4Z3KA

Human sepiapterin reductase in complex with the cofactor nadp+ and the trypthophan metabolite xanthurenic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
GLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrahydrobiopterin Biosynthesis as a Potential Target of the Kynurenine Pathway Metabolite Xanthurenic Acid.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sepiapterin reductase
total genus 91
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.153: Sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).
pdb deposition date 2015-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4z3kA00
1HDCA 1CQJA 2OXIA 5IXSA 3FR8A 3F5SA 1ZH8A 4U5QA 3P2OA 5TC4A 1N7HA 2WM3A 2QYTA 4WCDA 1AXEA 3GPDG 1KERA 4NK4A 4NFYA 1N2SA 3FTNA 5TF4A 1EVYA 1KETA 2OP1A 1VRWA 3ZN2A 4R5MA 1BTOA 4GQAA 3I83A 3KUXA 4YCAA 4EDFA 2FZWA 3JD2A 3ROMA 1QYXA 3PI7A 4DMLA 4GBJA 2EKLA 2FWMX 4MVJI 4PG4A 4PG5A 1D3AA 3ZHBA 3BAZA 3RUFA 3DONA 3R3JA 9LDBA 3FCOA 4HWKA 4Q3BA 2I99A 5L9AA 3KBOA 3Q1LA 4BV9A 3S2IA 2I5PO 3AM4A 3SLGA 5A5EA 2GRAA 3GLQA 4PFJA 2FR8A 3RROA 1UXJA 3ROKA 3OH8A 4E0BA 3WX0A 4Q3EA 1GEGA 3D5TA 1Y81A 2VWQA 3ETEA 2Q1TA 2VYVD 4ND5A 1KVUA 1OZAA 4CM8A 1XQ6A 2C5EA 4PG8A 4J4HA 2X9NA 5B12A 1J4AA 3JQ7A 4J1TA 4PCVA 3OIGA 4CLRA 3UOGA 3UXYA 5KVSA 5IXYA 1CDOA 4CMBA 4J1SA 1YDEA 4QFDA 4BNVA 2Y67A 3ZH2A 2EKPA 2WE8A 1H93A 2HK7A 2VWPA 4WEOA 3I9MA 3GF4A 2VUSA 4DPMA 3RUCA 2ZQYA 2WYUA 4MKXA 1TB4A 4DC1A 3L6DA 2VRBA 5EERA 3GGGA 4ZVVA 4LISA 5IN4A 5JYEA 4HNHA 3RC1A 1KC1A 3Q3CA 4XRRA 5BSEA 2OGUA 1Q7CA 4W9NC 4R4JA 3L6OO 1C1XB 1JQBA 1HRDA 1T4DA 1E0DA 2J3JA 3A9WA 4M49A 5G0UA 1D1SA 1DFGA 2O50A 4RVFA 3U49A 1I2ZA 2VOJA 4IQ8A 2NVUB 3PHHA 2RCYA 4II3A 3TFQA 2GR9A 3GVIA 2JCXA 3CEAA 4GKBA 2ZYDA 4BKPA 4D79A 3DZJA 2NVWA 3ST7A 4BO6A 3PWKA 2R00C 3GEMA 3U4DA 3JQ9A 3T7CA 5L40A 4QUKA 3WGQA 1SMKA 2DLDA 3G17A 2HO5A 4XR9A 1UAGA 1HDOA 5C7OO 2YDYA 2GLXA 2PFGA 4BKUA 1M6HA 4CMHA 1IL0A 1PGOA 3H3JA 4XB2A 1Z7BA 1E6UA 1V35A 5KKCA 3NGLA 1CF2O 3JYLA 4ND2A 5JLAA 4YAGA 5HRUA 3UGKA 1PEDA 1HZJA 3DBLA 1B8PA 1QMGA 4P4GA 2NU8A 4YAEA 3V5NA 8LDHA 1PR9A 3PQEA 1YBVA 3LT1A 3JQBC 1UZNA 1P1IA 4G81A 1LDNA 4XR4A 1H6BA 4OAQA 2WSBA 5JPIA 3JD0A 4RPKA 3DQPA 1CETA 1N5DA 1U2DA 1Y8QB 4ALNA 1Y8QA 4BNZA 1RYDA 1Z45A 2Q1SA 2DBRA 1DIAA 4J6FA 3NRCA 3S55A 3VZRA 2FPIA 2EKQA 1G0OA 1LSSA 2EP7A 3OSUA 4BGUA 4XYEA 4CMGA 3KSUA 4OIMA 1QG6A 3ZW9A 4QFCA 1AUPA 3KTDA 5TRTA 1DLJA 4YJHA 5FI5A 1SNYA 2P4QA 1XA0A 5B4VA 2POQX 3UICA 4DWVA 2Y99A 3D4OA 5TLSA 1DIGA 3JQ9C 4J16A 1Z75A 4FIZA 1U7HA 2FRDA 2WEKA 3G0OA 3VZSA 1ZKMA 1DIBA 1JW9B 3JQ8B 4O5OA 5I9NA 4QXMA 4YEDA 5JC8A 5JAIA 2V6FA 3IL2A 1U9JA 1JAXA 1JDJA 4B4VA 3TOXA 3RFXA 4GVLA 3H7AA 1Q1NA 2J6IA 3L0DA 3GN1A 4UAGA 3GNTA 3BYZA 5JO9A 5EPOA 1VM6A 1DRWA 6ADHA 1LRKA 1JAYA 3GNSA 5B4UA 1ULUA 1DRUA 2CF5A 2HMVA 3B70A 3E1KA 3L07A 4YJGA 2AMFA 3MOIA 4J2HA 4IY1A 4BB6A 5ILOA 3VDRA 5IF3A 2EERA 3IKVA 1QP8A 1Y8RA 3DEYX 1N1GA 5CG2A 1LNQA 3HB4X 4IJWA 1L7EA 1SAYA 2BFAA 2H63A 2CDBA 3ITDA 3JV7A 5A9SB 1XELA 2VTDA 4FCCA 4OSOA 1ENOA 1K3TA 4B3IA 5KVQA 3K5PA 4QQRA 2G17A 1HEUA 1BGVA 3CINA 2A9FA 4BNWA 3IQDB 3ENNA 5THKA 3JQ7B 3H9GA 4U0JA 2WJPA 3RAJA 3X2FA 3C85A 2P91A 1Q0HA 2O2SA 4KQXA 5H83A 3EZLA 2X5KO 2QG4A 1P1KA 3SJUA 2W2KA 3VTFA 2NWQA 1T4BA 4BO9A 2BF7A 1MA0A 5DBFA 4WLEA 4CUJA 3ROPA 4NK5A 2ZYGA 2E4AA 3I3OA 4OXYA 2C54A 2OBYA 4MVJM 2NTVA 3T4XA 3QV1A 4IXWA 5JDCC 1U5CA 3GUYA 1YRLA 3QVWA 1FJHA 1BMDA 1QLHA 2FR1A 3JQFA 3OJFA 4YAJA 4JP3A 3KLMX 3FBTA 4CLDA 1MV8A 3K2EA 4B79A 1D7OA 3B20A 4D43A 1K0UA 1HE4A 3DHNA 3I9KA 4XDZA 4XQ9A 1ZBQA 1OOEA 4XRGA 2TMDA 3VH1A 2VWHA 1IPEA 2AA3A 4IBOA 4Y8VA 1PX0A 2HU2A 2E6UX 2QIOA 1X7GA 2WD7B 3G79A 2Y1FA 1EFLA 1ZK4A 1QV6A 5IAAA 3NDJA 3CMCO 2CY0A 3JQAB 4AL4A 5L7WA 4RF3A 5IZCA 4IDEA 3U4CA 3JSAA 4BMVA 3QWBA 1JN0A 1N92A 4TROA 3E5MA 3HNPA 3KEOA 5JMPA 2FMUA 2BGMA 3V1UA 1BXKA 4BKQA 2PNFA 2QZZA 1MC4A 2J3IA 1BHSA 4AJPA 2EHDA 3WGYA 4XJTA 4A26A 4P22A 4D45A 2WYVA 3DOOA 3FNHA 4WK6A 4I9HA 2ZB4A 1XKQA 1T26A 3BMOA 4MO2A 1SB9A 2PGLA 4DL9A 1D1TA 1L7DA 3ZU2A 3TWOA 2HUNA 4J91A 4D0SA 3IP3A 2GASA 2RBEA 3FNGA 3GOHA 3GRPA 5JC1A 1OAAA 5K6AC 1F17A 3WFIA 1PJBA 2VCYA 5A3JA 4R1TA 2ZB7A 3E03A 1V9LA 1PGJA 1DAOA 2QRKA 3L77A 3JQCA 3L6EA 1K2WA 1XDWA 1N8KA 4IQGA 1EVZA 1LDGA 3UUWA 5KJFA 4WCFB 3ABIA 1ZUD1 1XCBA 3ZWAA 4YAKA 3P7MA 1C0LA 4UUMA 2IYPA 4OYRA 2A92A 3GHHA 4NBTA 2D8AA 4B4OA 4CM4B 4ALIA 4Z0HO 3OQBA 3GNQA 3C7DB 3QWIA 4WASA 2VQ3A 5IZCC 4AJ4A 3E18A 4K6CA 2P5UA 3M6IA 2JCYA 1K6JA 4MVJH 4RQUA 5CDYA 5HS6A 2LDXA 3DL2A 2Q99A 3T7EA 1T1SA 1X15A 2WD8A 4B4UA 1B2LA 2BH9A 2GGSA 3FBGA 4YRAA 1I0ZA 4Z6KA 1E7RA 3WBBA 3O8QB 5TIIA 2AG5A 5DP1A 4E31A 4YJFB 5C7IO 3IKTA 2Z5LA 3PK0A 3LC2O 1FDTA 2DKNA 3GHYA 2XXBA 4WUVA 1N9GA 3GH3A 4YJGB 3K9QO 1QYWA 2IZZA 3CKYA 4IIUA 4FR5A 4J1NA 5DCUA 1K5HA 1W0CA 3DOJA 2JAPA 4ZRNA 4W7HA 2PGDA 1QYDA 3F1LA 1X1TA 3FWZA 3ITKA 4RZIA 5KVVA 4XKJA 4S1VA 1B3BA 1Y5RA 4QEDA 5ITWA 1GU7A 1UH5A 1VKNA 3MJVA 2ZTVA 3QQPA 4MVJD 3AI3A 3V1YA 2R2GA 2GERA 1YB1A 3QVTA 1N7GA 3TOZA 4EJ6A 3TDKA 3JQGA 1T2CA 3OJEA 2V6MA 4GLLA 4Y9DA 3FNEA 2DTDA 4LK3A 3GVXA 4P4NA 4XQGA 4IZHA 4FC6A 4QO7A 1DC6A 2C82A 4NBUA 3LT2A 3E9MA 1GEEA 1KOLA 1XIVA 4PVCA 2EJWA 1EUZA 1PS0A 4CQLB 4QECA 1W73A 1U4SA 2UAGA 3TSCA 5EN4A 1ZXLA 2PV7A 4HXYA 1YVEI 4D46A 3I9LA 3VPHA 1EQ2A 2XOXA 2AE1A 3INRA 3OM9A 3U4HA 5KVCA 4IJUA 1PJ4A 3K96A 5ER9A 4AJIA 5F1KA 4B8WA 1MLDA 4UREA 2EV9A 4CPDA 3S2EA 1WZEA 4OGWA 4TSKA 1NAHA 4CR8A 2HK8A 4BB5A 1QSGA 1Z6ZA 1Z74A 1WMAA 3PFWO 2AQKA 3W4IA 2HMTA 1H0KA 3AM3A 1DLIA 3EK2A 4OH1A 4Q3NA 1H9BA 4CMJA 4F6LA 5T57A 4PRLA 5I7FA 1FDUA 1SCUA 2Y93A 1O8CA 2ZATA 1RPNA 3PPIA 4QTZA 1HSOA 1ZMTA 2YFQA 4HX5A 4BNTA 3DDNA 2PZLA 3WQRA 3WWZA 1PL8A 1GUFA 4HFJA 4JCOA 2C5AA 1NPYA 1E6EA 3EYWA 4GMFA 3AFNA 3M1LA 4DYDA 2OHXA 1ZSYA 4TRRA 1B3RA 3I6QA 3WLFA 3PQDA 4FJ0A 5CP8A 1E3JA 1PGNA 4ZQHA 1KS9A 2B37A 3JD1A 3GGOA 4G2NA 4JXKA 2GZ3A 4IDFA 3E5RA 3SC6A 4UUPA 1F14A 2HLPA 4AJOA 2RHCA 4XZ3A 2Q4BA 3R1IA 1NR7A 1NHWA 1P1FA 4RF5A 4BS9A 3L9WA 4N54A 3FPLA 3PYMA 3U0BA 2W2LD 3LU1A 5T67A 1MP0A 4BIIA 2WYWA 2Z1NA 1LLUA 2O3JA 3VH2A 1R0KA 3DOCA 4INAA 4LGVA 4PIVA 3JQBA 4ALMA 4RF2A 3ZWNA 2PGJA 4GX1A 4NBVA 1UJMA 4ZQGA 2W2KB 2NVBA 4LVCA 1QYCA 5G0VA 4JBIA 4NBWA 3D5QA 5IN5A 4TWRA 2BD0A 3C8MA 1S7CA 2NSDA 3GZNA 1U3WA 3GEDA 4FD3A 2X4GA 2GN9A 9LDTA 4BQRA 2GO1A 4I08A 4Q3DA 2XXJA 2J3KA 1BXZA 1ULSA 2FR0A 3WIDA 1U1IA 7ADHA 1OI7A 4GX2A 4P38A 5HA5A 2Q3EA 5DZSA 1F0YA 1HDGO 1A5ZA 3WR5A 1CRWG 4BMNA 2EGHA 1EBFA 1LI4A 1X0XA 4H16A 4BNUA 1GYQA 1IUKA 3PHJA 3GMSA 1N1EA 1ADCA 1TLTA 4IIVA 4WGGA 1NVMB 2DPGA 5C7LO 1JKFA 1O94A 1U8XX 2WTBA 2AQHA 1H9AA 3D4NA 2Q1WA 1SB8A 3RU7A 4OOEA 4BNYA 1KEVA 4CLXA 3UCFA 3K30A 4CLOB 3BTSA 2VYNA 4GGOA 2E49A 3SX2A 2PKQP 4PZCA 4O0LA 3LYLA 3EHEA 1EDZA 1A4UA 1GFSA 3KYDA 5COQA 1SEPA 3AW9A 4EYEA 4BNGA 2DFVA 3MCVA 4I5DA 4U8GA 4BHTA 5JCJA 4CMAA 1X13A 3BHJA 3COSA 1F8FA 3DAGA 4GL4A 4Q3AA 5I9MA 1FMCA 3BZUA 3DBRB 3D7LA 4A7PA 2VRCA 4W82A 2DBQA 1WAMA 2FHSA 2FOIA 1TT7A 4NU6A 1ZK2A 5JCJD 2BLLA 4DGSA 1CQIA 1H94A 1VSUA 5TGDA 2CMDA 2Q45A 5G0TA 3RWBA 3TL3A 5EQFA 1HDRA 4W9NA 4IDDA 1GDHA 1YBAA 3W4KA 3VC7A 5F1PA 1ZJYA 2EXXA 3DFZA 3LLVA 1DFHA 3ZU3A 2PWZA 1P77A 1XWFA 3FD8A 4WCFA 3F6YA 4YJHB 3AU8A 3WGHA 4G65A 4YQZA 3NDRA 3JD3A 4IPTA 1LU9A 4NNJA 5TSDA 2YW9A 3UVEA 4XIJA 5A05A 3V8BA 1Z7EA 2B35A 2OP0A 3G1TA 4IJKA 1ISIA 3ASUA 3P2YA 2X23A 3VKUA 1BW9B 4D3SA 4E33A 3GG9A 2UVDA 5BNFA 2PZJA 3OETA 1PJSA 2PKQO 5CPFA 3TF5A 4ZN6A 1IY8A 1NP3A 2DBZA 3QHAA 3U4IA 4ZRMA 3RUDA 2EGGA 3TZHA 1ONNA 3SBOA 1T2DA 1HKUA 2GNAA 3S2GA 3C1AA 4NJMA 3HFSA 1ZVMA 1PU2A 3ONEA 3PHGA 4PG6A 4Z9FA 3FTPA 4XGIA 1KEPA 4W4TA 3RJ9A 4DQXA 1H6DA 1UZLA 1E3WA 2IE0A 2YHUA 4YJFA 1GADO 1XG5A 1Y9EA 2EG9A 3VZPA 4E5YA 4M54A 3TJRA 3GPIA 5H81A 3T4EA 4GWGA 5IJZA 4RORA 1NVTA 2G0TA 1LRLA 4AJEA 1ZK0A 5HM8A 4AVYA 4X54A 3BHMA 1O89A 2ZK7A 3RBXA 3AM5A 2PLAA 1JLLA 2I65A 3OEYA 1SOWA 4KMSA 2VTEA 4I9UA 1Y1PA 1GZ3A 4HY3A 1HE3A 2NUAA 3WNVA 4CM1A 4B4WA 5GZ6A 3AY3A 1IB6A 4OM8A 1DC3A 5G4KB 3WYEA 4J0EA 1JTVA 3AOEC 2J5RA 3HDQA 1XU9A 2TMGA 1ORRA 1TA4A 4EUEA 4FW8A 1SO8A 5CDGA 4YB8A 2X5OA 5T5QA 1E3IA 4CODB 4IMPA 4CM6A 3NX4A 4OSPA 3LVFO 4M89A 3MZ0A 1PJQA 1WPQA 1HWYA 4RPHA 3AI2A 1UDAA 1DC5A 2EF1A 2JKVA 1GV1A 3BA1A 2O7SA 2YHIB 2GSDA 3ZGYA 3HZZA 3R3SA 4AG3A 1E92A 3TZKA 1P1HA 2VOEA 4Q39A 1BXGA 4DLAA 4B3JA 1D8AA 3MWEB 4BNFA 2HMSA 3S2FA 4MDHA 4XYGA 3RBVA 1GQQA 4XD2A 5I8ZA 5MGBA 1LLDA 3ETDA 4XGNA 2VZ9A 3VVCA 3RJ5A 3EVTA 3LT4A 3MJSA 2CF6A 2JAHA 1WLYA 2IZ1A 2WE7A 3ZI0A 5JSFA 3NEPX 4R1UA 4TQGA 3H8VA 3ZV5A 4EITA 3AY6A 3QWHA 4FN4A 2H6EA 5COBA 3WGOA 3WB9A 1DDOA 3NKLA 4WNCA 1SOVA 4MP6A 3ZW8A 3KETA 2QYSA 2Q49A 3PLNA 3F5QA 5I7VA 3IP1A 2ZTMA 2YQ5A 5THQA 3H5AA 2NLOA 2O7QA 2JFFA 2RH4A 3I9JA 1U8FO 4FFMA 4XA8A 4YVFA 1NNUA 3BHIA 1WDKA 3IC5A 2JD0A 2HMWA 1BSVA 5T8KC 4L73A 1PZGA 1P1RA 3KM0A 5DBGA 1ZIDA 3KYBA 2DU8A 4ALKA 1Y8RB 4ND4A 5JAMA 4PLCA 1DAPA 4XWYA 3AK4A 2PD4A 2PH5A 3F9IA 3CIFA 2A35A 3NGXA 3NJ8A 4D44A 3UW3A 1V6AA 1YOVB 3O4RA 1BXGB 5A5FA 4CM7A 3ANLA 1PGQA 4ZQBA 1DBVO 1ZSNA 3ENKA 1RKXA 5TQVA 3WICA 3O03A 1VC2A 2VT3A 4IUYA 4EUFA 3HE3A 1Q0QA 4ZD6A 5JDIC 1HDXA 4XGKA 4K26A 3SC4A 3JYPA 1NTOA 4FOSA 5KNLA 2IYOA 3KVOA 1EE2A 2ZB8A 1IZ0A 3C1TA 3JQ6A 4TKLA 5FF9A 1V3TA 2CZCA 4PVDA 2E37A 2H1SA 1R4MB 1HTBA 1E7WA 4J7CA 3HWRA 3RUEA 2DQ4A 1I3MA 4BO1A 1ISFA 4OJNA 1KEUA 2AG8A 2PR2A 4YTEA 5GMOA 4TRNA 3GVHA 4R51A 4FSHA 2W90A 2QX7A 5T64A 4I5FA 4MP8A 4WCFC 1KVRA 1KVSA 1OMOA 1MB4A 2VHWA 3IIEA 2X0NA 2X9VA 2V65A 4O63O 2VUUA 3DR3A 1YH3A 3H2ZA 2CVOA 3DB2A 4KDFA 4Z3KA 1V0JA 1NFRA 4B8ZA 4OOFA 1EBUA 1MG5A 1U3UA 5A9SA 3DBRA 4WOKA 3DBLB 3ROQA 4NH4A 3F47A 1I8TA 2PKRA 3KLPX 1HL3A 1LSOA 5HWSA 4A2CA 4PLHA 2AW5A 1E3WB 1RYEA 3NT5A 1B15A 3RUIA 3ADPA 2P9CA 3A06A 2UUOA 5T6BA 1DSSG 3RSHA 2BMAA 1FDWA 2O3SA 3PGXA 3HB5X 1CWUA 4CV1A 2I6TA 4E5MA 1SBYA 4BGEA 1I10A 3TQHA 3VVBA 3ADOA 2Q4EA 1E6WA 1UP4A 3K2BA 4IDAA 5C5IA 4DREA 3N7UA 4JGBA 3GZ4A 5KJ1A 4K9DA 3Q6IA 3PJEA 3DHEA 3D1LA 4MVJF 3PEFA 4B7UA 3H9JA 3LLSA 2VNAA 4KWHA 3CUKA 4FFOA 4CM5A 3NTRA 3OECA 2P5YA 4L76A 5FFFA 3DXFA 1MXHA 4AJKA 1GTMA 1G6KA 1J5PA 3DAFA 4K1LA 4MP3A 4YACA 1GYPA 4MINA 5FYDA 4RVUA 4XDYA 4IDBA 4D0RA 1P33A 4E5KA 2DTXA 2IXAA 3WG9A 2HJRA 3G1UA 3CXRA 3IUPA 3WQQA 2XAAA 1UXHA 1YJ8A 2B4QA 1UP6A 3E8XA 3OICA 4CM9A 5HBRA 3L9XA 2Y0EA 4MKRA 1VL0A 3DC2A 3HDYA 4L4SA 2CSUA 3ZWMA 2IODA 5L4SA 1SC6A 5DCYA 1P1JA 5EJ2A 3VH3A 5CEJA 1I2CA 3ZZNA 4DTIA 1XSEA 2VHXA 1VE9A 1CIVA 1PS8A 3HG7A 1OC4A 4P4LA 3W1VA 2AQ8A 4RPJA 3CE6A 3RFVA 1EDOA 1EUCA 1PZHA 2ZJ0A 2IEBA 5CHEA 4CQMD 2QW8A 4JBHA 2VUTA 2EP5A 3QY9A 3GVCA 4PLZA 3X2EA 4J49A 4EJ0A 5ER6A 3M1AA 4E2XA 4F46A 3BMCA 1JWAB 3ZWOA 3RD5A 5AYVA 1HXHA 4YBZA 3UKOA 3EC7A 3WSWA 3PDJA 1EQUA 4IDCA 3JYOA 1FDSA 3ZHZA 5LDGA 3UF0A 4E4YA 5L7TA 4BO2A 1E77A 3TZ6A 4YR9A 5TNXA 4NFHA 5JO0A 1IE3A 3E9QA 4TZKA 4HV4A 4C7KA 1FXSA 1LLCA 1IPFA 3PZBA 1E7YA 3HADA 4IINA 2W4QA 4U6QA 3HQ4O 4A10A 4L4XA 1A4IA 5COAA 2PD3A 2NQ8A 2X0RA 4F3YA 1YQXA 1B16A 5F21A 1NPDA 3JQFC 3EVNA 4LSMA 4RCVA 4DQUA 1IHXA 3WYCA 1ZXBA 3KSDO 3I52A 1G0NA 3PJFA 4N7RA 3MOGA 2PD6A 3QRWA 3N74A 3JQGB 1ZMOA 3NT4A 3FSRA 1E1NA 2IDZA 4EI2A 2I67A 1BRMA 1B14A 1ZK1A 3ZNQA 4CQMB 4FPXA 4DPKA 2O2YA 3PTZA 1R16A 3P5SA 3DZGA 2Y1OA 3NTQA 1ZK3A 4NPCA 4OO3A 3PDUA 1LSJA 2VZ8A 1I01A 1QYVA 4IS2A 5ENDA 4WLUA 5DBIA 2RHRA 5CDTA 2NU6A 1HE5A 4HFMA 3LQFA 4FBGA 1QKIA 1X7DA 3PVZA 2C0CA 3VHRA 1AHIA 1G1AA 1N9GB 5EIOA 2B5WA 2A4KA 4Z0TA 1U4OA 2RIRA 3DHYA 3DBVO 4D3DA 5LC1A 4E6PA 3M2TA 4XEHA 1QXSA 4ZJUA 5A9TA 2H5LA 1TT5A 1VJ0A 4J2OA 2WMDA 4KOAA 4W6ZA 5A4DA 3EUWA 4AICA 1NYTA 2E82A 4XCVA 3QWAA 1O5IA 4MKZA 2WDZA 3DMTC 3GT0A 1DO8A 1XU7A 2LDBA 4NIMA 2FSSA 1BWSA 1EMDA 2DPHA 2YFHA 5LCXA 3QVSA 4R54A 4J7XA 4QSMA 4HKTA 3E82A 2AEMA 3Q0EA 4D41A 4BOYA 3I23A 4PLFA 4PLYA 3SVTA 2IZ0A 1LJ8A 5EL0A 2YJZA 5AXBA 3TN7A 3UFXA 1I33A 3KSZO 4OMUA 3BMNB 1CYDA 1R0SA 2EEZA 4GMGA 1VJ1A 4H3VA 3RC7A 3R0IA 3I5MA 3ZWPA 3WGTA 4YT2A 5L4NA 1YOVA 4EEZA 4LVUA 1ADBA 5JFOA 3VPSA 5I7SA 3ETGA 1ARZA 3ZWWA 1DXYA 2BGLA 4OQYA 5ICMA 3VOSA 1AE1A 2GCGA 1E7SA 1JVSA 5CPBA 2QQ5A 1YL6A 1PZFA 3D0OA 3ZV3A 5F5NA 3LF1A 5L51A 3WJ7A 1LQTA 1O9BA 3IAHA 2HMUA 5HTOA 4L4RA 3LT0A 3OA0A 5G4LA 2CFCA 3DZBA 3ZU5A 5KIAA 1MUUA 1PQUA 3DWFA 4B7CA 4E2ZA 4N5NA 3IUSA 1EK6A 1YDWA 4U7WA 1R4MA 2C29D 3GMDA 3V2UA 4E13A 1PWZA 1LC3A 1NQ5A 4I1IA 4UVEA 4WJZA 1ZFNA 1EK5A 1QLJA 5IDYA 1W6UA 4NHEA 4BO7A 2VHVA 1B7GO 1HYEA 1PL7A 4CV2A 4EGFA 4RL6A 2JHGA 3WDSA 4BO0A 3VTZA 4URFA 1T1RA 4XQCA 1ENZA 4PLGA 2HK9A 4ILKA 4FJ2A 5B37A 3PYLA 4DIBA 3PP8A 1KEWA 5TT1A 1YJQA 5MDHA 1GR0A 1LRJA 4RQTA 3BMNA 4BO3A 2UV8A 3NAQA 3ICPA 1PJLA 4TMFA 4FB5A 3SJ7A 4LRSB 4QT0A 4XYBA 5BR7A 3WIEA 5KKAA 3BMOB 1BDBA 4CMKA 3FR7A 2NADA 5JMWA 5JY6A 3EY4A 1OC2A 4BL5A 4RDHA 4UVDA 2UYYA 4PRKA 2PH3A 1HT0A 1KBZA 2Y1CA 5FI3A 4J43A 4UVIA 1IYZA 1QORA 4ROSA 4CV0A 5AQ1A 5DNAA 3E9NA 2ZTUA 4IS3A 1E3LA 2CVZA 3OFSA 1UZMA 4LCJA 3RASA 3A14A 4IM7A 5JDCA 1WZIA 3ZNOA 2NVUA 1GZ6A 3W6ZA 3ZWYA 5GZ1A 3TNLA 3L4SO 3PLRA 2BI8A 2WD7A 3EZYA 3W8DA 2OBNA 4RLHA 1YQDA 2V6GA 4L74A 3I1JA 4E21A 4RPLA 4JJGA 3BTVA 4JJFA 3NV9A 1OFGA 1YGYA 2QRLA 1UDBA 1RJWA 1O95A 2JFGA 4MVJG 4YT8A 1HLDA 5JBIA 1LQUA 1R0LA 4Y6PA 5A1TA 5DT9A 4YAIA 4QO8A 2J3HA 3CPSA 3F46A 5JAQA 3FNFA 3WNQA 2NU7A 4JN6B 1XQ1A 2PZKA 1UDCA 4P8RA 1GCOA 4JK3A 1F06A 4BUCA 2ZB3A 3I6IA 4KUGA 4NBRA 4H15A 4ONEA 3OIFA 1UUFA 2GZ2A 5JE8A 3K6JA 5U1PA 2X8LA 3TL2A 4J9VA 5ITVA 4ZA2A 4R68A 1EVIA 3JTMA 4IDGA 4RLSA 2IRWA 3GRKA 2D2IA 2OOSA 1YBMA 2C07A 3NUGA 1GCUA 1UR5A 3DBHA 3H2SA 4JJIA 5IDXA 3LK7A 2NU9A 3HDJA 1LTHR 2NNLD 3MJTA 4WE3A 4EBFA 1MFZA 2AHRA 4KWIA 1P31A 2DUWA 4A5OA 4KDEA 3H5NA 3RUHA 3KHUA 5A9RA 4A0SA 3PWSA 1R66A 2I66A 1K6XA 3ICCA 3K73O 3HHPA 4Q9NA 1H6CA 3ZU4A 4BGIA 2ZQZA 3SEFA 4J3FA 5BQFA 3JQAA 5K9ZA 2X58A 3OA2A 5DULA 3S1LA 1E5QA 5IFLA 4CM8B 2X1HA 4JROA 4WLVA 4DQVA 2G5CA 3DBHB 3OBBA 1LC0A 4MVJP 3C7AA 1TI7A 4FJ1A 3W6UA 4RVGA 2JHFA 1C1DB 3WSVA 2EWMA 2OUIA 3D3WA 2A94A 2PA3A 2V6BA 3A28A 5A03A 1P0CA 5EINA 1DJQA 1K6IA 4MJLA 3WGGA 2DM6A 2HCTA 1UAYA 3GGPA 1U28A 2NTJA 4ZHSA 3H9QA 1NFFA 2B83A 1NQOA 1HYGA 3V2GA 4BNMA 1AXGA 3DZHA 1F12A 2JCVA 1I3LA 5BSGA 1B0AA 1IZ9A 1SPXA 3HSKA 3INTA 4XYLA 3LC1O 4WLNA 1C1XA 5JYDA 1YB5A 2C7VA 4Z0PA 4GWKA 1ZJZA 2BFPA 4PLVA 2CDCA 2AEJA 3GFBA 3BMCB 4TZTA 3WYBA 3PJDA 5BT9A 1RWBA 5T8KA 2CD9A 3MJCA 4NJOA 5TJ9A 5K0ZA 1PS9A 1BVUA 3GR6A 1YL5A 4E5PA 5JW6A 4CL8A 1I36A 2BELA 2CUKA 3C1OA 1M67A 1A9ZA 1VKOA 3F3SA 1FK8A 1HZZA 1Y7TA 2W98A 4BNLA 2Q46A 5AXCA 4DIOA 3O26A 3W8FA 2FY8A 4HUJA 3NTOA 3KRTA 2I3GA 4Q3CA 1J6UA 4GGPA 2O3TA 2GUGA 1M66A 1M75A 4BKRA 1B8VA 3K92A 2ZJ1A 4LMPA 2ET6A 4BGVA 1VPDA 1EVJA 1BDMA 2C59A 2Q1UA 3LC7O 4GLOA 5ADHA 2NM0A 1DOHA 3DTTA 2JJYA 2O3RA 3GY0A 1IOLA 1GUZA 1PJTA 1ZO8A 2AEFA 3AI1A 1ZW1A 3INGA 5AXAA 3ON5A 3FPCA 3DMYA 1PSDA 3U9LA 4YWJA 2O3QA 4FFPA 1KC3A 1SZJG 4CQMA 1GPJA 5JDIA 3E48A 2VT2A 1DPGA 3HFGA 2G76A 5C37A 4J4TA 3OEWA 2OL4A 3DZKA 4NZ9A 1WDMA 3D4PA 3RUAA 3ANNA 4BV8A 1Z73A 3H65A 3KB6A 2NV6A 2HAEA 4H7PA 1GL3A 4ALLA 1FF9A 4IJVA 3RCBA 1T25A 3LSYA 3BIOA 3GQVA 3TZQA 3ZWBA 4PZEA 3NDIA 2Z1MA 3HDHA 1B8UA 3AOGA 4XIYA 3OQ6A 4KP7A 3ANMA 1GV0A 1EEHA 4BO5A 1NPTO 1TXGA 5KJEA 1AHHA 5TS3A 4YJDA 2YUTA 4GI2A 4TVOA 2F00A 3UAGA 4YXFA 1NR1A 4R69A 3AJRA 2W2LA 3Q9NA 1LDBA 2D5AA 3UCXA 4BNXA 1PQPA 4DLLA 1VSVA 4TRMA 4JX8A 5CFZA 2BRUA 4GSLA 4TRJA 2D1YA 1K89A 3ASVA 2GZ1A 4RJTA 1GAEO 3AFMA 4E32A 3IDSA 3WFJA 2GPTA 2QHXA 4B3HA 1A72A 1ZSVA 3LZ6A 1DFIA 4RGBA 1JVBA 4HNGA 1ISMA 4AJ2A 2DBVO 5CDSA 4D3FA 4CMEC 1C1DA 1CEQA 4YA6A 1DHTA 3AUTA 4UEJA 1ISHA 3A1NA 2E48A 4O1MA 3PWZA 5AOVA 2DVMA 3AWDA 5A06A 6LDHA 3WXBA 2O48X 3DMTA 2GYYA 4I8XA 4DPLA 1MG0A 4NI5A 3PHIA 4R5HA 1B26A 1E7MA 3DFUA 5KJ6A 2Q2QA 1NX6A 3KZVA 3TFOA 1GD1O 3PJGA 4UULA 2ILTA 2FP4A 1VL8A 1XYGA 1JA9A 2Q2WA 2Z95A 4R1SA 4R41A 3GDOA 4GX0A 3DAPA 2PTGA 4PGFA 4D7AA 4BNKA 2EW8A 2C2YA 1NXQA 1I32A 1LEHA 1NAIA 1BG6A 4TKMA 3PHLA 1MC5A 2H9IA 3F4LA 2C2XA 3GAZA 4GAEA 2IEDA 1P9LA 5DCWA 4Z3DA 5G0SA 5L3ZA 2GDZA 1ADGA 3FN4A 1C3VA 3EGOA 4CQLA 5ICSA 2AE2A 2C20A 2BGKA 1P3DA 3QP9A 3STHA 5KWEA 1JU9A 1YL7A 4W99A 3PIDA 3JQEA 2BFOA 3GG2A 1NVGA 4HBGA 4XX0A 1UXKA 3ZCXA 3BTUA 3C3XA 1PIWA 3MEQA 3AY7A 4J7UA 3ZDFA 3H4VA 3IS3A 2J5QA 5LDHA 3JYQA 1ZEMA 4U0KA 3ZV6A 5JS6A 1I5RA 2YV2A 4KTTE 1CERA 3RKUA 4YQYA 1XHLA 2DC1A 4Y6RA 1A7KA 1YKFA 2VWGA 3SLKA 1VI2A 1ONOA 2B4RO 4CUZA 3OJOA 3P19A 4C7JA 4Y98A 5A04A 2VZ0A 1H2HA 1CJCA 2J8ZA 4JQCA 4R9RA 1R4NB 2RH8A 3IJRA 1Z82A 4MPDA 1YXMA 1ZZEA 5JXWA 3KOUA 4CR7A 3WS7A 5DDIP 1PTJA 3TZCA 3SXPA 1LBEA 3JCZA 4NMHA 5TT0A 3WGIA 1X1EA 4CMIA 2Q2VA 3E6AA 2GN6A 5GY7A 1ZNQO 2D4AA 1P74A 2FPGA 3RC2A 4ZQEA 4YT4A 1JKIA 1YS4A 1ZCJA 1SEVA 5JNLA 4IXTA 4OXNA 3OMLA 5U4QA 2HRZA 3UCEA 5DN9A 1PJ2A 1RM0A 2GN8A 4KUEA 3EMKA 2FZEA 2CNBA 3DZFA 1UXGA 3MJ4A 1LSUA 1LLQA 3QE3A 4DIFA 4DRYA 2YYYA 4BVAA 5IZ4A 5L4LA 1M76A 4FGWA 1I24A 4GX5A 1F8GA 5I7EA 2X5JO 3BXXA 4GPD1 5G2OA 1DIRA 4K6FA 5H82A 3VPGA 4OQZA 3RIHA 1DC4A 1TVEA 4E30A 3OJLA 1LA2A 2XF8A 3PZRA 3OJ0A 3LF2A 3WQSB 1UXIA 3QW2A 2BI7A 4M86A 2ZKLA 4OKNA 2VNSA 1ID1A 1KYQA 3S8MA 1GY8A 1RM5A 2BFMA 3F1KA 1E1LA 1KIFA 5KTKA 2UUPA 5U9CA 3DO5A 3MJEA 1WWKA 4BNJA 3D3EA 3RC9A 4ZGWA 5JY1A 3I4CA 2YZ7A 2ZYAA 4YRDA 4FC7A 4FFNA 4FS3A 4XJSA 4LMRA 4MIEA 4J90A 1QV7A 3GVPA 1MFPA 1RM3A 2YDXA 3DZIA 3WLEA 3ZNNA 2CDAA 2BKAA 2RAFA 3M2PA 5CAEA 3NJ4A 4J1QA 1XEAA 4OXKA 4FDAA 2P68A 2V7PA 4E2YA 1YB4A 4E12A 1J49A 2C7GA 3Q11A 1ADFA 1U5AA 2X22A 1AN9A 2P9GA 3H9UA 4BO8A 3KYDB 3B6ZA 3I4FA 4NQZA 2G82A 4XB1A 4DXHA 1GPDG 3GDGA 1VJTA 1RM4A 2Q50A 3JD4A 4G5HA 3H3FA 4L75A 1LDMA 3KV3O 2PY6A 3RI3A 4YT5A 1HSZA 4E5NA 2FN7A 4UVGA 3FHLA 3CTMA 4EW6A 2HDHA 3BTOA 1Y6JA 1H5QA 3L4BA 4KQWA 4UEKA 5AXDA 1PQWA 4BMSA 4CLOA 3KXDA 1AGNA 4HP8A 1YWGO 3CMMA 4FOOA 2JFHA 5IDQA 3OQ1A 1R4NA 1LXCA 4YDRA 4BQPA 1T2FA 1NASA 4M1QA 3WTBA 3WMXA 1E1KA 4YYZA 4RPGA 4PG7A 3B1KA 1ONPA 3QVOA 1UP7A 3UN1A 1NM5A 5TX7A 1LUAA 3MTJA 4CR6A 3A4VA 2GN4A 3FF4A 4L9RA 3PIIA 4NJMB 4J9UE 3V1TC 5ILGA 2G1UA 1T2AA 3JYNA 3PXXA 3U5TA 2F1KA 3UH1A 4JBGA 3KO8A 5HS4A 3GZNB 3KEQA 4WOJA 1A7AA 3ONDA 4I9NA 3W4JA 5FWNA 2W8ZA 2HRBA 3C24A 4AFNA 3BMQA 2OFPA 3AUUA 4JNKA 1WDLA 3U62A 3HN7A 3ZNPA 2B0JA 2X6TA 4CM9D 1U3TA 1MX3A 1ZEJA 2OMEA 4R1NA 3PRJA 3QIVA 4DBVO 5DF1A 3K31A 4ND1A 4UEOA 2VN8A 5F3RA 1O6ZA 2EIHA 3GFGA 5A3VA 1Q2XA 3HJAA 3I9NA 1PR3A 4ESOA 4O6VA 5EMHA 2Y1GA 4C4OA 4A03A 3GUCA 2D3TA 3LDHA 1EE9A 2OORA 4EJMA 4IGEA 4XYMA 5L45A 3QWFA 1C0KA 2VHYA 1Q7GA 4YPOA 3GK3A 2DFDA 4JLWA 1NFQA 3IMFA 2HKIA 4DBZA 1Y9AA 1YQGA 3CZMA 3GAFA 3ORFA 4B7XA 1A9YA 3KYCA 4ZICA 3OIDA 5B4TA 3ZHYA 3AOEA 3QSGA 2I3AA 2DUUA 3QVXA 3WJAA 1NQAO 4MIYA 1W4ZA 1U3VA 2OO5A 2XPCA 4TVBA 1R6DA 4LSWA 5EESA 3Q9UA 3K8ZA 4N18A 1WW8A 4RO0A 4RVSA 3RBZA 1PJCA 3AU9A 3GN2A 1V3VA 1E3SA 1NBOA 2AXQA 1I30A 1HYHA 2B69A 2CVQA 4E2WA 5KJCA 2VYND 4DUPA 4WPGA 3WBFA 3FI9A 4FFLA 2GD1O 1PL6A 4Y6SA 2Y0DA 1XR3A 3JQDA 5F5LA 3GA0A 3PQFA 4E3ZA 3RQSA 1A27A 4CMCA 4NDNE 1I3KA 4DLBA 1DIHA 5CEEA 3VPFA 5JCXA 5CG1A 2OZPA 4KUHA 4DYVA 3O38A 4R3WA 5JAZA 4RVDA 3GEGA 4FQ8A 4CM3A 3WOHA 4UUNA 5L53A 2YV1A 1Q7BA 3FWNA 3QJ5A 2P2SA 2X9GA 3EDMA 5B1YA 1KVQA 2O4UX 4LCEA 2JD2A 1M2WA 4PN3A 2I76A 3F4BA 4RDIA 1QRRA 4GVXA 5F1OA 4DVJA 3VZQA 3G49A 4RZHA 2YY7A 1DEHA 3ZWXA 2NACA 3MWDB 1DJNA 3N58A 4ITUA 5KOIA 1W8DA 1I3NA 1U2GA 1WVGA 1H2BA 4ND3A 3VPXA 4UUOA 4KTVE 2VYVA 3ZHXA 5FEUA 3IOYA 1JKJA 8ADHA 5L95A 4BNNA 3VDQA 3QA9A 4L8VA 5DOVA 3CH6A 1E3EA 4EEXA 3ONFA 2B5VA 3G3EA 3CSDA 1HE2A 1GZ4A 3O9ZA 4CV3A 4IGFA 4AJHA 1R12A 4LN1A 4XQEA 4FGSA 3Q2KA 5DP2A 1LDEA 2PK3A 2AQIA 4IMRA 3QLJA 5IDWA 1EFKA 3WMWA 1DHRA 4WEQA 3WGZA 5G0WA 3H5RA 1P45A 2FSVA 4LW8A 1GUYA 2YQ4A 4IZIA 5G4KA 4NU5A 3ZWVA 2X0JA 4GSKA 2D5CA 4GKVA 1ML3A 4BNHA 4DA9A 1GYRA 2X7HA 4OHUA 3OP4A 3BMQB 3H9EO 3TPCA 2HSDA 1QR6A 3MTGA 1XGKA 3JQ8A 1C0PA 2GF2A 3FRJA 4EUHA 3D3WB 1NQTA 3V2HA 3L4BC 2FPPA 3WTCA 4ZU3A 2IXBA 4WNIA 2VHZA 5KCZA 5IG2A 5K6AA 2R6JA 4S3MA 4JIGA 4GH5A 4NFSA 3UHAA 2QZ9A 1P0FA 4J0FA 4ID9A 3OHSX 1VL6A 4PLPA 2NTNA 1T24A 1PZEA 3B1JA 4MOWA 1YE3A 4A27A 5BNIA 4D42A 1ISJA 5ENVA 4CMEA 1DB3A 3PYXA 4WLOA 2UDPA 4ALJA 5CEFA 1LX6A 3U3XA 2J5KA 1PGPA 5DOZA 3RFTA 1BW9A 3R6DA 4OKIA 4Z9XA 3D64A 5GZ3A 4ZQFA 5ES3A 2HQ1A 4F45A 1O0SA 2O3UA 4AJJA 1FDVA 5AVOA 1WNTA 4HADA 1HDYA 1OBFO 1P44A 3DTYA 4MVJA 2VRCD 4BO4A 3TRIA 4O59O 2PZMA 4R3NA 1WP4A 3WWYA 3PGJA 2B36A 1HETA 1YONA 5CDUA 4HFRA 1WMBA 4LRTB 3NYWA 3KYCB 3GC6A 2ZTLA 3ZWCA 1PJ3A 2JL1A 1T2EA 2NQTA 4CMIB 1NWHA 2YV3A 4I5GA 4R01A 4UVHA 3HUDA 4N5MA 1Y5MA 2EJVA 3AUSA 4PZDA 4Z9YA 4QX6A 4N5LA 2P4HX 1BVRA 3CZRA 4MIOA 4Y67A 1L1FA 4FFRA 3RVDA 4W7IA 3IJPA 3EW7A 1MGOA 4I5EA 5EQDA 5J23A 2D59A 2SCUA 1GQYA 2D0IA 1I2BA 1VLLA 2QRJA 1HF3A 1PWXA 2HJSA 2B4TO 2Y05A 3H6KA 2O4CA 4RVHA 2R00A 1D4FA 4JP2A 5BSFA 1EZ4A 1J0XO 1C14A 3VH4A 2ZIZA 2ZCUA 3ZV4A 3B1FA 5BNTA 1JWBB 2YHIA 5L7YA 4AJ1A 4YRBA 4CJXA 4CUKA 4CLEA 4AJLA 1KVTA 3HN2A 4M55A 1R15A 4WECA 3VAZA 4CL3A 4WLFA 4HFNA 1C0IA 4M87A 3NT2A 4II2A 4CLRB 1U7TA 2X0IA 2Y0CA 3U09A 1EUDA 1GQ2A 1KY5A 4M8SA 4AJNA 3OF2A 5BSHA 3GDFA 4BKOA 4CLHA 1NWCA 4KZPA 1V8BA 1YO6A 4PLTA 1KY4A 1DRVA 1E1MA 1H6AA 1HLPA 4RV9A 4MVJE 2Y1DA 4OL9A 1R37A 3JQAD 1X7HA 3I9OA 3O8QA 3PFFA 3C7CB 4DC0A 1X0VA 1IULA 5TJHA 4PLWA 4J4BA 4U6SA 5A02A 4NG5A 1S6YA 4R9SA 3RU9A 3VKVA 4WKGA 2X86A 3ULKA 2Y68A 1E7QA 1M6WA 1NHGA 4DMMA 7MDHA 2I9PA 1TT5B 4IQ0A 4A73A 2BHLA 5I8WA 1LDYA 4K28A 2DAPA 4RF4A 1TEHA 3AUAA 1HDZA 2Y66A 1E5LA 1MXFA 2WWRA 2JD1A 2EW2A 2DTEA 1X14A 4CM4A 1ISGA 1V3UA 4R16A 3RKRA 4EZBA 5C3MA 2Y1EA 1ENPA 2P9EA 5I9LA 3W8EA 1Q0LA 4NR0A 2ZCVA 1A71A 3EAGA 4BNIA 2DT5A 2O23A 3Q2IA 4L0QA 1ENYA 1IHYA 4F6CA 1XLTA 1WXDA
chains in the Genus database with same CATH superfamily
2X3YA 1A5AB 1HDCA 2XE7A 4NU0A 4DJEC 4YAUA 5FA8A 2F8TA 3F5SA 3GD5A 1L8LA 5FOVA 1ZH8A 4HGNA 4X1YB 2QM8A 1FIUA 2A5GA 4Q5IA 3WHKA 1WSDA 1T5OA 1WOMA 3PTAA 3ASZA 5TF4A 4B3MB 2IXTA 3H2IA 3OP1A 1BOOA 2Z2XA 3BCSA 3PRKE 4LTMA 1FQJA 3MGCA 3IR6A 3SMVA 1RC8A 1Q1BA 1UODA 1XDBA 3KUXA 4JDPA 4LWQA 2VF7A 4YCAA 5CITA 1XHFA 2MMCA 1EUCB 2BKUA 2OCXA 3HEAA 1X8JA 3PI7A 3AMVA 2OT3B 4DMLA 4Z99A 3TBHA 3E7PA 5ALOA 3KQQA 1GSAA 2IC5A 1D3AA 2EEPA 3N6VA 4ZPXA 3DONA 4M46A 1GLVA 5EXTA 1OGIA 4HWKA 1OFUA 1XJWA 3Q1LA 4ZFNA 1O95D 2I5PO 4KE7A 4G4SP 5AW3A 2XIJA 1JQJC 2FSPA 3GLQA 4R8KA 4FW9A 4PFJA 3RT9A 1M9NA 1NUHA 1GIAA 3ROKA 3W5VA 3AESB 3OH8A 4TGLA 5I4KA 1Z29A 1KQGA 1C3EA 3VMMA 1W5BA 1TEXA 4PC3A 4U2CA 2VWQA 3X43A 2NYUA 3QPBA 4YMHA 4KBFA 4EB6A 5B6IA 3R5HA 1U0TA 1PJAA 1KVUA 5EUQB 2CBGA 2VDUE 4RABA 4CM8A 4KIGA 2KB0A 2BDUA 4DLUA 1R1DA 3PGLA 4ZAZA 2Q3JA 3OIGA 1E3QA 4LF4B 2QRZA 2A7XA 5CM9C 5KSYA 1M72A 1U8CB 3KJQA 5KVSA 3CQ9A 4N6GA 3DMFA 1CDOA 4GKKB 1DARA 1E9CA 1FFBA 1GRCA 1FVFA 1U3GA 1G7TA 1Y1LA 1YDEA 3W5JA 1G5QA 1W2HA 2QTBA 2EKPA 2WE8A 1H93A 2HK7A 4ZZIA 4ND6A 5BN3B 2JI8A 3WO0A 3ZD9A 5E6UA 4EI9A 1TYEB 4MUXA 4UE3S 2ZIXA 3BRQA 1XTSA 1R6XA 3FTQA 1RXYA 1YCHA 2PQ6A 3BJZA 4PM4A 3RRMA 5HKOA 3CTPA 1TB4A 5FUYA 4LXGA 1KSGA 5I9IA 5JMTA 3L6DA 4YPFA 3TMKA 4MW7A 2XMSA 1OBOA 3CF0A 3HVHA 1BA3A 4JZKA 1SRRA 3L8EA 4LISA 5EVJA 4B5LA 3GLFB 3RC1A 4PF1A 1KC1A 1K08A 5EWLB 4KFCA 3ABSB 3HJHA 4W9NC 3VU0A 4R4JA 2H1CA 1SXHA 2QPOA 3FTCA 3UAZA 1USWA 1ZCFA 4Z53A 3OPYA 3U16A 3F5DA 2IT1A 3GLHE 5G0UA 3OHPA 2WI8A 1XDSA 2X6QA 2HNKA 4IQ8A 1SQ0A 4II3A 4ZO7A 1USVA 1PJ8A 2GR9A 2I6UA 2ANBA 2WUEA 1WU8A 3HCBA 3ORQA 4CGYA 4JVLA 4IFEA 3KTFA 1XRPA 3AVYA 2P2NA 3LXXA 1C29B 1W0KA 3HJBA 2BOVA 3PWKA 3O3NB 3TW0A 3U4DA 4AIIA 1GGVA 3T7CA 4AS3A 2FSFA 4PZ9A 1SMKA 2DLDA 5ICCA 2B6HA 1WY5A 3SOPA 1C7ZA 1ZICA 4XR9A 1G3RA 4ECEA 2MR6A 4HAZA 4B2IA 3IDQA 1QRSA 1F9AA 1XWWA 3I42A 4UU0A 3LIIA 3TSYA 3K0HA 4XB2A 4QU9A 2A88A 1Z7BA 3U3KA 4OHBA 5I7WA 2OYSA 4X71A 1XZIA 3NGLA 2F1OA 1CF2O 4ARIA 4E14A 1SUBA 3ZZUA 3A1UA 3EW9A 3QU9A 4YAGA 1O94D 3DM9B 5GAJA 1QIKA 3L6RA 1PEDA 4Y0VA 1DCTA 2VH2A 3LP5A 4BEBA 1PR9A 5JROA 4JQZA 2FEKA 4NG4A 5K8TA 1Y34E 4GE0A 3PQEA 1QGZA 4P7KA 5CBPA 2JJ2D 3V00A 2HT1A 3JQBC 2H57A 1YK0A 5ESXA 4G81A 4Q48A 5DX0A 2OFWA 3TRJA 3U7QB 4BFLA 3ZJVA 2WTAA 5AJUA 5DPMA 1T9KA 3PDIB 2O14A 3JD0A 2AYXA 1IJEA 3F9RA 3LT5A 4BMXA 4ALNA 1Y8QA 3WVNA 3N5KA 4C0SA 1Z45A 1VYUA 1KH1A 5IJAA 2Q1SA 5IKMA 1AQYA 4RW0A 1GRQA 1L5HB 1U5BB 1U7WA 4LQCA 2AJLI 2VBIA 4ZYTA 4C04A 2WKSA 5CTJA 1G0OA 2EP7A 4BGUA 1C1YA 1ZHHA 3DCJA 4MUYA 4HJXA 4P2BA 2QAJA 3R6TA 4MS3B 3KTDA 1ORDA 3EIFA 6REQA 2P4QA 6REQB 1Y7IA 2VSXA 4RM3A 1V3QE 2POQX 1ZMBA 2X19A 3AHHA 5J5VA 3B7PA 3D4OA 4H1WA 4F38A 4DXDA 4UMFA 1BEEA 5CU7A 2ZWOA 5JRDS 4J16A 3REQB 5HKBA 3M81A 4PIPA 5B7GA 4KITB 3K71B 1CP3A 4K9QA 3DNMA 4QUKA 4WQMA 3HA2A 4UFPA 3GRZA 3RWOA 3G0OA 2NU7B 4YCCA 1DIBA 1JW9B 2IYWA 1LK7A 1FSFA 2X3FA 5JAIA 1VHJA 2BMJA 4BBJA 5KHOC 2FK7A 3NPMA 1RYFA 5C31A 3ZDRA 5SV2A 3IL2A 1VB3A 2Q3MA 2XA9A 3D31A 5ABPA 2P1RA 1OIWA 2V8BA 3E22B 4INPA 3QELB 4DRZA 5GADl 4LJ8A 1URPA 3H7AA 3EPJA 2RH9B 1Q1NA 2WJWA 4IEIA 4NCAA 4UAGA 1NLYA 5T3UA 3ETJA 4HDOB 1DKRA 5HSGA 5DTEA 4ID3A 6ADHA 2QDXA 3S1AB 4IIBA 3AVTA 4KVAA 4C7OB 4BU0A 1K8XB 2QXUA 4J2HA 2Q6KA 3TLEA 3SM9A 1JDBC 1EA5A 1GZDA 3QOWA 3RTBA 5ILOA 4JV5B 1Z5WA 1HTWA 2V7WA 4ZRDA 3HB4X 3QYFA 1SAYA 3UTDA 2XQKA 2AF3C 2CDBA 3RU3A 1Q20A 4M83A 3WQBA 1GNRA 1TPYA 1X19A 2PWAA 3CN7A 1CYEA 5MFZA 1WHTB 3SZMA 2VTDA 4QYSA 1T3HA 3TNFA 4HPXB 1ENOA 4LHEA 1R6UA 1JAHA 1Y3FE 1S9HA 3PNVA 4QQRA 5IANA 3W8NA 4CKBB 4CCSA 3K0BA 5A4FS 2G4CA 2X40A 2PUWA 2O0LA 1JDTA 2KMLA 3G5LA 5DFAA 1T9CA 5IP5A 1NLZA 2DY0A 3F8WA 2ZIWB 4HQKA 2C78A 3ENNA 2R7AA 3PQ6A 3HWX1 5THKA 4B4KA 1TVKB 1OUMA 2FZVA 4U0JA 1HM5A 3C85A 4YMIA 3OQPA 5CK4A 1U31A 3OOEA 5EQJB 4KQXA 3EZLA 4ZYZA 5EJ7A 4G0YA 2XZOA 2MYUA 2NVOA 2IU6A 3M5PA 4ZYVA 3VTFA 1G2QA 2CHGA 3DE2X 4GG1A 1FUKA 2AHOA 3VJMA 1KJ9A 3O1HB 4NK5A 1OILA 1ZAKA 4A6EA 4OXYA 2C03A 2C54A 3NETA 4DA8A 4MVJM 4UOZA 4XX0B 3KK0A 1J24A 2NTVA 3I5AA 3LLCA 1XZ8A 4IXWA 5JDCC 5IBPA 3DE1X 3GUYA 4MYTA 2Q3LA 1SUSA 1TO6A 3FCYA 2FR1A 4QBTA 5CCEA 2QSJA 2HQBA 3FBTA 4CLDA 2YVLA 2BSAA 3FOWA 1W47A 1YA6A 1OJLA 3PD0A 2CFIA 5C1DA 4XQ9A 1FU4A 3TOSA 1ZBQA 1OOEA 3E9ZA 2TMDA 1IPEA 1QMPA 1CCWA 1N6KA 2WW8A 1CQZA 3OTGA 3R7NA 2YNMA 3F6PA 3BEDA 5A3SA 2C2MA 1Y80A 3BB1A 2E6UX 3FDJA 5I3ZA 3AVOA 5IAAA 4BLUA 2MINB 3NDJA 3JQAB 3N05A 1PHRA 2IDKA 5L7WA 5CDFA 3STTA 2GAFA 2ZWAA 2FLWA 4BMVA 1E0JA 1N1DA 1UOQA 1K7EB 3QU4A 4TROA 5HKKA 5LMNB 3UJPA 2AJ8A 2HJVA 3L82B 3TZEA 1GVNB 2PNFA 3NUZA 2J3IA 2YJ5A 2HA6A 3CEMA 4DDVA 5AMXA 5CVCA 1VCMA 3WGYA 3U7IA 4A26A 2WYVA 1QVRA 1SIBE 1ZG3A 4Q47A 2X1VA 4DCTA 4QXPA 2F3SA 1J2RA 1NN3A 2W2TA 2ADMA 1SB9A 2AXPA 1QHGA 3F2IA 1L7DA 5FBRB 1K9SA 2QUHA 5D7NA 3ZU2A 1Z6YA 2XXAB 4F60A 2VF4X 4L28A 4EG0A 4D0SA 3ZDCA 3OMXA 3IVGA 2RBEA 2NP6A 1T9ZA 1IUOA 5C8XA 5K6AC 3TI7A 1F17A 2PSFA 2ZB7A 1G3MA 1SGWA 2W8BB 4JKIA 3UAVA 3G2NA 2J5XA 1J9EA 1V9LA 2HD4A 2XSZD 1RI1A 1IMOA 3EGXA 3EBPA 8MHTA 4UNSA 3TCNA 3L77A 5SY6A 3L6EA 4HNQA 1XDWA 1L4KA 5EIAA 4IQGA 3I45A 3OZBA 2O0KA 2WPNA 3UUWA 1DINA 3ABIA 3ZWAA 1XCBA 4YAKA 1R3DA 2MSWA 3V4OA 4M7WA 5ERYA 3Q8MA 4UUMA 1XNQB 4PO9A 4OYRA 1JVNA 1QIHA 3PQ8A 2PRSA 2WF6A 2CB0A 1OWLA 5ITZB 1P62B 3FAKA 4Z0HO 1YK1A 2PVSA 5I7AA 2VQ3A 3QLEA 4YAOA 3AERB 3ZBUA 1TCAA 2QLLA 3E18A 4ZZ0A 1VKJA 4DDKA 4AK9A 5FHRA 4R1PA 1UZAA 4JBLA 1QIIA 1RE1A 2ZBEA 2A7QA 4XUEA 2AFIE 2Q99A 4DT1A 5FDFA 5KEIA 1MZPA 2WG0A 1ADJA 5HUQA 4LJSA 4KXYA 5LLDA 2WD8A 4FKZA 1B2LA 4WZZA 2ERYA 5F52A 1VPVA 3U7HB 1D5CA 1P2GA 2BY4A 4MW2A 4Z6KA 4Z4GA 1E7RA 4NDAA 3WBBA 1GTJ1 2JKYA 4QXRA 4RETA 3O8QB 1AQJA 2IXDA 2XGOA 3PVSA 4K9LA 5CW2A 5FPPA 2D6FA 4IDQA 1E69A 4E31A 2G70A 2RGEA 1SBHA 4KKVA 3VO2A 2Z5LA 5C7IO 5LMUB 1NSTA 1M2HA 3ABOB 1RAAA 2AMLA 3PK0A 5AI0A 3PD7A 1FDTA 1K3FA 4GC9A 4LZOA 4PGHA 2IYFA 2DKNA 4WUVA 3R5SA 1N9GA 5AOAA 3GH3A 1RZRA 3SJZA 4FEGA 2HTFA 4OJYA 3CKYA 1UK8A 1WXIA 4B9EA 4FR5A 2PX5A 4K8RB 3RTGA 1SVMA 1W0CA 1WZCA 3S28A 2JAPA 4ZO8A 4D8TA 3SP1A 4ZV7A 3D9QX 2PGDA 2C3PA 4OXRA 1E66A 5BY2A 1U90A 1ZH2A 5JSZB 3HGTA 3RVRA 3LX4A 3N2EA 1JG6A 4XKJA 1OX4B 1ESCA 1NW3A 2AMVA 3G0IA 5ITWA 4YAWA 1UH5A 3P2MA 4TN1A 3ZHTA 4A1FA 2ZTVA 3KIPA 5ANRB 4QG3A 1X1DA 2XB4A 2R1UA 2BRUC 4CEHA 1YB1A 4UCFA 5EE1A 1N7GA 1DTWB 1ODSA 3SIXA 5IVIA 4EJ6A 1PEAA 2EFCB 5AVVA 3TDKA 3SKYA 4J1TC 1U0JA 3OJEA 3FZNA 3GEIA 1S01A 2JIDA 1N3LA 1K8QA 4Y9DA 3KZCA 4P4NA 4U2EA 4EHJA 5ICEA 2VSFA 1H4TA 2BKVA 2K4MA 1PBNA 3I3SR 4O5AA 1XQVA 1DC6A 2C8KA 1KAGA 3H16A 4HLUA 4PVCA 3RTCA 3TKAA 1M7BA 4TYQA 3AP1A 1E4YA 3ELWA 1N5RA 3GJXC 4PX5A 1W73A 3HP4A 1U4SA 5DGHA 3TSCA 1K7XB 1ZXLA 2PV7A 3Q5EA 4MV3A 4D46A 3I9LA 3L0IB 4HNTA 5CXQA 2XOXA 5GIPE 3INRA 2WAAA 3PNOA 2ZE6A 2Z30A 3U48A 3FYSA 1UDWA 3D8TA 1RHJA 3H5OA 2LCQA 4B8WA 4CT4B 5JTUA 2EV9A 2PS9A 2OK7A 3KLNA 2P3QA 3EIUA 3P2IA 5IJ9B 5IK2D 5IX8A 4H0CA 4OGWA 5JFGA 2XB9A 1NAHA 5ECGC 4CR8A 1E1RA 2X4DA 4WY2A 3A9CA 1QSGA 4JJAA 4IKEA 3UT6A 2BCGY 1QQAA 3N2IA 1MQSA 4RADA 4CEJA 1H0KA 2AC2A 5MN5A 2DSNA 3ZCPA 4MDFA 1JJ7A 4CMJA 4BQQA 3KQLA 4PRLA 2M32A 3O4GA 3NJRA 1R4ZA 3RADC 2Y93A 1ZGJA 2E5WA 3PNKA 4MLCA 1ODJA 5AOBA 3PQCA 4QTZA 1ZMTA 2YFQA 1UBEA 4N0MA 4BB0A 2AYYA 4JYPA 3DV2A 4MRMB 2PL9A 1W87A 2BISA 4JCOA 3ICWA 3K9FC 1H5NA 1P73A 2F55A 1QDUA 3EGVA 3EYWA 4HGRA 4WXRA 3IE0A 4DLSA 1T1EA 2IY9A 4RTLA 1QGOA 1QK3A 2OHVA 3CH4B 3G5AA 4FJ0A 1E9VA 1E89A 3FOAA 2ZJ2A 1E3JA 3EVCA 3W6OA 1PGNA 2B37A 2IEYA 4LC0A 4QPNA 4LRQA 4G2NA 1UFKA 3FCEA 4HLDA 2MMGA 4PQGA 3UA4A 5LKRA 1HT2E 4A15A 5KNCH 2Q4BA 3TBKA 4DQKA 2PXCA 3N2NA 1KK0A 1ZS9A 3PXEA 2PUDA 3A6GA 2G07A 2WSMA 2W2LD 1FYVA 1EWQA 2WYWA 1M1YA 3E3MA 4MROA 4DEYA 1LLUA 3EPLA 3HU3A 2ORYA 5AHWA 3DOCA 4INAA 4DARA 3IURA 3RNOA 1OXKB 1I9GA 3RYIA 1Z0SA 3A4YA 3DEZA 3KR2A 2DBYA 3WK9A 5EHZA 2PGJA 4GX1A 4NBVA 3I8OA 4NMWA 4D9MA 4ETIA 1VL5A 4ZQGA 2I4TA 1LZLA 3KDSE 3WLJA 2PX8A 3ZK9A 5JD6A 4JBIA 4YRJA 4NBWA 3C16C 4TWRA 2LIVA 5K6TA 4RTJA 4N1AA 1K92A 3C8MA 2QN3A 1SK8A 4QWWA 4RZ3A 5AK4A 1HT3A 2ZBPA 2WSLA 1DBRA 3KSMA 2HJ9A 1R0WA 3E1GA 4QSHA 1N6PA 2GO1A 4I08A 2XXJA 1I2DA 3U7EB 3WIDA 1TCBA 3B53X 1OI7A 4GX2A 4P38A 3VC1A 2Q3EA 3WLMA 1F0YA 1HDGO 3G88A 1RWWA 4DABA 4B43A 2PRYA 4RJJA 3KSAC 3N2KB 1B74A 1BFKA 5ERXA 2DG2A 2V7XA 4OA5A 2XYVA 4ISCA 2JGJA 3G2JA 2DPGA 3EEQA 3P9KA 2OXFA 2DFKB 1FVXA 1O94A 1U8XX 3GLHB 4KNWA 1BE0A 4TQAA 5HEKA 5IDVA 3A2NA 5HNKA 4UBMA 5JVDA 1XEXA 1SB8A 1R9GA 5IUJC 2QGZA 2G08A 1EM6A 1R0RE 2OCGA 2VHCA 4GI5A 5JG7A 3VOBA 3X3HA 5IVDA 3UCFA 4CLXA 2V3VA 3MWGA 3UKDA 5KWSA 3LQQA 2ZBRA 1MABB 2NUTB 2QGNA 1LWNA 3BTSA 4R6WA 3RTAA 3ZXSA 4RKQA 2YY6A 1NBEA 5AVJA 4QUDA 2YRFA 4PZCA 3F6CA 2MTBA 3ACDA 1CUHA 5LOVF 5AJTA 5A0TA 5COQA 2GF0A 1CY0A 1ZD3A 5E0KB 3AW9A 1AQ6A 1H05A 2G83A 3P45A 3N5CA 4AYWA 2DFVA 2EJTA 4U8GA 5IKXA 3LW8A 2QV0A 3L43A 5JCJA 3COSA 1NLMA 2XJ4A 3MQ4A 4GL4A 4LV6A 3BZUA 2R6DA 3FCSB 1CJTC 2UXCB 3CVOA 2V58A 4ECAA 2DBQA 4WZBE 1C3OA 1TKBA 3U7JA 2BZ0A 1E2UA 5HDQA 2HYDA 2P2GA 2IPOA 2FP4B 2FOIA 1MB2A 2TMKA 1DPFA 5FH9A 9ABPA 2P2LA 4NU6A 1T4GA 5BW8A 1H94A 1JHAA 1QIJA 2AV6A 2IHYA 2WJ4A 3EYAA 2FJUA 4BRSA 1ZOIA 3CF4A 2YBEA 3E15A 4JC4A 4RYDA 4XUDA 3U60B 5KNCD 2F90A 5BR4A 3CLRD 5EP1A 3GNLA 4BBZA 5F1PA 2AG1A 4HGOA 3DFZA 3HKCA 1OLXA 3LLVA 4M1MA 4C6TA 4I2NA 5J2TA 1XWFA 1GLNA 3KSRA 3FD8A 1BD3A 1ND5A 4MI6A 3W04A 1TAHA 4OJQA 4L27A 3P0HA 1QHIA 1Q3KA 1FX1A 1Z8NA 1ZISA 3RRXA 1KAQA 2WKPA 2Z5FA 4ASUA 1OU0A 4RSHA 2O19A 4G65A 4YQZA 3ICOA 4N3GA 3JD3A 3GJSA 1A0OA 2CUNA 2W00A 2B8NA 4Q9AA 1UC4B 5ALGA 5FCDA 3LC0A 4G01B 4WA7A 4XIJA 1YFKA 2RGNC 3CLUD 1J5XA 2AFRA 2OUKA 2VJPA 3GJQA 3K0AB 4KZKA 4X84A 4A7PA 2B35A 3D6JA 4IJKA 4EJSC 4D8WA 4I8DA 5JOQA 2X23A 4RZSA 3WLSA 1BW9B 3LCJA 2NZYA 2UVDA 5IFKA 1ULHA 1WP9A 2CJYA 2PKQO 4TXJA 4ZN6A 4B3BA 4NZOA 4FYIA 2QD3A 4EW1A 1L3IA 1ONNA 3B9RA 3A6PC 4DJTA 2INGX 4K9OA 1DO0A 1F48A 2GNAA 3KKMA 1XMVA 1R0ZA 2VXCA 1QZ3A 5C32A 1YJAA 1PU2A 1P2SA 1X7WA 2FPMA 4PG6A 4C3VA 4DQXA 1KEPA 1WXGA 5IM4F 2JI7A 3EZ2A 1E3WA 2IE0A 1GZSA 2ISSD 3UKJA 4DMUB 4I9GA 1XG5A 2EG9A 2C4WA 2VUHB 4IQFA 4UM8B 3UJ3X 2AMYA 4BFWA 3TPFA 4Z86A 1DAGA 3TX6A 4RORA 4UDXX 1A5BB 3SY8A 1EQAA 3RR2A 2P1ZA 1P5ZB 1ZK0A 4JFRA 1UFOA 1BFUA 3SSAA 4AVYA 3U81A 9ATCA 3NHMA 2UYOA 1O89A 2V03A 2BP7A 1XL1A 1ZOLA 2Y2UA 2FZKA 3L7NA 4EENA 1T5LA 5SY9A 3VPCA 3OEYA 4YUYA 1E79A 3GFVA 1GZ3A 2I3ZA 4HY3A 1FBNA 1OWPA 1UKYA 2NUAA 4CM1A 5A3QA 1HOXA 4DAEA 2JIOA 2E87A 3PFNA 4I4IA 5B1EA 2XITA 2JLAA 3JARA 1M3SA 1SIUA 5C9ZA 1XTRA 4ZT3A 1F2UB 2AOXA 3C0KA 2R1VB 2WSYB 1NMSA 1KO8A 2AR7A 3HDQA 1O0BA 1C8KA 2R8ZA 2EFYA 4B48A 4FW8A 3ADDA 2MSDB 5DM4A 3MN1A 1X70A 5T5QA 2H7XA 1E3IA 4OYLA 4IMPA 3NX4A 2IWHA 3LTEA 5JPCA 3EC1A 1US8B 3IPAA 3CNEA 3QXHA 1HWYA 2B82A 4CRWB 1UDAA 2EF1A 3QKIA 4V0MA 3BA1A 3EIHA 3CFYA 5HBGA 3ZLBA 1TZBA 2O7SA 1JPVA 2GSDA 5MGNA 3V97A 4AG3A 4K6KA 6YASA 5TE9A 2CWDA 4Q39A 4KQCA 4XJVA 1BXGA 4R6XA 1R9JA 1LFDB 3FBWA 4P4TA 2HMSA 3S2FA 4MDHA 1OKKD 4XYGA 1PDWA 1VXOA 5MGBA 2G88A 1LTKA 1GNLA 1CS0B 4H1HA 4QC2A 1JALA 3T9DA 1KTVA 3I2JA 2FZGA 1O96A 4WFJA 3U4MA 3RJ5A 3OZSA 2LGJA 2I1VB 5JPDA 1ONSA 3ZI0A 1KPHA 4CWAA 1E1RD 1S1MA 2AD1A 2O8BA 4HAVA 3ZC3A 3DTVD 4ZDJA 2QUAA 4ENSA 1T5SA 2XYGA 3IUNA 2P27A 2UVQA 3MQ2A 3AY6A 3ZV5A 3WGOA 1E1CA 1P2TA 3E4DA 4BRWA 3RRJA 4AZWA 1SOVA 1ORIA 4MP6A 4JZYA 2E89A 3KETA 2QYSA 2Q49A 4L8LA 3IHTA 4PS0A 4PHGA 4PYKA 5IKEA 2VQEB 2ENUA 5THQA 1FXUA 1SHZA 2ODQA 2RH4A 1H1LB 5AM4A 4IVPA 5JI2E 1CQIB 1TK3A 1U8FO 1YU6A 2QLTA 4FFMA 4BFUA 2QF7A 1NNUA 3D8UA 4HT3B 3NHBA 1Y42X 1I6WA 3RDPA 3ZTTA 3IVMA 3P9CA 4ZCSA 1FX0B 3N2GB 4IDNA 5DBGA 1WVIA 2OQ2A 1NKTA 1ZIDA 4W5NA 2CE7A 1AUOA 1Y8RB 3HYTA 3OF3A 4ND4A 2Q28A 3AKZA 2ZE5A 1HFKA 1G20B 4XWYA 5HVNA 3L41A 1PW7A 1UMBB 2PD4A 3A1TA 3TTYA 3HPQA 1E9EA 3F9IA 3DV9A 2CJPA 4FYKA 2ZT6A 1KK3A 2GJ9A 2WSSD 2O2CA 4QGGA 3T61A 3NIGB 1V6AA 4NDZA 3EUFA 3RRBA 3MWJA 4CM7A 3ANLA 2PCLA 4M1ZA 2JIQA 1MENA 1OR8A 2SKDA 3DXZA 2IX3A 3O03A 2VT3A 3Q8XB 4EUFA 3LTNC 2QTMA 3MMSA 2PPLA 2BGUA 1E18A 3JYPA 2XMBA 4PZLA 3KVOA 2O9JA 3GDHA 4J8PA 3DPUA 2I7CA 3QK7A 2F9MA 3UYLA 1IZ0A 1YVDA 2CZCA 4H3HB 5A1JA 1R4MB 3T3PB 1E7WA 1EWVA 3HJRA 5ETJA 4ZT2A 3ZW7A 2XYHA 1XMQB 3HWRA 2RGXA 1NGSA 4QOHA 3RUEA 3U9TA 1XUOA 2QRMA 1ISFA 4KHZA 4N39A 4PYRA 1YZGA 3NZEA 1IPHA 3A36A 4OJNA 4EPWA 1WXXA 1KEUA 1RHRA 2YX1A 5IJ0A 1R0CA 3MWEA 4KVGA 1Y3BE 1A8HA 4QAJA 1IC6A 1U1GA 3QSYA 2GBFA 4X1IB 1L4UA 2EQBA 2W90A 4P81A 4EF4A 4MP8A 4UXJA 1KVRA 4Q18A 3IIEA 4EHDA 1RAEA 1T8YA 1UWVA 2X9VA 2QN9A 2V65A 3LPLA 4U4AA 4HEHA 1YH3A 3H2ZA 5E9QA 2CVOA 5K1ZA 5BYAA 4OOFA 5B2ZA 1GRNA 4FX5A 3DBRA 3PEWA 3E61A 1GZUA 3H86A 1HL7A 3IVRA 4NOJA 1T4CA 2EU8A 5IH7A 3BG5A 2PKRA 2FLVA 3CNBA 3KLPX 4IF4A 4HUTA 2ZR7A 4KRGA 1APBA 4A2CA 4PLHA 2AW5A 1RYEA 2ZSDA 5CB4F 2P9CA 3A06A 2UUOA 5T6BA 1V11B 3RSHA 2BMAA 2Q41A 5LIRA 2O3SA 3RANA 4R8VA 3VR3D 1CWUA 3D7KA 1OLSB 3C5EA 5DHRA 3WK6A 6Q21A 1O6CA 1E8NA 1L4HA 4BGEA 3S81A 3M4ZA 4J07A 4A9AA 2J7PA 4PICA 3I5XA 2BKXA 2OLJA 4O33A 3ZCUA 4B71A 4BX8A 4DOMA 8OHMA 3NTVA 2BGNA 2LR0A 3B1YA 1EEXB 1KSHA 3QOXA 4QEZA 4DZRA 4EKIA 4ND8B 2R4QA 5JHHB 2FFQA 4UPDA 2LRHA 2G5PA 3GLRA 3ZZ1A 5JQWA 2J45A 1ZESA 3HJFA 3SYTA 2GK7A 1TIKA 3MTBA 2M6KA 3NTRA 4BZQA 2ZIAA 3OU6A 4CZ2A 4L76A 4DCNA 4EGCB 3FYUB 3OU2A 3W7BA 2KM1A 2D0PB 2VLBA 2F59A 2F8MA 5FV7A 3UWSA 1SKUA 1PUIA 1DS6A 3RT1A 1GTMA 3KX2A 3DA8A 3GFTA 4UC0A 1XP5A 1CF9A 2A8YA 2DCMA 2Q6OA 2PS3A 4MINA 3VPDA 1HGXA 1JR2A 5FYDA 5K0BA 4F5ZA 4F3NA 4IDBA 4D0RA 4L95C 4LF8B 1KYXA 1L4MA 1Y6ZA 2DTXA 4R2KA 5EP4A 1Q0TA 3R3YA 2HJRA 3WQQA 3U5ZB 3E8XA 1FNMA 4G23A 1UP6A 1M2FA 2UKDA 1GQSA 2VSYA 2W2QA 3L9XA 2JGNA 4POAA 1CY2A 2Y0EA 4MKRA 5CJ2A 4L4SA 4IHJB 4N12A 3WL6A 2CSUA 2XVZA 5C35A 2FSIA 5EMNA 1ESNA 3EAFA 1HY3A 1C80A 1I2CA 4U9UA 3ZZNA 2AI1A 4UTZA 2YIMA 3X1YA 3LBNA 1KMIY 1PS8A 2R79A 4FMDF 4M9RA 4P4LA 1UBRS 2XMCA 4OYHA 1RS0A 3QE0A 2AS0A 4HK4A 1YB2A 2ACKA 1DU4A 3B3FA 4M3NA 4YIKA 4DBLC 5DGXA 4CBVA 2QW8A 3FDZB 4KJZA 3DOEA 3FYCA 1CUUA 4RPCA 1R64A 3DWGA 5ALEA 3RQIA 2PV0A 3CKLA 3O83A 4Y2RA 4GBED 5LYJF 4I1SA 4C5BA 4E2XA 1IATA 2IH5A 1LS6A 1JWAB 2QNBA 3BMCA 3I9FA 4L16A 5FLEX 3RD5A 3GA7A 3KSBC 4DMFA 4F4FA 1V43A 1XQ9A 3CRW1 1CUEA 1D07A 3TB4A 1SD5A 4TLLB 2FHPA 4P82A 5DHFA 3UKOA 4AT1A 1Z6TA 5I7RA 4GUDA 2WHXA 3SNHA 4IDCA 1R6VA 3WSWA 2W6CX 1B76A 3JYOA 2IOHA 4O2AB 1AY0A 4G67A 3ZDEA 3UF0A 4E4YA 1JIUA 1I14A 3CG0A 1UJNA 3MBKA 3BJIC 2ZTHA 1LPMA 4ZZ3A 5D5PA 2PMBA 4JLJA 3AHCA 1FXSA 2C2OA 2FJ0A 2VXOA 3R2JA 4JYCA 4Y7DA 3RVNA 3PZBA 5LSAA 2QL7A 4DB2A 1Q3TA 2GSWA 2RKBA 2VPTA 4IIYA 1JG1A 2W4QA 2PSJA 4QOEA 3SZLA 1OLUA 3H2JA 5JZBA 1WHSA 1E63A 1FY2A 2CFRA 3WL4A 1BO6A 2RB5A 4C4XA 5EZ5A 1FE8A 5JZMA 4D8YA 2GBIA 1U6JA 3JQFC 1NX9A 4LSMA 2QP4A 2XNHA 4BP9A 3DM5A 2W4MA 1ZXBA 4KL8S 1KKUA 1H3NA 1CY4A 2C1EA 3I52A 3P9PA 4PAWA 2OC4A 3PJFA 5E3HA 2RBKA 4TQ9A 4N7RA 3S40A 3QRWA 3C5WP 5F7OA 2YWRA 4DADA 5J4LA 1TU0A 4IGIA 4RNDB 1E1NA 4EI2A 3UC9A 4S04A 2WICA 3SIWA 4GUAA 1ZK1A 4AY3A 2VDWA 3M6MD 4Y1RA 1NOKA 4CQMB 4EMBA 1LBHA 4CF5A 2O2YA 4DG8A 1R16A 5AK6A 3P5SA 4MV0A 1SBQA 5HDBB 2Y1OA 3NTQA 5H70A 4W9RA 3PJRA 2EYUA 5AKJA 2IA5A 5EWMA 3E3OA 3PDUA 3TEMA 4UNNA 1YDGA 2VZ8A 3MGGA 2MINA 4MR7A 3LL7A 1I4EB 3GCGA 2CJWA 2HQOA 2B2CA 2CJWB 3AHJA 1E59A 2VK1A 4O8ZA 5E6RB 5HFAA 3NMUF 3WRYC 4HFMA 1TPZA 3LQFA 4Y6QA 2FEMA 1QKIA 4OD0A 2PT6A 4I14A 2DR2A 3CZPA 2WF8A 2QPTA 4FGKA 3DHYA 4PIMA 3THWB 3Q40A 4OEHA 4DUZB 2A9KA 4U00A 4PN7A 3DQZA 2D54A 5EZSA 4J2OA 2I3DA 1C7QA 1PYOA 2CKDA 4LTDA 4W6ZA 2V98A 3RYFA 3EUWA 3FYDA 4AZVA 2ORED 1NYTA 1W9HA 2B7CA 1H2EA 2E82A 3CO5A 5GPBA 1N2BA 3ROTA 1KO1A 4NHOA 1D09A 1DO8A 2O1XA 3GT0A 4JB0A 3H2KA 4CI9A 2OTCA 1EMDA 3D0RA 2F43B 2XXAA 4R05A 2UYGA 2G1JA 3B36A 4MGEA 4YI5A 5LCXA 3SFVA 3QVSA 1MKYA 2I87A 5TB5A 4IO0A 1EP2B 2BR4A 4H4EA 3E82A 4HH1A 4QHSA 4AP9A 4PQRA 1XVLA 3S1AA 1Z2EA 3I23A 4MNTA 4PLFA 4BOYA 5IHXA 3SVTA 4DM3A 5BORA 3X1WA 3CGWA 4YXWD 1IHDA 1I33A 3KSZO 3ZXYA 3CVXA 4Z3OA 2QN7A 1TCUA 1X9HA 1QHNA 2G7MC 2Z2KA 3L46A 3SMQA 1RWMA 1RXIA 4KHPB 1ABFA 1E5TA 4G8DA 4U8HA 2ZEJA 3M5DA 4GMGA 4LRUA 4RENA 1B93A 2G04A 1X87A 1OJ7A 2PKEA 2VQSA 4OQLA 1D04A 2J4DA 1ADBA 3VPSA 4D3XA 4KOEC 3FB4A 1QPGA 3EVAA 1QU3A 2PZFA 1IU9A 4RD4A 1ZBDA 5ICMA 4F3TA 4BQEA 2QQ5A 1HPLA 5DK4A 2IYYA 1UIMA 2JAQA 3DL4A 2WC1A 3T1YB 2J08A 3K09A 3VO1A 4EVIA 5L51A 3WJ7A 2X14A 1L8AA 3V6LA 3HUEA 2HMUA 1BCSA 2QUJA 2I2XB 3EIXA 3FROA 1QAOA 4OBXA 2OXTA 4CIWA 3LT0A 2V0GA 5G4LA 3TFWA 2C99A 2CFCA 4F6RA 2F8LA 4FE4A 4DLXA 1NMEA 4HPWA 4CT5A 2DSTA 1X94A 4ZVSA 2C29D 2V8OA 2V4UA 2NTYC 2V5AA 3C3BA 3GMDA 4RJKA 4ZVPA 1MB9A 3PFBA 1XTZA 4NABA 3B1WA 3ZGVA 4JGGA 1NQ5A 3IOEA 4TYMA 1G9SA 3OJWA 2M2IA 3QLUC 1VA4A 5IDYA 1N4AA 5FTLA 4NHEA 4C4TA 3NXSA 5DNUA 3Q7PA 3S8EA 4CV2A 1HYEA 4D57A 4EGFA 4RL6A 2JHGA 2J85A 1CZKA 1R8XA 2H1WA 3SS8A 2Y9PB 1JG4A 4URFA 4KR6A 1NJ2A 3A9SA 2AD5A 4A36A 3UFXB 1I80A 4NENB 5B37A 3OHMA 4FJ2A 3VR3A 3N70A 4F6CA 1BVHA 1PG0A 4E08A 5MDHA 1W88B 3QPAA 3K15A 4RGQA 3BGIA 1OPRA 4IH1A 2IYVA 2IHVA 3NAQA 1CR0A 3SXJA 1VHDA 3RUCA 1E6KA 2P40A 1R5NA 3QF4B 4QT0A 3B48A 3FX2A 1QZXA 2YZGA 3BK2A 3KZOA 5KKAA 1S1CA 1HQCA 4GNKA 1BDBA 2CMHA 1TA0A 3Q6NA 2XNDD 4EW2A 5B3AA 5JY6A 1JB1A 2BZGA 1G5IA 1W30A 2OCYC 5K8JB 4QDOA 1GPAA 3LX5A 4NYMR 2AXEA 2C9ZA 3CGGA 4TLEA 4M36A 1F2TB 2R1TB 3TE7A 2GK4A 1QQTA 1P2BA 4ROSA 3OE1A 3EG9B 3FMPB 1V71A 4ENRA 1U3DA 3F9CA 2ZQ5A 2PT7A 3EXEB 3SWWA 5LXTA 4JVOA 2GKOA 5JDCA 1WLSA 1CY1A 1KOFA 3ABZA 3EOBI 3R5KA 3AFOA 2B8TA 3EG5A 1VSBA 1ATIA 3EZYA 3N8DA 5ALZA 4AMVA 2YV5A 2XJ9A 3ETNA 2IUTA 2VJMB 1ZVKA 2GPSA 1ZW6A 2J4FA 2V6GA 4L74A 3RLIA 4E21A 5BN5A 3WB0A 1NVBA 2GEJA 2VAXA 4RPLA 3R76A 3NV9A 3OLXA 1MA3A 1OFGA 1V1RA 1UDBA 1RJWA 2WHEA 4BNDB 3GFFA 1FUUA 1HLDA 5IKOA 5A1TA 3FUTA 4O4HF 4OBBA 5DT9A 3F46A 3LGAA 1Y9JA 4JC8A 5JAQA 4X1KB 4JYZA 4IWYA 4NE2A 5TV2A 2VR1A 2A3RA 5CIWA 5KTRA 1MU0A 5CVJA 2PN1A 5BUQA 2PUBA 3AETA 1JZSA 4G89A 4EGAA 4KUGA 4NBRA 4ZI7A 3AR7A 3X1DA 3GEPA 4ONEA 2XRFA 3OIFA 1E1QD 5JYBA 2EX4A 3O3MB 1OSNA 3D8NA 3LQ2A 4DSOA 2OAP1 2C9MA 3KD2A 5ITVA 3TL2A 4J9VA 5C5EA 2JGRA 4JEMA 3TLAA 4RA6A 5KYNA 3JTMA 4C2AA 4O4HA 3IDFA 3N86A 4LDJA 3L04A 5K3FB 3OE4A 1GCUA 2O5CA 4JJIA 4N65A 5IDXA 1CEEA 3LK7A 2NU9A 1LTHR 1RRPA 2NNLD 2RK6A 4K81B 3I6YA 4KMRA 4QYTA 1U2EA 5D6OA 5E4FA 2J3DA 4RTPA 5JJKA 3DH0A 3IPXA 3RS0A 4A5OA 2DUWA 3NTLA 1S96A 4B2YA 3MRVA 4KDEA 3VUEA 3H5NA 2PRZA 4A0SA 3SFTA 4ZHQB 4WBXC 4MW1A 4F97A 2PWYA 3L6UA 1A9OA 1O6BA 1RXEA 3ZE8A 2PUGA 3R9XB 5EJAA 1MOPA 3FVRA 3EQZA 3FHTA 3NWPA 2C0PA 4MWSA 2G1PA 3TS1A 4LYHA 3ZU4A 4DV7B 1ZIYA 4QNRA 5TVGA 1UEIA 4BGIA 3SEFA 3N6RA 4J3FA 2K6GA 3HCAA 3I1YA 4OHXA 1EFPB 1EH5A 1NJSA 3H7IA 4PYNA 4XFKA 3ND6A 1G7RA 3OQHA 2X1HA 2JGKA 4XUCA 1FLDA 2BFDB 5D3QA 2NV0A 1PEKE 4HRAA 4HWOA 4DQVA 5F9MA 3ZGZA 1G8YA 2EKBA 4MVJP 1IOWA 2BL4A 3W6UA 2GCOB 3STXA 3WSVA 2GBGA 1UWLA 1WXHA 1LW6E 3H84A 5BMOA 1YHZA 1YMQA 3R8CA 1P5JA 3EH1A 4MZXA 1U3CA 4QPPA 3SF8B 3TI9A 4LRYA 2PA3A 3GCXA 3KHKA 2W6JD 1OLXB 1M8JA 1DJQA 4M0MA 2N46A 1GGHA 1ZN9A 4HNAB 3H1TA 4MJLA 3WGGA 2DM6A 2HCTA 2UYHA 1UAYA 2RI1A 3FDXA 3PV0A 1U7DA 1B43A 1V9CA 1X92A 2FPRA 2NTJA 2FN3A 2GXUA 2I2CA 4LV8B 2IYEA 2H5IA 3H0KA 3ZI7A 4F11A 1TIBA 1UC9A 3QU2A 5AJVB 5KYGA 5J4YA 4H7KA 5BVGA 3V2GA 1OFUX 2CFTA 5CNMA 3DNFA 3AVQA 4KE6A 2H06A 1I3LA 2JCVA 5ALFA 5BSGA 1IOVA 1WBBA 2FG5A 2ST1A 3GJRA 3GXBA 2NT4A 4FEYA 4V02A 4XYLA 1Z2NX 2Q3HA 3IESA 1TOAA 2NGRA 2BW0A 3BH6A 1YB5A 4E1AA 4Z0PA 1ZJZA 1B6SA 1D2RA 2VT6A