE 3QXTA 3V9FA 3WNOA 3QUYC 4O02L 3VSQA 1KELL 1JCKA 3ABZA 1G0DA 3L5XH 4QEGA 1W72A 2HN7B 5SWZD 2PCFB 2BVTA 2IAMA 3VD7A 1CURA 4LIQE 2IV8A 1TQTA 1JZFA 1C08A 4UV7H 3WDJA 1V7ML 4X7TB 1DE4A 3V55A 3QUXA 3RY6C 3S37H 4G80B 3GJFH 4AT6A 2CA3A 1OCZB 4TM9A 5CBAA 3TV3H 4IKNA 1JZ3A 5CN3A 3OLIA 2YHGA 1VCAA 2VR7A 1D7CA 5C0BB 2JQAA 3BSZH 2X6AA 3MV7E 3SGEI 3PNRB 2BSSB 1IM9A 1NJ9A 3I50L 1RPUA 4PJEB 5A6MA 2XU9A 5A1AA 3VXUB 5GJTL 1HIML 1MVFA 2CQVA 1P2CA 3CFKB 3KJ6H 1EMTH 3LIZH 3VXMD 4XOAA 4CKVX 2YXMA 1LD9A 2AXFA 1YMMA 4PJ8D 4LAJH 5JOFB 1S7UA 5IJVB 2ETWA 4P5MA 4ANUA 3QJUB 4J3XA 3ULVL 1CDGA 3BD5A 2KZKA 4PJAA 3HJEA 1OGPA 4YAQB 3FT9A 4J3SA 2K8MA 1JGLL 2R0ZH 1PLAA 3IU3B 2GIYA 4P07A 2EIKB 3O4LA 1IQWL 4AEIH 3OKNA 3SPHA 3DO7A 2P1YA 1T20B 4NI6A 3QORA 3GUTA 2VMJA 3B9KC 3RVUC 5LHDA 1KTDB 4CGTA 1EANA 4JQXC 1ZA6A 1T1XB 5JUEH 4LZKA 4AC4A 1DBKH 3GHEL 1DVXA 1XL4A 2PPEA 3QCTL 1PY0A 5KJ4A 4ZMTA 1BG1A 2R4RL 3COOA 2K9FB 3UZVA 2Y7LA 3LKRB 5HGAB 4YLCA 3J27A 3QUML 5BOJA 3MX0B 2EDYA 3KS0H 3ZJAA 1UT2A 2OR7A 1PQZA 2PTTB 4WHTB 4DO6A 2AEPL 3QDJD 4XPBL 3D8MA 1JTTA 1YNLH 3O3UN 2Y7NA 4JG0H 3AREA 2Y36L 3MFGB 4YN3A 1Z6JT 1B0GA 3ZTEA 1USZA 3A21A 1WFTA 4R7NB 1FL6A 4P9ML 5MP6H 5KW9L 3WGVB 2NSXA 1PYWA 4PTUB 1MNUL 3A47A 1FA4A 1CR9L 2NY4C 5F7FA 3HHRB 3T8VA 3FB6A 2P45B 3SYOA 2J6WA 2NY7H 4WEEA 1U4FA 3D3VA 4EIGB 5IQNA 4LQFL 2Z7WA 5JHDE 1AXSA 2ED6A 5A2BA 1YNTB 3PQYB 4LCWD 1AYOA 4KU1A 4P4KA 5H35A 3QG7L 3L5HA 4LPUA 4CILA 4F15C 1VGEL 4HH8A 4BH7B 5C0FA 2C9QA 2ZSWB 3NCMA 4PRID 3MLZH 4OZHB 4W9KC 3BEWA 4RFEB 5TK4A 5JLZB 3EYUH 4XN2A 3MUY1 4Y2DD 4WW2F 5GSVA 3WEXB 32C2B 5CUSL 1P5VB 2AJXH 1JPFA 3P4LA 1EZSA 4LARL 1CU4H 3ZKND 4ATTA 3H6AA 3LZPA 3BZEB 1OW0C 2YA0A 3LN9A 4NQCD 4QIRA 3GTVA 3WY1A 3P4NB 4XNXH 3RVTD 5F6HI 3IVKA 3QJHB 1D9KD 2J88H 4DVBA 3TCTA 1Y07A 2LU7A 4TPRL 5FM8A 4FXKA 1AZVA 1NC2D 3EJCA 2A6KA 4JW3A 5I6OA 2L7QA 1DLFH 4NLHA 4HIJA 1OTSD 4JM2F 4QRUA 2CIIA 3IE4A 4Y5XB 5D70H 3V6FB 2EVIA 1G6RB 1M42A 1OHQA 3TZVB 1MUJA 1U8HA 4AYSA 4W4NA 3P2DA 5D7HA 2X3BA 5AL8A 1LO0H 4EI5A 2TSBA 4F9LC 1CD1B 5EZLB 3WTWA 3QZWB 3P4OA 4B60A 1E8YA 1RIHL 1HH6B 1XSJA 2DQFA 5I0ZA 2EIEA 5H4ZA 1FG9C 2C9XA 3ARZA 4NBXB 4N2NA 4NB7A 3TNMB 2APBA 4WFGE 1VZGA 1M2VA 2FSDA 2K1MA 1L7TH 4NQXB 2GC7C 3LKNB 4YHPA 3KGRA 3PDGA 2GCYA 2GBUA 5T33H 3BP7B 3SHSA 4NM8L 4HAGA 1BOGA 5ID1A 4WO4A 4HDIA 3K6NA 1I9IH 3TGXA 1XCXA 2GI0A 3EO1A 1BZQK 5DYOA 1UM4L 3RFZC 3MV7A 3EJYD 4OQ1A 4BCZA 4I0PA 2HCZX 3CNKA 3KPOA 5MEOA 1M6OA 1CTOA 3F7QA 3MLSH 3O3AA 4ZOEA 3VI3F 1X5HA 5F9DC 3FTSA 4BZ1A 1QBMH 2LT9A 2LLLA 4S0SD 1KCSL 1MCHA 1X4ZA 4LCCC 1SHXA 2A83A 4E9WA 4A55A 3HZMB 1T0MB 1EVTC 5EU5A 1FFNA 1H6EA 2V37A 5D7JC 5MEQB 2KPNA 1M56B 3QR1A 1S78C 3B34A 1VA9A 1XEDA 4TN9A 5ITFA 5E70A 3FPYA 3WO4B 4MAZA 2EZ0C 1WBYB 3MCG1 4YJZL 1JV5A 3FT2B 2ZCHL 2CBPA 3HZKA 3W5MA 1EH9A 3LDBB 3BVTA 5KVDH 1XIWD 1WDAA 1JRHL 1B9ZA 4NNXB 2EXYC 4N24A 3RJDA 3SGJC 3V6OC 4MD0A 5GGRA 4JX0A 4PJGF 4PM1A 3ZTJG 4JM2D 4DCQB 1O6SB 5AUMA 5KYYB 5H37A 5F0MB 4XWOD 5IGXL 3CX2A 4NQEE 4HSAC 1YEFH 4JB9L 2OCJA 2ROYA 3CVCA 1FH5H 3V5DA 5GGVH 4O02A 4MKTA 4XH2A 2P47B 3K6SB 4K07A 5SX4I 1FI8C 3LAFA 3AY2A 2F8IA 5L88H 2MOVA 3T2PA 3IXTB 1FL3A 3DUUB 2OK0L 1CUOA 5EG6C 3ZTNL 4OLZL 2OMBA 3W39B 1G84A 5EFIA 2EECA 2IJ0C 5I1KH 1T0OA 1AZUA 4XNAA 4LSQH 2UX6A 3U82B 2J20A 5G4MA 1UURA 2V33A 4JFTA 4HUVB 5DJ2B 2QSCH 3GGWB 1F90H 2Z92B 2D9CA 3HNSL 1LEGA 2YSTA 1MJJA 2JLLA 3GEWB 4GXUM 4UBDC 3INUL 1QFWL 4I3SH 2CO1A 5C0CB 4ZO9A 2C3XA 1OXYA 2FYVA 2EO9A 4PD4K 1ORSB 5CU9A 3SD5A 3KLAB 1NCBH 3AG1B 5M95B 1ETJA 1M7UA 4GW5B 4LRIA 2W07B 5E8EA 2FLRT 5DLMH 2EKJA 2ICWJ 1KEMH 5B7FA 3ES6B 4PJCA 4N2MA 3SPVA 1PAZA 1I82A 4LAQL 2IWEA 2X6BA 5JHLH 4MQXD 4UQ3B 4X99A 3B3BA 3DJ9A 4G7RB 4PI0A 3RPBA 3N40P 1CYWA 4C56D 3MGTA 4ZMWA 5HYFA 1IBHA 4JM0A 1MDAA 3MA7A 4FQJL 4GAYA 2IVFC 2F5AH 1RUAH 4PS4H 2ZT9C 2G9HA 2VISB 4HWZA 1CFSB 3KVQA 2GQHA 4Q6IA 4QHUA 1XGRB 3WJMB 4M3KB 1SN2A 2FDBP 1NAKL 3FU7A 4KJQC 4ZO8A 3THMH 4Y2NA 4PREA 1A6AB 4H8QA 3QUMA 4OZIF 4P2RE 3QXDA 3VSVA 3OKDA 3NPSB 4NFDA 5SWSE 3IT8D 3HLKA 3EGSA 5ECGA 3PYCA 4PJIF 2IMNA 4PJDB 3AT0A 4KRMB 5CMAB 2FAUA 4Z7OB 4JZNB 1LE9B 1TCRB 3VXME 1QI3A 3L08A 2R1WA 5FO9A 4QKXB 2YQ3A 5CZKA 3T2LA 5BV7B 4F2FA 4KZEL 5E1AB 1W6WA 4X5XB 5HYSB 5IQ7H 5B22A 3S88L 5IHBA 4TMPA 1EFXD 2A99A 4DN4H 4WI0A 5HHQB 5GS0D 3CFDA 1PZ5A 3G9VA 3S4SA 4Y1AB 5J57B 3BP4A 4JFDB 3ZDXB 4AKPA 1I9JL 4PJBE 3C8KB 2DKSA 3LMJL 2JH2A 1WWAX 3JUYA 1RSYA 2BINA 2XQYA 3FJTA 4NQDE 4NOBA 3OC8A 5D1ZD 2CE6A 5F7MC 2ICWI 2HG5A 1HC1A 2BP3A 2ZCLL 4EIBA 3QEUA 4POUB 4FNUA 3CH1B 2ZE0A 3SDDB 2JCCF 1YY9D 4Z1PA 2NY6D 3ROOA 5K9KB 4ZPTA 3STLA 3VH8A 4HLZH 4PRAA 5B1KA 4AIZB 5BV7H 3O3EB 1QX1A 2W0KA 3B9KA 1XCQB 2NLJA 3E8UL 4LCYB 4PV9A 4XCCH 3TO2A 4H8UA 4MXQD 4JQXA 4HYTB 1YAIA 4ZO6A 3HE7D 1JHKH 3T6ZA 2CUMA 5I16B 3QDGA 4FD0A 4U6XA 4XRCA 1MCKA 1R47A 3QZMA 1FFQA 2DQGL 4YWGL 1J9CT 5LB1A 3SQBB 1PF3A 5GGTL 2RB8A 3HI1A 1E2WA 2AEQL 2CO6B 3KMDA 5ERWB 2EXWD 3QIWB 4ENZA 3IFNH 5KJRH 4Y9EA 4G6KL 5DC9B 1OGTA 5EZIL 1KCUL 4Z7UA 3V10A 1S3KH 4KRPB 3VB8A 5I0VA 1CT8B 1KGIA 5KSUB 3DUSA 5CZXC 1BV8A 5T1DH 4OLXH 1FAIH 2BRRH 1FBIL 3H3PL 4TXVB 1L4IA 1XH3B 1RIUL 4XXDB 4C83A 3NP4A 5C0DA 5EN2A 2V6HA 3FSZA 3EBIA 2YXFA 1TXKA 5I6MA 4P3CH 2J2ZB 4DETA 3II2A 2WUCL 2W9EH 4NQCE 3G5VA 5FHBH 4D7PA 5FOBB 3MBXH 3HG1D 3LN4A 4M6NL 2W94A 1L6ZA 3CC5B 3DBXA 3IMRA 2XFXA 2JELH 5IROD 1KSRA 1UB5B 1N64H 1XL6A 2YGPA 4I8DA 2C9UA 4ZNEA 1E3FA 1OAKH 1IE4A 5CSZA 2BM3A 1MHCB 4YDNA 2GHWB 3Q2LA 4OR1A 3ZRSA 4FKEA 3RZWA 3HVDA 4YSTA 5DDHB 1KB5B 4H20H 3WFDL 3V0EA 4U4IA 3U6XS 2DLTA 4YHYB 3UIZA 1F4YH 2EP6A 1AIZA 1KNOB 2YKKA 1D7FA 3GIVA 4H1LA 3NFPB 1BMGA 1K6QL 5TDPA 3BHBA 2X0VA 5IQ9B 5KVFL 1IKNA 1F8TH 2VDLL 4HBCH 3VI4F 4RMWA 4Z3TA 3OKEA 2H32A 4HWBL 1INEL 4AGLA 1HAWA 3AWEA 4HJSA 1ET7A 5BVJB 4UT6L 5DJ8B 1IV8A 1BXAA 3KPRE 4WI4A 3F7RA 1RQ5A 3F12B 1X7QB 12E8L 1I8UA 3FH8A 4RGMB 3TVMA 1H8NA 1XB6A 2MIZA 3BW9B 1YYCA 4F9LA 4HXBL 2G2NA 3RL2B 4P2RA 5J12C 2ADYA 1KB5H 2A0LD 4LF3B 1VEOA 4UM9A 5SWSA 3L3OC 2O61A 3RWGA 1QP1A 4GSQA 4LSTL 4PBVC 1U8LA 1I3GL 2CBMA 1TENA 5G55A 1BF2A 1IBGL 1AGCB 2Y07H 1QSFD 4PLJD 2BIOA 1OAUH 4NOFA 5KVGH 1QEXA 1A9BA 3C5XA 4FERA 2J6EL 3OHXA 4N85A 1GXEA 3PJLA 1HZLA 3LEYL 2WM0A 4I4WA 2EE2A 4ONHA 5AOIA 4EI6B 1UJ3C 4LDEB 5FYKL 3BPNB 5B1CA 3WIFA 4XGZA 3ABGA 1FO0B 1ACYL 1BVLA 2MWCA 2E8ZA 4MCYA 3O6FA 1ZT1A 3P9MA 4NI3A 5CGTA 1NLDH 4EPSA 4Z3FA 3RFZA 3G5XA 3VXTA 1A3QA 3BN9C 2PW2B 3ML8A 4PJBA 5FF6B 3ZMRA 1JOIA 2F2HA 4XAKE 3OBAA 3OZ9L 4NQDA 4ODUA 4HT1L 1MW3A 4XBEL 1RZGB 5JPMB 1XBRA 2DJSA 2VXVH 2W91A 2DD8L 5F7EH 3BWUF 5IVXA 2E75C 1D5BA 3H3BC 3T04D 4WHYG 3SE8L 4NDMB 5AB2A 4W9JC 2E9GA 1CVSC 4MCNA 1KYOK 4LXFA 2WLKA 4ZSOE 4TVPH 2YPVL 2PYEB 2FGWL 1KZQA 4TF4A 2VRAA 3GMPB 4HKZA 4KMTL 3D4GA 3NJXA 1B6UA 3CXDH 4IOIB 1E5AA 2AJZB 2NDFA 2ENPA 4N0CC 1RULL 2AERT 1IC7L 3BX7C 3NJNA 2ICEC 3OX8B 4K8RC 4NJ9H 4ZT1A 4W68A 3SGJA 4WI2A 2Y7MA 3VFWA 2B1AL 4G83A 1AO7D 3BAYA 3GZKA 1S7TB 2XI9A 4OFDA 5BO1H 3FO2B 4NHUB 1A9VA 1QI5A 2UY7A 3KM2A 5DRZA 1CB4A 1JJUA 2Y1YA 4H88L 4LBEB 4ELME 4GT7A 1I7TB 1JZ5A 4WW2B 1UKQA 2WNKA 3RDTA 3ULSB 5K9QG 3N6YA 4MDJA 1ZVHA 3NIDF 1BYNA 4ABUA 2QZ5A 4KVPA 3CLWA 4BK5C 3E6FA 4L1BA 1FYTD 4OKDA 1W0WB 4HUWB 2P52A 1FNGB 4R4FL 4IRZH 3L16A 4OFPA 4X8JB 2CXGA 3LPGA 5FA4B 3SBWA 3U1QA 2ZWLT 3WGUB 5JORA 4XXCC 3W9DB 3DROB 4QRPD 4I9WE 4KNSA 2FEDC 3FULA 3GI8L 2YUWA 3RZCC 1HL5A 5DHVB 5FIEA 3RGHA 4IIQC 5AAMC 4RRPM 3IJSA 3FUHA 4UIKH 1EO7A 4BDVA 4HH9A 4C56E 2ZUYA 3WSQH 3BZDA 5HYJE 2AAVA 4E68A 4ELKA 2DWEA 5B3JF 5LAXA 1MN4A 2X9WA 4QT5B 1E9OB 4LOFA 2QQKL 3ARGB 1BPVA 4X42A 1UACH 5I8EA 4OQTA 5IQMA 3FZUC 3QNZA 4WWNA 1TKWB 2A9NH 1KTJA 5C0RH 2QZQA 5L9DH 1MSPA 6TAAA 3DX7B 2A6IB 1OT1A 3CH8A 3R06B 4Z95H 3L6FA 5MHSE 3KYKH 2R56H 1PD1A 5FV1L 3FQXA 3QDHA 2ALWA 5GRWA 2EADA 1CDHA 3M1BB 4D9LL 5ADPL 4R4ND 5HVHB 5HXMA 3NJGA 2DMKA 4GS7B 4UT7L 5L4FA 4K8RL 3Q2WA 1U21A 1RZJC 4N2EA 3W9EA 5BOZG 4OF8A 1FCCA 3KPRA 4LOVA 4P5SA 3CDYA 5EU6D 3FTGA 1JFQL 1WAPA 4J3BA 1MWAB 3HHSA 3HHMA 1IFRA 3GMOA 3ZR6A 5GGTA 2ZKHH 4PJXF 2W65B 1OP3K 3UJIH 2XXFA 3S36L 1UH3A 3OXRA 5EO1A 1LO5B 2V9RA 2VLJE 3BVUA 3LH9A 3SDCC 3C60B 3W81A 1ILSA 4KH9A 3B43A 5KYXA 4XMTA 2BNUB 3D9AL 1TJHL 1JIBA 4J6RL 1GC1C 5BJTB 3LB6D 3S8WA 3I6KB 5D93C 2FJHA 2APVA 3PGFH 3MV8B 3UBXI 2YSSB 2Z35B 3EDFA 1OB1B 3FS9A 3WYRA 1OALA 3ELAT 4ES8A 5T1KA 4LHJB 1MFEH 4JO8A 1PG7X 3GMNB 4M43H 4NBYB 2VR9A 1XAUA 4MB3A 2XV0A 3PCYA 3NH7L 1MWAH 4DTGL 1Y6MR 3EOBA 4QHPA 3MUUA 2VLLB 4N0RA 3L5JA 3ZOAA 4IU2A 1E9QA 4OCYH 4POZD 5AZUA 1PG7W 4EUPH 4R3SB 1DQQB 4FQ1L 3TT1L 3GO1H 2I26N 4LSSL 2WCPA 1UASA 1S9VA 3HAEG 4XPGL 3VAEA 3IAGC 5JW5B 2FBJL 2VITA 2E7HA 3GSWA 1TYRA 1BFVL 1IGTA 5C3TA 3UCRA 2XPGB 3QFJE 3QIUC 2H2PC 3CVHL 3FRPA 3NABL 1A8JH 1FNAA 4MXVF 5CILH 3WL9B 2W0LA 4LT7A 3F64A 1J9TA 3FN0H 3JWNE 3GMRB 2R69L 3NACL 3K6DA 3QNYA 3F84A 1RZJL 4MS8D 3H85A 4OD3H 5GIRB 4HWBA 3QO1A 3CAFA 4P5TB 2OTUB 2RALA 1NEZG 4FNLL 4UT6A 3LH2L 4KITB 2BIIA 1RH8A 5IESH 2VKXA 3CD4A 4J3OC 4K3DL 3P54A 1ZA3B 4AE0A 3BZFB 4Q9BA 3FU5A 5CLZA 3VRJB 5CFAA 4ELMA 4JRXE 1AC0A 3WD5L 2WLHA 1IGFH 4AGNA 2EVHA 1T1WA 1L0PA 3AJ7A 1FAKT 3FL7A 3QJSB 1HL4A 3BUPA 2G2RA 3K6IA 3MHZA 3BDYH 2FBOJ 4AEHL 3NJJA 2KMWA 3D2UD 1GC1L 3U0WL 3TIDB 4ERSH 3BZ5A 3RX7A 1KYAA 2FL5B 4G7YL 3DV6A 3V8OA 5ETUA 4ZUUB 1SHSA 5I8CB 5KBKA 2NSQA 2RA1A 2ZOKA 3F2LA 4K5NA 1JNNL 4WRLA 4U6VH 2X9XA 4HOWA 4AJWA 5LCVH 1K5NA 2P3YA 3MLTA 3VX1A 2FQEA 2E7LC 1WA2X 3MUGA 1TLMA 4X9BA 4UT9L 5HP5A 4A6YL 1MVUA 4KQ3L 3NGBB 5HYJA 4AW7A 3GSNH 4NO2A 4B9KC 4OD2A 1BQHB 3Q2CA 3WLBB 4PLKC 1XT5A 1O9ZA 5B8CA 4FA8A 2R15A 2L3BA 4UYPA 5E94A 5JZ7D 2VLKD 1RUQL 3LEXA 4J8RB 4KK6C 3UYRL 3VUAA 4OZIB 4W4OC 4XNUL 1SRDA 2CO3A 4ZXBA 3MZTA 3QAQA 3UDWA 4ZQTA 5D7IF 5AKSA 5JQ6L 5DWUH 2GSIA 4B0MM 4JPIB 4WWOA 2X38A 4NKMA 2CGRH 3V4UH 3T4YA 4U3SB 1ES0B 4HHWA 5B4MC 4HPOH 1A1NB 1IAIH 3NN8A 3DOSA 3JT0A 3K2KA 1OTUC 2F7IA 5ALBL 4P2OD 1MRCH 1NDGA 3LNHA 1TZIB 3QJOA 3BGMB 1TU2B 2FVNA 3MACL 3TESA 2K4WA 2AV7B 4GXVL 4TSBH 4PB9L 1EXGA 5E4IA 2OL3B 2XTJE 4PV1C 4Q2ZA 2YD8A 4S2SA 3GS4A 4Q0XL 4P23D 2VR4A 2BHFA 1O7DE 2D73A 4HCGA 4K7PY 2VR6A 3P3UA 3QQ4A 4A2GA 1RZIA 5D5ME 1G4MA 3VMOA 1CXHA 1CD8A 5LJYH 3TL5A 1CF8H 5I0DA 5GJSH 2XN1A 3BH9B 4UMGA 3L3OA 1GYAA 3TO4B 1J0HA 3ZYIA 3TYFA 5J9PA 2YEZA 2Z8RA 3M8OH 3OJ2C 4ZW7A 2VLJA 3OSKA 4OIAA 1ITBB 3MTRA 1BYPA 4QF1A 1JK9B 1QNZL 4G11A 4HEME 2JCCB 4ZTOH 5BRZD 4IRJD 4WU7A 3JYCA 2X89D 4GKNA 1WFUA 4KTEL 4YH6A 1OARH 1FE8H 1UJ3A 4R90L 4G59C 1MCSA 5K1JA 2XVLA 1FN4A 3MO1A 1OM3L 3ZT5A 1S3RA 2OL3H 4OKVB 1TTCA 4X5RA 3JWDC 4NN6B 4LEXL 2XNAA 3A24A 4JHUA 4JL1A 5E8NB 5DC0A 4BUGA 2CJ3A 1UYWL 1EUTA 1QKZL 2UZXB 2LV4A 3G5ZB 2VDPB 4DP5X 4PG2C 5HHOB 5JW3H 1NSNH 4GBXD 3KPTA 1DFBL 3MCKA 5IB2B 3SKMA 1MFBH 4ZS7L 1NIFA 3ZUCA 4I5BB 3ZL1A 3EAKA 2OPCA 2P24A 3D0LA 3FUFA 4JRFA 4RQQB 1MIMH 2E0PA 1A64A 4MMYA 4NX0A 5B38A 2PYFA 5DRWA 2AFNA 2RCSH 3O6LH 3V0VB 3PGCA 3APCA 2B5IC 3ZU8A 1ODUA 3QFJA 2AXWA 3FUDA 1ONQA 1SYSA 1JHTB 1XEUA 2R2BA 3CZEA 3QARA 2J1KA 4XP4H 5CGBA 4W9GC 4OGQC 3REWB 2ZXDA 5J5EA 3DHUA 3TIEB 3LPOA 1HNFA 4OCMC 1E5UI 1WS7A 4KI1A 1I8MA 2YIHA 4EIZC 4WI9A 1CE6B 3NT0A 2F58L 2VDPH 3EW3B 1LEIB 3IDJB 2VDKH 5G5DB 5ANHA 4QRPE 3UTTA 4Y4KA 4NUPA 5JA8B 1WSST 2AXGB 2WIIB 3F7PC 3QQ3A 2YD7A 4JRXA 3UEZA 5I73B 2HPTA 2X3AA 4TNWK 3HG2A 5DA4A 5I1CL 4AXWB 1E42A 1MW0A 4NQTA 3SZKC 3N85H 4B96A 3O9WA 4MRCA 4GKZA 2NY5H 1GJWA 1Z7JA 2IQAB 2EIBA 3PWVB 1OOWA 4U3XA 2YRLA 1PKQB 5E6SB 3VGAC 3DIFA 3SE9H 5KYUA 1Q90A 2TRHA 1P6AB 1A8ZA 3NRPA 3VG0L 4YPGA 1O75A 1F3JB 1TQUA 3QIBB 4PRNB 3JWDL 5GISH 1QR1A 5DJYA 5BXFB 4GO9A 2V8MA 1E67A 1HILA 4IIQA 2EDLA 5AAMA 4PVMA 2WC7A 1G9HA 2DL9A 4BFNA 4J12A 3MQIA 3V2AR 3V6ZA 2BOBA 4UAOB 2NW3B 4U0RB 5TDOA 5AOJA 3TYGL 3RP1A 1HN1A 1NZRA 5JR1H 3BAKA 4XP1H 3VDCA 1PMYA 4J4PD 1TYJA 3MJ9L 1L9OA 5EU6E 3H0TB 4RBPK 1NGWA 4IKJA 1RJLA 2H0JA 2ZX8A 4BSWA 1S46A 2KQMA 2W8CA 2Y06L 2BRQA 4J28A 1IBBA 3FO9A 2DWDB 3MCLL 3OMNB 4F7CB 3PWPD 3DC0A 2AVFA 2WO2B 2BNRA 2ENJA 3LNDA 2AEIT 1TJXA 4ZD3L 1JBJA 2G60L 3Q13A 1PDKA 1OP5K 1P7QB 3VXSE 4EOWL 1U8PA 4QGYA 1D5MB 2NXYD 4HIXL 1MREH 1OT2A 3C2AL 3RNQA 4MB4A 3K0WA 4F1SA 3FONA 4K2UH 4LDLB 4M6OH 1P6WA 1R75A 3T9WA 5I1AA 2Z31C 4PR5A 5D5MA 5IBUB 2OYKA 4XB3A 2PN5A 1MCRA 2OMZB 1FG2A 4FTVD 5GGRY 2BP5M 3BLBA 5EC2B 2YKLL 4KGLA 3BEVB 1INQA 1F3RB 1T2JA 2DTSA 4QCIB 1F6FB 1S5IH 3SEPA 2ESVD 1EJ6A 3UXFA 4JY4B 4WU5B 4XNBA 1WCBB 4JJ5A 4BKLA 2EVGA 4Q7DA 1W0VB 2EYSB 1B2WH 5FYJL 4NO0A 2OX5A 4YDVA 2WXKA 2AF2A 1ZPUA 2HTLC 3FCTA 1FVEB 3ISWA 3RGVD 4AGPA 3K6OA 3AW5A 1H6TA 1R3HA 3WKNA 5F72S 2HT3C 1MCFA 1MZZA 3SO3C 4G8FB 1G0XA 4MZRA 4JK0D 4RMSA 2GJ6E 2NXZC 4EXPX 3CDZB 4A6YA 4NQVA 5DRNA 2X1OA 3AU1B 2EEDA 4O2FB 3M07A 1BGXH 4ODWA 3TURA 2GY5A 4YMPA 3MJGX 4QWWC 4JNXA 1JZ6A 5JHBA 2W9LA 2C4FU 4IBZA 2XKUA 3W82A 2BSED 2O5NA 1JWSA 4NZFA 5TQ2H 4X4YA 1UWXK 3S37L 4K0OA 2Y7QB 3VNZA 4KJYA 3OAWA 3L3GA 1I8KB 4AQEB 3ARXA 2HJFB 1MWOA 2WYHA 5IV2B 2IWGA 1J5HA 1IEHA 1JNHB 4UNIA 4HWEH 4ZODA 7CGTA 3CCHA 1A47A 1ZEAH 2X7LB 3H9HB 3BSZL 1KIRA 2FYYB 4Q9RH 3QYMA 5I6PA 1QSEE 1CDCA 3VWJD 1H9DA 1IUZA 1MFNA 4UINH 3S3PA 2WWKT 1T89C 1EMTL 3KJ6L 5FDWA 2ZWNA 2AHIA 2IBBA 3RIKA 5D7EA 3P4MB 1OT4A 5DJDA 3AQZA 5IMKB 1XR8A 2NY0B 3FB5A 4FGMA 5CNHA 5JW4N 4ZUSA 3ZL2A 4JZJA 1G7JB 2F74B 3NSYA 4KKPA 3F7KA 5C07B 4AEIL 4LKXA 3UH8A 2XN2A 1DLHB 1Q9OA 2XKNB 2B39A 1ZD6A 2IPKA 3FO0L 3WNJA 1TQBC 2FECI 5JUEL 1GR7A 5LWYL 1DBKL 5EU4B 1ACZA 2IH8A 2XWBB 3SKUD 2QKSA 3IFOB 2GAZB 3QI9A 1WGVA 1XF5B 3NK4A 4KH2A 4GO6B 2DDQH 3BLPX 2BCMA 2IEPA 1NKRA 3QJFA 1PS3A 4MAYA 4Z77B 3AROA 2V7HA 3CN0A 1BIHA 1DQJA 4AV0A 2Z7UA 4JG0L 1DZ0A 3TFKC 3ARDC 1I8LC 3P77A 2B3IA 2KUTA 4TQEH 1B4TA 1FZOB 5I1LB 1TJGH 4A2DA 1VPOL 2PUQT 1QATA 1S8DB 2ZPKH 2X09A 5MP6L 4RFNB 4PJXB 4YXLH 4F33A 2YBRA 4MJJA 2MMXA 3PHSA 4X6EA 3F7YB 1DEDA 2XN9B 2D3JA 1LILA 3NESA 4HHGA 1PPIA 1UOKA 4JO3H 4QNPF 1QACA 1P69B 2BJML 1HL9A 4OLUH 5HJGA 4B3EA 5HYQA 3ESPA 3H6JA 2CR6A 4Y5XC 4G8GE 3TU6A 1Y18B 3UGUA 1AD0B 3IWUA 5DD6B 1EEZB 2UY6A 3TZVC 3MLZL 1OTTC 1ZHNB 2LAGB 2XZQH 2YZ1A 3VXSA 5BRZE 4PPTA 1J0IA 1JNLL 3CZUB 3D6GA 3HZYA 2OCCB 1VENA 2Z34A 1CU4L 3FSAA 2BZ7A 4YHKH 2QVKA 2LTQB 3OKOA 4I1NB 3EFOB 4S0TD 5HVGB 3BXNA 2BCKB 4XNXL 2CDEA 1OAZL 2WWMD 4KY2A 2J88L 2WLZA 3ET9F 4OB5H 2H5UA 3NEXA 1KLFA 1T03L 3F6IA 2YD2A 4S0HA 4JFFD 4NWTH 2F08A 2R29H 1A66A 3RPIB 1DLFL 4ZQKA 3ZE1B 1CDYA 5C0BE 3WTXA 2FSEA 5D70L 1HHJA 3FXIC 2CXKA 1D3CA 2QT6A 4PJEE 5CM1A 5D2NB 4Z7VF 2FE0A 3VXUE 4DAGH 4NCC1 1LO0L 4KJWD 1E8WA 1A6PA 3FRUB 2L7EA 4XMWA 5KBNC 2A4EA 1IC0A 2OQJB 1NBQA 5DJXA 2OSWA 1RCYA 2EVFA 2GJ6A 2WBJC 1UOVA 8FABB 3VWKA 1XFPA 3UJJL 4HETA 3SDYH 2HH0H 4QHLA 3RKDD 3SCMC 5CEZH 1CFVH 4PI2A 1L7TL 1R46A 1SFDA 1IIKA 4KVNL 3SE4A 3RL1A 1DQLH 4PP1D 1HAUA 4YSPA 3OKLB 3U36A 4WF7A 4CNIB 3ZYZA 1Z3GH 2LABA 4KFZC 4NRYA 5T33L 3CFIC 1GHFL 2D2CC 2PPAA 3VU2A 2X87A 3PAZA 1CJYA 4APQB 1JGEA 1DN0A 1ZS8A 3F01A 5CIPB 4PVBA 1XH0A 4WCYH 3Q8AA 5DJ6B 4BFIA 1QSEA 2PW1A 4K7PX 4JJOA 1EVUA 4GAJL 3OPZH 3SKOB 1U4EA 3MLSL 1H15B 2P42B 5DFVD 4JPWL 2J57A 5CP7A 3WG7B 4IBLT 4YHIA 4X6CB 2BVOB 5FB8B 1U93A 5K59F 1QBML 3D08A 5C6WH 1ZHKA 3TNNA 1KC5H 4NKDA 4ODXB 2XG5B 5E9NA 5BQ7A 3HB3C 4JCMA 2CR3A 4AJYV 4LVEA 4N2GA 2P5WB 2OR9H 2H2SC 4FI6A 1T66C 1RZQA 2UXVA 3F58H 4FFYL 4JQIH 4J23A 2FR4A 4DGYH 3IRCA 1GYWA 3PUCA 4YDIH 1ZPLA 3SJVB 4XI5C 1RLBA 5D7IB 3PQYE 4UTBL 3QIWD 2GTZB 5KVDL 1JD9A 1AKJA 1BJMA 2CHZA 4UM8B 1EGJH 1UKSA 2VO8A 3BLKA 4CSPA 4EIUA 3LS5H 4Z0XB 4XWGH 4ILDA 3WE6A 3DMMC 4LVNB 2B9BA 1NUGA 4H4NA 4B3VA 4MXWL 4OZHE 4PCKA 5LGHH 4ZUWA 1G9NH 3WN5A 4PTTB 4IGBC 4Z7WF 2IOIA 3D69B 3TBWB 5KSBE 1YEFL 3VG9B 1SMAA 4BELD 3FQTB 5AB0A 3T4AC 3HPJA 2PABA 1GJUA 5GGVL 4OLWH 3VTAA 3GM8A 1NL0L 4K9EH 1TSHA 1IZKA 1P5UC 4WTWA 1AGDA 5L88L 1SOKA 4RGND 2BNQA 1BQUA 4JM4H 3ROLA 2VAAB 4IBSA 3U4BH 2HVJA 2AK4D 2UZYB 2W5PA 2LU3A 5ISZB 3U6RB 5I1KL 3WFBH 3L2LA 5GS1B 4TQ8A 3BQUD 3GJFA 2KC0A 1EZLA 4LSQL 4U6TA 4ZYKB 3ZHDA 2PO6D 4EKJA 4F9PC 2E9BA 2B16A 2KKQA 2QSCL 1F90L 3C6LD 1YEIH 4G8GA 4GFTB 1YPZF 2GTWA 4U05A 4MJHA 5LG6A 1S7WA 4GSDH 2FJFB 4XOBA 4KK9D 3LZLA 4I3SL 4JPVH 4LDOB 4ODTL 3MRCB 4KNQA 3P9LA 2BIHA 1J8HD 3DXAB 3LIZA 2W88A 5CINH 3VFMB 1NCBL 3L1GA 1UQSA 3PPSA 4Z3EA 5EIIB 2JFCA 4LPXA 4P3DB 3E7JA 4HHAB 2Z31A 1FUNA 4FLQA 5DLML 4XP9H 2HN7A 1KEML 4L4TD 2PCFA 5JHLL 3TA3C 2MEJB 4PUBH 3STBA 2YAEA 4JVWA 2NUTB 2GVYA 4EVNB 3RE0A 4X7TA 4YOKA 5HDBF 3TJPA 5A3ID 4G80A 4UDUB 4QTHB 4BBWA 3VM7A 1NINA 1KPRB 3EHBD 1F6LL 1TITA 5CJBA 4L8CB 5KVDE 2I07B 3RBGA 2R0KL 2F5AL 3SO5A 4IBTA 1RUAL 4PS4L 3MNVB 5C0BA 2VABB 4FADA 4YGVB 2YMTA 4JRWA 4PJEA 5I17B 4AG4H 3LRHA 3VXUA 3MXVH 1U95B 3CFKA 3BSGA 3THML 4CDGC 1ZVYA 3S5LG 2W92A 4I87A 2EUVA 1E2VA 1E4XH 2J44A 3FQUB 2HG0A 3O8XD 4P46B 4R5TA 4BHUA 5BNXD 5IJVA 5JOFA 2ATKB 2M26A 5A2JH 1DJWA 4PHZA 4A7QA 3SDDC 1NMCC 4YAQA 3OMZA 3IU3A 4XCYB 1MCBA 1KIUB 5C2BH 1N8OE 1HWHB 1T20A 4WEBH 5KG9B 2FD6H 1KYFA 2CAKA 1KTDA 2HLFC 4L3EB 5IQ7L 3P02A 1WICA 1T1XA 4NP4H 3HFMH 3TFBA 2C1OA 4DN4L 1M71B 4IMLB 3DJTA 2HRPH 2X1WL 2ZX9A 3OKYA 5E9DB 2HFFB 4KDTA 3LKRA 4QHKI 4TTDD 4UQDA 5DURB 2R23B 5HGAA 2XRAL 5DHYB 3OGCA 3MX0A 1TFHA 1WD9A 1NUDA 1F4WL 2PTTA 4I13B 4WHTA 4PJ8C 1FIGH 1XD1A 2QHRH 1BZOA 3NVQA 3A4FA 3MBEB 5INDB 4Y16B 4A2LA 4G3YH 2VIRB 4R7NA 2P80A 2X4PB 1LTXA 1YY8B 1BWMA 3BCDA 5IB3B 1NCOA 3GXPA 4PTUA 3TBYB 2R8SH 3UZQB 3X12B 3MI6A 5F97E 3L5WB 3S3JA 1BVZA 1M7DB 2DQCL 2D0FA 4XCCL 1U2HA 2IC2A 1EEQA 3EGDB 5KVEH 1JHKL 1YNTA 3PQYA 1KIPB 1XZ0B 3KXFB 3CX5K 5AENA 1QR4A 1WO2A 4BH7A 2ZSWA 4OZHA 5C0CE 4RFEA 4YSEA 1BYOA 5JLZA 2XX1A 3RNKB 5DD0L 4JRYB 3VQ1C 4XX5A 2WAQA 3N0PB 32C2A 3WEXA 3T5WA 1P5VA 3IFNL 5KJRL 1T2QH 5FGCB 2L4OA 1FLTX 3BZEA 1S3KL 2ZYRA 5DGRA 2CK2A 4ZMXA 1PJWA 3MRNB 3P4NA 5F88B 4AITA 3QJHA 2BRRL 5CLWA 5DHMC 2JIXB 4AQ1B 3KG5A 2KI6A 3EGXB 4FDWA 4OFYD 25C8H 4ZMVA 1ZGLB 4P3CL 1OAQH 2WPGA 2W9EL 5CBEB 2MOQA 3DPDA 2WVSA 3PE9A 5DR5H 5CCJA 3MBXL 3T3MF 1TF4A 4Y5XA 3V6FA 3UC0H 5AVTB 1G6RA 3VXRB 3TZVA 1N64L 2DM4A 3BGFC 3JUZA 3X1FA 4JFFE 1OAKL 4AYMC 1IFHH 5GRVK 1WISA 1XHHA 2ZXWB 1CD1A 1A0QH 2ZXCA 3QZWA 5EZLA 5B39G 3ZKNC 1ZLVK 3MOAH 4MJ5B 1BBJB 1HH6A 1Z32X 3QHFH 5C08D 1WAAE 4PJDE 4H20L 1CXKA 1K8DB 1QD0A 1ZJAA 4Z7OE 3FQWB 2B7DT 3TNMA 3RVVD 3RVTC 4LCIH 4W9EC 3GQFA 1F4YL 2APSA 3RB5A 3WIHH 5EA0H 4JVPA 2J8OA 1F8TL 4HBCL 3CZNA 1WH0A 3BP7A 1MJ8H 4ZMZA 1BQSA 4BFJA 3BPNC 4KXZH 4NM4H 5JHAA 1XGZA 3CN4A 4GSXA 5DUBB 2VERN 2X42A 2ZSVB 4XR8C 4YL4A 5KBMA 3OWEA 4Y1AE 3TXAA 3ZDXE 1OWRM 1YRKA 1S9WB 3KW8A 4L4JA 4P48A 1JPTH 3B7YA 4PWKA 4HMEA 4BWTA 3HE6D 2F53D 1J05B 4FFVD 4QOKB 1WC7A 5MI0B 4DP4X 2AITA 3UP6A 2N3JA 3NFSH 4PCTA 1KB5L 2HT4C 4RMVA 4P2QB 1DUZB 3U9PH 3ARFD 4XC3L 2A1WH 4UDTB 2Q6WB 3HZMA 5IKCB 1UATA 1T0MA 1YEJL 1EV2E 2Y07L 4LO9A 3FUKA 5MEQA 4HG4J 2MTAA 1OAUL 2G4EA 5KVGL 2V3DA 4YSSA 2VXTH 4ONGH 2PWGA 5D55A 3G5YB 2CJUH 3C87A 1WBYA 4HMCA 4B7IA 4YZFF 2YFNA 3FT2A 1MY5A 4LL4A 1KTBA 1NOLA 1L6PA 4HLJA 1T3FB 4X6DF 2BY3A 1N5YH 2QVIA 2RH0A 3K4AA 4U7MA 4NNXA 2FWLB 5KSAB 1AFVH 1NLDL 3EJYC 3I3EA 2DBJA 4OZGF 2I69A 3GRWA 1V55B 5D96C 5DA0B 1O6SA 4DCQA 5T3ZD 2P48B 4FQLL 2XG4B 5KYYA 1IAIM 3QUZB 4GG6B 2HMID 4B97A 2AC0A 5F7EL 3VE0B 5C0IB 4WW2C 2ZUTA 1KJMB 1ZT7B 3WFZA 3GS7A 4JUSA 3K6SA 1MAMH 3FQ1A 4AL8C 3EH1A 4TVPL 2GJRA 3IXTA 3JTSB 4KMLB 4ALAC 3DUUA 1GGBL 1EDQA 3AY4C 1NMAH 1SNRA 2O6DA 3GXNA 3W39A 3OAUH 3OL2A 3KL5A 3CXDL 3K0YA 3O4OB 4MA1C 1EHNA 5AB1A 3B6SB 1XIWC 2DMCA 1FFTB 4PJ9B 5DJ2A 4HUVA 5I76B 4EDWH 3GGWA 3JV4B 1VGKB 4NJ9L 4NPYB 4B9FA 5JXED 2Z92A 3DMMA 1MCQA 4JM2C 1N6UA 5IHUH 4NLAA 3G6AB 1VEPA 3L4YA 1XSIA 2Z8SA 4JPSA 4XWOC 5C0CA 3KL0A 5F8QC 1DSWA 4MJID 1ORSA 2FRGP 3NIFB 1WZLA 3BE1H 2W07A 3L45A 2OJ1A 2V9QA 3ARGC 4AM0B 5DZJA 3ES6A 3MPCA 3DJRA 3S8GB 2A3TA 4DSYA 5CP3H 4UQ3A 3DDGA 3L48A 2K6ZA 3BD4A 4LU5L 5F3FA 4YBLB 4MJ4A 1H3PH 1AHWB 1A4AA 3T08A 4N68A 3VO0A 2WLMA 3DX2A 4IRZL 4H8WC 4KVCH 3RTQD 4F9PA 1IJ9A 3IXAB 3L4XA 3ZQ9A 3IGAB 1T83C 5EDXA 3ZDZF 5JOPD 1U8QB 1ND0B 4WHYH 2F5BH 1OCRB 1ZVSA 1CFSA 3N55A 1XGRA 3WJMA 5ABDE 1SUJA 3WSQL 1XBDA 4GKSB 3G08B 3QWRA 4WV1B 4ZAKD 5LBSL 3NCFB 5FCUL 3MLXL 4PGZA 1A6AA 1CFQB 1CGVA 2R7EB 2XZZA 4OGAD 4G1EB 3QC5X 2CJTA 5E2VH 3QRFM 3QXAB 1X5FA 2XZAH 3IBEA 2WCSA 1I1YB 3L9EA 1R17A 3Q5OA 4KNUA 5HTSA 3LHAA 3UAJD 1WAAA 4PJDA 4IBUA 4MQXC 5CMAA 4AJ0A 3CZGA 4YE0A 2A9NL 5C0RL 4ALAL 1MPAH 4JZNA 1LE9A 1XF4B 5L9DL 4ABQA 1TCRA 5BO0D 1BJ8A 2EEBA 2ZCZA 4O58H 2ICES 4Z95L 4M7LL 5JIDA 3KYKL 3IPBA 4CUCA 5EF0A 5E1AA 5HYSA 4X5XA 5GSRB 4NXSA 1U8OB 5F1IB 1P53A 3FU0A 1D6EB 5C6PB 1YEHH 3LRSB 2DQHL 5HHQA 4BFFA 5IEHB 5CJ8A 5TQ0L 4ICWA 4DQAA 4Y1AA 3Q6GL 4JFDA 2JQMA 3C5ZB 3C8KA 5J0BA 4OIIL 2YUZA 3VFPB 1YEEH 3VFVB 1IBZA 4L4VD 2ZKHL 4BFGA 4QRTB 3UJIL 4OM0H 1PW3A 5C09D 1QTSA 3CH1A 2M8XA 2WANA 2CZNA 2MNUA 3SDDA 1YQVL 1N6VA 4LHUG 4F20A 4Y9CA 5C0JB 1IGCH 4P9HH 5J8OA 5K9KA 4D0DB 2NY2B 4KO5A 2PYEE 4AIZA 5DF0A 4E0RB 4XN7A 3GBMH 3O3EA 4HU8A 4H8WL 1TMCB 4N2HA 1XCQA 2QL1A 2OMXB 1B6DA 3PGFL 4LCYA 4MAUH 1D5XB 3BKCL 3D18A 4IRSB 2J56A 2NW2B 3E9TA 1AQMA 1MI5D 3D0VB 1QFOA 2MRYA 4JHBA 5GS0C 1MFEL 4HUNB 5I16A 2A6DB 4PFEA 3UYPB 3ZTCC 2EICA 1MWAL 3FUMA 1ANUA 1L9RA 5HVFB 3SQBA 2DQUL 3NJVA 4DUWA 4ZX4A 3HC3H 5D1ZC 2CO6A 4OCYL 4OU3A 4UTAH 5KBDA 4OLVH 3F83A 2WLLB 2HTKD 2ZX5A 2I24N 4X7EC 5ERWA 2XJLA 4HFWB 2QEJA 1PX4A 1LO3H 4YS4A 1TTFA 2J71A 4Z7WB 1QUNB 1X4XA 1NCWH 1W8NA 1YY9C 2J8HA 1PLGH 4ODSH 1CGYA 3KR3L 1CT8A 5KSUA 5BS0B 2D31B 1Z1WA 2JKXA 1F5WA 4B95C 4FMFA 1UEYA 3S6CA 3WHE0 3WNPA 1XH3A 3BD3A 4XXDA 3TEXA 4N2LA 5CILL 3ULUE 4MXQC 3FC8A 2I7OA 3FN0L 3PABA 4HJJL 2Q7YB 3E1F1 3HE7C 2PXYD 1F42A 2I7SA 2J2ZA 4X80H 3EG9B 2QGCA 2EYTB 4GQPH 2UX7A 1Q72L 2WBWB 5C7XL 2H6OA 3SE3A 5FOBA 4HP5A 1OF2B 2VRQA 3CFEB 5I6LA 2WO3B 3CC5A 3D51A 2GBTA 2XFGB 1CTMA 3HAEB 4HIQA 4UNTA 1HWWA 1UB5A 2X6VA 4A2MA 4IBQA 3AGVA 1G7LB 3SY6A 1YPZB 2EXWC 2CALA 1MHCA 3TBCA 3QCVH 3DI3B 3EH2A 5DDHA 3UABA 4CSSA 4MGXA 1KB5A 1R19A 4K4KA 3BDYL 3H4FA 4AJVA 3QXUA 4MNHB 5D1QD 3A4AA 3R8BB 1F6AB 1KNOA 3MA9H 4Z3IA 2KH2B 1QTPA 4M4RB 3NFPA 4I77H 4ERSL 5CN2A 3LD8C 5IQ9A 3VFTB 3VA2C 1JYVA 1Z9OA 5E8PB 3DYOA 4GIPD 4TNWF 4TNVK 4Z7NB 1NC4D 3I6GB 3NCCB 3QJXA 1FPTH 4U6VL 4AKQA 3IFPB 5LCVL 5BVJA 5DJ8A 3HAEH 4N6RB 4G7SB 4QPEA 4WWKB 3P0GB 5IW3A 3F12A 1X7QA 1AR1D 1PZ3A 2K0RA 4FFWD 4PRPB 5I0YA 1HVXA 3GSNL 2YLKA 4H8HA 1NMBH 3VXNB 5C97A 5EBWB 3KZ8A 3SN6N 3RL2A 2CKBH 4XODA 3X11B 1SDAB 4LF3A 2LOEA 3TCLB 2NQCA 3E1ZA 4MDIB 1KY6A 2BW5A 1AGCA 1MHEA 3LKOB 3M1OA 5DWUL 1NIEA 2PPCA 1ZJBA 3GUTB 3O3DB 3SQRA 3QB7C 3GFUA 1N6QH 2CGRL 3LXBA 1DJZA 4HPOL 3N0AA 2BVPB 2QQNL 4G9FB 4EI6A 3WXVH 4K71C 3ZX1A 1W80A 4KKCD 3MRMB 1MRCL 2CMRH 4HKJB 3QJVB 4X0KB 4A7TA 3LHPH 4HS8H 5ICUA 1NA8A 3H1ZA 4TSBL 2NZ9D 1FO0A 4UZSA 3SYAA 1OGSA 2H6UA 2NY1B 1YJDH 4E9LA 2O5XH 2TAAA 3R1GH 1AC6A 4QRRD 2PW2A 5J1AB 4XTRD 4B9JA 5FF6A 2ARJB 3TBBA 3KYAA 3T65B 3D5OF 5JPMA 4XN5A 1RZGA 3DX3A 2A0LC 1CF8L 5LDSA 3DV4B 4M1CD 5HI3D 2F54D 2EH7H 2BH0A 4FTDA 4DHLA 4OSUH 1DO5A 2HYMA 4NDMA 3O2DH 2GHZA 5J13C 5T3ZE 3CSGA 5ACZB 3D3VB 5GZOC 1VFAB 3JTTA 2PYEA 4WTZA 2NY5C 3GMPA 1YEKH 1NBCA 1FE8L 1OARL 4RFOH 2OP4H 4M4PA 4IOIA 1N67A 4IRZA 1WTLA 4JY5H 2R0LH 4DKTA 4O9HH 4XMLH 3KLHD 1REIA 3OX8A 5JIHA 4XNQB 5T3XD 2QTEA 4Y9GA 1U3HC 3PP3K 2XDHA 3DARA 1S7TA 2H1PH 1VLXA 3OLGA 4JFED 5EIQA 5AEAA 3FO2A 4NHUA 3WY2A 4LHQB 3DWTA 4X9GA 1GGIH 1NSNL 3CXHK 4AMKL 5JW3L 4XN4A 1ZANH 4LBEA 1MFBL 5IJKC 1WA1X 5JIMA 1SUHA 3UTZB 1I7TA 3MLUL 5TFSH 2XYCA 4WW2A 1JS4A 4JG5A 4LNVA 1W8EA 1MIML 1I31A 3ULSA 3AABA 5E6IB 3WJLA 4KUZH 1NCGA 2YAPA 2RCSL 2P5ED 1TNNA 4MJIE 2Q86B 4XO8A 2F7OA 2H3KA 4GRLD 1NCTA 1W0WA 3P0YH 4HUWA 4L9DA 1FNGA 1OPGH 4X8JA 4XP4L 5FA4A 3GLEA 3W9DA 3DROA 3VSUA 4N5UA 2EDKA 2AW2A 1BMWA 5DHVA 4PD4J 3UO8B 4FF9A 2B08A 2FHBA 4DESA 1QLEB 3CUPB 1T6WA 2VDPL 4LVHB 4PJFB 4BFOA 1JK8B 1NAMH 4OFYA 1H0DB 2VDKL 4U1LB 3H2QA 1G9EA 4WHCA 1QPXA 4QT5A 1E9OA 4DP1X 1AZRA 3VSTA 4ZPVB 2F18A 3P0VH 2VR5A 3ARGA 4LSDA 3RTLA 1I3UA 4BFBD 5D71L 4LEOB 5CHNB 2A6JA 1TKWA 3N85L 4KROB 2ZWSA 2GCYB 2NY5L 1FFRA 3DX7A 2A6IA 2AV1B 3KDMB 3AT9A 3R06A 4HEPA 3Q06A 3CFUA 1F1AA 5E1HB 4X5PA 2BSTB 3MJ6A 2GBAA 5FS5A 4LLMB 3M1BA 4PJ5B 2WBKA 2NX5B 3WMSA 1LDPH 3HR5B 5GISL 1LWRA 5GZND 2PMZA 1Q0YH 2RFXB 3O3AB 4EI0A 4Z23A 1MWAA 3NIGF 4N20A 3IPEA 4FQ2H 3VRLF 2BO0A 1IKFL 3RIFK 4E41B 2N1TE 1LO2H 2F7PA 2W65A 1EAQA 5JR1L 1KJ2L 5BVPH 1N2RB 3IN0A 3PNWB 4PMEA 3C60A 3CHXA 3BWUC 3O81A 5IBTH 2BNUA 4L4VE 1SGKA 4EXKA 4EE2A 4OGZA 3RJQB 1LDSA 5BJTA 4HIIB 4FFZH 3I6KA 4N2OA 1QYGH 4R4NC 3MV8A 2YSSA 4JVUA 5CCHE 2Z35A 5D2LE 4PP2B 1OB1A 2XQ0A 2VH5H 1Z9MA 4MD0B 3AS1A 2J5LB 2XQYK 4HGMA 3GMNA 3ULAB 2V5TA 1MREL 1BFTA 4X6DB 4G7VL 2VLLA 1ZLUH 1IL1B 1ZV5A 3S9DB 1AANA 1YSOA 3OTTA 2BSBA 4R3SA 1DQQA 4O02B 1MI5E 4YO0A 4L1HA 2HFEA 2UXTA 3KPSB 1S5IL 4BQBA 1LGVA 1QWNA 3L4VA 1A2YB 5JW5A 1TQCC 4UQAA 2AJVL 1ZE3C 3NCJL 1B2WL 4JFXB 2XPGA 3LB6C 3MCYA 3S97C 3WL9A 2DYSB 4UQ9A 3A22A 4MWFB 1M7IB 3GMRA 1C16B 3CFMA 3RWHB 4NAQA 3CBKB 3ARQA 5GIRA 1BVKB 3MXWH 4X83A 1JNJA 4XBGB 4P5TA 2OTUA 1M9WA 3F5WB 3ZHLA 3D33A 4KTYA 2WLJA 3D85D 5T1JA 5LCVA 1VJSA 1FLRH 4XO9A 3MV9B 2GITB 3L7EB 2Q3AA 1ZA3A 2E76C 3L4UA 4JKPH 5E5LA 3BZFA 3PHOB 2NY0C 4YEEA 4YXKH 3GSNA 3VRJA 4U2YA 4CVZB 2WQWA 3JVGC 3NJLA 1BGXL 3NSCA 5DJCB 5CEYB 4HJ0D 3BVDB 2MNJB 3HKZA 4XCEB 2NNRA 1ETB1 4E9QA 4N1EA 5E1IA 3GSOB 5TQ2L 5E1GA 1V7MH 1PJ9A 1BFSA 5LKNA 1EERB 5I1JL 3TIDA 1X5JA 4AYGA 3GLZA 3OJVC 1UZGA 2FL5A 3S36X 4E36A 1PKQE 2MKLC 1ZEAL 1F1GA 4ZUUA 5I8CA 4B9CA 3Q48A 4H0LC 4U33A 4HWZB 2WZAA 3NA4A 4QHUB 3EJJX 1RJYB 5D1QE 2VDNL 4N1CA 1HIMH 2PPDA 5E23A 4A68A 5BMFH 4PW4A 4GPVA 4XB8A 3QXDB 3X3GH 3BVVA 1I7RB 3QUYB 1NFKA 3F6JA 2VMCA 3IJ9A 4TS6A 3CN3A 1BQHA 3WLBA 3ULVH 4NERA 3ILDA 4BJLA 4I89A 3K8LA 1ZV9A 4L3AA 4GP8B 2KDGA 4J8RA 4KI5D 4OZIA 2R0WH 3KLKA 4W9HC 4D9RE 1O6TA 5C9KA 1FSKC 4Y5YC 2UUDH 3B7TA 3ARTA 4FNPA 1IQWH 1I75A 2WCGA 3W56A 1DDTA 5GGQL 3ESUF 3DUHA 4JPIA 3ZO9A 1G4RA 4U3SA 1ES0A 3B2XA 1A1NA 1GSMA 3LXUX 5LXGH 2Q8AH 2VGLM 5DD1H 2QMKA 4M6ML 1TZIA 5AW1B 3BGMA 1TU2A 2QSVA 4HGWB 1F4XL 2AV7A 2DDQL 4YL9A 5ACMA 5K5YA 2V2TB 1J1OH 2XVGA 4NFBA 2OL3A 1BXVA 1BMZA 1WJ3A 1KCWA 3ELQA 2NNCA 3HFFA 2AEPH 2YPLB 4PWHA 4YHNB 1CMOA 5ISZD 2ED8A 4RA3A 2O6FA 3HBQA 1RK0B 3KLDA 4JDTH 4FC3E 4TQEL 5JZ7C 4Q4EA 1TJGL 2LTQC 4E42A 4WENB 2R39A 5GQBA 5FO2A 3BH9A 5I71B 3QNFA 4YXLL 3LPFA 4C55A 5KW9H 1S4IA 3TO4A 5EO9B 1R5IB 2Q2EB 4QRRE 3CLEH 3W11C 2NLJB 2Z1KA 4HS6B 1JK9A 3CZLA 2JCCA 4ZFGH 4NQSB 1RHFA 4BGLA 3OJMB 4H5SB 3RI5K 4NC2B 4P2OC 4G6JH 4OLUL 1BSIA 3QEGH 4M5ZH 5SX5H 3QHTC 2JMRA 1M1XB 3MNZB 1XXDC 5I23A 2VRKA 2IQ9H 4M5TA 4PY8I 2Z3FA 4OKVA 2F1EA 5LQBL 5H37G 4FYTA 1Z5LB 3NJKA 5G4OA 5E8NA 4AYID 1GVIA 2CLRB 3E6HB 3RUGB 2UZXA 1DJIA 2WYTA 1ZLSH 5HHOA 3B9VA 4Z7UB 3JZ7A 1DVYA 2IALB 5IB2A 1KYOJ 3FPXA 4EEEA 2XETA 2NY3D 3V0HA 4I5BA 3MREB 2VOTA 5DXWA 1I1AB 2V3EA 4L37B 5I6KA 1AZBA 3MYJB 4OB5L 3VFUB 3U30B 4KPHH 4RQQA 3GS0A 2Y1ZA 4IRJC 4NWTL 5GZOA 1RZFH 2R29L 4K15A 3V0VA 4DZ8B 2YQGA 5I75C 1SDDB 4P46D 4Y4FD 1JHTA 2H4EA 4APQC 2PWDA 5SV4A 5DSCB 3PJSB 3OR6B 1QLFB 1MHHB 1H3XA 4F15B 4TULH 3V7AE 3REWA 3L3DB 4DAGL 4RVBA 3MRKB 2B0SH 5F1SA 4DO5A 4ZMAT 2NYYD 3G7TA 1BBDH 2EDOA 1G9NC 1U3HA 1VFUA 1CE6A 1XGQB 1SN5A 4NN7B 1LEIA 3IDJA 5AOZA 4ZNCD 4GBXC 1PFOA 5G5DA 4AGOA 1E4JA 3QEQB 1EFQA 2YN3A 1OLLA 4W9CC 3SDYL 1M3IA 4FNQA 4HBQA 2HH0L 3GKWH 4K9EC 2RHEA 1GGTA 2AXGA 1KTLB 1CFVL 2WIIA 3I9IA 1DQLL 2B1HH 5C07E 4QXVA 5BZXA 4AXWA 2EYRB 1DVFD 1Z3GL 4KV5E 2IGFL 4B9PA 4NM8H 1DQML 3V9CA 4Q9QL 2IQAA 5CN1A 4R2GD 3KVPA 2QDWA 1PKQA 1SZNA 3FFCB 3OQ3B 1XO8A 5EO0B 1NLBH 1ZWIB 1UM4H 2HWZH 3NDYE 4WCYL 1YO4A 1F3JA 4PRNA 3QIBA 2WSDA 2BVQB 3LZNA 4PHXA 5C3IA 3M7OA 5DEZA 5BXFA 5CCGE 3VXPB 5DS8B 4XB7A 1FVCB 4U6YB 3EF7A 1ZGLM 4M93C 3IDNB 1KC5L 2AQNA 4GH7B 1KCSH 3ME0B 2JF1A 1H3TA 5E4AA 2X88A 4FP8H 1UT1A 4WUUD 1N9PA 5HVWA 3NCXA 4ANXA 2E6PA 1AMYA 2OR9L 3S3SA 4LPWA 3T0XA 4JQIL 3H0TA 2XN9E 3CZFB 4DGYL 4D94A 4ONHB 4OI8A 3B1TA 4YDIL 4JRYD 3KAAA 2WJ5A 3QQDB 3HUJE 4P05A 1G7MB 2R2HB 3OLDA 2WXGA 5GGVY 2VZVA 1EGJL 3S4SG 2OFQA 2DWDA 3PY9A 4Z7QF 4F7CA 2XWRA 3IBOA 3Q8BA 4XWGL 3U1SH 5ESVB 3GEFA 5HGHB 3I74A 4G1MA 1XD0A 2FQDA 4JKWA 3MU3A 4OV5B 5LGHL 1TJIH 1G9NL 1P7QA 3B2MA 2EE9A 5F9AC 1D5MA 3HW7A 5DVKA 1KB9K 4CMHC 5MERB 4Q9CA 4ZZFA 4JB9H 5IF0B 5DRXB 1L9SA 4OLWL 5JIIA 4LCCB 3CG8A 1CGUA 4K9EL 2OMZA 5IFAL 5D7JB 3VH8G 2EC8A 5EC2A 2JCWA 3BEVA 5CEZE 2WB7A 4JM4L 4QCIA 3U4BL 2OK0H 5E03A 9PCYA 4JY4A 3ZTNH 4WU5A 2K3HA 2OZNA 4OLZH 1WCBA 3UADA 1I9RH 3QR0A 3WFBL 1W0VA 2EYSA 4NFCA 1EAPB 1UEMA 2OSXA 2YZ8A 2I25N 3ZE1E 5AYTA 1FVEA 5I24A 5DK3A 5D2NE 3ZDYF 5DZPA 4LPTA 3VFWB 1DCEA 4DFIA 2GJZB 4JO1H 5E5RB 1A14L 2NXYC 3CWGA 2DQTH 3QUHA 4JPVL 3INUH 3T0ED 3UBXG 1QFWH 4G8FA 3WLWD 1EQWA 4MNQA 4JHAH 5CINL 1E8XA 1NANH 3CDZA 4FXGB 4YFLF 3OHMB 1SJVA 3AU1A 4ANWA 4O2FA 3V9EA 3I9GH 1IAII 5EWIH 5DO2D 2A4ZA 4LAQH 1A22B 3EJZC 2WQ8A 4QXGL 3M7FB 3EJSA 1VFBB 2CHXA 3KE0A 4M5YH 2Y7QA 3E6FB 1V3LA 3AZUA 4YQXH 1I8KA 2HJFA 5IV2A 1GTNA 4ZBJA 2IGLA 1JNHA 3RGVC 3SYPA 2NZIA 2X1XR 2X7LA 3H9HA 1FC2D 2FYYA 5F70A 4OJEH 1MQKL 1ACCA 3ABKB 5CZVH 3PUUA 3QS3A 5LAXB 3VD2A 4FKKA 4X6CE 1TO5A 2DQDH 3P4MA 3HPLB 5CF3A 4E5XG 5ENWB 2TSAA 5IMKA 1KGCD 3ZLQC 3W0WD 2E8YA 1U9KA 1E8ZA 3UTSB 1HZHH 4B7LA 3LKQB 2P5WE 1NFDB 5CSGA 4UU9B 1G7JA 2F74A 2WB1A 3QJZA 5EMYA 2YA2A 1YDPB 3C8DA 5C07A 1FFPB 5C2BL 1J88A 4WEBL 3LKPB 1DLHA 2XKNA 3QQ9D 3SJVE 4K3HA 3POHA 1P7HL 4RX4A 5C0ND 5HJ3B 4IHOB 5KYWA 4NP4L 3HFML 4HSCX 4MVBD 4GRWB 4KI5E 1H3GA 3ZHFA 1SM3L 2XWBA 4PGDB 4HMDA 4TQPA 2HRPL 5GHWH 3S2CA 3IFOA 2GAZA 5IP4A 1XF5A 4ETQA 3VFOB 1AJ7L 1KXVC 1WBXB 4Z77A 1P7BA 2KZ1B 4ZI8A 5KOMC 3WKYA 1Q8MA 3EYFB 1FIGL 1DO6A 4PJHE 2DQIH 4EAEA 3KL3A 4YR6B 4F3FB 5AW5B 5EO1B 5L2KD 1FZOA 2DB8A 4DN3L 5I1LA 1UKTA 4S1QH 1S8DA 3OVUB 1QWUA 4LLDB 1NCNA 2EE3A 2OKMA 5F3HB 3K81A 4PJXA 1RPKA 4Y5YA 4BFKA 4F7EB 4NPKA 5HYEA 3F7YA 1BEXA 2NYZA 5ISZE 2XN9A 3E8UH 5KVEL 2VT0A 4OFIA 4OVUA 5JTWA 2ZCKH 4GRWH 3G5WA 5KZCB 2R29A 3RWJB 1Q9WB 1IT9L 1E5BA 1HE8A 4WY7H 1FCGA 2GUOB 1AD0A 3S37X 5DD6A 1EEZA 1I9EA 2WKOF 4WO0A 1I1RA 1CL7L 1ZHNA 2FH6A 1OCCB 4O51B 4A04A 3DXAE 1CBJA 3EKCA 4JO4H 1T2QL 1S7QB 4KHXH 4G6KH 4N2FA 3ZN6A 1ZLEA 4QAMB 3FTXA 4IOFC 3TN0D 3EFOA 4A7UA 5D4IA 1MRDL 2BCKA 2F8OA 3AMKA 4CRPA 2D7MA 3L2MA 3H3PH 1AE6H 1KUMA 3GXIA 5D7LB 1OAQL 3SPGA 4M7JH 1JGDB 2CGZA 4S11A 2WUCH 1HHHB 3RPIA 1PZSA 4R8WH 5DR5L 3L1EA 1CK0H 3MOBH 1CICD 2MJWA 5J4MA 4R6UA 5D2NA 5DC4B 4FABH 1G7PB 1J9RA 5DMJB 4HISA 4CMMB 4YLBA 3JV6B 1OQOA 3ZKQD 1IFHL 3MRIB 2KBGA 3FRUA 2OQJA 4WFHD 1MFAL 2ENYA 5GGUA 3VGBA 3QHFL 3FQ2A 5EEWA 3U7AA 1O9VA 3WFDH 3SPIA 2D8KA 4LCIL 2XLLA 1D5IH 2WWMC 5FEBA 4G6FB 4ONFH 5EA0L 3WIHL 1P4IH 2FUQA 4KDWA 3OKLA 4GSUA 4Z0BL 4FNSA 3DV6B 2R83A 4CNIA 4JQIA 1XF1A 4L3EE 5T5NG 1KTRL 1MJ8L 4FJZA 1LQBC 5C7ZA 4NM4L 3LNIA 4Q6YA 5FW6A 3Q05A 3CFCH 4HUCA 4HZLA 4JPKH 4APQA 1FGNH 3IDMB 2JKSA 3QDMD 5CIPA 5KSAC 2IAND 1NICA 5E9DE 4GQRA 4E9YA 5DJ6A 1T5KA 1OKEA 1TEYA 4D8PB 4GKOA 4GO8A 1V05A 1GCYA 4C59B 3SKOA 1H15A 1JXJA 2Z8VC 2HFTA 4LASL 3NFSL 4X6CA 2BVOA 5FB8A 1ZLWK 5EULV 3L2NA 3U9PL 3ASOB 2A1WL 5J3HC 1U8CB 4F24A 4ODXA 2XG5A 1MFCH 3QHZH 3ZYJA 3MJWA 3RKDC 3QWQB 1P9MA 4PP1C 4L3FA 2VXTL 2P5WA 3WJJA 4PJAF 4ONGL 2WP3O 3J07A 2CJUL 2FX7H 3LEYH 3AQYA 1DSYA 1OP4A 5FLUA 3SJVA 5J1TC 5D7IA 1J1PH 3O4OC 5FYKH 3K7UA 1Q38A 2FO8A 2GTZA 3CSYB 3KXFE 4LP8A 3HEIB 4UM8A 4WUUE 1RK1A 4U7KA 4XPAL 1YQ2A 3OB0H 3VTTA 3CSPA 4JN2B 1ACYH 3GXUB 3PHAA 5C0AB 1AFVL 4BV1A 3GRBA 4DIXA 4RSVA 4AEEA 1OVZA 4X5LA 3T3PF 4JRYE 5DFVC 3TX4A 4PTTA 3D69A 4AYDC 1A1OB 3TBWA 1A6VH 3FQTA 3PL6D 5J12B 3RKPA 4K73A 2DD8H 3V5HB 3G6JE 4AQ8C 5L4MA 3GHBH 2XBDA 4KKQA 1MAML 1JMZA 5CSBA 4WI5A 1HEJC 2R9HD 2EILB 2VAAA 1K8IB 2GSGB 2YPVH 4Q6KA 1NMAL 4YBLC 5MENB 1PNCA 2UZYA 1YUHB 3OAUL 5JYLA 5FECB 2GEQA 3U6RA 2DZEA 5GS1A 1OCOB 2JI2A 4ZYKA 1NCDH 4QTIH 2WZ6A 3QZLA 4H2CA 1S9XB 5EEVA 1EHKB 3UERA 2IAMD 3FTYA 4AZUA 2OSLB 4XMKH 3W1ZA 1KG0B 1PZUB 1ITCA 1L3WA 4Y19B 3VXRE 3FQ4A 2GIXA 3MRBB 5IHUL 3QUXD 4NPJA 3PXLA 2FJFA 2BFVH 1NBZB 2AAAA 4WV1C 3DOHA 1PX3A 3MRCA 1J8RA 1QFPA 3DXAA 1C5DB 2AXHA 1GYUA 2G2PA 2GC4C 3VFMA 3MCKB 4Q52A 3SKMB 1CQYA 1KCLA 5EIIA 2X4QB 4WJKB 4P3DA 3FAWA 2LLGA 3BE1L 1G9MH 4HHAA 5JW4R 5I5MA 3LSOB 2C5DC 1IM9D 2J8UF 4P5KB 2DLGA 2O1AA 4ORGB 3AQDA 1F18A 3BO8A 1T7VA 4RGNC 4N2KA 4YHZH 1G5AA 3SDAB 2UXGA 3I6LD 3FRPG 5CJQH 1I85C 4GI6A 3DTXB 1ICTA 1YMMD 2NUTA 5AFAA 1UUSA 1H3PL 3WAKA 4UDUA 4QTHA 4L9LC 3CHOA 2PO6C 4KVCL 1KPRA 5F9WC 5F7YC 4ETYA 1GZQB 4L8CA 2ICEB 2I07A 3C6LC 3GI8H 4JAMB 4Y5VB 2F5BL 2VABA 3KEHA 2V5MA 4YGVA 3O4LD 3CZSA 5FHAH 1MJUH 3MJ8B 5I17A 2BWIA 3C5ZC 1SYVB 2WSPA 3QORD 4XVTL 1U3YA 5KUMA 1E90A 4QOKE 1HOEA 1WUZA 3I75A 5FCSH 4TNVF 3FQUA 4P2QE 4Y7MA 1UJTA 2XZAL 3QQ3B 4M56A 3T1WA 4N5ED 4TUUA 3K72B 5D9SB 2WJ7A 1HZKA 1MPAL 3AITA 3OD3A 4XCYA 2HFGL 2FHCA 5A3IC 1KIUA 2EE0A 5CLYA 1SHWA 2AMUA 5KG9A 2H1LM 5DGQA 5EV7A 3ARED 1HJBC 4D9LH 1NGQL 1KGCE 2CDGB 4HCRA 4L3EA 5EUOB 3W0WE 5IWLC 4JMNA 4UT7H 3SOBH 1M71A 4IMLA 3RZCB 1HYRC 1JGUH 4TLUA 3D39B 5CXPA 4OY9A 5E9DA 2HFFA 3WFEH 2R23A 4JL2A 3D3VD 3CHSA 1YEEL 3IGFA 4W9DC 5DHYA 4ZFOL 4JG1L 5GRZA 3FTVA 2G75B 3QS2A 4TSAL 4G82A 1A9EB 1EAOA 1PL3A 4F8TA 3O8XC 5I1EL 4GG6E 4OM0L 5HHMB 5KYNA 3IPFA 5GS2H 4P4KD 4EQ2A 3P3YA 2CG9X 3TBVB 4IBWA 1OCWH 2Q20A 5AYQA 1ZSHA 5INDA 3MBEA 4Y16A 1TR7A 5HI5D 1F58H 2VIRA 4N8CH 2Y25A 4F58H 1IGCL 2X4PA 1YY8A 1R3KB 1U3JA 2ADGB 3TBYA 3MBWB 2VMDA 1MCPH 4XXWC 3UZQA 4QD2E 3I6SA 4J6RH 3GBML 3X12A 1KFAH 3HKFA 2ZWKA 3L5WA 1M7DA 2J1XA 1XDTT 4MAUL 5DTFB 3CVHB 2H0EA 3EGDA 3MMEB 1JPGB 4QXUH 4GIAA 3ZE2B 1KIPA 1XZ0A 3KXFA 5TJWK 3SBQA 5IMLB 1U91A 1QEWB 2C7FA 2GTQA 1U8PB 2UZIH 2EUWA 3E3QE 3NH7H 4TTDC 4Z7QB 5ICZB 4LHUB 3HLAB 3HC3L 1KXVA 4N4YB 3SGKC 5I2IB 1ADWA 4JRYA 4UTAL 4L5FE 4N2IA 2VSCA 3NIFE 3LNGA 3TT1H 1LO3L 4X9YA 3V0GA 1QZNA 1ZHBB 3ECBB 1LP9B 4ODSL 2FATL 1A7RH 2VN5A 3SDCB 4MLIA 3E80A 5L4JA 3MRNA 2BDNH 4HJGA 5F88A 1K5WA 3D48R 5FKPA 1X5LA 5EOCH 4CC0A 2JIXA 2DF3A 4YDVB 4EI5D 1BAGA 2Q0ZX 3FTWA 3WIHA 4AQ1A 3EGXA 5H8DA 3CVHH 5D93B 2CO7B 3SGEH 3NZUA 4OZ4B 3BAEH 5KS9E 3JYBA 3K2MC 1ZGLA 1AG0A 1A6TB 3IJ7A 3NACH 4X80L 3GF8A 5CBEA 1X9LA 4I9XA 2B20A 4DK5A 4LSPH 4KKLC 4IDJL 4IMKC 4PJ7E 4XHQA 5DLLA 2CM5A 4JE4B 3QWNA 2EIMB 3ARSA 4HIPA 2ZYIA 3VXRA 3P73B 4BRJA 3H7LA 3ZDYB 4K3DH 2BP8B 1OV8A 2DEWX 2DIJA 4NQVB 3ESOA 2P7TB 4WO4D 1WS8A 2BK8A 3PP4H 4ADIA 3QCVL 4LOEA 1R3JB 3WD5H